GenomeNet

Database: RefSeq
Entry: NC_006155
LinkDB: NC_006155
Original site: NC_006155 
LOCUS       NC_006155            4744671 bp    DNA     circular CON 27-AUG-2013
DEFINITION  Yersinia pseudotuberculosis IP 32953 chromosome, complete genome.
ACCESSION   NC_006155
VERSION     NC_006155.1  GI:51594359
DBLINK      Project: 58157
KEYWORDS    RefSeq; complete genome.
SOURCE      Yersinia pseudotuberculosis IP 32953
  ORGANISM  Yersinia pseudotuberculosis IP 32953
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Yersinia.
REFERENCE   1  (bases 1 to 4744671)
  AUTHORS   Rosso,M.L., Chauvaux,S., Dessein,R., Laurans,C., Frangeul,L.,
            Lacroix,C., Schiavo,A., Dillies,M.A., Foulon,J., Coppee,J.Y.,
            Medigue,C., Carniel,E., Simonet,M. and Marceau,M.
  TITLE     Growth of Yersinia pseudotuberculosis in human plasma: impacts on
            virulence and metabolic gene expression
  JOURNAL   BMC Microbiol. 8, 211 (2008)
   PUBMED   19055764
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4744671)
  AUTHORS   Chain,P.S., Carniel,E., Larimer,F.W., Lamerdin,J., Stoutland,P.O.,
            Regala,W.M., Georgescu,A.M., Vergez,L.M., Land,M.L., Motin,V.L.,
            Brubaker,R.R., Fowler,J., Hinnebusch,J., Marceau,M., Medigue,C.,
            Simonet,M., Chenal-Francisque,V., Souza,B., Dacheux,D.,
            Elliott,J.M., Derbise,A., Hauser,L.J. and Garcia,E.
  TITLE     Insights into the evolution of Yersinia pestis through whole-genome
            comparison with Yersinia pseudotuberculosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (38), 13826-13831 (2004)
   PUBMED   15358858
REFERENCE   3  (bases 1 to 4744671)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-AUG-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 4744671)
  AUTHORS   Chain,P.S.G., Carniel,E., Garcia,E. and Larimer,F.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-FEB-2004) Biology and Biotechnology Research Program,
            Lawrence Livermore National Laboratory, Livermore, CA 94550 USA,
            Yersinia Research Unit, Institute Pasteur, 75724 Paris Cedex 15,
            France, and the Genome Analysis Group, Oak Ridge National
            Laboratory, Oak Ridge, TN 37831 USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BX936398.
            RefSeq Category:
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4744671
                     /organism="Yersinia pseudotuberculosis IP 32953"
                     /mol_type="genomic DNA"
                     /strain="IP 32953"
                     /db_xref="taxon:273123"
     gene            complement(270..710)
                     /locus_tag="YPTB0001"
                     /db_xref="GeneID:2953036"
     CDS             complement(270..710)
                     /locus_tag="YPTB0001"
                     /note="An electron-transfer protein; flavodoxin binds one
                     FMN molecule, which serves as a redox-active prosthetic
                     group"
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin"
                     /protein_id="YP_068551.1"
                     /db_xref="GI:51594360"
                     /db_xref="GeneID:2953036"
                     /translation="MADITLISGSTLGSAEYVAEHLADKLEEAGFSTEILHGPELDEL
                     TLNGLWLIVTSTHGAGDLPDNLQPLLEQIEQQKPDLSQVRFGAVGLGSSEYDTFCGAI
                     IKLDQQLIAQGAQRLGEILEIDVIQHEIPEDPAEIWVKDWINLL"
     misc_feature    complement(273..710)
                     /locus_tag="YPTB0001"
                     /note="FMN-binding protein MioC; Provisional; Region:
                     PRK09004"
                     /db_xref="CDD:181608"
     gene            complement(803..1264)
                     /gene="asnC"
                     /locus_tag="YPTB0002"
                     /db_xref="GeneID:2955244"
     CDS             complement(803..1264)
                     /gene="asnC"
                     /locus_tag="YPTB0002"
                     /note="transcriptional repressor of asnA which codes for
                     aspartate-ammonia ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator AsnC"
                     /protein_id="YP_068552.1"
                     /db_xref="GI:51594361"
                     /db_xref="GeneID:2955244"
                     /translation="MSEIYQIDNLDRSILKALMENARTPYAELAKNLAVSPGTIHVRV
                     EKMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYT
                     TGHYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
     misc_feature    complement(806..1264)
                     /gene="asnC"
                     /locus_tag="YPTB0002"
                     /note="DNA-binding transcriptional regulator AsnC;
                     Provisional; Region: PRK11179"
                     /db_xref="CDD:183019"
     misc_feature    complement(<1100..1243)
                     /gene="asnC"
                     /locus_tag="YPTB0002"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(1100..1102,1118..1123,1127..1132,
                     1139..1144,1148..1159,1184..1186,1190..1195,1232..1240))
                     /gene="asnC"
                     /locus_tag="YPTB0002"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(1181..1183,1193..1195))
                     /gene="asnC"
                     /locus_tag="YPTB0002"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(833..1048)
                     /gene="asnC"
                     /locus_tag="YPTB0002"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     gene            1434..2426
                     /gene="asnA"
                     /locus_tag="YPTB0003"
                     /db_xref="GeneID:2955242"
     CDS             1434..2426
                     /gene="asnA"
                     /locus_tag="YPTB0003"
                     /EC_number="6.3.1.1"
                     /note="catalyzes the formation of asparagine from
                     aspartate and ammonia"
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthetase AsnA"
                     /protein_id="YP_068553.1"
                     /db_xref="GI:51594362"
                     /db_xref="GeneID:2955242"
                     /translation="MKKQFIQKQQQISFVKSFFSRQLEQQLGLIEVQAPILSRVGDGT
                     QDNLSGSEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFDFGADQGVYTHMKALRPD
                     EDRLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFGVKPF
                     LPDHIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDY
                     DDWTSPSAEGFSGLNGDIIVWNPILEDAFEISSMGIRVDAEALKRQLALTGDEDRLEL
                     EWHQSLLRGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVDGLL"
     misc_feature    1470..2423
                     /gene="asnA"
                     /locus_tag="YPTB0003"
                     /note="Asparagine synthetase A [Amino acid transport and
                     metabolism]; Region: AsnA; COG2502"
                     /db_xref="CDD:225304"
     misc_feature    1518..1532
                     /gene="asnA"
                     /locus_tag="YPTB0003"
                     /note="motif 1; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(1521..1526,1530..1532,1668..1673,1728..1730,
                     1734..1736,1854..1856)
                     /gene="asnA"
                     /locus_tag="YPTB0003"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(1647..1649,1653..1655,1731..1733,1773..1775,
                     1779..1781,1785..1793,2175..2180,2190..2192,2307..2312,
                     2316..2321,2328..2330)
                     /gene="asnA"
                     /locus_tag="YPTB0003"
                     /note="active site"
                     /db_xref="CDD:238391"
     misc_feature    1728..1736
                     /gene="asnA"
                     /locus_tag="YPTB0003"
                     /note="motif 2; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(2319..2321,2328..2330)
                     /gene="asnA"
                     /locus_tag="YPTB0003"
                     /note="motif 3; other site"
                     /db_xref="CDD:238391"
     gene            complement(2525..3991)
                     /gene="yieM"
                     /locus_tag="YPTB0004"
                     /db_xref="GeneID:2953037"
     CDS             complement(2525..3991)
                     /gene="yieM"
                     /locus_tag="YPTB0004"
                     /note="contains a von Willibrand factor type A domain;
                     stimulates the ATPase activity of RavA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068554.1"
                     /db_xref="GI:51594363"
                     /db_xref="GeneID:2953037"
                     /translation="MLSLATLDMLLSISEGELIEEMVVGLLAAPQLAIFFEKFPRIKR
                     ALMKDIPGWKQNLQQRIREASVPPGLANEFSLYQQSLLEDSPQFYAHLPDIVAQLQDL
                     HSPFATQAKTLVQTADLAKNPPGGDSLQTLFLQRWRVSLILQTITIHHQLLEQEREQL
                     LAELQRRLALSGALEPILTTNDNAAGRLWDMSQGHLQRGDYQLLLQYGDFLQQQPELI
                     RLAEQLGRSRSAKAQPAPDARYEPYTVMVRQPDSVPEEVSGIHQSNDILRLLPTELVM
                     LGMSELEFEFYRRLLERRLLTYRLQGDNWQEKTQQRPVSLKQNDEQPRGPFIVCVDTS
                     GSMGGFNEQCAKAFCLALLRIALADNRRCYIMLFATEIIHYELSADNGIEQAIRFLNQ
                     HFRGGTDLAACLANTLNKMEDREWYDADAVIISDFIAQRLPEELVRKIKIQQQAHQHR
                     FHAVAMSAYGKPGIMRIFDHIWRFDTSLKSRLIRRWKR"
     misc_feature    complement(2528..3946)
                     /gene="yieM"
                     /locus_tag="YPTB0004"
                     /note="Uncharacterized protein containing a von Willebrand
                     factor type A (vWA) domain [General function prediction
                     only]; Region: COG2425"
                     /db_xref="CDD:225281"
     misc_feature    complement(2576..3019)
                     /gene="yieM"
                     /locus_tag="YPTB0004"
                     /note="VWA YIEM type: Von Willebrand factor type A (vWA)
                     domain was originally found in the blood coagulation
                     protein von Willebrand factor (vWF). Typically, the vWA
                     domain is made up of approximately 200 amino acid residues
                     folded into a classic a/b...; Region: VWA_YIEM_type;
                     cd01462"
                     /db_xref="CDD:238739"
     misc_feature    complement(order(2714..2716,2798..2800,2984..2986,
                     2990..2992,2996..2998))
                     /gene="yieM"
                     /locus_tag="YPTB0004"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238739"
     gene            complement(3995..5533)
                     /locus_tag="YPTB0005"
                     /db_xref="GeneID:2953038"
     CDS             complement(3995..5533)
                     /locus_tag="YPTB0005"
                     /note="interacts with LdcI, lysine decarboxylase; may be
                     active in late log/ early stationary phase"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory ATPase RavA"
                     /protein_id="YP_068555.1"
                     /db_xref="GI:51594364"
                     /db_xref="GeneID:2953038"
                     /translation="MAQSSQLAERISRLSHALESGLYERQEAIRLCLLAALSGESVFL
                     LGPPGIAKSLIARRLKFAFRHARAFEYLMTRFSTPEEVFGPLSIQALKEEGRYQRMTG
                     GYLPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGDREDSIPMRLLVTASNELPDA
                     DSSLEALYDRMLIRLWLDRVQEKQNFRSLLISRQNENHNPVAENLSITDEEFHQWQPL
                     IDKITLPDHCFELIFQLRQRLSALEHAPYVSDRRWKKALRLLQASAFFSGRDEITPID
                     LILLKDCLWHDLNSFKLLQQQLEQLLTEQGYQQQSLLMKLQDINSKWLQHQQQQSDHQ
                     ALTVVKQSGMFSRKAQYALPDNLTDSTLTLLLQKPLNLHDIQVNHLQVDKEALAQWLN
                     KGGALRAKLNGVGYAQSIDAEIDDQLHIIILDVSRQPSTLSLPGATTTSVPPELLLAL
                     TKLESTLAEQRRLFSQHQPCLFTPSSWLAKIEASLLQVVEQLQFQQIQFQQRKFQQQK
                     HSGH"
     misc_feature    complement(4064..5533)
                     /locus_tag="YPTB0005"
                     /note="regulatory ATPase RavA; Provisional; Region:
                     PRK13531"
                     /db_xref="CDD:184118"
     misc_feature    complement(5009..5467)
                     /locus_tag="YPTB0005"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(5375..5398)
                     /locus_tag="YPTB0005"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(5069..5071,5192..5194,5372..5395))
                     /locus_tag="YPTB0005"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(5189..5206)
                     /locus_tag="YPTB0005"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(5024..5026)
                     /locus_tag="YPTB0005"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(4064..4207)
                     /locus_tag="YPTB0005"
                     /note="Protein of unknown function (DUF3763); Region:
                     DUF3763; pfam12592"
                     /db_xref="CDD:193091"
     gene            5807..7675
                     /gene="trkD"
                     /locus_tag="YPTB0006"
                     /db_xref="GeneID:2955928"
     CDS             5807..7675
                     /gene="trkD"
                     /locus_tag="YPTB0006"
                     /note="Responsible for the low-affinity transport of
                     potassium into the cell; involved in potassium ion uptake
                     under hyper-osmotic stress at a low pH"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transport protein Kup"
                     /protein_id="YP_068556.1"
                     /db_xref="GI:51594365"
                     /db_xref="GeneID:2955928"
                     /translation="MSTEHKQSLSAVTLAAIGVVYGDIGTSPLYTLRECFSGHYGFDV
                     RPDVVFGFLSLIFWMLILVVSVKYLTYVMRADNAGEGGILTLMSLAGRNTSSRATSIL
                     VVLGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVLTLLFVIQKH
                     GTGSVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFVEYKSVSFFAL
                     GAVVLAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNP
                     FFLLAPDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIHTSEMES
                     GQIYIPVINWTLYLAVVLVIIGFERSSNLAAAYGIAVTGTMVITSILFCTVAWKNWHW
                     NRFLVAFLLMVLLIIDIPMFSANVLKLFSGGWLPLSLGLVMFIIMTTWKSERFSLLRR
                     MHEHSNSLEAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHERVVLL
                     TMRTDDVPYVHNVERVTIEQLSPTFWRVVARYGWRETPNVAEIFHRCGLEGLSCQMME
                     TSFFMSHESLILTKRPWHLFLRGKLFIALSRNALRAPDQFEIPPNRVIELGTQVEI"
     misc_feature    5807..7672
                     /gene="trkD"
                     /locus_tag="YPTB0006"
                     /note="potassium transport protein Kup; Provisional;
                     Region: trkD; PRK10745"
                     /db_xref="CDD:182693"
     misc_feature    join(5825..5893,5936..6004,6110..6178,6206..6274,
                     6308..6376,6434..6502,6539..6607,6665..6733,6809..6877,
                     6893..6961,6980..7048,7061..7129)
                     /gene="trkD"
                     /locus_tag="YPTB0006"
                     /note="12 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            7880..8299
                     /locus_tag="YPTB0007"
                     /db_xref="GeneID:2953039"
     CDS             7880..8299
                     /locus_tag="YPTB0007"
                     /note="cytoplasmic mutarotase that catalyzes the
                     conversion between beta-pyran and beta-furan forms of
                     D-ribose; RbsD is required for efficient ribose
                     utilization in E. coli; rbsD-mutant E. coli strains are
                     unable to use ribose as a sole carbon source"
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose pyranase"
                     /protein_id="YP_068557.1"
                     /db_xref="GI:51594366"
                     /db_xref="GeneID:2953039"
                     /translation="MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLAL
                     TRGVPGFLQVVDVVTQEMQVENAYLAEEIVKNNPQLHEALLVLLTQLEQRQENQIALR
                     YISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF"
     misc_feature    7880..8296
                     /locus_tag="YPTB0007"
                     /note="D-ribose pyranase; Provisional; Region: PRK11797"
                     /db_xref="CDD:183318"
     gene            8350..9276
                     /locus_tag="YPTB0008"
                     /db_xref="GeneID:2953040"
     CDS             8350..9276
                     /locus_tag="YPTB0008"
                     /EC_number="2.7.1.15"
                     /note="catalyzes the formation of D-ribose 5-phosphate
                     from ribose"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="YP_068558.1"
                     /db_xref="GI:51594367"
                     /db_xref="GeneID:2953040"
                     /translation="METGKLVVLGSINADHILNIEQFPRPGETVIGQQYNVAFGGKGA
                     NQAVAAGRSGADIAFIACVGDDDIGERVRQQLTADKIDTQPIEAIKGATTGVALIFVN
                     SDGENVIGINAGANSAVTPEYLRRYQQQVIDADALLMQLESPLDTVIAAAKLAKQHQT
                     QVILNPAPARKLPDELLTLVDMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIAT
                     VIITLGSRGVWLSEQGKGKLVAGFKVNAVDTIAAGDTFNGALLTALLEGQSMDAAVRF
                     AHAAAAIAVTRPGAQPSIPWRAEIDSFLQERV"
     misc_feature    8362..9237
                     /locus_tag="YPTB0008"
                     /note="Ribokinase catalyses the phosphorylation of ribose
                     to ribose-5-phosphate using ATP. This reaction is the
                     first step in the ribose metabolism. It traps ribose
                     within the cell after uptake and also prepares the sugar
                     for use in the synthesis of nucleotides...; Region:
                     ribokinase; cd01174"
                     /db_xref="CDD:238579"
     misc_feature    order(8386..8388,8392..8394,8467..8475,8482..8484,
                     8638..8640,8644..8646,8674..8676,8680..8682,8773..8775,
                     9097..9102,9109..9111,9217..9219)
                     /locus_tag="YPTB0008"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238579"
     misc_feature    order(8395..8397,8401..8403,8416..8436,8473..8475,
                     8635..8637,8641..8649,8665..8688,8851..8853)
                     /locus_tag="YPTB0008"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238579"
     misc_feature    order(8905..8907,9013..9021,9028..9030,9067..9069,
                     9085..9087,9094..9096,9103..9108,9115..9117,9181..9183,
                     9190..9195,9202..9204)
                     /locus_tag="YPTB0008"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238579"
     gene            9329..9499
                     /locus_tag="YPTB0009"
                     /db_xref="GeneID:2953041"
     CDS             9329..9499
                     /locus_tag="YPTB0009"
                     /note="not present in pestis"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068559.1"
                     /db_xref="GI:51594368"
                     /db_xref="GeneID:2953041"
                     /translation="MARAGLPIIAGYEVVSDFEFGGGLVALKQRLNNPEAEPQVLPLT
                     PELIERGSVSLR"
     misc_feature    <9329..>9430
                     /locus_tag="YPTB0009"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     misc_feature    <9407..9484
                     /locus_tag="YPTB0009"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     gene            complement(9496..10920)
                     /locus_tag="YPTB0010"
                     /db_xref="GeneID:2953042"
     CDS             complement(9496..10920)
                     /locus_tag="YPTB0010"
                     /note="similar to Yersinia pestis YPO0009  membrane
                     transport protein (100% evalue=0); Salmonella typhimurium
                     STM3887 yieO; MFS family tranport protein (1st mdule) (74%
                     evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS multidrug:H+ antiporter"
                     /protein_id="YP_068560.1"
                     /db_xref="GI:51594369"
                     /db_xref="GeneID:2953042"
                     /translation="MIKSARSMAGLPWIAAMAFFMQALDATILNTALPSIAESLNRSP
                     LTMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFILAVSLFTFGSLLCALSGSLAFLV
                     ASRVIQGIGGAMMMPVARLALIRAYPRSELLPVLNFVTIPGLVGPVMGPLLGGLLVTY
                     TTWHWIFILNIPIGLLGIFYARKYMPNFTMPKRTFDFVGFLLFGISLVMISTSLEIMG
                     RPEIADYLPAATLLGGLLMLIFYIFHAKGHPNPLIGLPLFKTRTFSVGIAGNVASRLG
                     TGCVPFLMPLMLQVGFGYSALIAGCMMAPTAIGSIMAKSAVTQVLRSLGYRKVLVGIT
                     LIIGVLIASFALQSPGMSAWMMILPLFILGIAMSTQFTAMNTITLADLTDNNASSGNS
                     VLAVTQQLSISFGIAISATVLRFYDGLSLGGNVDHFHYTFITMGIVTLLSSLVFLLLK
                     PRDGDNLIQGRNVKKVAPQVKNNV"
     misc_feature    complement(9607..10884)
                     /locus_tag="YPTB0010"
                     /note="putative transporter; Provisional; Region:
                     PRK10504"
                     /db_xref="CDD:182502"
     misc_feature    complement(9832..10884)
                     /locus_tag="YPTB0010"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(9916..9918,9925..9930,9937..9942,
                     9949..9954,9985..9987,9994..9999,10009..10011,
                     10018..10023,10030..10032,10171..10173,10189..10191,
                     10198..10200,10210..10212,10222..10224,10264..10266,
                     10273..10278,10285..10290,10297..10299,10480..10482,
                     10498..10503,10510..10515,10549..10551,10558..10563,
                     10570..10575,10582..10587,10723..10728,10732..10737,
                     10747..10749,10756..10761,10768..10770,10819..10824,
                     10828..10836,10843..10845))
                     /locus_tag="YPTB0010"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    complement(join(9574..9639,9685..9750,9787..9852,
                     9883..9948,9985..10050,10066..10131,10192..10242,
                     10273..10338,10378..10434,10447..10512,10549..10602,
                     10618..10683,10723..10788,10834..10899))
                     /locus_tag="YPTB0010"
                     /note="14 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(11000..11689)
                     /locus_tag="YPTB0011"
                     /db_xref="GeneID:2953043"
     CDS             complement(11000..11689)
                     /locus_tag="YPTB0011"
                     /note="similar to Yersinia pestis YPO0010  GntR-famly
                     transcriptional regulator (100% evalue=1.E-128);
                     Escherichia coli Z5258 yieP; orf; Unknown function (67.6%
                     evalue=5.E-85)"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_068561.1"
                     /db_xref="GI:51594370"
                     /db_xref="GeneID:2953043"
                     /translation="MQLNTQQQAAQRNLSYLLAEKIGQRILAGEYEAGSILPGEIELG
                     EQFGVSRTAVREAVKMLAAKGMLLPRPRIGTRVMPQTNWNYLDQELLTWWMTKENFDQ
                     VMQHFLILRTSLEPQACYLAATHANEKQRELLASLVAEMRALHSNFNREQWIQVDTQF
                     HKLIYEASGNPFLISFANLFSSVYYSYFRAITGDEVIKLQHHQNIVDTILAGDNQGAL
                     FACQVLLKTVD"
     misc_feature    complement(11003..11656)
                     /locus_tag="YPTB0011"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(11459..11650)
                     /locus_tag="YPTB0011"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(11465..11476,11480..11485,11513..11515,
                     11522..11527,11531..11545,11567..11572,11576..11578,
                     11645..11647))
                     /locus_tag="YPTB0011"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(11039..11362)
                     /locus_tag="YPTB0011"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            12249..13794
                     /locus_tag="YPTB_RNA_93"
                     /db_xref="GeneID:2955142"
     rRNA            12249..13794
                     /locus_tag="YPTB_RNA_93"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:2955142"
     gene            13928..14003
                     /gene="tRNA-Glu1"
                     /locus_tag="YPTB_RNA_1"
                     /db_xref="GeneID:2956760"
     tRNA            13928..14003
                     /gene="tRNA-Glu1"
                     /locus_tag="YPTB_RNA_1"
                     /product="tRNA-Glu"
                     /note="anticodon TTC, Cove Score=56.95"
                     /db_xref="GeneID:2956760"
     gene            14256..17162
                     /locus_tag="YPTB_RNA_94"
                     /db_xref="GeneID:2955143"
     rRNA            14256..17162
                     /locus_tag="YPTB_RNA_94"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:2955143"
     gene            17271..17390
                     /locus_tag="YPTB_RNA_95"
                     /db_xref="GeneID:2955144"
     rRNA            17271..17390
                     /locus_tag="YPTB_RNA_95"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:2955144"
     gene            17956..19143
                     /locus_tag="YPTB0012"
                     /db_xref="GeneID:2953044"
     CDS             17956..19143
                     /locus_tag="YPTB0012"
                     /note="similar to Yersinia pestis YPO1583 transposase for
                     the IS285 insertion element (99.7% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068562.1"
                     /db_xref="GI:51594371"
                     /db_xref="GeneID:2953044"
                     /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELT
                     EHLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQ
                     MDSQILSLYAKSMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY
                     PIVYMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTEL
                     KNRGLQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSG
                     LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYT
                     TNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKMEYADPELAVSDEPFYY
                     RVR"
     misc_feature    17956..19080
                     /locus_tag="YPTB0012"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     misc_feature    17983..19092
                     /locus_tag="YPTB0012"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            complement(19223..19753)
                     /gene="mobB"
                     /locus_tag="YPTB0013"
                     /db_xref="GeneID:2956059"
     CDS             complement(19223..19753)
                     /gene="mobB"
                     /locus_tag="YPTB0013"
                     /note="in Escherichia coli the MobB protein is not
                     essential but has been found to interact with multiple
                     proteins involved in the molybdopterin guanine
                     dinucleotide cofactor biosynthesis pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobB"
                     /protein_id="YP_068563.1"
                     /db_xref="GI:51594372"
                     /db_xref="GeneID:2956059"
                     /translation="MNYKSPPLLGIAAYSGTGKTTLLKSLIPLLQQRQVRVGLIKHTH
                     HNMEIDTPGKDSYELRKAGALQTLVASDCRWALMTETPEQQPLNLHYLASRLDASTID
                     LILVEGFKHEPINKIALYRESIGKPFSGLIDKHVIALASDKPIETTVKQLDINQPEQI
                     TEFICTWLENISFEVR"
     misc_feature    complement(19259..19738)
                     /gene="mobB"
                     /locus_tag="YPTB0013"
                     /note="Molybdenum is an essential trace element in the
                     form of molybdenum cofactor (Moco) which is associated
                     with the metabolism of nitrogen, carbon and sulfur by
                     redox active enzymes. In E. coli, the synthesis of Moco
                     involves genes from several loci: moa; Region: MobB;
                     cd03116"
                     /db_xref="CDD:239390"
     misc_feature    complement(order(19694..19702,19715..19717))
                     /gene="mobB"
                     /locus_tag="YPTB0013"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:239390"
     gene            complement(19997..20395)
                     /gene="mobA"
                     /locus_tag="YPTB0014"
                     /gene_synonym="chlB; mob; nar"
                     /pseudo
                     /db_xref="GeneID:2956058"
     misc_feature    complement(19997..20395)
                     /gene="mobA"
                     /locus_tag="YPTB0014"
                     /gene_synonym="chlB; mob; nar"
                     /note="similar to Yersinia pestis YPO0013 mobA, mob, chlB,
                     nar; molybdopterin-guanine dinucleotide biosynthesis
                     protein A (97.5% evalue=1.E-39); Escherichia coli b3857
                     mobA; molybdopterin-guanine dinucleotide biosynthesis
                     protein A (52.5% evalue=3.E-19);pseudogene of
                     molybdopterin-guanine dinucleotidebiosynthesis protein A"
                     /pseudo
                     /db_xref="PSEUDO:CAH19254.1"
     gene            20495..20764
                     /locus_tag="YPTB0015"
                     /db_xref="GeneID:2953045"
     CDS             20495..20764
                     /locus_tag="YPTB0015"
                     /note="similar to Yersinia pestis YPO0013a conserved
                     hypothetical protein (100% evalue=3.E-46); Escherichia
                     coli b3858 yihD; hypothetical 10.3 kD protein in mobA-dsbA
                     intergenic region (O89) (76.4% evalue=2.E-35)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068564.1"
                     /db_xref="GI:51594373"
                     /db_xref="GeneID:2953045"
                     /translation="MKCHRVNELIELLHPAWQQEPDLNLVQFLQKLAAEAGFKGDFSD
                     LTDDVLIYHLKMRGAASTEVIPGLKKDYEEDFKTALLRARGIIKD"
     misc_feature    20495..20758
                     /locus_tag="YPTB0015"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3084"
                     /db_xref="CDD:225626"
     gene            20855..21841
                     /locus_tag="YPTB0016"
                     /db_xref="GeneID:2953046"
     CDS             20855..21841
                     /locus_tag="YPTB0016"
                     /note="catalyzes the phosphorylation of protein substrates
                     at serine and threonine residues in vitro; specific
                     substrate in vivo has not been identified yet; plays a
                     role in long-term cell survival and expression of surface
                     appendages"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="YP_068565.1"
                     /db_xref="GI:51594374"
                     /db_xref="GeneID:2953046"
                     /translation="MNNSAFNFQTLSPDLIMDALEGAGLRVDSGLTALNSYENRVYQF
                     MDEESKRYVVKFYRPERWSSEQITEEHQFSLDLAESEIPVIAPLRLNGKTLHTHCGFF
                     FAVFPSVGGRQYEIDNLDQLEWVGRFLGRIHQAARNSLFVARPTMGIEEYLTEPRQLL
                     ANCDLVPVKQRDKFLAAADLLITTIKQYWHTEWQPLRLHGDCHPGNILWRDGPMFVDL
                     DDARNGPAIQDLWMLLHGDRRDQSMQLDILLEAYSEFADFDQRELALIEPLRAMRMVY
                     YLAWVARRWQDPAFPKSFPWMAESDFWLQQTASFTEQVKLLQEPPLQLMPMY"
     misc_feature    20855..21826
                     /locus_tag="YPTB0016"
                     /note="serine/threonine protein kinase; Provisional;
                     Region: PRK11768"
                     /db_xref="CDD:236974"
     misc_feature    20963..21622
                     /locus_tag="YPTB0016"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     gene            21869..22492
                     /gene="dsbA"
                     /locus_tag="YPTB0017"
                     /db_xref="GeneID:2955486"
     CDS             21869..22492
                     /gene="dsbA"
                     /locus_tag="YPTB0017"
                     /note="similar to Yersinia pestis YPO0015 dsbA; secreted
                     thiol:disulfide interchange protein DsbA (100%
                     evalue=1.E-116); Salmonella typhimurium STM3997 dsbA;
                     periplasmic protein disulfide isomerase I (75.8%
                     evalue=1.E-88)"
                     /codon_start=1
                     /transl_table=11
                     /product="protein disulfide isomerase"
                     /protein_id="YP_068566.1"
                     /db_xref="GI:51594375"
                     /db_xref="GeneID:2955486"
                     /translation="MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEF
                     FSFYCPHCYQFEEVYQVPKAVKKALPEGTKMTRYHVEFLGPLGKQLTQAWAVAMALGV
                     EEKITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAA
                     EDLQLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK"
     misc_feature    21938..22468
                     /gene="dsbA"
                     /locus_tag="YPTB0017"
                     /note="DsbA family, DsbA subfamily; DsbA is a monomeric
                     thiol disulfide oxidoreductase protein containing a redox
                     active CXXC motif imbedded in a TRX fold. It is involved
                     in the oxidative protein folding pathway in prokaryotes,
                     and is the strongest thiol...; Region: DsbA_DsbA; cd03019"
                     /db_xref="CDD:239317"
     misc_feature    order(22013..22015,22019..22024,22373..22375)
                     /gene="dsbA"
                     /locus_tag="YPTB0017"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239317"
     misc_feature    22112..22120
                     /gene="dsbA"
                     /locus_tag="YPTB0017"
                     /note="hinge region; other site"
                     /db_xref="CDD:239317"
     misc_feature    order(22133..22159,22172..22231,22238..22264,22280..22309)
                     /gene="dsbA"
                     /locus_tag="YPTB0017"
                     /note="alpha helical domain; other site"
                     /db_xref="CDD:239317"
     misc_feature    21881..21934
                     /gene="dsbA"
                     /locus_tag="YPTB0017"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            22983..25781
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /db_xref="GeneID:2956294"
     CDS             22983..25781
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /EC_number="2.7.7.7"
                     /note="has 3'-5' exonuclease, 5'-3' exonuclease and
                     5'-3'polymerase activities, primarily functions to fill
                     gaps during DNA replication and repair"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="YP_068567.1"
                     /db_xref="GI:51594376"
                     /db_xref="GeneID:2956294"
                     /translation="MAQIAENPLILVDGSSYLYRAYHAFPPLTNGSGEPTGAMYGVLN
                     MLRSLLLQYRPSHVAVVFDAKGKTFRDELFAEYKSHRPPMPDDLRVQIEPLHQMVKAM
                     GLPLLVVSGVEADDVIGTLAREAEKAGHSVLISTGDKDMAQLVTPNITLINTMNNTIL
                     GPQDVCDKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLFSNL
                     DKISTLTFRGAKTMSAKLEQNKDVAYLSYKLATIKTDVELDVTCDELTVSPPDDKQLH
                     QLFSRYEFKRWLADVEAGKWLDSKKDRPTGQTSSQSFVAADTAPTAEVTAVLSQENYQ
                     TILDEKALADWIERLKAAEVFAFDTETDGLDTLSCNLIGMSFAVAPGEAAYLPLAHDY
                     LDAPPQLDRDWVLATLKPLLEDDKALKVGQNLKFDKSMLARYGIDLKGIAFDTMLESY
                     VLDSVAGRHDMDSLAERYLNHKTITFEEIAGKGKNQLTFNQIALEQAGPYAAEDADVT
                     LQLHLVLWPKLQQSEGLKRVFQEIEMPLLPILSRIERTGVLIDQNILAAHSKELTIRL
                     DELEKQAHELAEEPFNLASPKQLQAILYEKQKLPILKKTPGGAASTNEEVLAELALDY
                     PLPKVILEYRGLAKLKSTYTDKLPLMINPVSGRVHTSYHQAVTATGRLSSRDPNLQNI
                     PVRNEEGRRIRQAFIAPKGYCIMAADYSQIELRIMAHLSQDNGLLAAFAAGQDIHRAT
                     AAEVFGSPLEKVTTEQRRSAKAINFGLIYGMSAFGLARQLGIPRGEAQRYMDLYFERY
                     PGVLEYMERTRKQAAEQGYVTTLDGRRLYLPDIHSRNANRRKAAEREAINAPMQGTAA
                     DIIKRAMIAVDGWLQQEPEPLVRVIMQVHDELVFEVHESVLQSAEQKIRELMEKSMQL
                     AVPLKVDVGVGANWDQAH"
     misc_feature    22998..25778
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="DNA polymerase I; Provisional; Region: PRK05755"
                     /db_xref="CDD:235591"
     misc_feature    23007..23477
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="PIN domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: PIN_53EXO; cd09859"
                     /db_xref="CDD:189029"
     misc_feature    order(23019..23021,23169..23171,23319..23321,23325..23330,
                     23394..23396,23400..23402)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="active site"
                     /db_xref="CDD:189029"
     misc_feature    order(23019..23021,23325..23327,23394..23396)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    23187..23225
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="putative 5' ssDNA interaction site; other site"
                     /db_xref="CDD:189029"
     misc_feature    order(23319..23321,23328..23330)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="metal binding site 3; metal-binding site"
                     /db_xref="CDD:189029"
     misc_feature    order(23394..23396,23400..23402)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    23499..23738
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="H3TH domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: H3TH_53EXO; cd09898"
                     /db_xref="CDD:188618"
     misc_feature    order(23529..23552,23556..23585,23589..23600)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:188618"
     misc_feature    order(23535..23537,23544..23546)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:188618"
     misc_feature    24024..24608
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="DEDDy 3'-5' exonuclease domain of Escherichia coli
                     DNA polymerase I and similar bacterial family-A DNA
                     polymerases; Region: DNA_polA_I_Ecoli_like_exo; cd06139"
                     /db_xref="CDD:176651"
     misc_feature    order(24054..24065,24072..24074,24246..24251,24255..24263,
                     24360..24365,24408..24413,24480..24482,24492..24494)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="active site"
                     /db_xref="CDD:176651"
     misc_feature    order(24054..24056,24060..24062,24261..24263,24480..24482,
                     24492..24494)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176651"
     misc_feature    order(24057..24065,24072..24074,24246..24251,24255..24260,
                     24360..24365,24408..24413,24480..24482,24492..24494)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176651"
     misc_feature    24633..25769
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="Polymerase I functions primarily to fill DNA gaps
                     that arise during DNA repair, recombination and
                     replication; Region: DNA_pol_A_pol_I_C; cd08637"
                     /db_xref="CDD:176474"
     misc_feature    order(24882..24884,24894..24896,24903..24908,24981..24989,
                     24993..24995,24999..25010,25104..25109,25191..25193,
                     25251..25253,25263..25265,25515..25517,25536..25538,
                     25632..25640)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="active site"
                     /db_xref="CDD:176474"
     misc_feature    order(24882..24884,24894..24896,24903..24908,24981..24989,
                     24993..24995,24999..25010,25287..25289,25512..25517,
                     25524..25526,25536..25538,25632..25640)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176474"
     misc_feature    order(25104..25109,25113..25115,25191..25193,25251..25253,
                     25263..25265,25638..25640)
                     /gene="polA"
                     /locus_tag="YPTB0018"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176474"
     gene            25940..26047
                     /gene="spf"
                     /locus_tag="YPTB_RNA_89"
                     /db_xref="GeneID:2956628"
     misc_RNA        25940..26047
                     /gene="spf"
                     /locus_tag="YPTB_RNA_89"
                     /product="spf Spot 42 RNA"
                     /db_xref="GeneID:2956628"
     gene            complement(26189..26839)
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /db_xref="GeneID:2953047"
     CDS             complement(26189..26839)
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="binds guanine nucleotides; in Escherichia coli
                     depletion results in defective cell division and
                     filamentation; in Bacillus subtilis this gene is
                     essential"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTP-binding protein YsxC"
                     /protein_id="YP_068568.1"
                     /db_xref="GI:51594377"
                     /db_xref="GeneID:2953047"
                     /translation="MTIRNYNYHMTHFVISAPDIRHLPRDEGIEVAFAGRSNAGKSSA
                     LNTLTNQKGLARTSKTPGRTQLINLFEVVDGVRLVDLPGYGYAEVPEEMKLKWQRALG
                     EYLQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQ
                     LNLVREAIIPFMGDIQVEAFSSLKKIGVDKLREKLDTWFSEIPPEVMAEEFDGEGE"
     misc_feature    complement(26231..26821)
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="Predicted GTPase [General function prediction
                     only]; Region: COG0218"
                     /db_xref="CDD:223296"
     misc_feature    complement(26243..26752)
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="YihA (EngB) GTPase family; Region: YihA_EngB;
                     cd01876"
                     /db_xref="CDD:206665"
     misc_feature    complement(26714..26737)
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="G1 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(order(26294..26299,26390..26392,26396..26398,
                     26600..26602,26648..26656,26663..26671,26711..26731))
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206665"
     misc_feature    complement(26639..26659)
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(26648..26650)
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="G2 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(26591..26602)
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="G3 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(order(26507..26512,26519..26563,26582..26593))
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(26390..26401)
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="G4 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(26291..26299)
                     /gene="engB"
                     /locus_tag="YPTB0019"
                     /gene_synonym="yihA; ysxC"
                     /note="G5 box; other site"
                     /db_xref="CDD:206665"
     gene            27205..27459
                     /locus_tag="YPTB_RNA_113"
                     /db_xref="GeneID:2955134"
     misc_RNA        27205..27459
                     /locus_tag="YPTB_RNA_113"
                     /product="regulatory RNA CsrC"
                     /db_xref="GeneID:2955134"
     gene            27604..28170
                     /locus_tag="YPTB0020"
                     /db_xref="GeneID:2953048"
     CDS             27604..28170
                     /locus_tag="YPTB0020"
                     /note="similar to Yersinia pestis YPO0020 conserved
                     hypothetical protein (100% evalue=1.E-103); Salmonella
                     typhi STY3878 yihI; conserved hypothetical protein (51.9%
                     evalue=1.E-43)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068569.1"
                     /db_xref="GI:51594378"
                     /db_xref="GeneID:2953048"
                     /translation="MKQPNKAPRANIAAPKGTATPKRRRKTRDELDAEARDRKRQKKH
                     SGNRSGARTNVEGSNKKGHSQTQEKDPRVGSKVPVPLVIESQVKAKSMPKPVEKNVVK
                     PRLTPEEELAKLENDERLDALLDRLDNDEVLNKEDQAYVDLTLDRIDALMEQLGIELG
                     DDEDDVEREEKQEDILQLLKRGNPKDTF"
     misc_feature    27637..28167
                     /locus_tag="YPTB0020"
                     /note="Der GTPase activator; Provisional; Region:
                     PRK05244"
                     /db_xref="CDD:235370"
     gene            28357..29730
                     /gene="hemN"
                     /locus_tag="YPTB0021"
                     /db_xref="GeneID:2955782"
     CDS             28357..29730
                     /gene="hemN"
                     /locus_tag="YPTB0021"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_068570.1"
                     /db_xref="GI:51594379"
                     /db_xref="GeneID:2955782"
                     /translation="MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQA
                     VKRYPQRPLSLYVHIPFCHKLCYFCGCNKLVTRQQHKADEYLVVLEKEIRQRAALFTG
                     RQVSQMHWGGGTPTYLNKTQISHLMTVLREHFDFLPDAEQSIEVDPREIELDVLDHLR
                     AEGFNRLSMGVQDFNKEVQRLVNREQDEDFIFALIARAKALGFNSTNIDLIYGLPKQT
                     PESFAFTLKRVAELNPDRLSVFNYAHLPSLFAAQRKIKDADLPTAEQRLDILQHTIRF
                     LTESGYQFIGMDHFARPDDELAIAQQEGTLHRNFQGYTTQGESDLLGLGVSAISMLGD
                     SYAQNEKDLETYYACVEQRGNALWRGLTMTEDDCLRRDVIKTLICHFQLSYQPIEQRY
                     GIRFADYFAEDFELLAPFEQDGLVERNETGLRVTPRGRLLIRNICMCFDIYLRKQARK
                     QQFSRVI"
     misc_feature    28369..29727
                     /gene="hemN"
                     /locus_tag="YPTB0021"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK09249"
                     /db_xref="CDD:236430"
     misc_feature    28540..29097
                     /gene="hemN"
                     /locus_tag="YPTB0021"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(28540..28542,28546..28548,28552..28554,28558..28566,
                     28687..28689,28693..28698,28789..28797,28864..28866,
                     28987..28989,29077..29082)
                     /gene="hemN"
                     /locus_tag="YPTB0021"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    29443..29649
                     /gene="hemN"
                     /locus_tag="YPTB0021"
                     /note="HemN C-terminal domain; Region: HemN_C; pfam06969"
                     /db_xref="CDD:253997"
     gene            complement(29784..31196)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /db_xref="GeneID:2956164"
     CDS             complement(29784..31196)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="response regulator of a two-component regulatory
                     system involved in the activation of nitrogen assimilation
                     genes; interacts with sigma-54"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(I)"
                     /protein_id="YP_068571.1"
                     /db_xref="GI:51594380"
                     /db_xref="GeneID:2956164"
                     /translation="MQRGIVWIVDDDSSIRWVLERALTGAGLNCVAFDSGNQVLDALA
                     TRTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYL
                     PKPFDIDEAVALVERAISHYQEQQQPARSQPVSGPTADIIGEAPAMQDVFRIIGRLSR
                     SSISVLINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAF
                     TGANQVRQGRFEQADTGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVR
                     IIAATHQNLELRVQEGKFREDLFHRLNVIRVHLPPLRERSEDIPRLARYFLHVAAKEL
                     GVESKNLHPETEAALTRLPWPGNVRQLENTCRWLTVMAAGQEVLVQDLPSELFETHMP
                     DASGQRAPDSWSTLLAQWADRALRSGHQDLLSEAQPEMERTLLTTALRHTQGHKQEAA
                     RLLGWGRNTLTRKLKELGME"
     misc_feature    complement(29787..31196)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="nitrogen regulation protein NR(I); Provisional;
                     Region: glnG; PRK10923"
                     /db_xref="CDD:182842"
     misc_feature    complement(30840..31175)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(30882..30887,30894..30896,30951..30953,
                     31011..31013,31035..31037,31164..31169))
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(31035..31037)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(31011..31019,31023..31028))
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(30879..30887)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(30264..30773)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(30669..30692)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(30351..30353,30477..30479,30666..30689))
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(30474..30491)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(30294..30296)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(29796..29915)
                     /gene="glnG"
                     /locus_tag="YPTB0022"
                     /gene_synonym="glnT"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(31204..32253)
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /db_xref="GeneID:2956163"
     CDS             complement(31204..32253)
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /EC_number="2.7.13.3"
                     /note="sensory histidine kinase in two-component
                     regulatory system with GlnG; acts as a signal transducer
                     which responds to the nitrogen level of cell and modulates
                     the activity of ntrC by phosphorylation/dephosphorylation"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(II)"
                     /protein_id="YP_068572.1"
                     /db_xref="GI:51594381"
                     /db_xref="GeneID:2956163"
                     /translation="MATGTLPDAGQILNTLINSILLLDDDLAIHYANPAAQQLLAQSS
                     RKLFGTPLPDLLGYFSLNIVLMRESLQAGQGFTDNEVTLVVDGRAHILSLTAQSLAEG
                     FILLELAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLAKALP
                     DPALLEYTQVIIEQADRLRNLVDRLLGPQRPGQHITQSIHQVAERVCQLVSLEKPDNV
                     TLIRDYDPSLPELAHDPDQIEQVLLNITRNALQALGETGGTITLRTRTAFQVTLHGMR
                     YRLAARIDIEDDGPGVPTQLQDTVFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFNS
                     WPGHTEFSVYLPIRQ"
     misc_feature    complement(31210..32253)
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="nitrogen regulation protein NR(II); Provisional;
                     Region: glnL; PRK11073"
                     /db_xref="CDD:182947"
     misc_feature    complement(31948..32208)
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(31993..31995,32008..32010,32080..32091,
                     32128..32130,32146..32148,32158..32160))
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(31966..31968,31972..31974,32056..32058,
                     32062..32064,32086..32088,32098..32100))
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(31696..31863)
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(31699..31701,31711..31713,31720..31722,
                     31732..31734,31741..31743,31753..31755,31801..31803,
                     31810..31812,31822..31824,31831..31833,31843..31845,
                     31855..31857))
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(31837..31839)
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(31219..31542)
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(31231..31233,31237..31239,31252..31254,
                     31258..31260,31306..31317,31378..31383,31387..31389,
                     31393..31395,31399..31401,31501..31503,31510..31512,
                     31522..31524))
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(31510..31512)
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(31309..31311,31315..31317,31381..31383,
                     31387..31389))
                     /gene="glnL"
                     /locus_tag="YPTB0023"
                     /gene_synonym="glnl; glnR"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(32506..33915)
                     /gene="glnA"
                     /locus_tag="YPTB0024"
                     /db_xref="GeneID:2955695"
     CDS             complement(32506..33915)
                     /gene="glnA"
                     /locus_tag="YPTB0024"
                     /EC_number="6.3.1.2"
                     /note="forms a homododecamer; forms glutamine from ammonia
                     and glutamate with the conversion of ATP to ADP and
                     phosphate; also functions in the assimilation of ammonia;
                     highly regulated protein controlled by the
                     addition/removal of adenylyl groups by adenylyltransferase
                     from specific tyrosine residues; addition of adenylyl
                     groups results in inactivation of the enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_068573.1"
                     /db_xref="GI:51594382"
                     /db_xref="GeneID:2955695"
                     /translation="MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHITIPAHQVNADFF
                     EEGKMFDGSSIGGWKGINESDMVLMPDASTAVMDPFFADSTLIIRCDILEPGTMQGYD
                     RDPRSISKRAEDFLKSSGIADTVLFGPEPEFFLFDDIRFGSSINGSHVSIDDVEGAWN
                     SSTKYEGGNKGHRPAVKGGYFPVPPVDSAQDLRSAMCLTMEEMGLVVEAHHHEVATAG
                     QNEVATRFNTMTKKADEIQIYKYVVHNVAHAFGKTATFMPKPMFGDNGSGMHCHMSLS
                     KNGNNLFAGDKYGGLSEIALFYIGGIIKHAKAINALANPTTNSYKRLVPGYEAPVMLA
                     YSARNRSASIRIPVVASPKARRIEARFPDPAANPYLCFAALLMAGLDGIINKIHPGDA
                     MDKNLYDLPPEEEAEIPKVAGSLDEAMAALNEDREFLTRGGVFTDDAIDAYIELRREE
                     MDRVRMTPHPVEFELYYSV"
     misc_feature    complement(32509..33915)
                     /gene="glnA"
                     /locus_tag="YPTB0024"
                     /note="glutamine synthetase; Provisional; Region: glnA;
                     PRK09469"
                     /db_xref="CDD:181884"
     misc_feature    complement(33631..33876)
                     /gene="glnA"
                     /locus_tag="YPTB0024"
                     /note="Glutamine synthetase, beta-Grasp domain; Region:
                     Gln-synt_N; pfam03951"
                     /db_xref="CDD:252271"
     misc_feature    complement(32779..33612)
                     /gene="glnA"
                     /locus_tag="YPTB0024"
                     /note="Glutamine synthetase, catalytic domain; Region:
                     Gln-synt_C; pfam00120"
                     /db_xref="CDD:249604"
     misc_feature    complement(34101..34260)
                     /product="pseudogene"
                     /note="similar to Yersinia pestis YPO0025 with a
                     frameshift."
                     /pseudo
     gene            34478..36301
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /db_xref="GeneID:2955292"
     CDS             34478..36301
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="similar to Yersinia pestis YPO0026 bipA, typA;
                     GTPase (99.8% evalue=0); Salmonella typhimurium STM4009
                     typA; GTP-binding elongation factor family protein (89.1%
                     evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase"
                     /protein_id="YP_068574.1"
                     /db_xref="GI:51594383"
                     /db_xref="GeneID:2955292"
                     /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERTEATERVMD
                     SNDLEKERGITILAKNTAINWKDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAM
                     DGPMPQTRFVTKKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDF
                     PIIYASALMGIAGEDHNDMAEDMTPLYQAIIDHVPAPDVDSSGPLQMQISQLDYNNYV
                     GVIGIGRIKRGIVKPNQQVTVIDSEGKTRNGKVGKVLGHMGLERIETTQAEAGDIVAI
                     TGLGELNISDTICDVNAVEALPPLSVDEPTVTMYFCVNTSPFCGKEGKYVTSRQILDR
                     LNKELIHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVINRII
                     DGRNQEPFESVTLDIEEQHQGAVMQAMGERKGDVKDMIPDGKGRIRLDYMIPSRGLIG
                     FRTEFMTMTSGTGLLYSTFSHYDDVRPGDIGQRQNGVLISNGQGKAVAFALYKLQDRG
                     KLFIGHGTEVYEGQIIGIHSRSNDLTVNCLTGKQLTNMRASGTDEATTLVPFLKKTLE
                     QALEFIDDDELVEVTPQSIRIRKRHLTENDRKRAGRGPREG"
     misc_feature    34478..36283
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="Predicted membrane GTPase involved in stress
                     response [Signal transduction mechanisms]; Region: TypA;
                     COG1217"
                     /db_xref="CDD:224138"
     misc_feature    34487..35068
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="Tyrosine phosphorylated protein A (TypA)/BipA
                     family belongs to ribosome-binding GTPases; Region:
                     TypA_BipA; cd01891"
                     /db_xref="CDD:206678"
     misc_feature    34511..34534
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="G1 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    order(34514..34516,34520..34522,34532..34537,34544..34546,
                     34553..34558,34652..34657,34709..34714,34781..34786,
                     34892..34894,34904..34906)
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206678"
     misc_feature    order(34520..34537,34859..34864,34868..34870,34973..34981)
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206678"
     misc_feature    34619..34654
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206678"
     misc_feature    34640..34642
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="G2 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    34697..34708
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="G3 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    34703..34759
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206678"
     misc_feature    34859..34870
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="G4 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    34973..34981
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="G5 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    35090..35347
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="BipA_TypA_II: domain II of BipA (also called TypA)
                     having homology to domain II of the elongation factors
                     (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein
                     with global regulatory properties in Escherichia coli.
                     BipA is phosphorylated on a...; Region: BipA_TypA_II;
                     cd03691"
                     /db_xref="CDD:239662"
     misc_feature    35669..35905
                     /gene="bipA"
                     /locus_tag="YPTB0025"
                     /gene_synonym="typA"
                     /note="BipA_TypA_C: a C-terminal portion of BipA or TypA
                     having homology to the C terminal domains of the
                     elongation factors EF-G and EF-2. A member of the ribosome
                     binding GTPase superfamily, BipA is widely distributed in
                     bacteria and plants.  BipA is a highly...; Region:
                     BipA_TypA_C; cd03710"
                     /db_xref="CDD:239681"
     gene            36623..37213
                     /locus_tag="YPTB0026"
                     /db_xref="GeneID:2953049"
     CDS             36623..37213
                     /locus_tag="YPTB0026"
                     /note="similar to Yersinia pestis YPO0027 conserved
                     hypothetical protein (100% evalue=1.E-110); Salmonella
                     typhi STY3852 yihX; haloacid dehalogenase-like hydrolase
                     (70.2% evalue=6.E-75)"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="YP_068575.1"
                     /db_xref="GI:51594384"
                     /db_xref="GeneID:2953049"
                     /translation="MLYIFDLGNVIVDIDFKRVLGVWSKLSSVPLATLNERFTMGEVF
                     QQHERGEISDEDFAHQLSDEMGISLSFEQFAEGWQAIFVALRPEVIDIMNKLRREGNR
                     VVVLSNTNRLHCYYWPEHYPEVAAAADHMYLSQDLGMRKPEARIYQHVLNAENVPAEQ
                     AVFFDDVEANVLAAKAVGINAIHVTDRQIIPTYFSL"
     misc_feature    36632..37174
                     /locus_tag="YPTB0026"
                     /note="haloacid dehalogenase superfamily, subfamily IA,
                     variant 3 with third motif having DD or ED; Region:
                     HAD-SF-IA-v3; TIGR01509"
                     /db_xref="CDD:233443"
     misc_feature    36875..37174
                     /locus_tag="YPTB0026"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    36941..36943
                     /locus_tag="YPTB0026"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            37310..38194
                     /gene="rbn"
                     /locus_tag="YPTB0027"
                     /db_xref="GeneID:2956403"
     CDS             37310..38194
                     /gene="rbn"
                     /locus_tag="YPTB0027"
                     /EC_number="3.1.-.-"
                     /note="RNase BN; required for 3' maturation of certain
                     phage T4-encoded tRNAs; forms a dimer; specific for
                     immature tRNA substrates containing incorrect residues
                     within the universal CCA sequence; 3' to 5'
                     exoribonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease BN"
                     /protein_id="YP_068576.1"
                     /db_xref="GI:51594385"
                     /db_xref="GeneID:2956403"
                     /translation="MASFRRFRLLSPLKPCVTFGRMLYTRIDKDGLTMLAGHLAYVSL
                     LSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFMPATGDIIQNYLEQFVANSNRMT
                     VVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFSFAVYWMVLTLGPILVGASMVI
                     SSYLLSLHWLAHARVDSMIDEILRVFPLLISWVSFWLLYSVVPTVRVPARDALIGALV
                     AALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGE
                     YRAERHHAKSVITQSPEM"
     misc_feature    37334..38188
                     /gene="rbn"
                     /locus_tag="YPTB0027"
                     /note="hypothetical protein; Reviewed; Region: PRK01637"
                     /db_xref="CDD:179313"
     misc_feature    join(37424..37492,37610..37669,37727..37795,37853..37912,
                     37949..38017,38045..38113)
                     /gene="rbn"
                     /locus_tag="YPTB0027"
                     /note="6 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            38201..38638
                     /locus_tag="YPTB0028"
                     /db_xref="GeneID:2953050"
     CDS             38201..38638
                     /locus_tag="YPTB0028"
                     /note="hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and
                     free tRNA(Tyr); possible defense mechanism against a
                     harmful effect of D-tyrosine"
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="YP_068577.1"
                     /db_xref="GI:51594386"
                     /db_xref="GeneID:2953050"
                     /translation="MIALIQRALSASVVVEGNIVGEIGPGLLVLLGVEQGDTEQKAQR
                     LCERVLGYRIFSDENDKMNLNVQQAGGSVLVVSQFTLVADTQKGMRPSFSRGAIPQEA
                     DRLYQYFVAQCRERGVKTETGLFAADMKVSLVNDGPVTFWLQV"
     misc_feature    38201..38635
                     /locus_tag="YPTB0028"
                     /note="D-Tyrosyl-tRNAtyr deacylases; a class of
                     tRNA-dependent hydrolases which are capable of hydrolyzing
                     the ester bond of D-Tyrosyl-tRNA reducing the level of
                     cellular D-Tyrosine while recycling the peptidyl-tRNA;
                     found in bacteria and in eukaryotes but not...; Region:
                     Dtyr_deacylase; cd00563"
                     /db_xref="CDD:238316"
     misc_feature    order(38219..38221,38429..38443,38477..38479,38621..38623)
                     /locus_tag="YPTB0028"
                     /note="putative active site [active]"
                     /db_xref="CDD:238316"
     misc_feature    order(38330..38332,38339..38347,38351..38362,38429..38434,
                     38438..38443,38447..38455,38459..38473,38477..38479,
                     38579..38632)
                     /locus_tag="YPTB0028"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238316"
     misc_feature    order(38342..38344,38357..38359,38459..38461,38468..38470)
                     /locus_tag="YPTB0028"
                     /note="putative tRNAtyr binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238316"
     gene            38824..39747
                     /locus_tag="YPTB0029"
                     /db_xref="GeneID:2953051"
     CDS             38824..39747
                     /locus_tag="YPTB0029"
                     /note="similar to Yersinia pestis YPO0032 conserved
                     membrane protein (100% evalue=1.E-178); Escherichia coli
                     b3888 yiiD; hypothetical 37.1 kD protein in rbn-fdhE
                     intergenic region (O329) (83.8% evalue=1.E-149)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068578.1"
                     /db_xref="GI:51594387"
                     /db_xref="GeneID:2953051"
                     /translation="MYHLRVPITEQELKDYYQFRWEMLRKPLHQPIGSEKDAYDAMAH
                     HQMVVDEQGKAVAIGRLYINADNEAAIRFLAVAPSVRNKGLGTLVAMTLESVARQEGV
                     KRVVCSAREDAVDFFAKLGFVCQGEITAPQTTPVRHFLMIKPVATMDDILHRPDWCGQ
                     LQQAWYDHIPLSEKMGVRISQYTGQRFVTTMPEAGNQNPHHTLFAGSLFSLATLTGWG
                     LIWLLLRERHLGGTIILADAHIRYSAPVTGRPRAVAELSSLSGDLDRLARGRRARVQL
                     NVNLFGDENQGAVFEGTYMVLPVAAGDDMAN"
     misc_feature    38965..39147
                     /locus_tag="YPTB0029"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(39043..39051,39079..39084)
                     /locus_tag="YPTB0029"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    39295..39717
                     /locus_tag="YPTB0029"
                     /note="Putative thioesterase (yiiD_Cterm); Region:
                     YiiD_Cterm; pfam09500"
                     /db_xref="CDD:255399"
     misc_feature    39427..39495
                     /locus_tag="YPTB0029"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(39882..41591)
                     /locus_tag="YPTB0030"
                     /db_xref="GeneID:2953052"
     CDS             complement(39882..41591)
                     /locus_tag="YPTB0030"
                     /note="similar to Yersinia pestis YPO0033 possible
                     exported protein (100% evalue=0); Escherichia coli b3655
                     yicH; hypothetical 62.3 kD protein in gltS-selC intergenic
                     region (49% evalue=1.E-164)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068579.1"
                     /db_xref="GI:51594388"
                     /db_xref="GeneID:2953052"
                     /translation="MKFLGKTLLTLLLLFALSIVLCYAVLQTSWAAGWLSRWVSNNSG
                     YHLSLRGIDHRWSQPGQISFSDVTLARADQPPFLTAQQVIFGLSWRQLTDPKHFLSLQ
                     LQNGSLTLNNSTPSLPLQADTLQLTDMTLNTTVESKNATSQWKIAGQHVNGGLVPWQP
                     IPGNSFGENTQFHFSAGFLTINDISAQQIYLQGSIQKDILTLTNFGANIAQGELTGNA
                     RQSADGSWLVDRLRLSNIRLQTTASLEDVWNNVLQLPPITLKRFDLIDARVEGKGWAV
                     NDVDLTLKNITFKQGDWQSDDGELVFNASDIIKGNIHLIDPIATFTLSPEGVAINQFT
                     TRWQDGLLRTLGSWSRATHRLQLGELTVVALVYTLPNDWKQLWQQTLPDWLSEVYVGK
                     LSANRNLLIDISPDFPFQITSLDAAGSNLLLAKNHQWGVWSGSLVLNAGNATFNKNDI
                     RRPSLALNANEQQITFSDLSAFTKEGLLEATASIDQTPDRALSLALTGRSVDLNFLHN
                     WGWPALPLQGLGNLKLQIKGNLTADAPLKPTLNGSLQAIDSNGQQINQTVLHGVVQGT
                     AEQ"
     misc_feature    complement(39936..41591)
                     /locus_tag="YPTB0030"
                     /note="AsmA family; Region: AsmA; pfam05170"
                     /db_xref="CDD:253057"
     misc_feature    complement(<39936..40232)
                     /locus_tag="YPTB0030"
                     /note="AsmA-like C-terminal region; Region: AsmA_2;
                     pfam13502"
                     /db_xref="CDD:257822"
     misc_feature    complement(41505..41570)
                     /locus_tag="YPTB0030"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(41738..43123)
                     /locus_tag="YPTB0031"
                     /db_xref="GeneID:2953053"
     CDS             complement(41738..43123)
                     /locus_tag="YPTB0031"
                     /note="similar to Yersinia pestis YPO0034  membrane
                     permease (99.3% evalue=0); Escherichia coli ECs4530
                     transport protein (84.4% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="NCS2 family xanthine/uracil:H+ symporter"
                     /protein_id="YP_068580.1"
                     /db_xref="GI:51594389"
                     /db_xref="GeneID:2953053"
                     /translation="MSTQSAELDTAQPSPARPSELIYHLEDRPPLPQTLFAACQHLLA
                     MFVAVITPGLLICQALGLPAEDTQRIISMSLFASGLASLLQIKTWGPVGSGLLSIQGT
                     SFNFVSPLIMGGLALKNGGADIPTMMAALFGTLMVASCTEILLSRVLHLARRIITPLV
                     SGIVVMIIGLSLIQVGLTSIGGGYGAMSDNTFGAPKNLLLAGAVLGVIILLNRQRNPY
                     LRVASLVIAMAVGYLLAWALGMLPESRPVVDTALITIPTPLYYGLSFDWNLLIPLMLI
                     FMVTSLETIGDITATSDVSEQPVRGPLYMKRLKGGVLANGLNSMLSAIFNTFPNSCFG
                     QNNGVIQLTGVASRYVGFVVAIMLIILGLFPAVAGFVQHIPEPVLGGATLVMFGTIAA
                     SGVRIVSRETLNRRAIMIMALSLAVGMGVAQQPLILQFAPDWIKTLFSSGIAAGGITA
                     IVLNLLFPQEK"
     misc_feature    complement(41741..43063)
                     /locus_tag="YPTB0031"
                     /note="Xanthine/uracil permeases [Nucleotide transport and
                     metabolism]; Region: UraA; COG2233"
                     /db_xref="CDD:225142"
     misc_feature    complement(41933..43060)
                     /locus_tag="YPTB0031"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     misc_feature    complement(join(41753..41809,41840..41905,41927..41992,
                     42008..42073,42278..42343,42404..42469,42491..42547,
                     42593..42658,42680..42745,42776..42841,42932..42997))
                     /locus_tag="YPTB0031"
                     /note="11 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            43361..44575
                     /gene="gltS"
                     /locus_tag="YPTB0032"
                     /gene_synonym="gltC"
                     /db_xref="GeneID:2955724"
     CDS             43361..44575
                     /gene="gltS"
                     /locus_tag="YPTB0032"
                     /gene_synonym="gltC"
                     /note="similar to Yersinia pestis YPO0035 gltS, gltC;
                     sodium/glutamate symport carrier protein (100% evalue=0);
                     Escherichia coli ECs4529 glutamate transport protein
                     (82.4% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/glutamate symport carrier protein"
                     /protein_id="YP_068581.1"
                     /db_xref="GI:51594390"
                     /db_xref="GeneID:2955724"
                     /translation="MFHLDTYGTLVAACLVLLLGRKLVQTVPFLKKYTIPEPVAGGLL
                     VAFMMLLVQKTLGWEVSFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFVFIVV
                     GLLLVQNTIGIVLAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFSERYGFENATEV
                     AMACATFGLVLGGLIGGPVARYLVKHSSTPEGTPDDSAVPSAFEKPSAGRMITSLVLI
                     ETIAMISICLMAGNLIAGWLQGTMFELPIFVCVLFVGVILSNTLSASGFYRVFDRAVS
                     VLGNVSLSLFLAMALMSLKLWELASLALPMLVILSVQALAMALYAIFVTYRIMGKNYD
                     AAVLAAGHCGFGLGATPTAIANMQAITDRFGPSHLAFLVVPMVGAFFIDIVNAIVIKL
                     YLLLPIFPAVTG"
     misc_feature    43364..44554
                     /gene="gltS"
                     /locus_tag="YPTB0032"
                     /gene_synonym="gltC"
                     /note="Sodium/glutamate symporter; Region: Glt_symporter;
                     cl19414"
                     /db_xref="CDD:267767"
     misc_feature    join(43370..43423,43457..43525,43568..43621,43640..43708,
                     43829..43897,43997..44065,44093..44161,44180..44236,
                     44264..44332,44369..44437,44480..44548)
                     /gene="gltS"
                     /locus_tag="YPTB0032"
                     /gene_synonym="gltC"
                     /note="11 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(44941..47022)
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /db_xref="GeneID:2956417"
     CDS             complement(44941..47022)
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /EC_number="3.6.1.-"
                     /note="catalyzes branch migration in Holliday junction
                     intermediates"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="YP_068582.1"
                     /db_xref="GI:51594391"
                     /db_xref="GeneID:2956417"
                     /translation="MKGRLLDAVPLSTLSGVGASQAGKLAKIGLETIQDLLLHLPLRY
                     EDRTRLYRIGDLLPGLSVTVEGEVLRSDISFGRRRMMTCQISDGSGVLTLRFFNFNAA
                     MKNSLSVGKHVIAYGEAKRGNNGPEIIHPEYRVHGENIGVELQESLTPVYPTTEGIRQ
                     ATLRKLIDQALAMLDTCVIAELLPIELSRSLISLPEAIHTLHRPPADIQLADLEQGKH
                     PAQRRLIMEELLAHNLSMLAVRAGAQSYRALPLMAEEQLKQRFLAALPFTPTQAQQRV
                     VAEIERDMTQSFPMMRLIQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHA
                     TTFRQWLEPLGFSVGWLAGKQKGKARLAQQEAVASGQVSMVIGTHAMFQEQVQFSGLA
                     LVIIDEQHRFGVHQRLTLWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDE
                     LPPGRTPVTTVAIPDTRRSDVIQRVKNACLEEGRQAYWVCTLIEESELLEAQAAEVTC
                     EELKIALPEIKVGLVHGRMKGPEKQAIMLAFKQGELQLLVATTVIEVGVDVPNASLMI
                     IDNPERLGLAQLHQLRGRVGRGAVASHCVLLYKTPLSKTAQMRLQVLRDSNDGFVIAQ
                     RDLEIRGPGELLGTRQTGSAEFKVADLLRDQAMIPEVQRVARHLHQQYPEHAKALIER
                     WLPERVRYTNA"
     misc_feature    complement(44944..47022)
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /note="ATP-dependent DNA helicase RecG; Provisional;
                     Region: PRK10917"
                     /db_xref="CDD:236794"
     misc_feature    complement(46618..46836)
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /note="RecG_wedge_OBF: A subfamily of OB folds
                     corresponding to the OB fold found in the N-terminal
                     (wedge) domain of Escherichia coli RecG. RecG is a
                     branched-DNA-specific helicase, which catalyzes the
                     interconversion of a DNA replication fork to a...; Region:
                     RecG_wedge_OBF; cd04488"
                     /db_xref="CDD:239934"
     misc_feature    complement(order(46618..46620,46675..46677,46681..46683,
                     46687..46689,46834..46836))
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239934"
     misc_feature    complement(order(46639..46641,46717..46719,46732..46734,
                     46783..46785))
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /note="ssDNA binding site; other site"
                     /db_xref="CDD:239934"
     misc_feature    complement(45733..46149)
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(46114..46128)
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(45823..45834)
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(45232..45633)
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(45367..45375,45448..45453,45541..45552))
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(45262..45264,45271..45273,45283..45285,
                     45349..45351))
                     /gene="recG"
                     /locus_tag="YPTB0033"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            complement(47023..47715)
                     /gene="trmH"
                     /locus_tag="YPTB0034"
                     /gene_synonym="spoU"
                     /db_xref="GeneID:2956737"
     CDS             complement(47023..47715)
                     /gene="trmH"
                     /locus_tag="YPTB0034"
                     /gene_synonym="spoU"
                     /EC_number="2.1.1.34"
                     /note="specifically modifies tRNA at position G18"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA guanosine-2'-O-methyltransferase"
                     /protein_id="YP_068583.1"
                     /db_xref="GI:51594392"
                     /db_xref="GeneID:2956737"
                     /translation="MNPQRYARICDMLATRQPDLTVCLEQVHKPHNVSAIIRTADAVG
                     IHQVHAIWPTTQMYTRLSAAAGSNSWVQVKTHPHIADAIAYLKSQDMQILATHLSDKA
                     VDFREIDYTRPTCILMGQEKTGISPEALALADQDIIIPMIGMVQSLNVSVASALILYE
                     AQRQRQNAGMYKRTHSVLAESEQQRLLFEGGYPVLAHVAKRKGLPQPHIDEQGQIIAD
                     AQWWSAMQATES"
     misc_feature    complement(47029..47715)
                     /gene="trmH"
                     /locus_tag="YPTB0034"
                     /gene_synonym="spoU"
                     /note="tRNA guanosine-2'-O-methyltransferase; Provisional;
                     Region: PRK11081"
                     /db_xref="CDD:236837"
     misc_feature    complement(47239..47661)
                     /gene="trmH"
                     /locus_tag="YPTB0034"
                     /gene_synonym="spoU"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     misc_feature    complement(47053..47229)
                     /gene="trmH"
                     /locus_tag="YPTB0034"
                     /gene_synonym="spoU"
                     /note="SpoU, rRNA methylase, C-terminal; Region:
                     SpoU_methylas_C; pfam12105"
                     /db_xref="CDD:152540"
     gene            complement(47721..49829)
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /db_xref="GeneID:2956629"
     CDS             complement(47721..49829)
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /EC_number="3.1.7.2"
                     /note="similar to Yersinia pestis YPO0038 spoT;
                     guanosine-3',5'-bisbis(diphosphate) 3'-pyrophosphydrolase
                     (99.8% evalue=0); Escherichia coli JW3625 spoT; Guanosine
                     3',5'-bis(diphosphate) 3'-pyrophosphatase (91.4%
                     evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional (p)ppGpp synthetase II/
                     guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase"
                     /protein_id="YP_068584.1"
                     /db_xref="GI:51594393"
                     /db_xref="GeneID:2956629"
                     /translation="MYLFESLNLLIQRYLPEEQIKRLKQAYLVARDAHEGQTRSSGEP
                     YITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSK
                     LDKLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIAR
                     ETLEIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILA
                     EIEGRLTEAGIPCRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVKEVDTCYRV
                     LGQAHSLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMG
                     VAAHWAYKEQGESGTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFT
                     PEGRIVELPAGATPVDFAYVVHTDIGHACVGARVDRQPYPLSQPLSSGQTVEIITAPG
                     ARPNAAWLNFVVSSKARAKIRQLLKNLKRDESVSLGRRLLNHALGNGRKLSDISEENI
                     KHELDRMKLATVDDLLAEIGLGNAMSVVVAKNLLGDPSTLGTSASGTRKLPIKGADGV
                     LITFAKCCRPIPGDPIIAHISPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDQETEQE
                     FIAEIKVDMFNQQGALANLTAAINAAESNIQSLNTEEKDGRVYSAFIRLTTRNRVHLA
                     NIMRKIRIMPDVVKVSRNRN"
     misc_feature    complement(47724..49829)
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /note="bifunctional (p)ppGpp synthetase II/
                     guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase;
                     Provisional; Region: PRK11092"
                     /db_xref="CDD:236843"
     misc_feature    complement(49332..49703)
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(49413..49415,49611..49616,49686..49688))
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(49611..49613)
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(48831..49190)
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /note="Nucleotidyltransferase (NT) domain of RelA- and
                     SpoT-like ppGpp synthetases and hydrolases; Region:
                     NT_Rel-Spo_like; cd05399"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(48834..48839,48861..48863,48867..48869,
                     48873..48875,48909..48911,48921..48923,48927..48929,
                     48933..48935,48948..48950,48954..48956,49038..49040,
                     49050..49055,49116..49118,49122..49124))
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /note="synthetase active site [active]"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(48837..48839,48867..48869,48873..48875,
                     48909..48911,48921..48923,48927..48929,48933..48935,
                     48948..48950,48954..48956,49122..49124))
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(48873..48875,49053..49055))
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143389"
     misc_feature    complement(48489..48668)
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /note="TGS_RelA_SpoT: The RelA (SpoT) protein, also
                     referred to as ppGpp hydrolase/synthetase, is a
                     ribosome-associated protein that is activated during amino
                     acid starvation and thought to mediate the stringent
                     response. RelA contains a TGS domain, named after...;
                     Region: TGS_RelA_SpoT; cd01668"
                     /db_xref="CDD:133438"
     misc_feature    complement(47733..47945)
                     /gene="spoT"
                     /locus_tag="YPTB0035"
                     /note="ACT  domain found C-terminal of the RelA/SpoT
                     domains; Region: ACT_RelA-SpoT; cd04876"
                     /db_xref="CDD:153148"
     gene            complement(49849..50124)
                     /gene="rpoZ"
                     /locus_tag="YPTB0036"
                     /db_xref="GeneID:2956528"
     CDS             complement(49849..50124)
                     /gene="rpoZ"
                     /locus_tag="YPTB0036"
                     /EC_number="2.7.7.6"
                     /note="promotes RNA polymerase assembly or stability;
                     latches the N- and C-terminal regions of the beta' subunit
                     thereby facilitating its interaction with the beta and
                     alpha subunits"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="YP_068585.1"
                     /db_xref="GI:51594394"
                     /db_xref="GeneID:2956528"
                     /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQIQSGGKDALVPEEND
                     KVTVIALREIEEGLITNQILDVRERQEQQEQEAAEIQAVTAIAEGRR"
     misc_feature    complement(49948..50124)
                     /gene="rpoZ"
                     /locus_tag="YPTB0036"
                     /note="DNA-directed RNA polymerase, omega subunit; Region:
                     rpoZ; TIGR00690"
                     /db_xref="CDD:188073"
     gene            complement(50179..50802)
                     /gene="gmk"
                     /locus_tag="YPTB0037"
                     /gene_synonym="spoR"
                     /db_xref="GeneID:2955731"
     CDS             complement(50179..50802)
                     /gene="gmk"
                     /locus_tag="YPTB0037"
                     /gene_synonym="spoR"
                     /EC_number="2.7.4.8"
                     /note="Essential for recycling GMP and indirectly, cGMP"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="YP_068586.1"
                     /db_xref="GI:51594395"
                     /db_xref="GeneID:2955731"
                     /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAK
                     RPGENHGEHYFFVSEKEFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLD
                     IDWQGAQQIRAKMPTARSIFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVAEMAHY
                     AEYDYLIVNDDFNLALSDLKTIIRAERLRLGRQKQRHDALISKLLAD"
     misc_feature    complement(50245..50796)
                     /gene="gmk"
                     /locus_tag="YPTB0037"
                     /gene_synonym="spoR"
                     /note="Guanylate kinase; Region: Guanylate_kin; pfam00625"
                     /db_xref="CDD:250008"
     misc_feature    complement(50263..50787)
                     /gene="gmk"
                     /locus_tag="YPTB0037"
                     /gene_synonym="spoR"
                     /note="Guanosine monophosphate kinase (GMPK, EC 2.7.4.8),
                     also known as guanylate kinase (GKase), catalyzes the
                     reversible phosphoryl transfer from adenosine triphosphate
                     (ATP) to guanosine monophosphate (GMP) to yield adenosine
                     diphosphate (ADP) and guanosine...; Region: GMPK; cd00071"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(50557..50559,50572..50574,50641..50643,
                     50668..50670,50677..50679,50698..50700,50752..50754,
                     50770..50772))
                     /gene="gmk"
                     /locus_tag="YPTB0037"
                     /gene_synonym="spoR"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(50752..50754,50770..50772))
                     /gene="gmk"
                     /locus_tag="YPTB0037"
                     /gene_synonym="spoR"
                     /note="G-X2-G-X-G-K; other site"
                     /db_xref="CDD:238026"
     gene            51203..52906
                     /gene="ligB"
                     /locus_tag="YPTB0038"
                     /gene_synonym="yicF"
                     /db_xref="GeneID:2953054"
     CDS             51203..52906
                     /gene="ligB"
                     /locus_tag="YPTB0038"
                     /gene_synonym="yicF"
                     /EC_number="6.5.1.2"
                     /note="this ligase is similar to LigA but it lacks the
                     C-terminal BRCT domain; catalyzes strand joining of nicked
                     DNA in the presence of a divalent cation and NAD+"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigB"
                     /protein_id="YP_068587.1"
                     /db_xref="GI:51594396"
                     /db_xref="GeneID:2953054"
                     /translation="MNILNLKIIMFLLISNIIVVGGAWATSTCPDWPATRIAVEINAL
                     EQQLNKWSAAYHQQGHSPVTDDIYDQLQDKLRVWQSCRGLPDKTESQPIPGKGQFLHP
                     VAHTGLKKLKDETALTRWMAGRKNLWVQPKVDGVAVTLVYHGGKLVQLLSRGNGVKGQ
                     NWTEKAPFISAIPQYIANAPALLTLQGELFLLMDGHQQAKSGGVNARSTVAGALMRKS
                     PSPLLAQVGVFIWAWPDGPTTMKEKVALLQVMGFPFTAKYSEPVMSHLDVVQWRQFWF
                     QAPLPFVTDGVVVRQEEEPAGRYWQATPGQWSMAWKYPPLQHIAEVKDIHFTLGRTGK
                     GTVVLEVLPIKIDDKWIRRVNIGSVTRWKQWDIAPGDHITLALAGHGIPRLDNVVWRV
                     HQRNTITAPNWDKFHQLSCFQRLPHGCEPQFLSRLIWLSGPGGLDIGGIGGGFWQKLI
                     HHELINDLVGWLLLTPEQIASIPGIGNARAEKIYQQFQRAKQQPFSRWLLALGFPQVV
                     SVDAQWQVVLRRSLSEWATMAGIGQMRAKQIKHFLDHPDVQALADFLSTQKVVGFELT
                     E"
     misc_feature    51218..52897
                     /gene="ligB"
                     /locus_tag="YPTB0038"
                     /gene_synonym="yicF"
                     /note="NAD-dependent DNA ligase LigB; Reviewed; Region:
                     ligB; PRK08097"
                     /db_xref="CDD:236150"
     misc_feature    51320..52147
                     /gene="ligB"
                     /locus_tag="YPTB0038"
                     /gene_synonym="yicF"
                     /note="NAD+ dependent DNA ligase adenylation domain. DNA
                     ligases catalyze the crucial step of joining the breaks in
                     duplex DNA during DNA replication, repair and
                     recombination, utilizing either ATP or NAD(+) as a
                     cofactor, but using the same basic reaction...; Region:
                     LIGANc; cd00114"
                     /db_xref="CDD:238062"
     misc_feature    order(51524..51526,51590..51592,51596..51598,51659..51661,
                     51764..51766,51893..51895,52064..52066,52070..52072)
                     /gene="ligB"
                     /locus_tag="YPTB0038"
                     /gene_synonym="yicF"
                     /note="nucleotide binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238062"
     misc_feature    order(51596..51598,51602..51607)
                     /gene="ligB"
                     /locus_tag="YPTB0038"
                     /gene_synonym="yicF"
                     /note="K-X-D-G motif; other site"
                     /db_xref="CDD:238062"
     misc_feature    51596..51598
                     /gene="ligB"
                     /locus_tag="YPTB0038"
                     /gene_synonym="yicF"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238062"
     misc_feature    52157..52372
                     /gene="ligB"
                     /locus_tag="YPTB0038"
                     /gene_synonym="yicF"
                     /note="NAD-dependent DNA ligase OB-fold domain; Region:
                     DNA_ligase_OB; pfam03120"
                     /db_xref="CDD:145978"
     gene            complement(52926..53543)
                     /locus_tag="YPTB0039"
                     /db_xref="GeneID:2953055"
     CDS             complement(52926..53543)
                     /locus_tag="YPTB0039"
                     /note="similar to Yersinia pestis YPO0042  membrane
                     protein (99.4% evalue=2.E-98); Escherichia coli b3646
                     yicG; hypothetical 22.0 kD protein in rph-gmk intergenic
                     region precursor (73.6% evalue=2.E-82)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068588.1"
                     /db_xref="GI:51594397"
                     /db_xref="GeneID:2953055"
                     /translation="MLLSVLYIIGITAEAMTGALAAGRRQMDMFGVIIIASATAIGGG
                     SVRDMLLGHYPLGWVKHPEYIVIVAIAAIVTTWMAPLMKQLRHLFLVLDAIGLIVFSI
                     IGAQIALDMGHSTIIAAIAAVITGVFGGVLRDMLCNCIPLVFQKEIYAGISFAAAWIY
                     IALQYTPLSHNWVIIITLITGLSARLLALRFRLGLPVFKYEHSDH"
     misc_feature    complement(52929..53543)
                     /locus_tag="YPTB0039"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2860"
                     /db_xref="CDD:225415"
     misc_feature    complement(53301..53537)
                     /locus_tag="YPTB0039"
                     /note="UPF0126 domain; Region: UPF0126; pfam03458"
                     /db_xref="CDD:251969"
     misc_feature    complement(53052..53279)
                     /locus_tag="YPTB0039"
                     /note="UPF0126 domain; Region: UPF0126; pfam03458"
                     /db_xref="CDD:251969"
     misc_feature    complement(join(52977..53027,53058..53123,53145..53210,
                     53223..53279,53301..53351,53391..53456,53478..53528))
                     /locus_tag="YPTB0039"
                     /note="7 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(54064..54927)
                     /locus_tag="YPTB0040"
                     /db_xref="GeneID:2953056"
     CDS             complement(54064..54927)
                     /locus_tag="YPTB0040"
                     /note="similar to Yersinia pestis YPO0043 conserved
                     hypothetical protein (100% evalue=1.E-157); Salmonella
                     typhi STY4059 conserved hypothetical protein (87.8%
                     evalue=1.E-140)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068589.1"
                     /db_xref="GI:51594398"
                     /db_xref="GeneID:2953056"
                     /translation="MIRSMTAYARRDIKGEWGNAAWELRSVNQRYLETYIRLPEQFRS
                     LEPVIRERIRSRLTRGKIECHLRFELDANAQSSLILNEKLAKQLVEAGNWVKMQSDEG
                     EINPVDILRWPGVMSAEEQDLDAISTELMQALDTALDDFIVSRETEGAALKTLIEQRL
                     EGVSAEVVKVRAHMPNILQWQRERLLNKLEEAQVQLENTRLEQELVLMAQRIDVAEEL
                     DRLEAHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLI
                     EQMREQIQNIE"
     misc_feature    complement(54067..54927)
                     /locus_tag="YPTB0040"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11820"
                     /db_xref="CDD:236993"
     misc_feature    complement(54466..54924)
                     /locus_tag="YPTB0040"
                     /note="YicC-like family, N-terminal region; Region:
                     YicC_N; pfam03755"
                     /db_xref="CDD:252148"
     misc_feature    complement(54067..54324)
                     /locus_tag="YPTB0040"
                     /note="Domain of unknown function (DUF1732); Region:
                     DUF1732; pfam08340"
                     /db_xref="CDD:254742"
     gene            55054..55770
                     /gene="rph"
                     /locus_tag="YPTB0041"
                     /db_xref="GeneID:2956483"
     CDS             55054..55770
                     /gene="rph"
                     /locus_tag="YPTB0041"
                     /EC_number="2.7.7.56"
                     /note="RNase PH; tRNA nucleotidyltransferase; forms
                     hexamers in Bacillus subtilis; phosphoroltic 3'-5'
                     exoribonuclease; involved in maturation of tRNA precursors
                     and removes terminal nucleotides near CCA acceptor arms of
                     mature tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="YP_068590.1"
                     /db_xref="GI:51594399"
                     /db_xref="GeneID:2956483"
                     /translation="MRPADRAAQQVRPLTLTRNYTKHAEGSVLVEFGDTKVLCTATVE
                     EGVPRFLKGQGQGWITAEYGMLPRSTHSRNAREAAKGKQGGRTLEIQRLIARSLRAAV
                     DLKKLGEFTITLDCDVLQADGGTRTASISGACVALADALNKLVASGKLKANPMKGLVA
                     AVSVGIVKGEALCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLALL
                     DLARGGIETIFQAQKAALES"
     misc_feature    55054..55764
                     /gene="rph"
                     /locus_tag="YPTB0041"
                     /note="ribonuclease PH; Reviewed; Region: rph; PRK00173"
                     /db_xref="CDD:178914"
     misc_feature    55081..55761
                     /gene="rph"
                     /locus_tag="YPTB0041"
                     /note="Ribonuclease PH; Region: RNase_PH_bact; cd11362"
                     /db_xref="CDD:206767"
     misc_feature    order(55111..55125,55153..55155,55159..55161,55165..55167,
                     55171..55173,55177..55179,55237..55239,55243..55245,
                     55249..55266,55270..55272,55279..55284,55306..55311,
                     55315..55320,55327..55329,55339..55341,55348..55350,
                     55390..55392,55396..55398,55402..55404,55408..55416,
                     55639..55653,55657..55659,55663..55680,55684..55686,
                     55693..55698,55705..55710,55717..55719)
                     /gene="rph"
                     /locus_tag="YPTB0041"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206767"
     misc_feature    order(55246..55248,55309..55311,55414..55431,55591..55593,
                     55609..55611)
                     /gene="rph"
                     /locus_tag="YPTB0041"
                     /note="active site"
                     /db_xref="CDD:206767"
     gene            55937..56584
                     /gene="pyrE"
                     /locus_tag="YPTB0042"
                     /db_xref="GeneID:2956387"
     CDS             55937..56584
                     /gene="pyrE"
                     /locus_tag="YPTB0042"
                     /EC_number="2.4.2.10"
                     /note="involved in fifth step of pyrimidine biosynthesis;
                     converts orotidine 5'-phosphate and diphosphate to orotate
                     and 5-phospho-alpha-D-ribose 1-diphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="YP_068591.1"
                     /db_xref="GI:51594400"
                     /db_xref="GeneID:2956387"
                     /translation="MKAYQREFIEFALNKQVLKFGEFTLKSGRISPYFFNAGLFNTGL
                     DLAKLGRFYAAALMDCGVEFDLLFGPAYKGIPIATTTAVALAEHHERDVPYCFNRKEA
                     KTHGEGGNLVGSPLQGRVMLVDDVITAGTAIRESMEIINAQGATLAGVMISLDRQERG
                     RGEISAIQEVERDYHCKVIAIVTLNDVIRYLEDKPEMAEHLVAVRQYREQYGVTL"
     misc_feature    56081..56470
                     /gene="pyrE"
                     /locus_tag="YPTB0042"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(56147..56149,56153..56155,56306..56314,56318..56332,
                     56402..56404)
                     /gene="pyrE"
                     /locus_tag="YPTB0042"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(56719..57315)
                     /gene="slmA"
                     /locus_tag="YPTB0043"
                     /gene_synonym="ttk"
                     /db_xref="GeneID:2956841"
     CDS             complement(56719..57315)
                     /gene="slmA"
                     /locus_tag="YPTB0043"
                     /gene_synonym="ttk"
                     /note="FtsZ binding protein; synthetically lethal with a
                     defect in the Min system; this protein is the first
                     identified nucleoid occlusion factor which works along
                     with the Min system to properly position the FtsZ ring
                     assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid occlusion protein"
                     /protein_id="YP_068592.1"
                     /db_xref="GI:51594401"
                     /db_xref="GeneID:2956841"
                     /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVS
                     EAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAERN
                     PGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
                     QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ"
     misc_feature    complement(56731..57315)
                     /gene="slmA"
                     /locus_tag="YPTB0043"
                     /gene_synonym="ttk"
                     /note="division inhibitor protein; Provisional; Region:
                     slmA; PRK09480"
                     /db_xref="CDD:181894"
     misc_feature    complement(57130..57273)
                     /gene="slmA"
                     /locus_tag="YPTB0043"
                     /gene_synonym="ttk"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(57437..57892)
                     /gene="dut"
                     /locus_tag="YPTB0044"
                     /gene_synonym="dnaS; sof"
                     /db_xref="GeneID:2955490"
     CDS             complement(57437..57892)
                     /gene="dut"
                     /locus_tag="YPTB0044"
                     /gene_synonym="dnaS; sof"
                     /EC_number="3.6.1.23"
                     /note="catalyzes the formation of dUMP from dUTP"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="YP_068593.1"
                     /db_xref="GI:51594402"
                     /db_xref="GeneID:2955490"
                     /translation="MKKIDIKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQP
                     GQTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWN
                     RGQQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTGGFGHSGRQ"
     misc_feature    complement(57530..57811)
                     /gene="dut"
                     /locus_tag="YPTB0044"
                     /gene_synonym="dnaS; sof"
                     /note="Trimeric dUTP diphosphatases; Region:
                     trimeric_dUTPase; cd07557"
                     /db_xref="CDD:143638"
     misc_feature    complement(order(57539..57541,57551..57553,57560..57574,
                     57584..57586,57590..57592,57596..57598,57602..57604,
                     57623..57625,57632..57634,57650..57658,57674..57691,
                     57695..57697,57746..57748,57752..57757,57770..57772,
                     57806..57811))
                     /gene="dut"
                     /locus_tag="YPTB0044"
                     /gene_synonym="dnaS; sof"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143638"
     misc_feature    complement(order(57602..57607,57617..57619,57626..57634,
                     57677..57685))
                     /gene="dut"
                     /locus_tag="YPTB0044"
                     /gene_synonym="dnaS; sof"
                     /note="active site"
                     /db_xref="CDD:143638"
     gene            complement(57873..59087)
                     /gene="dfp"
                     /locus_tag="YPTB0045"
                     /db_xref="GeneID:2955455"
     CDS             complement(57873..59087)
                     /gene="dfp"
                     /locus_tag="YPTB0045"
                     /EC_number="4.1.1.36"
                     /EC_number="6.3.2.5"
                     /note="catalyzes the conjugation of cysteine to
                     4'-phosphopantothenate to form
                     4-phosphopantothenoylcysteine, which is then
                     decarboxylated to form 4'-phosphopantotheine"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase"
                     /protein_id="YP_068594.2"
                     /db_xref="GI:161760595"
                     /db_xref="GeneID:2955455"
                     /translation="MTGLSGKHIVLGISGGIAAYKSPELVRRLRDKGADVRVVMTHAA
                     KAFIAPLTLQAVSGYPVSDDLLDPAAEAAMGHIELGKWADLVIIAPATADLLARMAAG
                     MANDLLTTVCLATAAPIAAVPAMNQQMYRAPATQENLQTLSKWGVLLWGPDSGSQACG
                     DIGPGRMLDPQEIVALAYNHFSAKQDLQHLSVMITAGPTREPLDPVRFISNQSSGKMG
                     FAIAQALAARGSNVTLIAGPVNLSTPEGVKRIDVITALEMQQAVQKIAQQQNIFISCA
                     AVADYRAEHVSDEKIKKQGDEITLKLVKNPDIVAGVASMAKNRPFVVGFAAETQNVEE
                     YARQKLARKNLDLICANDVSLAEHGFNSDTNALHLFWSTGEKRLPLSDKYLLSQRLID
                     EIVSRYDEKNRH"
     misc_feature    complement(57888..59087)
                     /gene="dfp"
                     /locus_tag="YPTB0045"
                     /note="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase; Validated;
                     Region: PRK05579"
                     /db_xref="CDD:235513"
     misc_feature    complement(58545..59072)
                     /gene="dfp"
                     /locus_tag="YPTB0045"
                     /note="Flavoprotein; Region: Flavoprotein; cl19190"
                     /db_xref="CDD:267543"
     misc_feature    complement(57978..58529)
                     /gene="dfp"
                     /locus_tag="YPTB0045"
                     /note="DNA / pantothenate metabolizm flavoprotein; Region:
                     DFP; pfam04127"
                     /db_xref="CDD:252395"
     gene            59284..59952
                     /gene="radC"
                     /locus_tag="YPTB0046"
                     /db_xref="GeneID:2956398"
     CDS             59284..59952
                     /gene="radC"
                     /locus_tag="YPTB0046"
                     /note="Involved in DNA double-strand break repair and
                     recombination. Promotes the annealing of complementary
                     single-stranded DNA and by simulation of RAD51
                     recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="YP_068595.1"
                     /db_xref="GI:51594404"
                     /db_xref="GeneID:2956398"
                     /translation="MDEWYGQVAPREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKM
                     AEYLIETFGSLHGLISADYQTLCAHKGIGASKYSQIQAIGELACRCFSSHLMRESVLL
                     NPGITQKFLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
                     KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLVVGRGECVSFAE
                     RGWL"
     misc_feature    59284..59949
                     /gene="radC"
                     /locus_tag="YPTB0046"
                     /note="hypothetical protein; Reviewed; Region: PRK00024"
                     /db_xref="CDD:178801"
     misc_feature    59608..59934
                     /gene="radC"
                     /locus_tag="YPTB0046"
                     /note="Mov34/MPN/PAD-1 family; Region: MPN_DUF2466;
                     cd08071"
                     /db_xref="CDD:163702"
     misc_feature    order(59644..59646,59794..59796,59800..59802,59824..59826,
                     59833..59835)
                     /gene="radC"
                     /locus_tag="YPTB0046"
                     /note="MPN+ (JAMM) motif; other site"
                     /db_xref="CDD:163702"
     misc_feature    order(59794..59796,59800..59802,59833..59835)
                     /gene="radC"
                     /locus_tag="YPTB0046"
                     /note="Zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:163702"
     gene            60215..60451
                     /gene="rpmB"
                     /locus_tag="YPTB0047"
                     /db_xref="GeneID:2956511"
     CDS             60215..60451
                     /gene="rpmB"
                     /locus_tag="YPTB0047"
                     /note="required for 70S ribosome assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="YP_068596.1"
                     /db_xref="GI:51594405"
                     /db_xref="GeneID:2956511"
                     /translation="MSRVCQVTGKRPMSGNNRSHAMNATKRRFLPNLHSHRFWVEGEK
                     RFVTLRVSAKGMRVIDKKGIETVLAEIRARGEKY"
     misc_feature    60215..60442
                     /gene="rpmB"
                     /locus_tag="YPTB0047"
                     /note="50S ribosomal protein L28; Reviewed; Region: rpmB;
                     PRK00359"
                     /db_xref="CDD:234736"
     gene            60463..60630
                     /gene="rpmG"
                     /locus_tag="YPTB0048"
                     /db_xref="GeneID:2956516"
     CDS             60463..60630
                     /gene="rpmG"
                     /locus_tag="YPTB0048"
                     /note="in Escherichia coli BM108, a mutation that results
                     in lack of L33 synthesis had no effect on ribosome
                     synthesis or function; there are paralogous genes in
                     several bacterial genomes, and a CXXC motif for zinc
                     binding and an upstream regulation region of the paralog
                     lacking this motif that are regulated by zinc similar to
                     other ribosomal proteins like L31; the proteins in this
                     group lack the CXXC motif"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="YP_068597.1"
                     /db_xref="GI:51594406"
                     /db_xref="GeneID:2956516"
                     /translation="MAKGVREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVR
                     QHVLYKEAKIK"
     misc_feature    60463..60621
                     /gene="rpmG"
                     /locus_tag="YPTB0048"
                     /note="50S ribosomal protein L33; Validated; Region: rpmG;
                     PRK00595"
                     /db_xref="CDD:179075"
     gene            60713..61522
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /db_xref="GeneID:2956108"
     CDS             60713..61522
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /EC_number="3.2.2.23"
                     /note="Involved in base excision repair of DNA damaged by
                     oxidation or by mutagenic agents. Acts as DNA glycosylase
                     that recognizes and removes damaged bases"
                     /codon_start=1
                     /transl_table=11
                     /product="formamidopyrimidine-DNA glycosylase"
                     /protein_id="YP_068598.1"
                     /db_xref="GI:51594407"
                     /db_xref="GeneID:2956108"
                     /translation="MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWPVSDEILTL
                     SDQPVLSVQRRAKYLLLELPKGWIIIHLGMSGSLRVLSEETAAEKHDHVDLVVSNGKI
                     LRYTDPRRFGAWLWAKDLETSNVLAHLGPEPLSDEFTAQYLFDKSRNKRTLIKPWLMD
                     NKVVVGVGNIYASESLFAAGILPDRAAGSLTDAESVLLVATIKAVLLHSIEQGGTTLR
                     DFLQSDGKPGYFAQELQVYGRAGEPCRQCGHPIEIAKHGQRSTFFCRHCQH"
     misc_feature    60713..61519
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="formamidopyrimidine/5-formyluracil/
                     5-hydroxymethyluracil DNA glycosylase; Validated; Region:
                     PRK01103"
                     /db_xref="CDD:234899"
     misc_feature    60716..61060
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="N-terminal domain of Escherichia coli Fpg1/MutM and
                     related bacterial DNA glycosylases; Region: EcFpg-like_N;
                     cd08966"
                     /db_xref="CDD:176800"
     misc_feature    order(60716..60721,60881..60883,60923..60925,60929..60937,
                     60977..60982,61034..61045)
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176800"
     misc_feature    60716..60718
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:176800"
     misc_feature    order(60719..60730,60734..60739,60746..60748,60872..60883,
                     60935..60937)
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="H2TH interface [polypeptide binding]; other site"
                     /db_xref="CDD:176800"
     misc_feature    order(60719..60721,60881..60883)
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:176800"
     misc_feature    60923..60925
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="turnover-facilitating residue; other site"
                     /db_xref="CDD:176800"
     misc_feature    order(60932..60934,61037..61039,61043..61045)
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="intercalation triad [nucleotide binding]; other
                     site"
                     /db_xref="CDD:176800"
     misc_feature    60935..60937
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="8OG recognition residue [nucleotide binding]; other
                     site"
                     /db_xref="CDD:176800"
     misc_feature    order(60980..60982,61040..61042)
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="putative reading head residues; other site"
                     /db_xref="CDD:176800"
     misc_feature    61097..61372
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="Formamidopyrimidine-DNA glycosylase H2TH domain;
                     Region: H2TH; pfam06831"
                     /db_xref="CDD:115485"
     misc_feature    61433..61519
                     /gene="mutM"
                     /locus_tag="YPTB0049"
                     /gene_synonym="fpg"
                     /note="Zinc finger found in FPG and IleRS; Region:
                     zf-FPG_IleRS; pfam06827"
                     /db_xref="CDD:253933"
     gene            complement(61528..62007)
                     /gene="coaD"
                     /locus_tag="YPTB0050"
                     /gene_synonym="kdt"
                     /db_xref="GeneID:2955343"
     CDS             complement(61528..62007)
                     /gene="coaD"
                     /locus_tag="YPTB0050"
                     /gene_synonym="kdt"
                     /EC_number="2.7.7.3"
                     /note="Catalyzes the conversion of ATP and pantetheine
                     4'-phosphate to diphosphate and 3'-dephospho-coA"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="YP_068599.1"
                     /db_xref="GI:51594408"
                     /db_xref="GeneID:2955343"
                     /translation="MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKP
                     MFTLDERVALAKKVTALLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQL
                     ANMNRHLMPKLESVFLMPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA"
     misc_feature    complement(61540..61998)
                     /gene="coaD"
                     /locus_tag="YPTB0050"
                     /gene_synonym="kdt"
                     /note="Phosphopantetheine adenylyltransferase; Region:
                     PPAT; cd02163"
                     /db_xref="CDD:173914"
     misc_feature    complement(order(61627..61629,61636..61638,61648..61650,
                     61690..61692,61702..61704,61711..61716,61735..61737,
                     61741..61746,61786..61794,61882..61884,61897..61899,
                     61945..61947,61954..61959,61975..61989))
                     /gene="coaD"
                     /locus_tag="YPTB0050"
                     /gene_synonym="kdt"
                     /note="active site"
                     /db_xref="CDD:173914"
     misc_feature    complement(61954..61965)
                     /gene="coaD"
                     /locus_tag="YPTB0050"
                     /gene_synonym="kdt"
                     /note="(T/H)XGH motif; other site"
                     /db_xref="CDD:173914"
     gene            complement(62004..62786)
                     /gene="kdtX"
                     /locus_tag="YPTB0051"
                     /gene_synonym="waaE"
                     /db_xref="GeneID:2955921"
     CDS             complement(62004..62786)
                     /gene="kdtX"
                     /locus_tag="YPTB0051"
                     /gene_synonym="waaE"
                     /note="similar to Yersinia pestis YPO0054 kdtX, waaE;
                     lipopolysaccharide core biosynthesis glycosyl transferase
                     (100% evalue=1.E-149); Vibrio cholerae VC0224
                     lipopolysaccharide biosynthesis glycosyltransferase,
                     (52.2% evalue=6.E-66)"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide core biosynthesis glycosyl
                     transferase"
                     /protein_id="YP_068600.1"
                     /db_xref="GI:51594409"
                     /db_xref="GeneID:2955921"
                     /translation="MGTKKRLSVVMITKNEASLLTDCLASVAWADEIIVLDSGSEDET
                     RALAQQFGAKVYSNINWPGYGKQRQLAQQYASGDYILMLDADERVTPELKIAIESVLL
                     APEEGAVYSCSRRNLFLGRFMRHSGWYPDRVTRLYPHHQYRYNDNLVHESLDSGSAKV
                     IPLAGDLLHLTCRDFFAFQRKQLSYAEAWAIQRHQQGKSCSYFAILSHTLGAFSKTWL
                     LRAGFLDGKQGLLLAVVNAQYTFNKYAALWALSHQYQKSEKS"
     misc_feature    complement(62031..62777)
                     /gene="kdtX"
                     /locus_tag="YPTB0051"
                     /gene_synonym="waaE"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    complement(62088..62771)
                     /gene="kdtX"
                     /locus_tag="YPTB0051"
                     /gene_synonym="waaE"
                     /note="UDP-glucose LOS-beta-1,4 glucosyltransferase is
                     required for biosynthesis of lipooligosaccharide; Region:
                     Beta4Glucosyltransferase; cd02511"
                     /db_xref="CDD:133005"
     misc_feature    complement(order(62529..62531,62535..62537))
                     /gene="kdtX"
                     /locus_tag="YPTB0051"
                     /gene_synonym="waaE"
                     /note="putative metal binding site; other site"
                     /db_xref="CDD:133005"
     gene            complement(62787..64064)
                     /gene="kdtA"
                     /locus_tag="YPTB0052"
                     /gene_synonym="waaA"
                     /db_xref="GeneID:2955920"
     CDS             complement(62787..64064)
                     /gene="kdtA"
                     /locus_tag="YPTB0052"
                     /gene_synonym="waaA"
                     /note="catalyzes the transfer of
                     2-keto-3-deoxy-D-manno-octulosonic acid to lipid A"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic-acid transferase"
                     /protein_id="YP_068601.1"
                     /db_xref="GI:51594410"
                     /db_xref="GeneID:2955920"
                     /translation="MLLRLYQVLLYLIQPLIWLRLLLRSRKAPAYRKRWGERYGFCAG
                     KVVAGGIMLHSVSVGETLAAIPLVRALRHRYPSLPITVTTMTPTGSERVQSAFGKDVH
                     HVYLPYDLPGSVNRFLDQVNPKLVIIMETELWPNLINTLHRRKIPLVIANARLSARSA
                     AGYKKIGSFIRTILQRITLIAAQNQEDGDRFIELGLKRSQLTVTGSLKFDISVTPELA
                     ARAVTLRRQWAPHRPVWIATSTHDGEETILLEAHRQLLQQFPTLLLILVPRHPERFGK
                     AVELTQKIGLSYTLRSKGEVPSSSTQVVIGDTMGELMLLYGIADLAFVGGSLVERGGH
                     NPLEAAAHAIPVLMGPHTFNFKDICAKLEQAEGLITVTDTLSLVKEITVLLTDEDCRL
                     YYGRHAVDVLHENQGALQRLLHLLEPYLPQRSH"
     misc_feature    complement(62793..64064)
                     /gene="kdtA"
                     /locus_tag="YPTB0052"
                     /gene_synonym="waaA"
                     /note="3-deoxy-D-manno-octulosonic-acid transferase;
                     Reviewed; Region: PRK05749"
                     /db_xref="CDD:235589"
     misc_feature    complement(63426..63974)
                     /gene="kdtA"
                     /locus_tag="YPTB0052"
                     /gene_synonym="waaA"
                     /note="3-Deoxy-D-manno-octulosonic-acid transferase
                     (kdotransferase); Region: Glycos_transf_N; pfam04413"
                     /db_xref="CDD:252580"
     misc_feature    complement(62871..63323)
                     /gene="kdtA"
                     /locus_tag="YPTB0052"
                     /gene_synonym="waaA"
                     /note="Glycosyl transferases group 1; Region:
                     Glycos_transf_1; cl19138"
                     /db_xref="CDD:267491"
     gene            complement(64484..65449)
                     /gene="rfaC"
                     /locus_tag="YPTB0053"
                     /gene_synonym="rfa-2; waaC"
                     /db_xref="GeneID:2956426"
     CDS             complement(64484..65449)
                     /gene="rfaC"
                     /locus_tag="YPTB0053"
                     /gene_synonym="rfa-2; waaC"
                     /note="similar to Yersinia pestis YPO0056 rfaC, waaC,
                     rfa-2; lipopolysaccharide heptosyltransferase-1 (100%
                     evalue=0); Escherichia coli b3621 rfaC, rfa-2;
                     lipopolysaccharide heptosyltransferase-1 (68.3%
                     evalue=1.E-127)"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose--LPS heptosyltransferase"
                     /protein_id="YP_068602.1"
                     /db_xref="GI:51594411"
                     /db_xref="GeneID:2956426"
                     /translation="MHVLIVKTSSMGDVLHTLPALTDAMNAIPGIRFDWVVEEGFSQI
                     PSWHPAVDKVIPVAIRRWRKNWFGSDTRQERCDFKRVVQQRSYDRVIDAQGLIKSAAL
                     ITRIAKGTKHGPDCKSAREPFASWFYNCRHEIDTKQHAVERIRQLFAKSLGYDKPESY
                     GDYAIAQRFLNQLPADAGQYLVFLHATTRDNKHWPESHWVQLIELVQPTGLKIKLPWG
                     AEHEHQRALRLAEHFPHVEVLPKLSLQQVAEVLAGAKAVVSVDTGLSHLTAALDRPNI
                     TLFGPTDPGLIGGYGKNQIAVISEQKKMDSLSAPTIMARLETLIS"
     misc_feature    complement(64553..65443)
                     /gene="rfaC"
                     /locus_tag="YPTB0053"
                     /gene_synonym="rfa-2; waaC"
                     /note="Lipopolysaccharide heptosyltransferase is involved
                     in the biosynthesis of lipooligosaccharide (LOS).
                     Lipopolysaccharide (LPS) is a major component of the outer
                     membrane of gram-negative bacteria. LPS
                     heptosyltransferase transfers heptose molecules from...;
                     Region: GT1_LPS_heptosyltransferase; cd03789"
                     /db_xref="CDD:99964"
     misc_feature    complement(order(64649..64651,64658..64663,64670..64672,
                     64706..64711,64802..64804,64895..64900))
                     /gene="rfaC"
                     /locus_tag="YPTB0053"
                     /gene_synonym="rfa-2; waaC"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            complement(65449..66513)
                     /gene="rfaF"
                     /locus_tag="YPTB0054"
                     /gene_synonym="waaF"
                     /db_xref="GeneID:2956429"
     CDS             complement(65449..66513)
                     /gene="rfaF"
                     /locus_tag="YPTB0054"
                     /gene_synonym="waaF"
                     /note="catalyzes the transfer of the second heptose to the
                     heptosyl-KDO2 moiety of the lipopolysaccharide inner core"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose--LPS heptosyltransferase"
                     /protein_id="YP_068603.1"
                     /db_xref="GI:51594412"
                     /db_xref="GeneID:2956429"
                     /translation="MKILVIGPSWVGDMMMSQSLYRTLKAEYPAADIDVMAPAWCRPL
                     LARMPEVRHAIPMPLGHGAFAFEERRRLGLALRETEYDRAYVLPNSFKSALIPYFSGI
                     KRRIGWRGEMRYFLLNDLRILDKQAFPMMVQRYVALAYDKERIRSAADLPQPLLWPQL
                     QVRDEEIAETTASFNLTDNRPIIGFCPGAEFGPAKRWPHYHYATLAQKLIDDGYQVVL
                     FGSAKDNEAGEDIRQALSDTDREYCLNLAGQTSLEQAVVLIAACSAVVSNDSGLMHVA
                     AALNKPLVALYGPSSPDFTPPLSEKATVIRLITGYHKVRKGDSAQGYHQSLIDIQPEH
                     VMAALEKQLATQECSVKGGD"
     misc_feature    complement(65491..66510)
                     /gene="rfaF"
                     /locus_tag="YPTB0054"
                     /gene_synonym="waaF"
                     /note="Lipopolysaccharide heptosyltransferase is involved
                     in the biosynthesis of lipooligosaccharide (LOS).
                     Lipopolysaccharide (LPS) is a major component of the outer
                     membrane of gram-negative bacteria. LPS
                     heptosyltransferase transfers heptose molecules from...;
                     Region: GT1_LPS_heptosyltransferase; cd03789"
                     /db_xref="CDD:99964"
     misc_feature    complement(order(65689..65691,65698..65703,65710..65712,
                     65746..65751,65857..65859,65956..65961))
                     /gene="rfaF"
                     /locus_tag="YPTB0054"
                     /gene_synonym="waaF"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            complement(66544..67476)
                     /gene="rfaD"
                     /locus_tag="YPTB0055"
                     /gene_synonym="htrM"
                     /db_xref="GeneID:2956427"
     CDS             complement(66544..67476)
                     /gene="rfaD"
                     /locus_tag="YPTB0055"
                     /gene_synonym="htrM"
                     /EC_number="5.1.3.20"
                     /note="catalyzes the interconversion between
                     ADP-D-glycero-beta-D-manno-heptose and
                     ADP-L-glycero-beta-D-manno-heptose"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
                     /protein_id="YP_068604.1"
                     /db_xref="GI:51594413"
                     /db_xref="GeneID:2956427"
                     /translation="MIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNLVD
                     LDIADYMDKEDFVASIVAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILH
                     FCLDRSIPFLYASSAATYGGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADS
                     QICGFRYFNVYGPREGHKGSMASVAFHLNNQINAGERPKLFAGSENFKRDFIYVGDVA
                     DVNLWFWQNGVSGIFNCGTGRAESFQAVADAVVDYHQSGPVEYIEFPEKLKGRYQAYT
                     QADLTKLRAAGYGKPFKTVAEGVKEYLAWLNRSV"
     misc_feature    complement(66553..67476)
                     /gene="rfaD"
                     /locus_tag="YPTB0055"
                     /gene_synonym="htrM"
                     /note="ADP-L-glycero-D-mannoheptose 6-epimerase (GME),
                     extended (e) SDRs; Region: ADP_GME_SDR_e; cd05248"
                     /db_xref="CDD:187559"
     misc_feature    complement(66553..67476)
                     /gene="rfaD"
                     /locus_tag="YPTB0055"
                     /gene_synonym="htrM"
                     /note="ADP-L-glycero-D-mannoheptose-6-epimerase;
                     Provisional; Region: rfaD; PRK11150"
                     /db_xref="CDD:182998"
     misc_feature    complement(order(66943..66948,66967..66969,66973..66978,
                     67045..67047,67057..67059,67129..67137,67189..67191,
                     67201..67203,67213..67215,67240..67242,67246..67254,
                     67318..67320,67363..67365,67381..67389,67444..67452,
                     67459..67464))
                     /gene="rfaD"
                     /locus_tag="YPTB0055"
                     /gene_synonym="htrM"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187559"
     misc_feature    complement(order(67018..67020,67027..67032,67039..67041,
                     67051..67053,67060..67074,67084..67086,67183..67185,
                     67195..67197,67207..67209,67216..67227,67321..67323,
                     67327..67344,67348..67353,67360..67362,67366..67371,
                     67375..67380))
                     /gene="rfaD"
                     /locus_tag="YPTB0055"
                     /gene_synonym="htrM"
                     /note="homopentamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187559"
     misc_feature    complement(order(66748..66750,66850..66852,66916..66918,
                     66925..66927,66931..66939,66970..66972,67234..67236))
                     /gene="rfaD"
                     /locus_tag="YPTB0055"
                     /gene_synonym="htrM"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187559"
     misc_feature    complement(order(67045..67047,67057..67059,67129..67131,
                     67198..67200))
                     /gene="rfaD"
                     /locus_tag="YPTB0055"
                     /gene_synonym="htrM"
                     /note="active site"
                     /db_xref="CDD:187559"
     gene            67722..68933
                     /gene="kbl"
                     /locus_tag="YPTB0056"
                     /db_xref="GeneID:2955909"
     CDS             67722..68933
                     /gene="kbl"
                     /locus_tag="YPTB0056"
                     /EC_number="2.3.1.29"
                     /note="catalyzes the formation of 2-amino-3-oxobutanoate
                     from acetyl-CoA and glycine"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-3-ketobutyrate CoA ligase"
                     /protein_id="YP_068605.1"
                     /db_xref="GI:51594414"
                     /db_xref="GeneID:2955909"
                     /translation="MSLPCNKHPFYQQLEQQLDTTRTEGLYKNERVITSAQQANIAVA
                     DGSRVINFCANNYLGLANHPKLIAAAKAGMDSHGFGMASVRFICGTQDIHKELEHKLA
                     SFLGMEDAILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKAKRYRYAN
                     NDMTELEAQLKQAKAEGARHIMIATDGVFSMDGVIANLKRVCDLADEYQALVMVDDSH
                     AVGVIGANGRGTHEYCEVMDRVDIITGTLGKALGGASGGYTAGRKELVEWLRQRSRPY
                     LFSNSLAPAIVAASIEVLSLLEEGGALRDRLWANARLFREKMSAAGFTLAGADHAIIP
                     VMLGEAKLAQDFANALLKEGIYVTGFFFPVVPKGQARIRTQMSAGHTTEQVERAIEAF
                     VRIGKQLNVIA"
     misc_feature    67818..68897
                     /gene="kbl"
                     /locus_tag="YPTB0056"
                     /note="8-amino-7-oxononanoate synthase; Region: bioF;
                     TIGR00858"
                     /db_xref="CDD:129937"
     misc_feature    67860..68909
                     /gene="kbl"
                     /locus_tag="YPTB0056"
                     /note="KBL_like; this family belongs to the pyridoxal
                     phosphate (PLP)-dependent aspartate aminotransferase
                     superfamily (fold I). The major groups in this CD
                     corresponds to serine palmitoyltransferase (SPT),
                     5-aminolevulinate synthase (ALAS); Region: KBL_like;
                     cd06454"
                     /db_xref="CDD:99747"
     misc_feature    order(67884..67886,68064..68072,68142..68144,68277..68279,
                     68289..68294,68364..68366,68370..68375,68457..68459,
                     68466..68468,68838..68840)
                     /gene="kbl"
                     /locus_tag="YPTB0056"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99747"
     misc_feature    order(68064..68072,68142..68144,68277..68279,68289..68291,
                     68364..68366,68370..68375,68457..68459,68466..68468)
                     /gene="kbl"
                     /locus_tag="YPTB0056"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99747"
     misc_feature    68466..68468
                     /gene="kbl"
                     /locus_tag="YPTB0056"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99747"
     gene            68943..69968
                     /gene="tdh"
                     /locus_tag="YPTB0057"
                     /db_xref="GeneID:2956673"
     CDS             68943..69968
                     /gene="tdh"
                     /locus_tag="YPTB0057"
                     /EC_number="1.1.1.103"
                     /note="converts threonine and NAD to
                     1,2-amino-3-oxobutanoate and NADH; functions in threonine
                     catabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonine 3-dehydrogenase"
                     /protein_id="YP_068606.1"
                     /db_xref="GI:51594415"
                     /db_xref="GeneID:2956673"
                     /translation="MKALSKLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHI
                     YNWDEWSQKTIPVPMVVGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGG
                     RTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSF
                     DLVGEDVLVSGAGPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVNVSKE
                     NLNDVMTELGMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRIAMLGIPPSDMSIDWNQV
                     IFKGLFIKGIYGREMFETWYKMAALIQSGLDLTPIITHRFPIDEFQQGFDAMRSGKSG
                     KVVLSWD"
     misc_feature    68943..69965
                     /gene="tdh"
                     /locus_tag="YPTB0057"
                     /note="L-threonine 3-dehydrogenase; Validated; Region:
                     tdh; PRK05396"
                     /db_xref="CDD:180054"
     misc_feature    68943..69956
                     /gene="tdh"
                     /locus_tag="YPTB0057"
                     /note="Medium chain reductase/dehydrogenase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR; cl16912"
                     /db_xref="CDD:266485"
     misc_feature    order(69054..69062,69069..69071,69384..69386,69396..69398,
                     69453..69470,69525..69530,69540..69542,69585..69587,
                     69657..69662,69726..69731,69798..69806)
                     /gene="tdh"
                     /locus_tag="YPTB0057"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176178"
     gene            complement(70106..71116)
                     /gene="yibQ"
                     /locus_tag="YPTB0058"
                     /db_xref="GeneID:2957073"
     CDS             complement(70106..71116)
                     /gene="yibQ"
                     /locus_tag="YPTB0058"
                     /note="similar to Salmonella typhi STY4089  exported
                     protein (63.6% evalue=1.E-106); Salmonella typhimurium
                     STM3706 yigQ; periplasmic protein (64% evalue=1.E-105)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068607.1"
                     /db_xref="GI:51594416"
                     /db_xref="GeneID:2957073"
                     /translation="MRYFNTRQFIIVSTLFIASTAQAGKLSIVIDDFGYRPQNENKIL
                     QMPLPISVAILPNAPYAREMATKAHNQGREILIHLPMAPQSKQPLERDTLQPSMSSEE
                     IQRIIRQAANNVPYAKGMNNHMGSAMTASLPGMQKVMQALGSYQLYFLDSVTIGNSQA
                     SKAAEGTGVKVIKRKIFLDDSQNEAAIRQQFNRAVALARRNGSAIAIGHPHPATIKVL
                     QQMLPQLPADIVLVRPSALLNEPVQSLSPDKTKPREPVKGQRLPAIKQCKAKASYVPE
                     KIYADKLFILLGESLMQNPAVIFIQQHWQQYFTPAPPATPIDEQKAIENTEKLPPKKA
                     AQ"
     misc_feature    complement(70406..71044)
                     /gene="yibQ"
                     /locus_tag="YPTB0058"
                     /note="Putative catalytic domain of family 2
                     polysaccharide deacetylases (DACs) from bacteria; Region:
                     CE4_DAC2; cd10936"
                     /db_xref="CDD:200562"
     misc_feature    complement(order(70490..70492,70496..70498,70661..70663,
                     70748..70750,70754..70756,70871..70885,71021..71032))
                     /gene="yibQ"
                     /locus_tag="YPTB0058"
                     /note="NodB motif; other site"
                     /db_xref="CDD:200562"
     misc_feature    complement(order(70490..70492,70742..70750,70883..70885,
                     71021..71026))
                     /gene="yibQ"
                     /locus_tag="YPTB0058"
                     /note="putative active site [active]"
                     /db_xref="CDD:200562"
     misc_feature    complement(order(70490..70492,71024..71026))
                     /gene="yibQ"
                     /locus_tag="YPTB0058"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:200562"
     misc_feature    complement(order(70748..70750,70883..70885,71021..71023))
                     /gene="yibQ"
                     /locus_tag="YPTB0058"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:200562"
     gene            complement(71140..72510)
                     /locus_tag="YPTB0059"
                     /db_xref="GeneID:2953057"
     CDS             complement(71140..72510)
                     /locus_tag="YPTB0059"
                     /note="similar to Yersinia pestis YPO0063  membrane
                     protein (99.5% evalue=0); Salmonella typhimurium STM3705
                     yibP; paral  membrane protein (65.7% evalue=1.E-150)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068608.2"
                     /db_xref="GI:161760594"
                     /db_xref="GeneID:2953057"
                     /translation="MKDRELLAKSITTKDAVSDGRESPSLLSDKLSRLPWSTLYASVF
                     CAGVLLLPFSGQAVEPPVAAKASENKNQLKTLQQDIAEKEKSVQQQKKQRSSLLDQLK
                     QQENTISQTSRSLRETQATLAELSKDIASLTTSIEKLQNQQSQQQSILSKQLAAAFKQ
                     GKHSSLQLILSGEESQRSERILAYFSYLNEARQKAIEELKQTRTTLSAEKKMLEQKQN
                     QHKALLDEQKAQQQKLEQARIARQKTLTSLEASLEKDQQSLAELKLNESRLRDQIAKA
                     EREAKARAEREAKEAARVREQVKVKEQQAKKTGSSYKPSESERSLMARTGGLGRPGGQ
                     ALWPVRGNVSHRFGEPLQGELRWKGMVITAPEGSEVKAIADGRVLLADWLQGYGLVVV
                     IEHGKGDMSLYGYNQSALVNVGAQVKAGQPIALVGTSGGQGEPSLYFEIRRQGQAVNP
                     QPWLGR"
     misc_feature    complement(71143..72510)
                     /locus_tag="YPTB0059"
                     /note="AmiB activator; Provisional; Region: PRK11637"
                     /db_xref="CDD:236942"
     misc_feature    complement(71590..>71916)
                     /locus_tag="YPTB0059"
                     /note="F0F1 ATP synthase subunit B; Provisional; Region:
                     PRK14471; cl17192"
                     /db_xref="CDD:266543"
     misc_feature    complement(71161..71442)
                     /locus_tag="YPTB0059"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            complement(72520..74067)
                     /locus_tag="YPTB0060"
                     /db_xref="GeneID:2953058"
     CDS             complement(72520..74067)
                     /locus_tag="YPTB0060"
                     /EC_number="5.4.2.1"
                     /note="catalyzes the interconversion of 2-phosphoglycerate
                     and 3-phosphoglycerate"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglyceromutase"
                     /protein_id="YP_068609.1"
                     /db_xref="GI:51594418"
                     /db_xref="GeneID:2953058"
                     /translation="MSSTKKPLVLTILDGYGHREEQQDNAILNAKTPVMDVLWQQQPH
                     TLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEGDFFTNPTLTAA
                     VDNAVKTGKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPR
                     SAESSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTADN
                     AVAGLQAAYARGENDEFVKPTVIQATGEADAAMNEGDTLIFMNFRADRARQITRTFVN
                     ADFDGFKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISE
                     TEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGK
                     YDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAE
                     QMRDPATGQAHTAHTSLPVPLIYVGNKAVKAVEGGKLSDIAPTMLSLMEMEIPQEMTG
                     KPLFIVE"
     misc_feature    complement(72529..74064)
                     /locus_tag="YPTB0060"
                     /note="phosphoglyceromutase; Provisional; Region:
                     PRK05434"
                     /db_xref="CDD:235463"
     gene            74465..74899
                     /locus_tag="YPTB0061"
                     /db_xref="GeneID:2953059"
     CDS             74465..74899
                     /locus_tag="YPTB0061"
                     /note="similar to Yersinia pestis YPO0065  membrane
                     protein (100% evalue=1.E-76); Salmonella typhi STY4092
                     secreted protein (67.8% evalue=2.E-52)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068610.1"
                     /db_xref="GI:51594419"
                     /db_xref="GeneID:2953059"
                     /translation="MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRG
                     EATRLINKEDAVVVDIRTREDYRKGHIANSINLIPSDIKNGNLGELEKHKTQPIIVVC
                     AMGTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK"
     misc_feature    74597..74863
                     /locus_tag="YPTB0061"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    74768..74770
                     /locus_tag="YPTB0061"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     misc_feature    74501..74557
                     /locus_tag="YPTB0061"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            75018..75266
                     /gene="grxC"
                     /locus_tag="YPTB0062"
                     /db_xref="GeneID:2955749"
     CDS             75018..75266
                     /gene="grxC"
                     /locus_tag="YPTB0062"
                     /note="similar to Yersinia pestis YPO0066 grxC;
                     glutaredoxin (100% evalue=3.E-43); Salmonella typhi
                     STY4093 grxC; glutaredoxin 3 (85.3% evalue=5.E-36)"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin 3"
                     /protein_id="YP_068611.1"
                     /db_xref="GI:51594420"
                     /db_xref="GeneID:2955749"
                     /translation="MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEM
                     IARSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDPLL"
     misc_feature    75024..75245
                     /gene="grxC"
                     /locus_tag="YPTB0062"
                     /note="Glutaredoxin (GRX) family, GRX bacterial class 1
                     and 3 (b_1_3)-like subfamily; composed of bacterial GRXs,
                     approximately 10 kDa in size, and proteins containing a
                     GRX or GRX-like domain. GRX is a glutathione (GSH)
                     dependent reductase, catalyzing the...; Region:
                     GRX_GRXb_1_3_like; cd03418"
                     /db_xref="CDD:239510"
     misc_feature    order(75042..75044,75051..75059,75171..75176)
                     /gene="grxC"
                     /locus_tag="YPTB0062"
                     /note="GSH binding site [chemical binding]; other site"
                     /db_xref="CDD:239510"
     misc_feature    order(75051..75053,75060..75062)
                     /gene="grxC"
                     /locus_tag="YPTB0062"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239510"
     gene            75354..75830
                     /gene="secB"
                     /locus_tag="YPTB0063"
                     /db_xref="GeneID:2956582"
     CDS             75354..75830
                     /gene="secB"
                     /locus_tag="YPTB0063"
                     /note="molecular chaperone that is required for the normal
                     export of envelope proteins out of the cell cytoplasm; in
                     Escherichia coli this proteins forms a homotetramer in the
                     cytoplasm and delivers proteins to be exported to SecA"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecB"
                     /protein_id="YP_068612.1"
                     /db_xref="GI:51594421"
                     /db_xref="GeneID:2956582"
                     /translation="MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDL
                     DTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYC
                     PNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA"
     misc_feature    75384..75770
                     /gene="secB"
                     /locus_tag="YPTB0063"
                     /note="Preprotein translocase subunit SecB. SecB is a
                     cytoplasmic component of the multisubunit membrane-bound
                     enzyme termed Sec protein translocase, which is the main
                     constituent of the General Secretory (type II) Pathway
                     involved in translocation of nascent...; Region:
                     Translocase_SecB; cd00557"
                     /db_xref="CDD:238312"
     misc_feature    order(75411..75413,75423..75425,75576..75578,75582..75584)
                     /gene="secB"
                     /locus_tag="YPTB0063"
                     /note="SecA binding site; other site"
                     /db_xref="CDD:238312"
     misc_feature    order(75573..75575,75579..75581,75585..75587,75591..75593)
                     /gene="secB"
                     /locus_tag="YPTB0063"
                     /note="Preprotein binding site; other site"
                     /db_xref="CDD:238312"
     gene            75830..76849
                     /gene="gpsA"
                     /locus_tag="YPTB0064"
                     /db_xref="GeneID:2955741"
     CDS             75830..76849
                     /gene="gpsA"
                     /locus_tag="YPTB0064"
                     /EC_number="1.1.1.94"
                     /note="catalyzes the NAD(P)H-dependent reduction of
                     glycerol 3-phosphate to glycerone phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase"
                     /protein_id="YP_068613.1"
                     /db_xref="GI:51594422"
                     /db_xref="GeneID:2955741"
                     /translation="MNTNPASMAVIGAGSYGTALAITLARNGHQVVLWGHDPKHIQQL
                     QQDRCNRAFLPDAAFPDTLRLETDLACALAASRDVLVVVPSHVFGAVLHQLKPHLRKD
                     ARIVWATKGLEAETGRLLQDVAREVLGEAIPLAVISGPTFAKELAAGLPTAIALASTD
                     VQFSEDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTAL
                     ITRGLAEMTRLGTALGADPSTFMGMAGLGDLVLTCTDNQSRNRRFGIMLGQGLGVKEA
                     QDNIGQVVEGYRNTKEVLALAQRHGVEMPITEQIYQVLYCHKNAREAALTLLGRTKKD
                     EKIGI"
     misc_feature    75845..76819
                     /gene="gpsA"
                     /locus_tag="YPTB0064"
                     /note="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase; Validated; Region: gpsA; PRK00094"
                     /db_xref="CDD:234629"
     misc_feature    75848..76318
                     /gene="gpsA"
                     /locus_tag="YPTB0064"
                     /note="NAD-dependent glycerol-3-phosphate dehydrogenase
                     N-terminus; Region: NAD_Gly3P_dh_N; pfam01210"
                     /db_xref="CDD:250446"
     misc_feature    76376..76810
                     /gene="gpsA"
                     /locus_tag="YPTB0064"
                     /note="NAD-dependent glycerol-3-phosphate dehydrogenase
                     C-terminus; Region: NAD_Gly3P_dh_C; pfam07479"
                     /db_xref="CDD:254224"
     gene            76909..77049
                     /locus_tag="YPTB0065"
                     /db_xref="GeneID:2953060"
     CDS             76909..77049
                     /locus_tag="YPTB0065"
                     /note="similar to Yersinia pestis YPO0069 hypothetical
                     protein."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068614.1"
                     /db_xref="GI:51594423"
                     /db_xref="GeneID:2953060"
                     /translation="MELQQGSKRAYPDELIHVSDSGGREPLTLIITKSIVTIINRNSA
                     TA"
     gene            77115..77936
                     /gene="cysE"
                     /locus_tag="YPTB0066"
                     /db_xref="GeneID:2955402"
     CDS             77115..77936
                     /gene="cysE"
                     /locus_tag="YPTB0066"
                     /EC_number="2.3.1.30"
                     /note="catalyzes the O-acetylation of serine"
                     /codon_start=1
                     /transl_table=11
                     /product="serine acetyltransferase"
                     /protein_id="YP_068615.1"
                     /db_xref="GI:51594424"
                     /db_xref="GeneID:2955402"
                     /translation="MSSEELEQVWSNIKSEARALAECEPMLASFFHATLLKHENLGSA
                     LSYILANKLANPIMPAIAIREVVEEAYRSDAHMIVSAARDILAVRLRDPAVDKYSTPL
                     LYLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHAT
                     GIVIGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGA
                     KIGAGSVVLQSVPAHTTAAGVPARIVGKPESDKPSLDMDQHFNGSIQGFEYGDGI"
     misc_feature    77115..77933
                     /gene="cysE"
                     /locus_tag="YPTB0066"
                     /note="serine acetyltransferase; Provisional; Region:
                     cysE; PRK11132"
                     /db_xref="CDD:182987"
     misc_feature    77139..77453
                     /gene="cysE"
                     /locus_tag="YPTB0066"
                     /note="Serine acetyltransferase, N-terminal; Region:
                     SATase_N; pfam06426"
                     /db_xref="CDD:253722"
     misc_feature    77532..77834
                     /gene="cysE"
                     /locus_tag="YPTB0066"
                     /note="Serine acetyltransferase (SAT): SAT catalyzes the
                     CoA-dependent acetylation of the side chain hydroxyl group
                     of L-serine to form O-acetylserine, as the first step of a
                     two-step biosynthetic pathway in bacteria and plants
                     leading to the formation of...; Region: LbH_SAT; cd03354"
                     /db_xref="CDD:100045"
     misc_feature    order(77535..77537,77541..77543,77586..77588,77688..77690,
                     77778..77780,77787..77789,77793..77795)
                     /gene="cysE"
                     /locus_tag="YPTB0066"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100045"
     misc_feature    order(77583..77588,77643..77648,77664..77669,77688..77693,
                     77724..77726,77769..77771,77775..77780,77787..77789,
                     77793..77795,77817..77819,77832..77834)
                     /gene="cysE"
                     /locus_tag="YPTB0066"
                     /note="active site"
                     /db_xref="CDD:100045"
     misc_feature    order(77583..77588,77664..77666,77688..77693)
                     /gene="cysE"
                     /locus_tag="YPTB0066"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100045"
     misc_feature    order(77643..77648,77664..77669,77724..77726,77769..77771,
                     77775..77780,77787..77789,77793..77795,77817..77819,
                     77832..77834)
                     /gene="cysE"
                     /locus_tag="YPTB0066"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100045"
     gene            complement(78059..78547)
                     /locus_tag="YPTB0067"
                     /db_xref="GeneID:2953061"
     CDS             complement(78059..78547)
                     /locus_tag="YPTB0067"
                     /note="similar to Yersinia pestis YPO0071
                     methyltransferase (99.3% evalue=1.E-90); Escherichia coli
                     JW3581 yibK; Hypothetical tRNA/rRNA methyltransferase
                     (79.6% evalue=2.E-71)"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_068616.1"
                     /db_xref="GI:51594425"
                     /db_xref="GeneID:2953061"
                     /translation="MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRL
                     RRAGLDYHEFADIKHHHDYQAFLDSEKLDSTQLARLFALTTKGTPAHSAVSYQANDYL
                     LFGPETRGLPAYILDALPAQQKIRIPMQADSRSMNLSNAVSVVVYEAWRQLGYPGALL
                     KE"
     misc_feature    complement(78065..78547)
                     /locus_tag="YPTB0067"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     cl17307"
                     /db_xref="CDD:266618"
     gene            78736..79800
                     /locus_tag="YPTB0068"
                     /db_xref="GeneID:2953062"
     CDS             78736..79800
                     /locus_tag="YPTB0068"
                     /EC_number="2.1.1.63"
                     /note="similar to Yersinia pestis YPO0072 bifunctional
                     regulatory protein/DNA repair protein (98.5% evalue=0);
                     Ralstonia solanacearum RS00768 ada, RSc2570;
                     methylated-DNA-protein-cysteine methyltransferase
                     O-6-methylguanine-DNA transcription regulator (64.8%
                     evalue=1.E-127)"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional regulatory protein/DNA repair
                     protein"
                     /protein_id="YP_068617.1"
                     /db_xref="GI:51594426"
                     /db_xref="GeneID:2953062"
                     /translation="MNNVKDPRWAAIINRDKTADGQFVYAVKTTSIYCRPSCPSRRAK
                     AEHIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQVEKISQACRLIELAETPPKLNEL
                     AAQLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSS
                     RFYAQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVQ
                     LVQQLQDKFPQANLVGGDAEFEQWVAQVVGCVEAPKLGLGLPLDIRGTAFQQRVWQAL
                     REIPIGETASYADIASRIGSPTAVRAVAGACAANILAVAIPCHRVIRQDGALSGYRWG
                     VERKRLLLERESVEKEAEDH"
     misc_feature    78751..79785
                     /locus_tag="YPTB0068"
                     /note="bifunctional DNA-binding transcriptional dual
                     regulator/O6-methylguanine-DNA methyltransferase;
                     Provisional; Region: PRK15435"
                     /db_xref="CDD:185333"
     misc_feature    78751..78948
                     /locus_tag="YPTB0068"
                     /note="Metal binding domain of Ada; Region:
                     Ada_Zn_binding; pfam02805"
                     /db_xref="CDD:251541"
     misc_feature    79000..79113
                     /locus_tag="YPTB0068"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    79144..79272
                     /locus_tag="YPTB0068"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    79288..79524
                     /locus_tag="YPTB0068"
                     /note="6-O-methylguanine DNA methyltransferase,
                     ribonuclease-like domain; Region: Methyltransf_1N;
                     pfam02870"
                     /db_xref="CDD:251580"
     misc_feature    79537..79770
                     /locus_tag="YPTB0068"
                     /note="The DNA repair protein O6-alkylguanine-DNA
                     alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
                     reverses O6-alkylation DNA damage by transferring O6-alkyl
                     adducts to an active site cysteine irreversibly, without
                     inducing DNA strand breaks. ATases...; Region: ATase;
                     cd06445"
                     /db_xref="CDD:119438"
     misc_feature    order(79537..79542,79594..79599,79621..79623,79630..79632,
                     79636..79641,79645..79647,79654..79659,79663..79665,
                     79687..79689,79702..79704,79723..79725)
                     /locus_tag="YPTB0068"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119438"
     misc_feature    order(79594..79596,79687..79692,79696..79698,79768..79770)
                     /locus_tag="YPTB0068"
                     /note="active site"
                     /db_xref="CDD:119438"
     gene            complement(79868..81244)
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /db_xref="GeneID:2955353"
     CDS             complement(79868..81244)
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /EC_number="2.7.3.-"
                     /note="part of two-component CpxA/CpxR system; senses
                     envelope stress; upregulates a number of periplasmic
                     folding and trafficking factors"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor protein"
                     /protein_id="YP_068618.1"
                     /db_xref="GI:51594427"
                     /db_xref="GeneID:2955353"
                     /translation="MINSLTTRIFAIFWFTLALVLMLVLMVPKLDSRQLTVLLDSEQR
                     QGTMLEQHIEAELANDPANDLMWWRRLHRAIEKWAPPGQHLILVTSEGRIIGVQRQEV
                     QMVRNFIGQSDNADQPKKKKYGRVEMVGPFSIRDGEDNYQLYLIRPANSPQSDFINLM
                     FDRPLLLLIATMLISAPLLLWLAWSLAKPARKLKNAADDVARGNLKQHPELESGPQEF
                     LATGASFNQMISSLDRMVVAQQRLISDISHELRTPLTRLQLATALMRRRHGEGKELER
                     IEMEAQRLDSMINDLLVLSRSQHKNELHREPIKADELWSDVLENAQFEAEQMGKTLVV
                     TAPPGPWPLFCNPAALDSALENIVRNALRYSHHHIAVAFSIDNQGVTIIVDDDGPGVS
                     PEDREQIFRPFYRTDEARDRASGGTGLGLAIVETAVSQHRGWVKAEDSPLGGLRLIVW
                     LPLHPLKS"
     misc_feature    complement(79874..81244)
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="two-component sensor protein; Provisional; Region:
                     cpxA; PRK09470"
                     /db_xref="CDD:236532"
     misc_feature    complement(80549..80683)
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(80549..80554,80561..80566,80570..80575,
                     80582..80587,80591..80596,80645..80647,80651..80656,
                     80663..80668,80672..80677))
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(80357..80533)
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(80372..80374,80384..80386,80393..80395,
                     80405..80407,80414..80416,80465..80467,80474..80476,
                     80486..80488,80495..80497,80507..80509,80519..80521))
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(80501..80503)
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(79892..80197)
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(79904..79906,79910..79915,79928..79930,
                     79934..79936,79982..79993,80072..80077,80081..80083,
                     80087..80089,80093..80095,80156..80158,80165..80167,
                     80177..80179))
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(80165..80167)
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(79985..79987,79991..79993,80075..80077,
                     80081..80083))
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(join(80684..80749,81164..81229))
                     /gene="cpxA"
                     /locus_tag="YPTB0069"
                     /note="2 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(81241..81939)
                     /gene="cpxR"
                     /locus_tag="YPTB0070"
                     /db_xref="GeneID:2955355"
     CDS             complement(81241..81939)
                     /gene="cpxR"
                     /locus_tag="YPTB0070"
                     /note="response regulator in two-component regulatory
                     system with CpxA; part of the envelope stress response
                     system"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator CpxR"
                     /protein_id="YP_068619.1"
                     /db_xref="GI:51594428"
                     /db_xref="GeneID:2955355"
                     /translation="MHKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQALSQLDSS
                     IDLLLLDIMMPRKNGIETLKELRQHHQTPVIMLTARGSELDRVLGLELGADDYLAKPF
                     NDRELVARIRAILRRSNWSEQQQNAEQGAPTLEVDCLQLNPGRQEASFEGQPLELTGT
                     EFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGLPWF
                     KTLRGRGYLMVSET"
     misc_feature    complement(81244..81939)
                     /gene="cpxR"
                     /locus_tag="YPTB0070"
                     /note="DNA-binding transcriptional regulator CpxR;
                     Provisional; Region: PRK10955"
                     /db_xref="CDD:182864"
     misc_feature    complement(81595..81927)
                     /gene="cpxR"
                     /locus_tag="YPTB0070"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(81637..81642,81649..81651,81706..81708,
                     81763..81765,81913..81918))
                     /gene="cpxR"
                     /locus_tag="YPTB0070"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(81763..81771,81775..81780))
                     /gene="cpxR"
                     /locus_tag="YPTB0070"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(81634..81642)
                     /gene="cpxR"
                     /locus_tag="YPTB0070"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(81256..81540)
                     /gene="cpxR"
                     /locus_tag="YPTB0070"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(81265..81267,81280..81282,81316..81321,
                     81343..81345,81352..81354,81406..81411,81466..81468))
                     /gene="cpxR"
                     /locus_tag="YPTB0070"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            82113..82601
                     /gene="cpxP"
                     /locus_tag="YPTB0071"
                     /db_xref="GeneID:2955354"
     CDS             82113..82601
                     /gene="cpxP"
                     /locus_tag="YPTB0071"
                     /note="repressor of the Cpx envelope stress response
                     pathway which occurs via periplasmic interactions with
                     CpxA; CpxP is degraded by DegP protease especially in the
                     presence of misfolded substrates"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic stress adaptor protein CpxP"
                     /protein_id="YP_068620.1"
                     /db_xref="GI:51594429"
                     /db_xref="GeneID:2955354"
                     /translation="MRKVTTLVMASMFVLGSSAAFAADNTKVTEGYHGDGKMMMNKKG
                     DRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRLDLEDHEAMHKLITADKFDEAAVR
                     AQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSSA
                     QK"
     misc_feature    82272..82547
                     /gene="cpxP"
                     /locus_tag="YPTB0071"
                     /note="CpxP component of the bacterial Cpx-two-component
                     system and related proteins; Region: CpxP_like; cd09916"
                     /db_xref="CDD:197366"
     misc_feature    order(82362..82364,82374..82376,82383..82388,82398..82400,
                     82404..82406,82416..82418,82425..82427,82437..82439,
                     82449..82451,82461..82463,82470..82475,82482..82484,
                     82491..82493,82524..82529,82536..82538)
                     /gene="cpxP"
                     /locus_tag="YPTB0071"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:197366"
     gene            83279..84238
                     /locus_tag="YPTB0072"
                     /db_xref="GeneID:2953063"
     CDS             83279..84238
                     /locus_tag="YPTB0072"
                     /note="similar to Yersinia pestis YPO0076 conserved
                     hypothetical protein (99.6% evalue=0); Salmonella
                     typhimurium PSLT051 samB; cytoplasmic protein (62%
                     evalue=1.E-108)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068621.1"
                     /db_xref="GI:51594430"
                     /db_xref="GeneID:2953063"
                     /translation="MIAQEDAHDYHRPMKTTPTPHDALFKNFMTQPATACDLLEFHLP
                     PELRQLCDLSTLRLESGSFIENNLRACYSDVLYSLKTTVGDGYVYALIEHQSSPDKHM
                     AFRLMRYAIAAMQSHLEAGYDKLPLVIPILFYHGMVTPYPYPMSWLHAFNQPELAGQL
                     YCGNFPLVDVTVIPDHEIMTHRRIALLELLQKHIRQRDLSELLDQLVILIASGYTTED
                     QLKSAINYIIQVGETAEPEVFIRSLAHRLPEHEESLMTIAQKLEQKGEARGIVKGRVE
                     GRVEGAQETALKIARTMLANGLDRATVMKMTGLSEEELTQIHH"
     misc_feature    83333..84232
                     /locus_tag="YPTB0072"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5464"
                     /db_xref="CDD:227751"
     misc_feature    83333..83941
                     /locus_tag="YPTB0072"
                     /note="Putative transposase, YhgA-like; Region:
                     Transposase_31; pfam04754"
                     /db_xref="CDD:252779"
     gene            84800..85702
                     /gene="fieF"
                     /locus_tag="YPTB0073"
                     /gene_synonym="yiiP"
                     /db_xref="GeneID:2953064"
     CDS             84800..85702
                     /gene="fieF"
                     /locus_tag="YPTB0073"
                     /gene_synonym="yiiP"
                     /note="member of cation diffusion facilitator family; CDF;
                     membrane-bound; induced by both zinc and iron, but does
                     not induce resistance to zinc; can transport zinc(II) in a
                     proton-dependent manner; instead this protein induces iron
                     resistance; forms dimers"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron efflux protein F"
                     /protein_id="YP_068622.1"
                     /db_xref="GI:51594431"
                     /db_xref="GeneID:2953064"
                     /translation="MDPQYARWVKAAALSATALASILLIIKIFAWWHTGSVSLLAALV
                     DSLVDLAASLTNLFVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGF
                     RHLASPEPLQDPSIGIGVTLVALFSTLILVTFQRWVVRKTHSQAIRADMLHYQSDVLM
                     NGAILIALALSWYGFRRADALFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQQI
                     IDIVTSWPGVIGAHDLRTRRSGQTRFIQLHLEMEDMMPLMEAHVLAEQVEHALLYRFP
                     GADVLIHQDPCSVVPKERHAHWEL"
     misc_feature    84800..85696
                     /gene="fieF"
                     /locus_tag="YPTB0073"
                     /gene_synonym="yiiP"
                     /note="ferrous iron efflux protein F; Reviewed; Region:
                     fieF; PRK09509"
                     /db_xref="CDD:181919"
     misc_feature    join(84833..84901,84911..84979,85037..85105,85148..85216,
                     85271..85324,85337..85396)
                     /gene="fieF"
                     /locus_tag="YPTB0073"
                     /gene_synonym="yiiP"
                     /note="6 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            85920..86903
                     /gene="pfkA"
                     /locus_tag="YPTB0074"
                     /db_xref="GeneID:2956238"
     CDS             85920..86903
                     /gene="pfkA"
                     /locus_tag="YPTB0074"
                     /EC_number="2.7.1.11"
                     /note="catalyzes the formation of D-fructose
                     1,6-bisphosphate from D-fructose 6-phosphate in
                     glycolysis"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="YP_068623.1"
                     /db_xref="GI:51594432"
                     /db_xref="GeneID:2956238"
                     /translation="MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLG
                     LYENRMKKLDRYSVSDMINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIG
                     GDGSYAGADLLTKEGGIHCVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSS
                     SHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHA
                     IVAITEKLDDIDSLAKYIEKETGRETRGTVLGHIQRGGAPVAYDRILASRMGSYAVDL
                     LLQDHDYKKGGFCVGVQNEKMVHELISVCIAPENKKSKFKEDWYDTAKKLF"
     misc_feature    85923..86900
                     /gene="pfkA"
                     /locus_tag="YPTB0074"
                     /note="6-phosphofructokinase; Provisional; Region:
                     PRK03202"
                     /db_xref="CDD:235111"
     misc_feature    order(85953..85955,86043..86045,86136..86138,86229..86237,
                     86241..86246,86298..86300,86304..86306,86310..86312,
                     86430..86438,86589..86591,86670..86672,86679..86681)
                     /gene="pfkA"
                     /locus_tag="YPTB0074"
                     /note="active site"
                     /db_xref="CDD:238216"
     misc_feature    order(85953..85955,86043..86045,86136..86138,86229..86237,
                     86241..86246)
                     /gene="pfkA"
                     /locus_tag="YPTB0074"
                     /note="ADP/pyrophosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238216"
     misc_feature    order(85983..85985,85995..85997,86082..86084,86097..86099,
                     86106..86108,86328..86330,86364..86366,86376..86378,
                     86385..86387,86469..86474,86478..86480,86562..86564,
                     86706..86711,86721..86723,86742..86744,86799..86801,
                     86892..86894)
                     /gene="pfkA"
                     /locus_tag="YPTB0074"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238216"
     misc_feature    order(85983..85985,85995..85997,86082..86087,86094..86099,
                     86385..86387,86478..86480,86484..86486,86556..86558,
                     86562..86570)
                     /gene="pfkA"
                     /locus_tag="YPTB0074"
                     /note="allosteric effector site; other site"
                     /db_xref="CDD:238216"
     misc_feature    order(86298..86300,86304..86306,86310..86312,86409..86411,
                     86430..86438,86589..86591,86652..86654,86670..86672,
                     86679..86681)
                     /gene="pfkA"
                     /locus_tag="YPTB0074"
                     /note="fructose-1,6-bisphosphate binding site; other site"
                     /db_xref="CDD:238216"
     gene            87124..88113
                     /gene="sbp1"
                     /locus_tag="YPTB0075"
                     /db_xref="GeneID:2956574"
     CDS             87124..88113
                     /gene="sbp1"
                     /locus_tag="YPTB0075"
                     /note="similar to Yersinia pestis YPO0079 sbp1; exported
                     sulfate-binding protein (98.7% evalue=0); Escherichia coli
                     JW3888 sbp; Periplasmic sulphate binding protein (83.5%
                     evalue=1.E-162)"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter subunit"
                     /protein_id="YP_068624.1"
                     /db_xref="GI:51594433"
                     /db_xref="GeneID:2956574"
                     /translation="MRKWGVGLSLLLLASGAIAKDIQLLNVSYDPTREFYQEYNQAFS
                     KYWQQQTGDKVTVRQSHGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKNWI
                     KRLPDNSAPYTSTIVFLVRKGNPKQIHDWSDLVKPGTSVITPNPKTSGGARWNYLAAW
                     GYALEHNNNDQAKAQEFVNALYKNVEVLDSGARGATNTFVERGIGDVLIAWENEALLA
                     VNEVGNGQFDIVTPSVSILAEPTVSVVDKVVDKRGTCDVADAYLKYLYSPEGQTIAAK
                     NYYRPRDPAVAAKFAKEFPQLKLFTIDEVFGGWTQAQKTHFATGGVFDEISKR"
     misc_feature    87124..88110
                     /gene="sbp1"
                     /locus_tag="YPTB0075"
                     /note="sulfate transporter subunit; Provisional; Region:
                     PRK10752"
                     /db_xref="CDD:182700"
     gene            complement(88363..89139)
                     /locus_tag="YPTB0076"
                     /db_xref="GeneID:2953065"
     CDS             complement(88363..89139)
                     /locus_tag="YPTB0076"
                     /note="similar to Yersinia pestis YPO0080 hypothetical
                     protein (99.6% evalue=1.E-137); Bacillus subtilis BG14094
                     yvgL, yvsD; molybdate transport system substrate-binding
                     protein (21.9% evalue=9.E-09)"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter periplasmic-binding
                     protein"
                     /protein_id="YP_068625.1"
                     /db_xref="GI:51594434"
                     /db_xref="GeneID:2953065"
                     /translation="MKYSNVIVSGLCMSMVSLATAAPTEVPSDEPVTLRIISSMATRQ
                     FLTEVIAQFAQQSKYQVELESVGGVDATKRVEAGEAFDVVILSANAIDKLIDSGKILP
                     NSRIDLVKSGVAIAVKEGAQIMDVSSEETVKQAVLAANTIAYSTGPSGVYLTEVFERW
                     GIAEQIKDRIVKVPPGVPVGSLVAKGEVELGFQQLSELLHLKGIIILGPLPTDIQIMT
                     HFSAGVPLKTNQQKAIKVLLDFLASPAATEAKIKNGMEPI"
     misc_feature    complement(88366..89103)
                     /locus_tag="YPTB0076"
                     /note="ABC-type molybdate transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: ModA; COG0725"
                     /db_xref="CDD:223797"
     gene            complement(89257..90684)
                     /locus_tag="YPTB0077"
                     /db_xref="GeneID:2953066"
     CDS             complement(89257..90684)
                     /locus_tag="YPTB0077"
                     /note="similar to Yersinia pestis YPO0081  membrane
                     transport protein (100% evalue=0); Escherichia coli
                     ECs0798  membrane pump protein (52.2% evalue=1.E-142)"
                     /codon_start=1
                     /transl_table=11
                     /product="DASS family 2-oxoglutarate/malate:Na+
                     antiporter"
                     /protein_id="YP_068626.1"
                     /db_xref="GI:51594435"
                     /db_xref="GeneID:2953066"
                     /translation="MKNKIWKLCILVMIPLVIWFIPPPEGLTELSWRLSGFYLAAICG
                     LILKPFSEAVVLLGVVGFAGFFLNNTSQILVGYATSTVWLVFAAFGISISFVKTGLGR
                     RIAFHMIRFCGSTTLRLGYVTAFLEFVISPVTPSNTARSGGIVFPIILSVVKALGSEP
                     GDTAKKAGSYLMSNIYFVMKVSSFMFITAMAPNLLAADFAAKILGIHLDWGVWALAMV
                     VPGLLLLLIVPAVGYYLDKPELKKVDNKKIADEGLAELGPITRNEKLLVGIFISALLG
                     WALPSLLGQLFGITLKIDATAVAIMAMALCILLGVIKWDDVLQNKGAWNTLLWFGGII
                     GLASALSKEKVFDWLANLIQNNVDFGHNPFIALTIIGFLSIIIRYFFASASSYAIAML
                     PVFLTVGKVAGADPMALALVLAATNSYGGALTHYGGGSAPIIFGAGYNNVKQWWASGA
                     VIATVCFIVTMTVGYVWWQFLGFVK"
     misc_feature    complement(89263..90681)
                     /locus_tag="YPTB0077"
                     /note="Sodium:sulfate symporter transmembrane region;
                     Region: Na_sulph_symp; pfam00939"
                     /db_xref="CDD:250243"
     misc_feature    complement(89281..90621)
                     /locus_tag="YPTB0077"
                     /note="anion transporter; Region: dass; TIGR00785"
                     /db_xref="CDD:233126"
     misc_feature    complement(order(89287..89325,89398..89454,89458..89460,
                     89527..89544,89560..89589,89665..89721,89761..89805,
                     89851..89889,89983..90027,90109..90144,90148..90183,
                     90214..90258,90262..90270,90274..90279,90286..90330,
                     90397..90450,90493..90528))
                     /locus_tag="YPTB0077"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     misc_feature    complement(join(89284..89349,89413..89478,89539..89604,
                     89665..89718,89749..89799,89821..89886,89989..90054,
                     90094..90159,90397..90462,90484..90573,90619..90669))
                     /locus_tag="YPTB0077"
                     /note="11 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(90750..91463)
                     /locus_tag="YPTB0078"
                     /db_xref="GeneID:2953067"
     CDS             complement(90750..91463)
                     /locus_tag="YPTB0078"
                     /note="similar to Yersinia pestis YPO0082 possible
                     transferase (100% evalue=1.E-131); Sinorhizobium meliloti
                     SMc00502 conserved hypothetical protein (58.1%
                     evalue=3.E-70)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068627.1"
                     /db_xref="GI:51594436"
                     /db_xref="GeneID:2953067"
                     /translation="MSLVNMKGVVVTNIERAELALLQRFAEYGVATVHEAQLRQGLLD
                     ERIKPIQQGRCIAGNAVTVLVTPGDNWMFHVAVEQCQPGDVLLVAPTSECHDGFFGDL
                     LATSLLARGVVALVGDIGIRDSQTLREMNFPVWSRAVWAQGTVKASLGSVNVPVICAG
                     QLVNPGDIVVADDDGVVIVPREQATAIADAAQTRVDLETSKRQRLANGELGLDIYQMR
                     APLAKKGLRYVNSLNALKS"
     misc_feature    complement(90774..91448)
                     /locus_tag="YPTB0078"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09262"
                     /db_xref="CDD:181735"
     gene            complement(91460..92197)
                     /locus_tag="YPTB0079"
                     /db_xref="GeneID:2953068"
     CDS             complement(91460..92197)
                     /locus_tag="YPTB0079"
                     /note="similar to Yersinia pestis YPO0083 hypothetical
                     protein (100% evalue=1.E-142); Sinorhizobium meliloti
                     SMc00503 conserved hypothetical protein (65.4%
                     evalue=3.E-89)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068628.1"
                     /db_xref="GI:51594437"
                     /db_xref="GeneID:2953068"
                     /translation="MAMIPQKTALVVSAHSADFVWRAGGAIALHVEQGYQVHIVCLSY
                     GERGESAKLWRKGDMTEERVKASRHTEAQAAANVLGASIEFFDMGDYPLRADKESLFR
                     LADVFRRIQPHFVLTHSLADPYNYDHPLAANLAQEARIIAQAEGYRPGEAIIGAPPVY
                     CFEPHQPEQCGWKPDVLLDITSVWEKKYAAIQCMAGQEHLWEYYTRVALQRGVQAKRN
                     IGIASTKTIIHGEGYQSLFPRVTEDLS"
     misc_feature    complement(91463..92197)
                     /locus_tag="YPTB0079"
                     /note="Uncharacterized proteins, LmbE homologs [Function
                     unknown]; Region: COG2120"
                     /db_xref="CDD:225031"
     gene            92334..93569
                     /locus_tag="YPTB0080"
                     /db_xref="GeneID:2953069"
     CDS             92334..93569
                     /locus_tag="YPTB0080"
                     /note="similar to Yersinia pestis YPO0084 possible
                     transcriptional regulator (99.1% evalue=0); Sinorhizobium
                     meliloti SMc00504  transcription regulator protein (26.3%
                     evalue=9.E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_068629.1"
                     /db_xref="GI:51594438"
                     /db_xref="GeneID:2953069"
                     /translation="MRKKNDRNSIKIMQIRAFCMTAEQGAASLAALNLFRTQSAITRS
                     IRDLEHTLAISLFERHAKGMLLTDLGNVILPRARSAMEELTRIPALLRRLQQRDDEGI
                     EDLEPIWLFNERRLQIFLSLYRQQHALHVAQALDITQSAVSAALKVLEKGAGMYLFHR
                     TPKGMLPTPAGHEIAPCISRALNALHHIPEEITAHRGALTGSVRVGALPLSRARLLPL
                     AMIKLISRHPGIKIVTNESGFTALIAELRAGDIDFIIGALRNEKMLLDIHSEILFEEE
                     LILLARPNHPLSDRRVKNQELKDIQWVLPRNHAPSRHLLEVAFCKMGLASPQPVVESG
                     DPAVVRALLLGSDMVAAVSSHQLDFEVSEGILIPLQVNLTGTRREIGLMTRQKALNSP
                     ATDALINCVREVIQSSNDK"
     misc_feature    92373..92543
                     /locus_tag="YPTB0080"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    92673..93545
                     /locus_tag="YPTB0080"
                     /note="pca operon transcription factor PcaQ; Region:
                     TF_pcaQ; TIGR02424"
                     /db_xref="CDD:233862"
     misc_feature    92673..92849
                     /locus_tag="YPTB0080"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    92937..93536
                     /locus_tag="YPTB0080"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(92982..92987,92991..92996,93003..93005,93015..93017,
                     93021..93041,93321..93338,93354..93359,93363..93368)
                     /locus_tag="YPTB0080"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(93800..94567)
                     /gene="tpiA"
                     /locus_tag="YPTB0081"
                     /gene_synonym="tpi"
                     /db_xref="GeneID:2956726"
     CDS             complement(93800..94567)
                     /gene="tpiA"
                     /locus_tag="YPTB0081"
                     /gene_synonym="tpi"
                     /EC_number="5.3.1.1"
                     /note="Reversibly isomerizes the ketone sugar
                     dihydroxyacetone phosphate to the aldehyde sugar
                     glyceraldehyde-3-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="YP_068630.1"
                     /db_xref="GI:51594439"
                     /db_xref="GeneID:2956726"
                     /translation="MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPA
                     IYLNQAKHELAGSRIALGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYH
                     QESDELIAKKFGVLKEIGLIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFE
                     GAVIAYEPIWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNA
                     AELFTQPDIDGALVGGASLKADAFAVIVKAAAKAKKA"
     misc_feature    complement(93830..94558)
                     /gene="tpiA"
                     /locus_tag="YPTB0081"
                     /gene_synonym="tpi"
                     /note="Triosephosphate isomerase (TIM) is a glycolytic
                     enzyme that catalyzes the interconversion of
                     dihydroxyacetone phosphate and
                     D-glyceraldehyde-3-phosphate. The reaction is very
                     efficient and requires neither cofactors nor metal ions.
                     TIM, usually...; Region: TIM; cd00311"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(93866..93871,93875..93877,93932..93934,
                     94049..94051,94067..94069,94283..94285,94535..94537,
                     94541..94543))
                     /gene="tpiA"
                     /locus_tag="YPTB0081"
                     /gene_synonym="tpi"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(94274..94279,94310..94315,94322..94324,
                     94376..94378,94415..94417,94424..94426,94430..94438,
                     94532..94534,94541..94543))
                     /gene="tpiA"
                     /locus_tag="YPTB0081"
                     /gene_synonym="tpi"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(94067..94069,94283..94285,94535..94537))
                     /gene="tpiA"
                     /locus_tag="YPTB0081"
                     /gene_synonym="tpi"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238190"
     gene            complement(94696..95331)
                     /locus_tag="YPTB0082"
                     /db_xref="GeneID:2953070"
     CDS             complement(94696..95331)
                     /locus_tag="YPTB0082"
                     /note="similar to Yersinia pestis YPO0086  exported
                     protein (99.5% evalue=1.E-114); Salmonella typhi STY3788
                     yiiQ; conserved hypothetical protein (57.2%
                     evalue=2.E-54)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068631.1"
                     /db_xref="GI:51594440"
                     /db_xref="GeneID:2953070"
                     /translation="MRKKIVSMRIILLLAALLLITFMLITTINHAHADPTNDSSPPKE
                     GAPPIAPYLLFNAPTFDLTLVKFRESYNRANPTLPINEFHAITVKEDSPPLTRAASKI
                     NENLYASTALEKGTGKIKTLQITYLPIKGNEEKTAKLLAINYMAALMRQFEPTLSVAQ
                     SLANVQKLLTEGKGSPFYAHTIGAIRYVVADNGEKGLTFAVEPIKLSLSEA"
     misc_feature    complement(94702..95241)
                     /locus_tag="YPTB0082"
                     /note="Protein of unknown function (DUF1454); Region:
                     DUF1454; pfam07305"
                     /db_xref="CDD:148740"
     misc_feature    complement(95251..95316)
                     /locus_tag="YPTB0082"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            95479..95913
                     /locus_tag="YPTB0083"
                     /db_xref="GeneID:2953071"
     CDS             95479..95913
                     /locus_tag="YPTB0083"
                     /note="similar to Yersinia pestis YPO0087 conserved
                     membrane protein (100% evalue=2.E-84); Escherichia coli
                     b3921 yiiR; hypothetical 16.5 kD protein in tpiA-fpr
                     intergenic region (O146) (66.6% evalue=3.E-55)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068632.1"
                     /db_xref="GI:51594441"
                     /db_xref="GeneID:2953071"
                     /translation="MTIQQWCFSFKGRIGRREFWIWMGLWLLAMLVIFTLAGKEWLPI
                     QSASFALVFLLWPTAAVVVKRLHDRNKAGWWALLAVLAWMLMAGNWQMLTPIWQWGVG
                     RFIPTLIFVMMFIDCGAFLGTEGDNRFGPEAVPVKFFADKAK"
     misc_feature    95479..95895
                     /locus_tag="YPTB0083"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3152"
                     /db_xref="CDD:225694"
     misc_feature    join(95536..95589,95599..95667,95692..95760,95773..95841)
                     /locus_tag="YPTB0083"
                     /note="4 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(96254..97000)
                     /gene="fpr"
                     /locus_tag="YPTB0084"
                     /gene_synonym="mvrA"
                     /db_xref="GeneID:2955637"
     CDS             complement(96254..97000)
                     /gene="fpr"
                     /locus_tag="YPTB0084"
                     /gene_synonym="mvrA"
                     /EC_number="1.18.1.2"
                     /note="similar to Yersinia pestis YPO0088 fpr, mvrA;
                     ferredoxin--NADP reductase (100% evalue=1.E-141);
                     Salmonella typhi STY3786 fpr; ferredoxin--NADP reductase
                     (77% evalue=1.E-110)"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-NADP reductase"
                     /protein_id="YP_068633.1"
                     /db_xref="GI:51594442"
                     /db_xref="GeneID:2955637"
                     /translation="MAEWVSGKITHIEHWTDALFSLQVNAPVDPFTAGQFAKLALDIN
                     GERVQRAYSYVNAPSDHNLEFYLVTVPEGKLSPRLDQLSVGGEVMITKQAAGFFVLEE
                     IPDCDTLWMLATGTAIGPYLSILQEGQDLERFKHLVLVHAARFAHDLSYLPLMQQLEQ
                     RYNGKLRIQTVVSREESPGSLTGRVPALIENGALEAAVGLKIDAKDSHVMLCGNPQMV
                     RDTQQLLKEQREMRKHLRRKPGHMTSEQYW"
     misc_feature    complement(96257..97000)
                     /gene="fpr"
                     /locus_tag="YPTB0084"
                     /gene_synonym="mvrA"
                     /note="ferredoxin-NADP reductase; Provisional; Region:
                     PRK10926"
                     /db_xref="CDD:182844"
     misc_feature    complement(96260..96979)
                     /gene="fpr"
                     /locus_tag="YPTB0084"
                     /gene_synonym="mvrA"
                     /note="Ferredoxin-NADP+ (oxido)reductase is an
                     FAD-containing enzyme that catalyzes the reversible
                     electron transfer between NADP(H) and electron carrier
                     proteins such as ferredoxin and flavodoxin. Isoforms of
                     these flavoproteins (i.e. having a non-covalently...;
                     Region: FNR1; cd06195"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(96260..96262,96653..96655,96773..96778,
                     96782..96784,96791..96793,96797..96799,96803..96805,
                     96842..96853,96893..96895))
                     /gene="fpr"
                     /locus_tag="YPTB0084"
                     /gene_synonym="mvrA"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(96842..96847,96851..96853))
                     /gene="fpr"
                     /locus_tag="YPTB0084"
                     /gene_synonym="mvrA"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(96713..96715,96719..96721,96746..96748,
                     96764..96766,96773..96775,96782..96784))
                     /gene="fpr"
                     /locus_tag="YPTB0084"
                     /gene_synonym="mvrA"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(96641..96643,96647..96658,96668..96670))
                     /gene="fpr"
                     /locus_tag="YPTB0084"
                     /gene_synonym="mvrA"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(96359..96364,96569..96577,96650..96655))
                     /gene="fpr"
                     /locus_tag="YPTB0084"
                     /gene_synonym="mvrA"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     gene            complement(97155..98165)
                     /gene="glpX"
                     /locus_tag="YPTB0085"
                     /db_xref="GeneID:2955715"
     CDS             complement(97155..98165)
                     /gene="glpX"
                     /locus_tag="YPTB0085"
                     /EC_number="3.1.3.11"
                     /note="type II fructose 1,6-bisphosphatae; in Escherichia
                     coli this protein forms a dimer and binds manganese"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose 1,6-bisphosphatase II"
                     /protein_id="YP_068634.1"
                     /db_xref="GI:51594443"
                     /db_xref="GeneID:2955715"
                     /translation="MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADGAAVQAMRIML
                     NQVNIDGRIVIGEGEIDEAPMLFIGEHVGTGQGDAVDIAVDPIEGTRMTAMGQANALA
                     VLAVGDQGTFLHAPDMYMEKLVVGPAAKGAIDLNLPLEQNLCNIATALNKPLADLTVI
                     TLAKPRHDGIIAAMQQLGVKVFAIPDGDVAASILTCMPESEVDVMYCIGGAPEGVISA
                     AVIRALDGDMQGRLLPRHQVKGDSEDNRRIGEQELLRCKSMGIEAGNVLQLGDMARND
                     NVIFSATGITKGDLLEGIYRKGNMATTETLLIRGKSRTIRRIRSTHFLDRKDPALHEF
                     LL"
     misc_feature    complement(97200..98162)
                     /gene="glpX"
                     /locus_tag="YPTB0085"
                     /note="Bacterial fructose-1,6-bisphosphatase,
                     glpX-encoded. A dimeric enzyme dependent on Mg(2+).
                     glpX-encoded FPBase (FBPase class II) differs from other
                     members of the inositol-phosphatase superfamily by
                     permutation of secondary structure elements. The core...;
                     Region: FBPase_glpX; cd01516"
                     /db_xref="CDD:238774"
     misc_feature    complement(order(97527..97529,97602..97604,97899..97913,
                     97995..98000,98067..98069))
                     /gene="glpX"
                     /locus_tag="YPTB0085"
                     /note="putative active site [active]"
                     /db_xref="CDD:238774"
     gene            complement(98418..99941)
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /db_xref="GeneID:2955712"
     CDS             complement(98418..99941)
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /EC_number="2.7.1.30"
                     /note="similar to Escherichia coli b3926 glpK; glycerol
                     kinase (84.6% evalue=0); Escherichia coli Z5471 glpK;
                     glycerol kinase (84.4% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="YP_068635.1"
                     /db_xref="GI:51594444"
                     /db_xref="GeneID:2955712"
                     /translation="MTTENTTQKKYIVALDQGTTSSRAVVLDHNANIVSVSQREFTQI
                     YPKAGWVEHDPMEIWATQSSTLIEVLAKAGINSDEIAGIGITNQRETTIVWDKVTGKP
                     VYNAIVWQCRRTADICEKLKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARER
                     AERGELLFGTVDTWLVWNMTQGRVHVTDYTNASRTMMFNIRTKEWDDRMLKALNIPRA
                     MLPEVRPSSEIYGKTNIGGKGGTRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCF
                     LLMNTGEEAVQSTHGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDELKLIGDATD
                     SEYFATKVKNSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNSNHIIRATLESIAY
                     QTRDVLDAMQADSGARLKSLRVDGGAVANNFLMQFQADILGTRVERPAIRESTALGAA
                     FLAGLATGFWDDLDEVKSKASIEREFRPGIETTERDIRYKGWKKAVARARDWEEHDE"
     misc_feature    complement(98433..99926)
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="glycerol kinase; Provisional; Region: glpK;
                     PRK00047"
                     /db_xref="CDD:234594"
     misc_feature    complement(98451..99911)
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="Escherichia coli glycerol kinase-like proteins;
                     belongs to the FGGY family of carbohydrate kinases;
                     Region: FGGY_EcGK_like; cd07786"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(98562..98567,98571..98588,98592..98597,
                     98601..98609,98613..98615,98841..98843,98847..98852,
                     98856..98858,98877..98879,98982..98984,99000..99005,
                     99009..99011,99015..99017,99024..99026,99030..99032,
                     99045..99065,99081..99083,99087..99089,99114..99116,
                     99123..99125,99180..99185,99201..99206,99258..99269,
                     99333..99335,99339..99344,99360..99365,99372..99377,
                     99516..99521,99525..99527,99531..99542,99549..99551,
                     99585..99587,99597..99599,99606..99608,99612..99617,
                     99675..99701,99795..99797,99843..99845,99849..99851,
                     99858..99863,99867..99869,99873..99875,99882..99887,
                     99894..99896,99900..99902,99906..99911))
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(98679..98681,98688..98696,98937..98939,
                     98943..98948,98982..98987,98991..98996,99114..99116,
                     99123..99131,99186..99191,99519..99521,99615..99617,
                     99672..99680,99873..99875,99882..99890,99894..99896))
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="active site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(98679..98681,98688..98696,98937..98939,
                     98943..98948,98982..98987,98991..98996,99123..99131,
                     99873..99875,99882..99890,99894..99896))
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(99189..99191,99885..99887,99894..99896))
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(99189..99191,99894..99896))
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(99114..99116,99186..99191,99519..99521,
                     99615..99617,99672..99680,99885..99887))
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="glycerol binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(99237..99242,99399..99401,99408..99410,
                     99639..99641,99738..99743,99750..99752,99762..99767,
                     99774..99776,99825..99827))
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(98796..98798,98805..98807,98817..98843,
                     98880..98882,98895..98897,98901..98903,98970..98972,
                     98979..98984,98991..98993,99000..99002,99612..99614,
                     99789..99791,99798..99800,99807..99809))
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(99216..99218,99222..99227))
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="FBP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(98481..98483,98487..98498,98502..98504,
                     98508..98510,98712..98714,98718..98720))
                     /gene="glpK"
                     /locus_tag="YPTB0086"
                     /note="protein IIAGlc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198361"
     gene            complement(100118..100966)
                     /gene="glpF"
                     /locus_tag="YPTB0087"
                     /db_xref="GeneID:2955710"
     CDS             complement(100118..100966)
                     /gene="glpF"
                     /locus_tag="YPTB0087"
                     /note="similar to Yersinia pestis YPO0091 glpF; glycerol
                     uptake facilitator protein (100% evalue=1.E-160);
                     Escherichia coli ECs4852 glycerol facilitator protein
                     (82.6% evalue=1.E-136)"
                     /codon_start=1
                     /transl_table=11
                     /product="MIP family glycerol uptake facilitator protein
                     GlpF"
                     /protein_id="YP_068636.1"
                     /db_xref="GI:51594445"
                     /db_xref="GeneID:2955710"
                     /translation="MSQTASSTLKGQCIAEFLGTGLLIFFGAGCVAALKLAGASFGQW
                     EISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFERRKVLPYIVAQVAGAFCA
                     AALVYGLYYSLFVDFEQTHQMVRGSTESLQLAGIFSTYPNPHISVVQAFLVETVITAI
                     LMCLILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFALNPARDLGPKAFSYL
                     AGWGDIAFTGGRDIPYFLVPIFGPIVGALLGAFGYRALIGRHLPCDVCTLEDEESTTI
                     TTERKA"
     misc_feature    complement(100205..100933)
                     /gene="glpF"
                     /locus_tag="YPTB0087"
                     /note="Major intrinsic protein (MIP) superfamily. Members
                     of the MIP superfamily function as membrane channels that
                     selectively transport water, small neutral molecules, and
                     ions out of and between cells. The channel proteins share
                     a common fold: the N-terminal...; Region: MIP; cd00333"
                     /db_xref="CDD:238204"
     misc_feature    complement(order(100343..100345,100352..100354,
                     100361..100366,100757..100765,100817..100819))
                     /gene="glpF"
                     /locus_tag="YPTB0087"
                     /note="amphipathic channel; other site"
                     /db_xref="CDD:238204"
     misc_feature    complement(order(100346..100354,100751..100759))
                     /gene="glpF"
                     /locus_tag="YPTB0087"
                     /note="Asn-Pro-Ala signature motifs; other site"
                     /db_xref="CDD:238204"
     misc_feature    complement(join(100196..100261,100361..100426,
                     100466..100531,100634..100699,100760..100825,
                     100871..100927))
                     /gene="glpF"
                     /locus_tag="YPTB0087"
                     /note="6 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(100976..101215)
                     /locus_tag="YPTB0088"
                     /db_xref="GeneID:2953072"
     CDS             complement(100976..101215)
                     /locus_tag="YPTB0088"
                     /note="similar to Yersinia pestis YPO0092 hypothetical
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068637.1"
                     /db_xref="GI:51594446"
                     /db_xref="GeneID:2953072"
                     /translation="MTAPLMRYTPLTFSQKITGPITLLKSLNALKLRENAHFMTNNTY
                     FDFATSRFRSLTINLHYPLHCSKGKNKKYPINLCL"
     gene            101610..101849
                     /locus_tag="YPTB0089"
                     /db_xref="GeneID:2953073"
     CDS             101610..101849
                     /locus_tag="YPTB0089"
                     /note="similar to Yersinia pestis YPO0093 conserved
                     hypothetical protein (100% evalue=1.E-37); Salmonella
                     typhimurium STM4088 yiiU; cytoplasmic protein (77.2%
                     evalue=4.E-27)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068638.1"
                     /db_xref="GI:51594447"
                     /db_xref="GeneID:2953073"
                     /translation="MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLTQEVQDA
                     AGSREALVRENEQLKQEQHVWQDRLRALLGKMEEV"
     misc_feature    101610..101846
                     /locus_tag="YPTB0089"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3074"
                     /db_xref="CDD:225616"
     gene            complement(102190..104304)
                     /locus_tag="YPTB0090"
                     /db_xref="GeneID:2953074"
     CDS             complement(102190..104304)
                     /locus_tag="YPTB0090"
                     /note="similar to Xylella fastidiosa XF1220 colicin V
                     secretion ABC transporter ATP-binding protein (43.6%
                     evalue=1.E-163); Pseudomonas aeruginosa PA4143 probable
                     toxin transporter (44.9% evalue=1.E-172)"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease/ATP-binding protein"
                     /protein_id="YP_068639.1"
                     /db_xref="GI:51594448"
                     /db_xref="GeneID:2953074"
                     /translation="MNDTHFNEIKNRLNFSFRRKVPQVLQTEAAECGLACLVMACRYH
                     GMDIDLFNLRQRFGISSHGATLALLINISAQLKFKTRALSLDLDELRQLKTPCILHWD
                     MSHFVVLVAVKGTRFIIHDPAFGRRTVSLSEMSQHFTGVALELWPDSEFTRQKSRTRL
                     SLLSLMRNISGLPGFLTKIFCLSLMVEAINLLLPVGTQLVMDHVIIAEDHDLLALICI
                     GLLFFILFRTFLSMLRSWTSLVMGSLVDVQWKAGLFDHLLKLPLAYFEKRKLGDIQSR
                     FGSLDIIRSTLTNNVVNGIIDGLMSIGVFIMMFLYGGWLVWVVLGFTAMYMILRLATY
                     NQYRQASEEQIVKNAKASSHFMETLYGISTLKALGLAATRSQFWLNLNIDTTNANIRL
                     TKLDMFFGGVNTLIGTIDQVVILWLGASMVIDGQMTLGMFVAFNAYRGQFSDRATNLI
                     NMVLQLRMLALHSERIADIVFTETEKEQTPRQLLSPNQPAVFEARNIAFQYDNLSKPI
                     FSDLNIHVEAGESVAITGPSGIGKTTLMKVIAGLLTPSQGHILIDGLDITTVGLNNYR
                     DCIACVLQDDKLFAGSIADNIASFDVNKDEQRILSCANHCNIHKEIMHMPMGYETLIS
                     ELGGSLSGGQKQRLLIARALYRQPSLLFLDEATSHLDLANEAHINNAIASLKITRIFI
                     AHRPSTIASAQRIINLEKQNVS"
     misc_feature    complement(102205..104247)
                     /locus_tag="YPTB0090"
                     /note="ABC-type bacteriocin/lantibiotic exporters, contain
                     an N-terminal double-glycine peptidase domain [Defense
                     mechanisms]; Region: SunT; COG2274"
                     /db_xref="CDD:225183"
     misc_feature    complement(103864..104244)
                     /locus_tag="YPTB0090"
                     /note="A sub-family of peptidase family C39. Peptidase
                     family C39 mostly contains bacteriocin-processing
                     endopeptidases from bacteria. The cysteine peptidases in
                     family C39 cleave the 'double-glycine' leader peptides
                     from the precursors of various...; Region: Peptidase_C39C;
                     cd02419"
                     /db_xref="CDD:239100"
     misc_feature    complement(order(103942..103944,103990..103992,
                     104209..104211,104227..104229))
                     /locus_tag="YPTB0090"
                     /note="putative active site [active]"
                     /db_xref="CDD:239100"
     misc_feature    complement(102976..103779)
                     /locus_tag="YPTB0090"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    complement(102196..102831)
                     /locus_tag="YPTB0090"
                     /note="ATP-binding cassette domain of PrtD, subfamily C;
                     Region: ABCC_Protease_Secretion; cd03246"
                     /db_xref="CDD:213213"
     misc_feature    complement(102706..102729)
                     /locus_tag="YPTB0090"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213213"
     misc_feature    complement(order(102253..102255,102340..102345,
                     102583..102585,102703..102711,102715..102720))
                     /locus_tag="YPTB0090"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213213"
     misc_feature    complement(102583..102594)
                     /locus_tag="YPTB0090"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213213"
     misc_feature    complement(102388..102417)
                     /locus_tag="YPTB0090"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213213"
     misc_feature    complement(102340..102357)
                     /locus_tag="YPTB0090"
                     /note="Walker B; other site"
                     /db_xref="CDD:213213"
     misc_feature    complement(102322..102333)
                     /locus_tag="YPTB0090"
                     /note="D-loop; other site"
                     /db_xref="CDD:213213"
     misc_feature    complement(102247..102267)
                     /locus_tag="YPTB0090"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213213"
     misc_feature    complement(join(103048..103113,103303..103359,
                     103372..103437,103612..103668,103714..103779))
                     /locus_tag="YPTB0090"
                     /note="5 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(104297..105589)
                     /locus_tag="YPTB0091"
                     /db_xref="GeneID:2953075"
     CDS             complement(104297..105589)
                     /locus_tag="YPTB0091"
                     /note="similar to Yersinia pestis YPO0099  exported
                     protein (99.7% evalue=0); Pseudomonas aeruginosa PA4142
                     probable secretion protein (25.6% evalue=4.E-41)"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family (ABC transporter associated)
                     multidrug efflux pump"
                     /protein_id="YP_068640.1"
                     /db_xref="GI:51594449"
                     /db_xref="GeneID:2953075"
                     /translation="MSSNQIFRRDAVEYIRTKWLGKALLTSGYSTTFIAALCAIFLVL
                     LITLIIYGTYTRRINVNGEVISQPHPINIFSPQQGFITKKWVEVGDIVRKGQHLYQID
                     VSRTTFSGNVSLNSLEAINNQLSQIDSIINNTQKNKELTLLNLRQQLAQYQKAHKKSQ
                     ELVDNAGKGMDDMRRTMASYGTYQRQGLITKDQLTNQRSLFYQQQNAFQSLNTQLIQE
                     SLQIAKLESEISTRASDFDNDISQYLFQKGDLKRQLAEVDASGMLLINSPSDGKIENM
                     SVTQGQMVNVNDSLVQLTPSDNPYYCLVLWVPNNSVPYINTGDKVNIRYDAFPFEKFG
                     QFPGRIISISNVPVSQQEIASYNIAPRLPNGGLIEPYYKVIVALDDIHFRYQSKPLML
                     SNGLKANVTLFLEKRPLYQWMLSPFYDIKKSVTGPVNE"
     misc_feature    complement(104327..105499)
                     /locus_tag="YPTB0091"
                     /note="type I secretion membrane fusion protein, HlyD
                     family; Region: type_I_hlyD; TIGR01843"
                     /db_xref="CDD:130902"
     misc_feature    complement(<105275..105382)
                     /locus_tag="YPTB0091"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    complement(104489..104797)
                     /locus_tag="YPTB0091"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     misc_feature    complement(105425..105490)
                     /locus_tag="YPTB0091"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            105802..106041
                     /locus_tag="YPTB0092"
                     /db_xref="GeneID:2953076"
     CDS             105802..106041
                     /locus_tag="YPTB0092"
                     /note="similar to Yersinia pestis YPO0100 hypothetical
                     protein (98.7% evalue=4.E-37)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068641.1"
                     /db_xref="GI:51594450"
                     /db_xref="GeneID:2953076"
                     /translation="MKELTQTEVMEVSGAGIVSDAGKVLGSGFGALIDAGASIFGIKP
                     NASATIGKIGESIGSAFDAGISGVKQFFGLSAPQQ"
     gene            106216..106365
                     /locus_tag="YPTB0093"
                     /db_xref="GeneID:2953077"
     CDS             106216..106365
                     /locus_tag="YPTB0093"
                     /note="similar to Yersinia pestis YPO0101 hypothetical
                     protein. 100% identical"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068642.1"
                     /db_xref="GI:51594451"
                     /db_xref="GeneID:2953077"
                     /translation="MKIAYRTIRFINLWIYAVFYSEFFGFELSHYLSTADMIFFGDYE
                     FILYH"
     misc_feature    106252..106320
                     /locus_tag="YPTB0093"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            106671..107255
                     /locus_tag="YPTB0094"
                     /db_xref="GeneID:2953078"
     CDS             106671..107255
                     /locus_tag="YPTB0094"
                     /note="similar to Yersinia pestis YPO0102  exported
                     protein (100% evalue=1.E-106)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068643.1"
                     /db_xref="GI:51594452"
                     /db_xref="GeneID:2953078"
                     /translation="MQRGCCFLRSTTTAGVALIVAMTLSVSAWAISEQAKSEQATTVP
                     NNDIVCHVAHLNARFDDKEGLFEGASQSGTLLILRNISARACQVNAMPVISFEGAVGQ
                     QLAVFRKVPRGMRQEPVLSPVTVAAGAEVAVQLRWVASDAFDGNNCVTPEKVVVTLLG
                     GTLRLPFGRQMCAASGDTEFFSQAPVGPATNEVQ"
     misc_feature    106818..107192
                     /locus_tag="YPTB0094"
                     /note="Protein of unknown function (DUF4232); Region:
                     DUF4232; pfam14016"
                     /db_xref="CDD:258251"
     misc_feature    106689..106757
                     /locus_tag="YPTB0094"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(107372..107857)
                     /gene="menG"
                     /locus_tag="YPTB0095"
                     /db_xref="GeneID:2956017"
     CDS             complement(107372..107857)
                     /gene="menG"
                     /locus_tag="YPTB0095"
                     /EC_number="2.1.-.-"
                     /note="regulator of RNase E; increases half-life and
                     abundance of RNAs; interacts with RNase E possibly
                     inhibiting catalytic activity"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease activity regulator protein RraA"
                     /protein_id="YP_068644.1"
                     /db_xref="GI:51594453"
                     /db_xref="GeneID:2956017"
                     /translation="MKYDTSDLCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFED
                     NGLLFDLLEENGLGRVLVVDGGGSVRRALINAELAELALKNEWEGIVVYGAVRQVDDL
                     AELDIGIQAMAAIPVGAADEGVGESDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDI
                     E"
     misc_feature    complement(107381..107857)
                     /gene="menG"
                     /locus_tag="YPTB0095"
                     /note="ribonuclease activity regulator protein RraA;
                     Provisional; Region: PRK09372"
                     /db_xref="CDD:236487"
     gene            complement(107999..108916)
                     /gene="menA"
                     /locus_tag="YPTB0096"
                     /db_xref="GeneID:2956011"
     CDS             complement(107999..108916)
                     /gene="menA"
                     /locus_tag="YPTB0096"
                     /EC_number="2.5.1.-"
                     /note="catalyzes the formation of dimethylmenaquinone from
                     1,4-dihydroxy-2-naphthoate and octaprenyl diphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="YP_068645.1"
                     /db_xref="GI:51594454"
                     /db_xref="GeneID:2956011"
                     /translation="MSLSINTSQTQAWLESLRPRTLPLAFASIVTGSALAVWLDSFKP
                     AVALLALLTAGLLQILSNLANDYGDAVKGSDTEERIGPLRGMQKGIISHQQMKVALII
                     TVILTIISGIALIAVACEKPSDILGFLLLGLMAIVAAITYTVGRKPYGYMGLGDISVL
                     VFFGWLSVAGTYYLQAGHFDSIVMLPATACGLLATAVLNINNLRDIENDKANGKNTLA
                     VRLGPVVARYYHALLISAAIFCLALFSILHLHSWHGWIFLLAIPLLGKHALFVLRDPT
                     AAGMRPMLEQMVKAALLTNILFAVGLVFS"
     misc_feature    complement(108014..108877)
                     /gene="menA"
                     /locus_tag="YPTB0096"
                     /note="1,4-Dihydroxy-2-naphthoate octaprenyltransferase;
                     Region: PT_UbiA_UBIAD1; cd13962"
                     /db_xref="CDD:260125"
     misc_feature    complement(order(108290..108292,108302..108304,
                     108311..108316,108710..108712,108719..108724))
                     /gene="menA"
                     /locus_tag="YPTB0096"
                     /note="putative active site [active]"
                     /db_xref="CDD:260125"
     misc_feature    complement(join(108098..108163,108179..108244,
                     108308..108373,108389..108445,108485..108541,
                     108557..108622,108728..108784,108800..108853))
                     /gene="menA"
                     /locus_tag="YPTB0096"
                     /note="8 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(109151..110482)
                     /gene="hslU"
                     /locus_tag="YPTB0097"
                     /db_xref="GeneID:2955842"
     CDS             complement(109151..110482)
                     /gene="hslU"
                     /locus_tag="YPTB0097"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease ATP-binding subunit HslU"
                     /protein_id="YP_068646.1"
                     /db_xref="GI:51594455"
                     /db_xref="GeneID:2955842"
                     /translation="MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEEL
                     RHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRD
                     LTDAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGVPDESQEPSATRQTFR
                     KKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKI
                     KEALKLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREG
                     VQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQA
                     LTTDDFERILTEPSASLTEQYKALMATEGVTIEFTREGIRKIAEAAWQVNERTENIGA
                     RRLHTVLERLMEDISYDASESSGQSITIDAEYVGKHLDELVADEDLSRFIL"
     misc_feature    complement(109154..110482)
                     /gene="hslU"
                     /locus_tag="YPTB0097"
                     /note="ATP-dependent protease ATP-binding subunit HslU;
                     Provisional; Region: hslU; PRK05201"
                     /db_xref="CDD:235364"
     misc_feature    complement(<110048..110431)
                     /gene="hslU"
                     /locus_tag="YPTB0097"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(110291..110314)
                     /gene="hslU"
                     /locus_tag="YPTB0097"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(110288..110311)
                     /gene="hslU"
                     /locus_tag="YPTB0097"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(109484..>109807)
                     /gene="hslU"
                     /locus_tag="YPTB0097"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(109712..109729)
                     /gene="hslU"
                     /locus_tag="YPTB0097"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(109508..109510)
                     /gene="hslU"
                     /locus_tag="YPTB0097"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(109214..109480)
                     /gene="hslU"
                     /locus_tag="YPTB0097"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; smart01086"
                     /db_xref="CDD:198154"
     gene            complement(110553..111077)
                     /gene="hslV"
                     /locus_tag="YPTB0098"
                     /db_xref="GeneID:2955843"
     CDS             complement(110553..111077)
                     /gene="hslV"
                     /locus_tag="YPTB0098"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease peptidase subunit"
                     /protein_id="YP_068647.1"
                     /db_xref="GI:51594456"
                     /db_xref="GeneID:2955843"
                     /translation="MTTIVSVRRDGHVVIGGDGQVTLGNTVMKGNAKKVRRLYNNKVI
                     AGFAGGTADAFTLFELFERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADET
                     ASLIITGNGDVVQPEDDLIAIGSGGPYAQSAARALLENTELGARDIVEKSLSIAGDIC
                     IYTNRFQTIEELTY"
     misc_feature    complement(110562..111074)
                     /gene="hslV"
                     /locus_tag="YPTB0098"
                     /note="Protease HslV and the ATPase/chaperone HslU are
                     part of an ATP-dependent proteolytic system that is the
                     prokaryotic homolog of the proteasome. HslV is a dimer of
                     hexamers (a dodecamer) that forms a central proteolytic
                     chamber with active sites on the...; Region:
                     protease_HslV; cd01913"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(110703..110705,110976..110978,
                     111018..111020,111024..111026,111072..111074))
                     /gene="hslV"
                     /locus_tag="YPTB0098"
                     /note="active site"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(110595..110597,110601..110606,
                     110613..110615,110625..110627,110658..110660,
                     110682..110684,110691..110696,110733..110735,
                     110745..110747,110826..110828,110997..111005))
                     /gene="hslV"
                     /locus_tag="YPTB0098"
                     /note="HslU subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238894"
     misc_feature    complement(110907..110963)
                     /gene="hslV"
                     /locus_tag="YPTB0098"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(111177..112022)
                     /gene="ftsN"
                     /locus_tag="YPTB0099"
                     /gene_synonym="msgA"
                     /db_xref="GeneID:2955658"
     CDS             complement(111177..112022)
                     /gene="ftsN"
                     /locus_tag="YPTB0099"
                     /gene_synonym="msgA"
                     /note="similar to Yersinia pestis YPO0107 ftsN, msgA; cell
                     division protein (99.6% evalue=1.E-160); Salmonella
                     typhimurium STM4093 ftsN; essential cell division protein
                     (51% evalue=2.E-77)"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsN"
                     /protein_id="YP_068648.1"
                     /db_xref="GI:51594457"
                     /db_xref="GeneID:2955658"
                     /translation="MAQRDYVSRGRSGARRKSTSRKKRSAPIVSKTVMALAVALLVVF
                     VGGLYFITHNKPGELPLLPNHDPRTGNGLPPKPEERWRYIKELENRQIGVPMPTEPSA
                     GGEVNAKTELTNEQRQLLEQMQADMRQQPTQLSEVPYNQGMQQVPRSAVTIKPPATSV
                     QPQPVTPPRQTTIPVQPQAPAPVRTPPAAPVTQAVTPPKVEKEKEKTQRWMVQCGSFK
                     AVDQAESIRAQLAFAGIESRITSGGGWNRVVLGPYNSKAAADKALQRLQGAGQSGCIP
                     LSVGG"
     misc_feature    complement(111180..111926)
                     /gene="ftsN"
                     /locus_tag="YPTB0099"
                     /gene_synonym="msgA"
                     /note="cell division protein FtsN; Provisional; Region:
                     PRK12757"
                     /db_xref="CDD:237191"
     misc_feature    complement(111198..111407)
                     /gene="ftsN"
                     /locus_tag="YPTB0099"
                     /gene_synonym="msgA"
                     /note="Sporulation related domain; Region: SPOR;
                     pfam05036"
                     /db_xref="CDD:252961"
     misc_feature    complement(111870..111935)
                     /gene="ftsN"
                     /locus_tag="YPTB0099"
                     /gene_synonym="msgA"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(112088..113116)
                     /gene="cytR"
                     /locus_tag="YPTB0100"
                     /db_xref="GeneID:2955418"
     CDS             complement(112088..113116)
                     /gene="cytR"
                     /locus_tag="YPTB0100"
                     /note="negatively controls the transcription initiation of
                     genes such as deoCABD, udp, and cdd encoding catabolizing
                     enzymes and nupC, nupG, and tsx encoding transporting and
                     pore-forming proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator CytR"
                     /protein_id="YP_068649.2"
                     /db_xref="GI:161760593"
                     /db_xref="GeneID:2955418"
                     /translation="MENKKEFTMTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKV
                     EQAVLAVGYSPHALSRNIKRNESRTILVIVPDISDPFFADVIQGIEHAAAQQGYLILI
                     GDCAQQTQQERTFVNLIITKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELE
                     LPTVHIDNLTAAYEAVNYLHELGHKRIACIAGPESLPLSHYRLQGYIQALRRNGITVD
                     NDYIIRGDFSYEAGAQSFAALMELPHPPTAIFSHNDVMAVGAIWQAKQLGLRIPQDVS
                     LVGFDDLKLSQFCDPPLTTVAQPRYQIGQQAMLLLLEQLQGHSVQSGSRLLDTELIIR
                     ESTAAPKH"
     misc_feature    complement(112925..113080)
                     /gene="cytR"
                     /locus_tag="YPTB0100"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(112928..112933,112937..112942,
                     112949..112951,112958..112960,112997..112999,
                     113006..113011,113024..113026,113033..113038,
                     113042..113056,113078..113080))
                     /gene="cytR"
                     /locus_tag="YPTB0100"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(112094..113020)
                     /gene="cytR"
                     /locus_tag="YPTB0100"
                     /note="DNA-binding transcriptional regulator CytR;
                     Provisional; Region: PRK11041"
                     /db_xref="CDD:182923"
     misc_feature    complement(112931..112960)
                     /gene="cytR"
                     /locus_tag="YPTB0100"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(112109..112912)
                     /gene="cytR"
                     /locus_tag="YPTB0100"
                     /note="Ligand-binding domain of an uncharacterized
                     transcription regulator from Actinobacillus succinogenes
                     and its close homologs from other bacteria; Region:
                     PBP1_LacI_like_6; cd06284"
                     /db_xref="CDD:107279"
     misc_feature    complement(order(112331..112333,112430..112432,
                     112748..112750,112805..112807,112811..112813,
                     112820..112822,112847..112849,112910..112912))
                     /gene="cytR"
                     /locus_tag="YPTB0100"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107279"
     misc_feature    complement(order(112223..112225,112274..112276,
                     112511..112513,112880..112882))
                     /gene="cytR"
                     /locus_tag="YPTB0100"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107279"
     gene            complement(113469..115667)
                     /gene="priA"
                     /locus_tag="YPTB0101"
                     /db_xref="GeneID:2956318"
     CDS             complement(113469..115667)
                     /gene="priA"
                     /locus_tag="YPTB0101"
                     /note="binding of PriA to forked DNA starts the assembly
                     of the primosome, also possesses 3'-5' helicase activity"
                     /codon_start=1
                     /transl_table=11
                     /product="primosome assembly protein PriA"
                     /protein_id="YP_068650.1"
                     /db_xref="GI:51594459"
                     /db_xref="GeneID:2956318"
                     /translation="MSVVQVALPVPLARTFDYRLDSAMACPVVGARVSVPFGKRKAIG
                     IVVGLSDTSTFPLEQLKTIDAILDNHSLFPPSLWRILCWATEYYHYPIGEVLFHALPI
                     LLRQGRPAQSAPLWQWFVTEQGRATPPESLKRAPKQQQALAALLQKPVYRHQVNEMAL
                     TESALQALRSKGLIDLRAQEATTTDWRHSFSVLGERLRLNTEQATAVGAIRSEDNQFA
                     AWLLAGVTGSGKTEVYLSVLENILAQGRQALILVPEIGLTPQTIARFRERFNAPVEVL
                     HSGLNDSERLSVWLRARSGEAAIVIGTRSALFTPFSRLGVIIIDEEHDSSYKQQEGWR
                     YHARDLAVFRAREEGIPIVMGTATPALETLHNVQMGKYRQLTLTKRAGSAKPAAQHLL
                     DLKGLPLKVGLSQPLLKRMKTHLQAGNQVILFLNRRGYAPALLCHECGWIAECQRCDH
                     YYTLHQNHRQLRCHHCDSQRPVPQQCPKCGSTHLVSVGVGTEQLENELAPLFPETPIT
                     RIDRDTTSRKGSLEQHLADVHQGGARILIGTQMLAKGHHFPDVTLVALLDVDGALFSA
                     DFRSAERFAQLYTQVSGRAGRAGKQGEVILQTHHPEHPLLQILLQQGYDAFAKQALEE
                     RKSVFLPPYTSHIIVRSEDHDNQQSALFLQQLRNLLEASPLKDEALWIMGPVPALQAK
                     RGGRFRWQLLLQHPSRQLLQRLIKTSQPLISTLPQARKVKWTIDVDPIDS"
     misc_feature    complement(113475..115667)
                     /gene="priA"
                     /locus_tag="YPTB0101"
                     /note="primosome assembly protein PriA; Validated; Region:
                     PRK05580"
                     /db_xref="CDD:235514"
     misc_feature    complement(114591..115007)
                     /gene="priA"
                     /locus_tag="YPTB0101"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(114975..114989)
                     /gene="priA"
                     /locus_tag="YPTB0101"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(114699..114710)
                     /gene="priA"
                     /locus_tag="YPTB0101"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(113901..114194)
                     /gene="priA"
                     /locus_tag="YPTB0101"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     gene            115920..116135
                     /gene="rpmE"
                     /locus_tag="YPTB0102"
                     /db_xref="GeneID:2956514"
     CDS             115920..116135
                     /gene="rpmE"
                     /locus_tag="YPTB0102"
                     /note="RpmE; there appears to be two types of ribosomal
                     proteins L31 in bacterial genomes; some contain a CxxC
                     motif while others do not; Bacillus subtilis has both
                     types; the proteins in this cluster have the CXXC motif;
                     RpmE is found in exponentially growing Bacilli while YtiA
                     was found after exponential growth; expression of ytiA is
                     controlled by a zinc-specific transcriptional repressor;
                     RpmE contains one zinc ion and a CxxC motif is responsible
                     for this binding; forms an RNP particle along with
                     proteins L5, L18, and L25 and 5S rRNA; found crosslinked
                     to L2 and L25 and EF-G; may be near the
                     peptidyltransferase site of the 50S ribosome"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="YP_068651.1"
                     /db_xref="GI:51594460"
                     /db_xref="GeneID:2956514"
                     /translation="MKQGIHPKYEQVTASCSCGNVIKINSTVGHDLNLDVCGECHPFY
                     TGKQRDVASGGRVDRFNKRFSVPGAKK"
     misc_feature    115920..116132
                     /gene="rpmE"
                     /locus_tag="YPTB0102"
                     /note="50S ribosomal protein L31; Reviewed; Region: rpmE;
                     PRK00019"
                     /db_xref="CDD:234576"
     gene            complement(116677..117132)
                     /locus_tag="YPTB0103"
                     /db_xref="GeneID:2953079"
     CDS             complement(116677..117132)
                     /locus_tag="YPTB0103"
                     /note="similar to Yersinia pestis YPO0112 conserved
                     hypothetical protein (100% evalue=2.E-81); Ralstonia
                     solanacearum RS01011 hypothetical transmembrane protein
                     (57.5% evalue=2.E-45)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068652.1"
                     /db_xref="GI:51594461"
                     /db_xref="GeneID:2953079"
                     /translation="MNPNYAKPSAAFTAASWSALLGGFVIFLIGLWNADMQLNERGYY
                     FAVLILGLFSAVSLQKTVRDKLEGLAITSIYYGLCWVAFIVAVLLLCIGLWNATLALS
                     EKGFYGVTFFMTLFGAIAVQKNTRDSAMSSDTESASLFKKVRDQLKAED"
     misc_feature    complement(116749..117132)
                     /locus_tag="YPTB0103"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4682"
                     /db_xref="CDD:227027"
     misc_feature    complement(116941..117099)
                     /locus_tag="YPTB0103"
                     /note="yiaA/B two helix domain; Region: YiaAB; pfam05360"
                     /db_xref="CDD:114102"
     misc_feature    complement(116752..116910)
                     /locus_tag="YPTB0103"
                     /note="yiaA/B two helix domain; Region: YiaAB; pfam05360"
                     /db_xref="CDD:114102"
     misc_feature    complement(join(116767..116817,116845..116910,
                     116956..117009,117037..117102))
                     /locus_tag="YPTB0103"
                     /note="4 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(117481..117798)
                     /gene="metJ"
                     /locus_tag="YPTB0104"
                     /db_xref="GeneID:2956027"
     CDS             complement(117481..117798)
                     /gene="metJ"
                     /locus_tag="YPTB0104"
                     /note="when combined with S-adenosylmethionine represses
                     the expression of the methionine regulon and of proteins
                     involved in S-adenosylmethionine synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor protein MetJ"
                     /protein_id="YP_068653.1"
                     /db_xref="GI:51594462"
                     /db_xref="GeneID:2956027"
                     /translation="MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRR
                     QVNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDT
                     WEY"
     misc_feature    complement(117487..117795)
                     /gene="metJ"
                     /locus_tag="YPTB0104"
                     /note="Met Repressor, MetJ.  MetJ is a bacterial
                     regulatory protein that uses S-adenosylmethionine (SAM) as
                     a corepressor to regulate the production of Methionine.
                     MetJ binds arrays of two to five adjacent copies of an
                     eight base-pair 'metbox'...; Region: Met_repressor_MetJ;
                     cd00490"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(117586..117588,117601..117609,
                     117613..117618,117622..117627,117634..117636,
                     117679..117681,117688..117693,117697..117702,
                     117706..117741,117760..117762,117766..117771))
                     /gene="metJ"
                     /locus_tag="YPTB0104"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(117634..117642,117676..117678,
                     117715..117717,117721..117735,117745..117747))
                     /gene="metJ"
                     /locus_tag="YPTB0104"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(117583..117588,117595..117597,
                     117601..117609,117613..117621,117628..117630,
                     117667..117672,117679..117681))
                     /gene="metJ"
                     /locus_tag="YPTB0104"
                     /note="corepressor binding sites; other site"
                     /db_xref="CDD:119402"
     gene            118176..119336
                     /gene="metB"
                     /locus_tag="YPTB0105"
                     /db_xref="GeneID:2956020"
     CDS             118176..119336
                     /gene="metB"
                     /locus_tag="YPTB0105"
                     /EC_number="2.5.1.48"
                     /note="catalyzes the formation of cystathionine from
                     L-cysteine and O-succinyl-L-homoserine"
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="YP_068654.1"
                     /db_xref="GI:51594463"
                     /db_xref="GeneID:2956020"
                     /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTH
                     DYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAIHLVCTTFLQPGDLLVAPHDCYG
                     GSYRLFDSLSKRGAYRVLFVDQGDEAALNRALAEKPKLVLIETPSNPLLRVVDIAAIC
                     QAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPEL
                     VVELAWWANNIGVTGAAFDSYLLLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLY
                     HPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALELFTLAESLGGVESLI
                     SHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQLAVTR"
     misc_feature    118236..119315
                     /gene="metB"
                     /locus_tag="YPTB0105"
                     /note="CGS_like: Cystathionine gamma-synthase is a PLP
                     dependent enzyme and catalyzes the committed step of
                     methionine biosynthesis. This pathway is unique to
                     microorganisms and plants, rendering the enzyme an
                     attractive target for the development of...; Region:
                     CGS_like; cd00614"
                     /db_xref="CDD:99738"
     misc_feature    order(118260..118271,118275..118280,118311..118313,
                     118317..118319,118395..118400,118404..118409,
                     118476..118478,118491..118493,118500..118502,
                     118764..118766,118788..118790,118794..118796,
                     118845..118847,118875..118877,118881..118886,
                     119121..119123)
                     /gene="metB"
                     /locus_tag="YPTB0105"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99738"
     misc_feature    order(118398..118406,118476..118478,118605..118607,
                     118692..118694,118758..118760,118764..118769,
                     118794..118796)
                     /gene="metB"
                     /locus_tag="YPTB0105"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99738"
     misc_feature    order(118398..118406,118476..118478,118692..118694,
                     118701..118703,118758..118760,118764..118769)
                     /gene="metB"
                     /locus_tag="YPTB0105"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99738"
     misc_feature    118767..118769
                     /gene="metB"
                     /locus_tag="YPTB0105"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99738"
     gene            119339..121774
                     /gene="metL"
                     /locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /db_xref="GeneID:2956029"
     CDS             119339..121774
                     /gene="metL"
                     /locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /EC_number="1.1.1.13"
                     /EC_number="2.7.2.4"
                     /note="multifunctional homodimeric enzyme that catalyzes
                     the phosphorylation of aspartate to form
                     aspartyl-4-phosphate as well as conversion of aspartate
                     semialdehyde to homoserine; functions in a number of amino
                     acid biosynthetic pathways"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aspartate kinase II/homoserine
                     dehydrogenase II"
                     /protein_id="YP_068655.1"
                     /db_xref="GI:51594464"
                     /db_xref="GeneID:2956029"
                     /translation="MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGD
                     LMVVSAAGSTTNQLISWLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISE
                     FIHDLERLAGLLDNKIDDVIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRA
                     ERAAQPQIDESRSYPLLQQLMAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQV
                     GALAGAERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQP
                     VSGSDIDLQLRCSYQPEQGSTRIERVLASGLGAKIVTSHDDVCLIELQIASHHDFSLA
                     QKEIDLLLKRAQIKPLATGIHPDRNLLQLCYTSEVVNSALRVLEDAALPGKLSLREGL
                     ALVALVGAGVSKNPLHSHRFYQQLKDQPVEFVWQAEDGISMVAVLRLGPTEHLIQGLH
                     QSLFRAEKRIGLMLFGKGNIGARWLELFAREQKSLSARSGFEFVLAGVVDSRRSLLSY
                     DGLDASRTLAFYNDEAKEQDEESLFLWMRAHPFDDLVVLDVTASPSLAEQYLDFASYG
                     FHVISANKLAGASSSNNYRQIRDAFAKTGRHWLYNATVGAGLPVNHTVRDLRDSGDSI
                     LAISGIFSGTLSWLFLQFDGSVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILA
                     REAGYDIEPNQVRVESLVPAGAESGSVDQFFENGEALNQQMIQRLEAAKEMGLVLRYV
                     ARFDANGKARVGVEAVRTDHPLASLLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAG
                     AIQSDLNRLSQLL"
     misc_feature    119372..121771
                     /gene="metL"
                     /locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /note="bifunctional aspartate kinase II/homoserine
                     dehydrogenase II; Provisional; Region: metL; PRK09466"
                     /db_xref="CDD:236530"
     misc_feature    119378..120238
                     /gene="metL"
                     /locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /note="AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK),
                     AK-HSDH; this CD includes the N-terminal catalytic domain
                     of aspartokinase (AK) of the bifunctional enzyme AK -
                     homoserine dehydrogenase (HSDH). These aspartokinases are
                     found in bacteria (E. coli...; Region: AAK_AK-HSDH;
                     cd04257"
                     /db_xref="CDD:239790"
     misc_feature    order(119387..119389,119501..119503,119729..119731,
                     119972..119974,120107..120109,120146..120148)
                     /gene="metL"
                     /locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239790"
     misc_feature    order(119387..119389,119393..119401,120032..120037,
                     120044..120049)
                     /gene="metL"
                     /locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /note="putative nucleotide binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239790"
     misc_feature    order(119483..119488,119501..119503,119729..119731)
                     /gene="metL"
                     /locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /note="putative aspartate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239790"
     misc_feature    120515..120700
                     /gene="metL"
                     /locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /note="ACT domains are commonly involved in specifically
                     binding an amino acid or other small ligand leading to
                     regulation of the enzyme; Region: ACT; cl09141"
                     /db_xref="CDD:263730"
     misc_feature    120734..121141
                     /gene="metL"
                     /locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /note="Homoserine dehydrogenase, NAD binding domain;
                     Region: NAD_binding_3; pfam03447"
                     /db_xref="CDD:251960"
     misc_feature    121163..121750
                     /gene="metL"
                     /locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /note="Homoserine dehydrogenase; Region: Homoserine_dh;
                     pfam00742"
                     /db_xref="CDD:250099"
     gene            122007..122891
                     /gene="metF"
                     /locus_tag="YPTB0107"
                     /db_xref="GeneID:2956024"
     CDS             122007..122891
                     /gene="metF"
                     /locus_tag="YPTB0107"
                     /EC_number="1.5.1.20"
                     /note="MTHFR; catalyzes NADH-linked reduction of
                     5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate
                     using FAD as a cofactor"
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="YP_068656.1"
                     /db_xref="GI:51594465"
                     /db_xref="GeneID:2956024"
                     /translation="MSFFHANQREALNQSLSELQGQINVSFEFFPPRTSEMEDTLWSS
                     IDRLSTLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASPTQLRDI
                     AIDYWNSGIRHIVALRGDLPPNSGKPEMYACDLVGLLKDVGDFDISVAAYPEIHPEAK
                     SAQADLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFK
                     QLQRFATMTNVRVPNWMTSIFDGLDNDPETRKMVGASVAMDMVKILSREGVKDFHFYT
                     LNRAELSYAICHTLGVRP"
     misc_feature    122079..122876
                     /gene="metF"
                     /locus_tag="YPTB0107"
                     /note="Methylenetetrahydrofolate reductase (MTHFR).
                     5,10-Methylenetetrahydrofolate is reduced to
                     5-methyltetrahydrofolate by methylenetetrahydrofolate
                     reductase, a cytoplasmic, NAD(P)-dependent enzyme.
                     5-methyltetrahydrofolate is utilized by methionine
                     synthase...; Region: MTHFR; cd00537"
                     /db_xref="CDD:238299"
     misc_feature    order(122184..122186,122268..122270,122355..122363,
                     122397..122402,122454..122456,122460..122462,
                     122472..122474,122478..122480,122499..122501,
                     122508..122510,122517..122522,122547..122549,
                     122553..122555,122829..122831)
                     /gene="metF"
                     /locus_tag="YPTB0107"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:238299"
     gene            complement(123720..126356)
                     /gene="ppc"
                     /locus_tag="YPTB0108"
                     /gene_synonym="glu"
                     /db_xref="GeneID:2956304"
     CDS             complement(123720..126356)
                     /gene="ppc"
                     /locus_tag="YPTB0108"
                     /gene_synonym="glu"
                     /EC_number="4.1.1.31"
                     /note="catalyzes the formation of oxaloacetate from
                     phosphoenolpyruvate"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxylase"
                     /protein_id="YP_068657.1"
                     /db_xref="GI:51594466"
                     /db_xref="GeneID:2956304"
                     /translation="MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILDRVETIRKLSKS
                     SRAGNEASRQELLTTLQNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPE
                     ALAQLFTRLKDKKLSDQDMRSAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQL
                     DHNDLADYERNKIMRRLRQLVAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPA
                     FLREFNEQLENSLDYRLPVEAVPIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATD
                     LFLRDIQVLVSELSMSECTPELRELAGGEEVLEPYRQLMKNVRTQLTNTQAYLEARLK
                     GERVLPPHDLLVSNDQLWEPLYACYQSLKACGMEIIANGQLLDTLRRVRCFGVPLVRI
                     DVRQESTRHTDAIAELTRYLGLGDYESWSESDKQAFLVRELNSKRPLVPLKWEPSAET
                     QEVLETCRVIAEAPQGSIAAYVISMAKVPSDVLAVHLLLKEAGCPFTLPVAPLFETLD
                     DLNNADDVMTQLLGIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYRAQDALIKT
                     CEKAGITLTLFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKFGLPE
                     VTISSLALYAGAILEANLLPPPEPKKEWIEVMDLLSDASCDMYRSYVRENPEFVRYFR
                     AATPELELGKLPLGSRPAKRRPDGGVESLRAIPWIFAWTQNRLMLPAWLGAGAGLQRA
                     IDAGKRDVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEYYDQRLVDKSLWPLGQQLR
                     DQLAADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNVLQAELLHRSRQQEHPD
                     ACVEQALMVTIAGVAAGMRNTG"
     misc_feature    complement(123723..126356)
                     /gene="ppc"
                     /locus_tag="YPTB0108"
                     /gene_synonym="glu"
                     /note="phosphoenolpyruvate carboxylase; Reviewed; Region:
                     PRK00009"
                     /db_xref="CDD:234570"
     gene            complement(126730..127899)
                     /gene="argE"
                     /locus_tag="YPTB0109"
                     /db_xref="GeneID:2955215"
     CDS             complement(126730..127899)
                     /gene="argE"
                     /locus_tag="YPTB0109"
                     /EC_number="3.5.1.16"
                     /note="catalyzes the formation of L-ornithine from
                     N(2)-acetyl-L-ornithine in arginine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine deacetylase"
                     /protein_id="YP_068658.1"
                     /db_xref="GI:51594467"
                     /db_xref="GeneID:2955215"
                     /translation="MKMKLPPFIELYRALIATPSISAADSALDQSNEALINLLAGWFA
                     DLGFRVEIQPVPDTRHKFNLLASIGENENGEGHGGLLLAGHTDTVPYDEGRWTRDPFT
                     LTEHDHKLYGLGTADMKGFFAFILDAVRDIDASKLTKPLYILATADEETTMAGARYFA
                     ANTQLRPDFAIIGEPTSLQPVRAHKGHISNAIRITGQSGHSSDPARGVNAIDLMHESI
                     TQLMALRTTLQERYHNPAFTIPYPTMNFGHINGGDAANRICACCELHMDIRPLPGLTL
                     SDLNELMTEALEPVSQRWPGRLSIDELHPPIPGYECPTDHHMVGVIEKLLGERTAVVN
                     YCTEAPFIQQVCPTLVLGPGSINQAHQPDEFIDMAFIEPTRELIGQLVDHFCQQK"
     misc_feature    complement(126754..127872)
                     /gene="argE"
                     /locus_tag="YPTB0109"
                     /note="acetylornithine deacetylase (ArgE); Region:
                     AcOrn-deacetyl; TIGR01892"
                     /db_xref="CDD:130947"
     misc_feature    complement(126754..127872)
                     /gene="argE"
                     /locus_tag="YPTB0109"
                     /note="M20 Peptidase acetylornithine deacetylase; Region:
                     M20_ArgE; cd03894"
                     /db_xref="CDD:193514"
     misc_feature    complement(order(127378..127380,127450..127455,
                     127549..127551,127645..127647))
                     /gene="argE"
                     /locus_tag="YPTB0109"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193514"
     misc_feature    complement(order(126898..126900,127093..127095,
                     127099..127101,127123..127128,127144..127167,
                     127171..127173,127234..127236,127243..127248,
                     127252..127257,127264..127269,127273..127275,
                     127291..127302,127333..127335))
                     /gene="argE"
                     /locus_tag="YPTB0109"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193514"
     gene            128144..129148
                     /gene="argC"
                     /locus_tag="YPTB0110"
                     /db_xref="GeneID:2955214"
     CDS             128144..129148
                     /gene="argC"
                     /locus_tag="YPTB0110"
                     /EC_number="1.2.1.38"
                     /note="catalyzes the reduction of N-acetyl-5-glutamyl
                     phosphate to N-acetyl-L-glutamate 5-semialdehyde in
                     arginine biosynthesis and the reduction of
                     N-acetyl-gamma-aminoadipyl-phosphate to
                     N-acetyl-L-aminoadipate-semialdehyde in lysine
                     biosynthesis; involved in both the arginine and lysine
                     biosynthetic pathways; lysine is produced via the AAA
                     pathway, lysine from alpha-aminoadipate"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="YP_068659.1"
                     /db_xref="GI:51594468"
                     /db_xref="GeneID:2955214"
                     /translation="MLNTLIVGASGYAGAELTAYLNRHPHMNITGLAVSAQSADAGKL
                     LSELHPQLKGILDLPLQPLVDVAQAAKGIDVVFLATAHEVSHDLAPQFLAAGCVVFDL
                     SGAFRVRDAAFYSQYYGFEHQHPDWLDKAVYGLAEWQSEDIKQAQLIAVPGCYPTASQ
                     LALKPLVDGQLLNDAQWPVINAVSGVSGAGRKASMGNSFCEVSLQPYGLFTHRHQPEI
                     VAHLGTPVIFTPHLGNFARGILATITCRLKAGVTAQNIADAYHHAYQNKPLVRLYQQG
                     VPALKAVVGLPFCDIGFSVQGEHLIIVATEDNLLKGAAAQAVQCMNIRFGFPETQSLL
                     "
     misc_feature    128144..129142
                     /gene="argC"
                     /locus_tag="YPTB0110"
                     /note="N-acetyl-gamma-glutamyl-phosphate reductase;
                     Validated; Region: argC; PRK00436"
                     /db_xref="CDD:234761"
     misc_feature    128159..128581
                     /gene="argC"
                     /locus_tag="YPTB0110"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; pfam01118"
                     /db_xref="CDD:250373"
     misc_feature    128630..129076
                     /gene="argC"
                     /locus_tag="YPTB0110"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase,
                     C-terminal domain; Region: Gp_dh_C; cl19935"
                     /db_xref="CDD:268288"
     gene            129331..130104
                     /gene="argB"
                     /locus_tag="YPTB0111"
                     /db_xref="GeneID:2955213"
     CDS             129331..130104
                     /gene="argB"
                     /locus_tag="YPTB0111"
                     /EC_number="2.7.2.8"
                     /note="catalyzes the phosphorylation of
                     N-acetyl-L-glutamate to form N-acetyl-L-glutamate
                     5-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="YP_068660.1"
                     /db_xref="GI:51594469"
                     /db_xref="GeneID:2955213"
                     /translation="MNPLVIKLGGVLLDSEEALERLFTALVTYREKHERPLVIMHGGG
                     CLVDELMKRLALPVVKKNGLRVTPADQIDIITGALAGTANKTLLAWAVKHQINAVGLC
                     LADGNTVTVTLLDAELGHVGKAQPGSAALVQTLLAAGYMPIISSIGITVEGQLMNVNA
                     DQAATALAATLGADLILLSDVSGILDGKGQRIAEMTAQKAEQLIAQGIITDGMVVKVN
                     AALDAARSLGRPVDIASWRHSEQLPALFNGVPIGTRISV"
     misc_feature    129340..130095
                     /gene="argB"
                     /locus_tag="YPTB0111"
                     /note="AAK_NAGK-NC: N-Acetyl-L-glutamate kinase -
                     noncyclic (NAGK-NC) catalyzes the phosphorylation of the
                     gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in
                     the second step of microbial arginine biosynthesis using
                     the acetylated, noncyclic route of...; Region:
                     AAK_NAGK-NC; cd04249"
                     /db_xref="CDD:239782"
     misc_feature    order(129349..129351,129355..129360,129457..129462,
                     129865..129867,129883..129885,129952..129954,
                     129958..129960,129976..129978)
                     /gene="argB"
                     /locus_tag="YPTB0111"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239782"
     misc_feature    order(129457..129462,129523..129525,129799..129804,
                     129808..129810)
                     /gene="argB"
                     /locus_tag="YPTB0111"
                     /note="N-acetyl-L-glutamate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239782"
     gene            130271..131644
                     /gene="argH"
                     /locus_tag="YPTB0112"
                     /db_xref="GeneID:2955217"
     CDS             130271..131644
                     /gene="argH"
                     /locus_tag="YPTB0112"
                     /EC_number="4.3.2.1"
                     /note="catalyzes the formation of arginine from
                     (N-L-arginino)succinate"
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="YP_068661.1"
                     /db_xref="GI:51594470"
                     /db_xref="GeneID:2955217"
                     /translation="MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKAL
                     VTVGVLNADEQQQLEQALSVLLEEVQANPHAILASDAEDIHSWVETKLIDKVGDLGKK
                     LHTGRSRNDQVATDLKLWCKFQITELQTAVQQLQQALVMTAEANQDAVMPGYTHLQRA
                     QPVTFAHWCLAYVEMLSRDESRLQDTLKRLDVSPLGCGALAGTAYAIDREQLAGWLGF
                     ASATRNSLDSVSDRDHVLELLSDASIGMVHLSRFAEDLIFFNSGEAAFVDLSDRVTSG
                     SSLMPQKKNPDALELIRGKCGRVQGALTGMTMTLKGLPLAYNKDMQEDKEGLFDALNT
                     WLDCLHMAALVLDGIQVKRPRCKEAAEQGYANATELADYLVAKGVPFREAHHIVGEAV
                     VEAIRQGKALEALALSDLQQFSSVIGDDVYPILALQSCLDKRVAKGGVSPQQVASAIA
                     EAKARLF"
     misc_feature    130271..131635
                     /gene="argH"
                     /locus_tag="YPTB0112"
                     /note="argininosuccinate lyase; Provisional; Region:
                     PRK04833"
                     /db_xref="CDD:179883"
     misc_feature    130334..131638
                     /gene="argH"
                     /locus_tag="YPTB0112"
                     /note="Argininosuccinate lyase (argininosuccinase, ASAL);
                     Region: Argininosuccinate_lyase; cd01359"
                     /db_xref="CDD:176463"
     misc_feature    order(130334..130336,130346..130348,130517..130519,
                     130523..130525,130592..130600,130607..130609,
                     130733..130738,130964..130966,131093..131095,
                     131099..131101,131123..131125,131129..131131,
                     131138..131140,131219..131221,131225..131227,
                     131234..131236,131240..131245)
                     /gene="argH"
                     /locus_tag="YPTB0112"
                     /note="active sites [active]"
                     /db_xref="CDD:176463"
     misc_feature    order(130562..130564,130571..130573,130580..130585,
                     130730..130753,130769..130771,130781..130786,
                     130802..130804,130811..130816,130823..130825,
                     130835..130837,130868..130882,130886..130888,
                     130895..130897,130937..130951,130958..130963,
                     130967..130969,130979..130981,130988..130990,
                     131000..131002,131009..131014,131018..131023,
                     131030..131035,131048..131053,131060..131062,
                     131084..131086,131102..131113,131117..131125,
                     131129..131131,131138..131143,131147..131164,
                     131168..131176,131183..131185,131189..131197,
                     131219..131230,131237..131239,131246..131248,
                     131279..131281,131288..131290,131369..131371,
                     131384..131386,131396..131398,131411..131416,
                     131423..131425,131432..131434,131570..131572,
                     131576..131590,131612..131614)
                     /gene="argH"
                     /locus_tag="YPTB0112"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176463"
     gene            132243..134735
                     /locus_tag="YPTB0113"
                     /db_xref="GeneID:2953080"
     CDS             132243..134735
                     /locus_tag="YPTB0113"
                     /note="similar to Yersinia pestis YPO3923  TonB dependent
                     receptor protein (99.5% evalue=0); Pseudomonas aeruginosa
                     PA3408 hasR; heme acquisition protein HasR (45.7%
                     evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB dependent receptor protein"
                     /protein_id="YP_068662.1"
                     /db_xref="GI:51594471"
                     /db_xref="GeneID:2953080"
                     /translation="MDNIIRDKKTIISVNKITTCILFALVTQSYSGQLAANTATIPTN
                     NNDMALDKLNVEGKGNAHDSDWIYDEPRSVSEITREQLDNRPARHAADILEQTPGVYS
                     SVSQQDPGLSINIRGIQDYGRVNMNIDGMRQNFMKSGHGQRNGSMYIDPEILSNVVIE
                     RGIFNGIGGAGAIGGIATFNTINASDFLAPEKELGGHIRAMTGDNGTRFIGSGALALG
                     NPNGDILLAVSERNLKDYWPGNKGVLAGLRLYSPTRNVGDDLKNTKTLFTGYKMRSQL
                     AKVGWNFEAGQRLEFSYLQTQIASPNASMLSEVLALSPSGKEITKIGWRNTSFTNVEN
                     RNIALDYRLNPEHISWLDATAKIYYVDTNDETDNANSLFKEYFWTQTRLKTRGLQLQN
                     TNTFTPSDAHQIRLKYGLEWFSDKSEGYSTRKLIERTTPPGKRAITSTFAQLNYEYDD
                     WLRLEGGLRYDQFRLKGNTWLHTRSFLQPYTFENPCDRRIHEQSEKPGSRCSSRRPAT
                     MRWDVDRREQQLSPTLAMGVKPGLEWLEFFGSYGKSWRPPAMTEVLATGTAHGYSWVL
                     PNPFVAAERARTWEAGFNIQQSNLFIEDDHFAAKVAYFDTRIANYINLELGKAKPKFG
                     GDSFTDVAYVNNLLKTRFRGLEYQLSYDAGTFYTNINYTRMIGVNNVCSPYAWLGGLQ
                     SVKYKYVGKVEQIYAVENEVANNYVTCMNANVLFGSSAYLPGDRGSLTLGSRIFDRRL
                     DFGTVIRYNKGYQDRSAQDENGNPLTAYVADWPKYIVYDLYASYKVTNNLILRSSIEN
                     ITNRAYLVNYGDTLSFAPSRGRTIQGGFEYKF"
     misc_feature    132423..134732
                     /locus_tag="YPTB0113"
                     /note="TonB-dependent heme/hemoglobin receptor family
                     protein; Region: TonB-hemin; TIGR01785"
                     /db_xref="CDD:233576"
     misc_feature    132459..134732
                     /locus_tag="YPTB0113"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            134963..135580
                     /gene="HasA"
                     /locus_tag="YPTB0114"
                     /db_xref="GeneID:2955768"
     CDS             134963..135580
                     /gene="HasA"
                     /locus_tag="YPTB0114"
                     /note="similar to Yersinia pestis YPO3922 hemophore HasA
                     (98.5% evalue=1.E-115); Pseudomonas aeruginosa PA3407
                     hasAp; heme acquisition protein HasAp (30.3%
                     evalue=9.E-18)"
                     /codon_start=1
                     /transl_table=11
                     /product="heme acquisition hemophore HasA"
                     /protein_id="YP_068663.1"
                     /db_xref="GI:51594472"
                     /db_xref="GeneID:2955768"
                     /translation="MSTTIQYNSNYADYSISSYLREWANNFGDIDQAPAETKDRGSFS
                     GSSTLFSGTQYAIGSSHSNPEGMIAEGDLKYSFMPQHTFHGQIDTLQFGKDLATNAGG
                     PSAGKHLEKIDITFNELDLSGEFDSGKSMTENHQGDMHKSVRGLMKGNPDPMLEVMKA
                     KGINVDTAFKDLSIASQYPDSGYMSDAPMVDTVGVMDSNDMLLAA"
     misc_feature    134963..135577
                     /gene="HasA"
                     /locus_tag="YPTB0114"
                     /note="Heme-binding protein A (HasA); Region: HasA;
                     pfam06438"
                     /db_xref="CDD:253731"
     gene            135746..137554
                     /locus_tag="YPTB0115"
                     /db_xref="GeneID:2953081"
     CDS             135746..137554
                     /locus_tag="YPTB0115"
                     /note="similar to Yersinia pestis YPO3920 ABC transporter
                     protein (99.6% evalue=0); Pseudomonas aeruginosa PA3406
                     hasD; transport protein HasD (58.4% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease/ATP-binding protein"
                     /protein_id="YP_068664.1"
                     /db_xref="GI:51594473"
                     /db_xref="GeneID:2953081"
                     /translation="MESCKTPGASSVPPTILSVLAGNKKILWGIGLFTAVINLLMLAP
                     AIYMLQVYDRVLASANTMTLLMLTVLVLGVFVFIGLLEWVRSAVVIRLGTQIDMQLNQ
                     PVFNAAFAANLKGHNTPAAQALNDLTVLRQFATGNALFAFFDAPWFPLYLLVIFLLHP
                     WLGMLAAAGAGILVVLAWLNQWICKKPLHDASIITSHATQQANANLRNADVIEAMGML
                     KALRERWLMQHANFLYQQNLASDKSSRVTAVAKSSRQALQSMMLGLGALLVIYNEITA
                     GVMIAGSILIGRVLGPIDQLIAVWKQWSHARLAYQRLSQLLAQHPSSPTGMVLPAPQG
                     KLNVTQLMACKPGTHIPVLHSINFELQPGDVLGILGPSGSGKSTLAKLLVASQPAFSG
                     TVRLDSADLSRWDKTQLGEFIGYLPQNIQLFRGTVAENIARFGAIDTAKVVAAAQLAD
                     VHDLILHLPQGYDTPLGDDGEGLSGGQRQRIALARAMYGIPRLIVLDEPNASLDKEGE
                     QALLASIIQLKQQGCTIVMITHKPELLSGSDYLLFLKNGQMDLFDRTQAVLQNIQGKD
                     KPAVQPEAKIRNSRSGWSNGVSYGIGPARTTSSPKP"
     misc_feature    135752..137485
                     /locus_tag="YPTB0115"
                     /note="ABC-type protease/lipase transport system, ATPase
                     and permease components [General function prediction
                     only]; Region: ArpD; COG4618"
                     /db_xref="CDD:226969"
     misc_feature    135962..136624
                     /locus_tag="YPTB0115"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    136781..137392
                     /locus_tag="YPTB0115"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    136853..136876
                     /locus_tag="YPTB0115"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(136862..136867,136871..136879,136997..136999,
                     137234..137239,137333..137335)
                     /locus_tag="YPTB0115"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    136988..136999
                     /locus_tag="YPTB0115"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    137162..137191
                     /locus_tag="YPTB0115"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    137222..137239
                     /locus_tag="YPTB0115"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    137246..137257
                     /locus_tag="YPTB0115"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    137321..137341
                     /locus_tag="YPTB0115"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    join(135824..135892,135920..135988,136151..136219,
                     136229..136297,136535..136603)
                     /locus_tag="YPTB0115"
                     /note="5 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            137630..138958
                     /locus_tag="YPTB0116"
                     /db_xref="GeneID:2953082"
     CDS             137630..138958
                     /locus_tag="YPTB0116"
                     /note="similar to Yersinia pestis YPO3919 HlyD family
                     secretion protein (98.8% evalue=0); Pseudomonas aeruginosa
                     PA3405 hasE; metalloprotease secretion protein (43.6%
                     evalue=1.E-93)"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="YP_068665.1"
                     /db_xref="GI:51594474"
                     /db_xref="GeneID:2953082"
                     /translation="MLPESACYSVANANRQPPLQINSGRYLNIGGGLVVIGFIGFLLW
                     AGLAPLDKGVAVTGLLVVAENRKVIQPLQGGRIQQLHVTEGDEIVSGQLLVTLDDTAI
                     RNQRDNLQHQYLSALAQEARLTAEQNDLDVITFPQALLEHATQPAVERNIILQQQLLH
                     HRRQAHLSEIARLSTQLTRHQARLDGLQAMRSNHQRQSNLFQQQLDSVQLLAKDGYIA
                     KNKLLEMESQLTSLQARVEQGTSDIAEAHKLIDETEQHVLQRREQYQSENSEQLAKAQ
                     QNTQELVQRLNIAEYELSHTRIFAPVSGSVIALAQHTVGGVVSSGQALMEIVPIGQPL
                     FVEAQLPVELIDKVAVGLPVDLNFSAFNQSNTPRLQGSVWRIGADRIQPPPTSPPYYP
                     LTVAIDLDPTELAIRPGMAVDVFIRTGERSLLSYLFKPFTDRLHLALAEE"
     misc_feature    137699..138955
                     /locus_tag="YPTB0116"
                     /note="type I secretion membrane fusion protein, HlyD
                     family; Region: type_I_hlyD; TIGR01843"
                     /db_xref="CDD:130902"
     misc_feature    137834..137959
                     /locus_tag="YPTB0116"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    138518..138856
                     /locus_tag="YPTB0116"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     misc_feature    137705..137773
                     /locus_tag="YPTB0116"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            139023..139826
                     /locus_tag="YPTB0117"
                     /db_xref="GeneID:2953083"
     CDS             139023..139826
                     /locus_tag="YPTB0117"
                     /note="similar to Yersinia pestis YPO3918  membrane
                     protein (98.8% evalue=1.E-147); C. jejuni Cj0181 tonB1;
                     possible tonB transport protein (34.8% evalue=3.E-18)"
                     /codon_start=1
                     /transl_table=11
                     /product="tonB protein"
                     /protein_id="YP_068666.1"
                     /db_xref="GI:51594475"
                     /db_xref="GeneID:2953083"
                     /translation="MNRLQQSSEKLIFWLVGALLACGIHIYALWWLSTASIPAIPTSY
                     PAAIMMELSAEPEFMQNLPQNSVVGITQNIIEPAVEQRINQPDDIVDLPTLPEQPEGQ
                     REITRKEPIKVKRPAENRATSRKPVNKETQESDSKQSSPAAAASAMLSGTSQQVAAAV
                     NSDSSHRQQAQVSWKSRLQGHLMGFKRYPSSARKQQQQGTAMIRFVVDKNGYVSSVQL
                     SNSSGTSALDREALAIIKRAQPLPKPPAELLSQGQITLSLPVDFNLKRK"
     misc_feature    139029..139817
                     /locus_tag="YPTB0117"
                     /note="Periplasmic protein TonB, links inner and outer
                     membranes [Cell envelope biogenesis, outer membrane];
                     Region: TonB; COG0810"
                     /db_xref="CDD:223880"
     misc_feature    139578..139814
                     /locus_tag="YPTB0117"
                     /note="Gram-negative bacterial TonB protein C-terminal;
                     Region: TonB_C; pfam03544"
                     /db_xref="CDD:252020"
     misc_feature    139056..139124
                     /locus_tag="YPTB0117"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(139942..141405)
                     /locus_tag="YPTB0118"
                     /db_xref="GeneID:2953084"
     CDS             complement(139942..141405)
                     /locus_tag="YPTB0118"
                     /EC_number="1.8.1.4"
                     /note="Catalyzes the oxidation of dihydrolipoamide to
                     lipoamide"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="YP_068667.1"
                     /db_xref="GI:51594476"
                     /db_xref="GeneID:2953084"
                     /translation="MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCA
                     RVGCMPSKLLIAAAEAVHQIEKAPGFGIHPQGKPLINGREVMDRVKRERDRFVGFVLK
                     GVETIPAADKIQGYARFIDDNTLQVDDHTQLTSQKIIAQRIVIATGSHPSWPASWNEL
                     GDRLIINDDVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDS
                     IVRDYAAKTLGDEFYLDPDVKVELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRR
                     PNVDKLGLENTSLILDERGVPQADRLTMQTNVPHIFIAGDASNQLPLLHEASDQARIA
                     GVNAGGFPEVVPGLRRSPISVVFSDPQIAMVGATFRELAQKFSACGCFEIGEVSFENQ
                     GRSRVMLKNKGILRIYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTIDQMLDMP
                     FYHPVIEEGLRTALRDLQSKLKLGADEAERCLRCPGE"
     misc_feature    complement(139984..141399)
                     /locus_tag="YPTB0118"
                     /note="dihydrolipoamide dehydrogenase; Validated; Region:
                     PRK06292"
                     /db_xref="CDD:235774"
     misc_feature    complement(140788..141381)
                     /locus_tag="YPTB0118"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(140017..140346)
                     /locus_tag="YPTB0118"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            complement(141499..142230)
                     /locus_tag="YPTB0119"
                     /db_xref="GeneID:2953085"
     CDS             complement(141499..142230)
                     /locus_tag="YPTB0119"
                     /note="similar to Yersinia pestis YPO3916
                     peroxiredoxin/glutaredoxin family protein (100%
                     evalue=1.E-141); Vibrio cholerae VC2637 peroxiredoxin
                     family protein/glutaredoxin (81.3% evalue=1.E-117)"
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin/glutaredoxin family protein"
                     /protein_id="YP_068668.1"
                     /db_xref="GI:51594477"
                     /db_xref="GeneID:2953085"
                     /translation="MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPG
                     AFTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVNDTFVMNAWKSDQHAENITFVPDG
                     NGEFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
                     KYLAPDFKVQESVAVFTKPGCPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGR
                     STVPQIFIGGRHIGGSDDLEKYLPA"
     misc_feature    complement(141748..142215)
                     /locus_tag="YPTB0119"
                     /note="Peroxiredoxin (PRX) family, PRX5-like subfamily;
                     members are similar to the human protein, PRX5, a
                     homodimeric TRX peroxidase, widely expressed in tissues
                     and found cellularly in mitochondria, peroxisomes and the
                     cytosol. The cellular location of PRX5...; Region:
                     PRX5_like; cd03013"
                     /db_xref="CDD:239311"
     misc_feature    complement(order(141850..141852,142081..142083,
                     142090..142092))
                     /locus_tag="YPTB0119"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:239311"
     misc_feature    complement(order(141859..141861,141922..141927,
                     141985..141987,141991..141993,142087..142089))
                     /locus_tag="YPTB0119"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239311"
     misc_feature    complement(141508..141720)
                     /locus_tag="YPTB0119"
                     /note="Glutaredoxin (GRX) family, PRX5 hybrid subfamily;
                     composed of hybrid proteins containing peroxiredoxin (PRX)
                     and GRX domains, which is found in some pathogenic
                     bacteria and cyanobacteria. PRXs are thiol-specific
                     antioxidant (TSA) proteins that confer a...; Region:
                     GRX_hybridPRX5; cd03029"
                     /db_xref="CDD:239327"
     misc_feature    complement(order(141568..141573,141682..141690,
                     141697..141699))
                     /locus_tag="YPTB0119"
                     /note="GSH binding site [chemical binding]; other site"
                     /db_xref="CDD:239327"
     misc_feature    complement(order(141679..141681,141688..141690))
                     /locus_tag="YPTB0119"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239327"
     gene            142377..143294
                     /gene="oxyR"
                     /locus_tag="YPTB0120"
                     /db_xref="GeneID:2956202"
     CDS             142377..143294
                     /gene="oxyR"
                     /locus_tag="YPTB0120"
                     /note="Activates the expression of a regulon of hydrogen
                     peroxide-inducible genes such as katG, gor, ahpC, ahpF,
                     oxyS, dps, fur and grxA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator OxyR"
                     /protein_id="YP_068669.1"
                     /db_xref="GI:51594478"
                     /db_xref="GeneID:2956202"
                     /translation="MNIRDLEYLVALAEFRHFRRAADSCHVSQPTLSGQIRKLEDELG
                     IMLLERTSRKVLFTQAGLLLVEQAKTVLREVKVLKEMASLQGESMSGPLHIGLIPTVG
                     PYLLPQIIPMLHKTFPKLEMYLHEAQTQNLLAQLDSGKLDCAILALVKETEAFIEIPL
                     FDEPMNLAIYADHPWANRERVEMHELAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTH
                     FRATSLETLRNMVAAGSGITLLPALAVPNERQRDGVCYLECYKPVPKRTIALVYRPGS
                     PLRGRYEQLAEAIRDHMQERMASSLEQAI"
     misc_feature    142377..143291
                     /gene="oxyR"
                     /locus_tag="YPTB0120"
                     /note="DNA-binding transcriptional regulator OxyR;
                     Provisional; Region: PRK11151"
                     /db_xref="CDD:182999"
     misc_feature    142383..142559
                     /gene="oxyR"
                     /locus_tag="YPTB0120"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    142647..143243
                     /gene="oxyR"
                     /locus_tag="YPTB0120"
                     /note="The C-terminal substrate-binding domain of the
                     LysR-type transcriptional regulator OxyR, a member of the
                     type 2 periplasmic binding fold protein superfamily;
                     Region: PBP2_OxyR; cd08411"
                     /db_xref="CDD:176103"
     misc_feature    order(142683..142685,142692..142697,142704..142706,
                     142716..142718,142740..142754,143031..143033,
                     143040..143045,143052..143054,143061..143066,
                     143070..143075)
                     /gene="oxyR"
                     /locus_tag="YPTB0120"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176103"
     gene            complement(143277..144677)
                     /gene="sthA"
                     /locus_tag="YPTB0121"
                     /gene_synonym="sth; udhA"
                     /db_xref="GeneID:2956644"
     CDS             complement(143277..144677)
                     /gene="sthA"
                     /locus_tag="YPTB0121"
                     /gene_synonym="sth; udhA"
                     /EC_number="1.6.1.1"
                     /note="catalyzes the conversion of NADPH to NADH"
                     /codon_start=1
                     /transl_table=11
                     /product="soluble pyridine nucleotide transhydrogenase"
                     /protein_id="YP_068670.1"
                     /db_xref="GI:51594479"
                     /db_xref="GeneID:2956644"
                     /translation="MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGG
                     CTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARTIKSSFADILNHADRVINQQTRMRQ
                     GFYDRNHCHMFSGDASFIDANTVNVRYADGTSDTLQADNIVIATGSRPYRPVNVDFNH
                     ERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQE
                     MSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTS
                     GLGLENIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLASAAYDQGRIAAQAMI
                     KGEANVHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMD
                     TGSLKILFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTLEYFVNTTFNYPTM
                     AEAYRVAALNGLNRLF"
     misc_feature    complement(143280..144674)
                     /gene="sthA"
                     /locus_tag="YPTB0121"
                     /gene_synonym="sth; udhA"
                     /note="soluble pyridine nucleotide transhydrogenase;
                     Provisional; Region: PRK05249"
                     /db_xref="CDD:235373"
     misc_feature    complement(144123..144650)
                     /gene="sthA"
                     /locus_tag="YPTB0121"
                     /gene_synonym="sth; udhA"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(143907..144146)
                     /gene="sthA"
                     /locus_tag="YPTB0121"
                     /gene_synonym="sth; udhA"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    complement(143304..143642)
                     /gene="sthA"
                     /locus_tag="YPTB0121"
                     /gene_synonym="sth; udhA"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            144883..145530
                     /gene="trmA"
                     /locus_tag="YPTB0122"
                     /db_xref="GeneID:2956734"
     CDS             144883..145530
                     /gene="trmA"
                     /locus_tag="YPTB0122"
                     /note="negatively controls the expression of fabA and
                     fabB, genes involved in the unsaturated fatty acid
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional repressor FabR"
                     /protein_id="YP_068671.1"
                     /db_xref="GI:51594480"
                     /db_xref="GeneID:2956734"
                     /translation="MGTIMGVRAQQKERTRRSLIEAAFSQLSAERSFASLSLREVSRE
                     AGIAPTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEF
                     IGNNPNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLELENHMPRSFTEAQAEA
                     MVTIVFSAGAEVLDVDIEQRRQLEERLVLQLRMISKGAYYWYRREQEKLAASRVE"
     misc_feature    144892..145494
                     /gene="trmA"
                     /locus_tag="YPTB0122"
                     /note="DNA-binding transcriptional repressor FabR;
                     Provisional; Region: PRK11202"
                     /db_xref="CDD:236881"
     misc_feature    144937..145068
                     /gene="trmA"
                     /locus_tag="YPTB0122"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            145543..145950
                     /gene="yijD"
                     /locus_tag="YPTB0123"
                     /db_xref="GeneID:2957079"
     CDS             145543..145950
                     /gene="yijD"
                     /locus_tag="YPTB0123"
                     /note="similar to Yersinia pestis YPO3912 yijD; membrane
                     protein (100% evalue=3.E-71); Salmonella typhimurium
                     STM4128 yijD; inner membrane protein (70.7%
                     evalue=1.E-41)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068672.1"
                     /db_xref="GI:51594481"
                     /db_xref="GeneID:2957079"
                     /translation="MEQSSRRETGTLLLALITGLAINGVCAALFSALVPFSVFPLLTL
                     ILAVYCLHQRYLNFAMPQGIPVLASACFLLGILLYSAIVRVEYPAIGSNFVPAVLSVV
                     LVFWILFKLRTRKSVQTHTDADIDINNSDQPQQ"
     misc_feature    145543..145902
                     /gene="yijD"
                     /locus_tag="YPTB0123"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11056"
                     /db_xref="CDD:236832"
     misc_feature    join(145576..145644,145654..145710,145729..145788,
                     145801..145869)
                     /gene="yijD"
                     /locus_tag="YPTB0123"
                     /note="4 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(146084..147187)
                     /gene="trmA"
                     /locus_tag="YPTB0124"
                     /db_xref="GeneID:2956735"
     CDS             complement(146084..147187)
                     /gene="trmA"
                     /locus_tag="YPTB0124"
                     /EC_number="2.1.1.35"
                     /note="catalyzes the formation of 5-methyl-uridine at
                     position 54 in all tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (uracil-5-)-methyltransferase"
                     /protein_id="YP_068673.1"
                     /db_xref="GI:51594482"
                     /db_xref="GeneID:2956735"
                     /translation="MTPNILPIESYDHQLAEKSARLKAMMLPFQAPEPEIFRSPADHY
                     RMRAEFRVWHDEDDLYHIMFDQQTKQRIRVEQFPVASRLINRLMDALMTAIRAEPLLR
                     RKLFQIDYLSTLSGKLIASLLYHRQLDEEWQQKALELRDQLRAQGFDLQLIGRAAKTK
                     IMLDHDYIDEVLPVAGREMIYRQVENSFTQPNAAVNIHMLEWALDVTQGATGDLLELY
                     CGNGNFSLALARNFERVLATEIAKPSVAAAQYNIAANNIDNVQIIRMSAEEFTQAMQG
                     VREFNRLKGIDLGSYNCETIFVDPPRSGLDHETVKLVQAYPRILYISCNPETLCANLE
                     QLQHTHKISRLALFDQFPYTHHMECGVLLEKRH"
     misc_feature    complement(146090..147187)
                     /gene="trmA"
                     /locus_tag="YPTB0124"
                     /note="tRNA (uracil-5-)-methyltransferase; Validated;
                     Region: PRK05031"
                     /db_xref="CDD:235332"
     misc_feature    complement(<146378..146551)
                     /gene="trmA"
                     /locus_tag="YPTB0124"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(146387..146395,146468..146473,
                     146519..146539))
                     /gene="trmA"
                     /locus_tag="YPTB0124"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            147319..147579
                     /locus_tag="YPTB_RNA_114"
                     /db_xref="GeneID:2955135"
     misc_RNA        147319..147579
                     /locus_tag="YPTB_RNA_114"
                     /product="Cobalamin riboswitch"
                     /db_xref="GeneID:2955135"
     gene            147649..149541
                     /gene="btuB"
                     /locus_tag="YPTB0125"
                     /db_xref="GeneID:2953086"
     CDS             147649..149541
                     /gene="btuB"
                     /locus_tag="YPTB0125"
                     /note="involved in the active translocation of vitamin B12
                     (cyanocobalamin) across the outer membrane to the
                     periplasmic space"
                     /codon_start=1
                     /transl_table=11
                     /product="vitamin B12/cobalamin outer membrane
                     transporter"
                     /protein_id="YP_068674.2"
                     /db_xref="GI:229310108"
                     /db_xref="GeneID:2953086"
                     /translation="MIIKNTMTIKKYTLLTALSVTAFSGWAQGNNTTDNNNEMVVTAN
                     RFPQPKSSVLAPVDVVTRADIDRWQSTNINDVLRRLPGINIAQYGGPRQLSSLFIRGT
                     NSSHVLVLVDGVRLNQAGISGSSDLSQIPISLVQRIEYIRGPRSAVYGSDAIGGVVNI
                     ITERETLGSTLTAGLGSNGYQNYNGSTQQKLGDDTTITLAGNYDYSKGYDVVAKGNTG
                     MASQPDRDGYLGKMLWLGANHKFNEQFSGFVRGYGFDNRSDYDSYYYPGSPLVDTRSL
                     SSRTYDTGINFSNGGYASQLIGSYSRTQDYNYDPSYGRYDQSATLDDISQYNLQWTNT
                     YQLGLGNVGGGLDWQKQTTEPGTNYLSNGYEQRNTGVYGTVQQFVGPVTLEGAIRGDD
                     NSQFGWHTTWQSSAGWEFVDGYRLIGSYGTAFKAPNLGQIYSSTYGNRDLKPEESTQW
                     EAAITGITGPLDWRLSAYRNDIDQMIATRGVYPNSRYYNVEKATIKGVEWTGSFETGP
                     LSHQVTLEYLDPRNADTHEILARRAKQQVKYQLDWQMADLDWSVTYQYIGQRYDSVFD
                     PITYAASPVKLAGISLWDLAVSYPVTSHLTVRGRIANLFDKDYEMVYGYQTPGREYYF
                     TGSYNF"
     misc_feature    147670..149538
                     /gene="btuB"
                     /locus_tag="YPTB0125"
                     /note="vitamin B12/cobalamin outer membrane transporter;
                     Provisional; Region: btuB; PRK10641"
                     /db_xref="CDD:236730"
     misc_feature    147814..149538
                     /gene="btuB"
                     /locus_tag="YPTB0125"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(147814..147843,147871..147900,147937..147954,
                     147973..147996,148042..148074,148108..148134)
                     /gene="btuB"
                     /locus_tag="YPTB0125"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    148633..148635
                     /gene="btuB"
                     /locus_tag="YPTB0125"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            149486..150349
                     /gene="murI"
                     /locus_tag="YPTB0126"
                     /gene_synonym="dga; glr"
                     /db_xref="GeneID:2956105"
     CDS             149486..150349
                     /gene="murI"
                     /locus_tag="YPTB0126"
                     /gene_synonym="dga; glr"
                     /EC_number="5.1.1.3"
                     /note="converts L-glutamate to D-glutamate, a component of
                     peptidoglycan"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="YP_068675.1"
                     /db_xref="GI:51594484"
                     /db_xref="GeneID:2956105"
                     /translation="MATKPQDANTTSREAITSKADSPPRPTALIFDSGVGGLSVYQEI
                     RQLLPNLHYIYAFDNVAFPYGEKSGEFIVERVLEIVTAVQQSHPLAIVVIACNTASTV
                     SLPALRERFAFPVVGVVPAIKPAVRLTRNGVVGLLATRATVHASYTLDLIARFATDCK
                     IELLGSSELVEVAETKLHGGVVPLEVLKKILHPWLSMREPPDTIVLGCTHFPLLTEEL
                     AQVLPEGTRMVDSGAAIARRTAWLISSQENVISSQDENIAYCMALDEDTDALLPVLQS
                     YGFPKLQKLPI"
     misc_feature    149546..150340
                     /gene="murI"
                     /locus_tag="YPTB0126"
                     /gene_synonym="dga; glr"
                     /note="glutamate racemase; Provisional; Region: PRK00865"
                     /db_xref="CDD:234851"
     gene            150806..152351
                     /locus_tag="YPTB_RNA_96"
                     /db_xref="GeneID:2955145"
     rRNA            150806..152351
                     /locus_tag="YPTB_RNA_96"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:2955145"
     gene            152485..152560
                     /gene="tRNA-Glu2"
                     /locus_tag="YPTB_RNA_2"
                     /db_xref="GeneID:2956761"
     tRNA            152485..152560
                     /gene="tRNA-Glu2"
                     /locus_tag="YPTB_RNA_2"
                     /product="tRNA-Glu"
                     /note="anticodon TTC, Cove Score=56.95"
                     /db_xref="GeneID:2956761"
     gene            152813..155719
                     /locus_tag="YPTB_RNA_97"
                     /db_xref="GeneID:2955146"
     rRNA            152813..155719
                     /locus_tag="YPTB_RNA_97"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:2955146"
     gene            155828..155947
                     /locus_tag="YPTB_RNA_98"
                     /db_xref="GeneID:2955147"
     rRNA            155828..155947
                     /locus_tag="YPTB_RNA_98"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:2955147"
     gene            156071..156147
                     /gene="tRNA-Asp-1"
                     /locus_tag="YPTB_RNA_3"
                     /db_xref="GeneID:2956753"
     tRNA            156071..156147
                     /gene="tRNA-Asp-1"
                     /locus_tag="YPTB_RNA_3"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:2956753"
     gene            156156..156231
                     /gene="tRNA-Trp-1"
                     /locus_tag="YPTB_RNA_4"
                     /db_xref="GeneID:2956814"
     tRNA            156156..156231
                     /gene="tRNA-Trp-1"
                     /locus_tag="YPTB_RNA_4"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:2956814"
     gene            157214..158170
                     /locus_tag="YPTB0127"
                     /db_xref="GeneID:2953087"
     CDS             157214..158170
                     /locus_tag="YPTB0127"
                     /note="similar to Yersinia pestis YPO3908  periplasmic
                     protein precursor (99.6% evalue=1.E-175); Escherichia coli
                     JW4186 ytfQ; Hypothetical ABC transporter periplasmic
                     binding protein (75.7% evalue=1.E-134)"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose/sugar ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_068676.1"
                     /db_xref="GI:51594485"
                     /db_xref="GeneID:2953087"
                     /translation="MYRRLLLAAAVTAAMCSAVQAAPLVVGFSQIGSESGWRSAETKV
                     AKQEAEKRGITLKIADAQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWTPVLQEAKE
                     AKIPVFLLDRMIEVNDPSLYTAAVASDSVYEGKVAGEWLLQDVVGKPCNVVELQGTVG
                     SSVAINRKKGFADGIASAPGVKIIRSQSGDFTRSKGKEVMESFIKAEQNGKNICAVYA
                     HNDDMAIGAIQAIKEAGLKPGSDIKIVSIDGVPDIFKAMSSGEANATVELTPNMAGPA
                     LDALIVLKKDGTQPPKFIQTESRLLQPDTAKQEYELKKSLGY"
     misc_feature    157256..158155
                     /locus_tag="YPTB0127"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     RbsB; COG1879"
                     /db_xref="CDD:224791"
     misc_feature    157286..158107
                     /locus_tag="YPTB0127"
                     /note="Periplasmic binding domain of ABC-type YtfQ-like
                     transport systems; Region: PBP1_YtfQ_like; cd06309"
                     /db_xref="CDD:107304"
     misc_feature    order(157322..157324,157544..157546,157712..157714,
                     157955..157957,158015..158017)
                     /locus_tag="YPTB0127"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107304"
     misc_feature    157226..157294
                     /locus_tag="YPTB0127"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            158256..159746
                     /locus_tag="YPTB0128"
                     /db_xref="GeneID:2953088"
     CDS             158256..159746
                     /locus_tag="YPTB0128"
                     /note="similar to Yersinia pestis YPO3907  sugar transport
                     system ATP-binding protein (99.7% evalue=0); Escherichia
                     coli Z5839  ATP-binding component of ABC transporter
                     (67.4% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATPase"
                     /protein_id="YP_068677.1"
                     /db_xref="GI:51594486"
                     /db_xref="GeneID:2953088"
                     /translation="MEILLEVRGLSVEFPGVKALDSVDFSLQRGEVVALLGENGAGKS
                     TLIKALTGVYKRSAGEVLLDGKAVCPIDTADAQLMGIGTVYQEVNLLPNISVAANLFI
                     GREPLRWGLIDHNKMNQQAAKLLTGYGLTLDVQQPLANFSIAIQQIVAIARAVDLSAK
                     VLILDEPTASLDAKEVSMLLDILCQLRDQGIGMVFVTHFLDQVYRISDRITVLRNGKL
                     VGTKTVAELPRIELVQMMLGHSFDEQLLKRGEHSITNKNPLVEFKNYGRRGVVENFDL
                     SVSPGEIVGLAGLLGSGRTETAQLIFGITTPDTGEAKIQGKPVKIRTPRKASKFGFGY
                     CPEDRKTEGIVGAATVRENIILALQAQRGWLRPLSMREQTQIADDFIQQLGIRTPSPE
                     QQIQYLSGGNQQKVLLARWLATKPRFLILDEPTRGIDVGAHAEIIRLIEKLCDEGLAL
                     LIISSELEELAGYADRVIVLRDRRHVAQLDHDEISVPAIMQAIAVQ"
     misc_feature    158256..159743
                     /locus_tag="YPTB0128"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    158268..158918
                     /locus_tag="YPTB0128"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    158364..158387
                     /locus_tag="YPTB0128"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(158373..158378,158382..158390,158511..158513,
                     158748..158753,158847..158849)
                     /locus_tag="YPTB0128"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    158502..158513
                     /locus_tag="YPTB0128"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    158676..158705
                     /locus_tag="YPTB0128"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    158736..158753
                     /locus_tag="YPTB0128"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    158760..158771
                     /locus_tag="YPTB0128"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    158835..158855
                     /locus_tag="YPTB0128"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    159027..159677
                     /locus_tag="YPTB0128"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            159758..160777
                     /locus_tag="YPTB0129"
                     /db_xref="GeneID:2953089"
     CDS             159758..160777
                     /locus_tag="YPTB0129"
                     /note="similar to Yersinia pestis YPO3906  sugar transport
                     system permease (100% evalue=0); Escherichia coli Z5840
                     ytfT; transport system permease (70.3% evalue=1.E-122)"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose/sugar ABC transporter permease domain"
                     /protein_id="YP_068678.1"
                     /db_xref="GI:51594487"
                     /db_xref="GeneID:2953089"
                     /translation="MGNRSLSMTQRPRKVKWVLPKGATQFGALAVILLIDSLVAPHFF
                     SIHIQDGRLFGSIIDILNRGAPVALLALGMTLVIATGGIDLSVGAVMAIAGATAATLT
                     SAGYPFMTVLALSLAVGALCGLWNGFLVAVLQIQPIVATLMLMVAGRGIAQLITEGQI
                     VTFDSGGLATLGSSTLMYLPMSVVIACSMLILVWLLTRKTALGLFIESVGINLRSARN
                     AGVSTRLVLIAVYVICGVCAAVAGIIVTADIRGADANNAGLWLELDAILAVVIGGASL
                     MGGRFNLLLSVIGALIIQGMNTGILLSGYQPEFNLVLKAIVVLAVLVVQSPMISLSHL
                     FQRRK"
     misc_feature    159950..160699
                     /locus_tag="YPTB0129"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    160397..160453
                     /locus_tag="YPTB0129"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     misc_feature    join(159833..159901,159959..160027,160088..160156,
                     160277..160345,160430..160498,160526..160585,
                     160604..160672,160700..160762)
                     /locus_tag="YPTB0129"
                     /note="8 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            160777..161769
                     /locus_tag="YPTB0130"
                     /db_xref="GeneID:2953090"
     CDS             160777..161769
                     /locus_tag="YPTB0130"
                     /note="membrane component of a  sugar ABC transporter
                     system"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_068679.1"
                     /db_xref="GI:51594488"
                     /db_xref="GeneID:2953090"
                     /translation="MLKRNVPLLITIAVFILGYAFCLSQFPSFSSSRVWCDLLTDNAF
                     LGIVAVGMTFVILSGGIDLSVGSVIAFTGVLLAKLIGTYGIHPVYAFAIVLVMGAMFG
                     ALMGWIIDSLKLPAFIITLAGMFFIRGMSFIVSEESLPINHPIYETLANYAWRVPGGG
                     RFTLLAFIMLMVVAFGILLAHHTRFGHNVYAIGGNSVSAGLMGVPVRRTTIKIYMLSS
                     TLAALSGIVFSLYTSAGYALAASGVELDAIAAVVIGGTLLAGGIGTVFGTLFGVLIQG
                     LIQSYITFDGTLSSWWTKIVIGILLFSFIVIQKAMSAFYLNRRSRPQSSPLTPV"
     misc_feature    160900..161700
                     /locus_tag="YPTB0130"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    161365..161421
                     /locus_tag="YPTB0130"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     misc_feature    join(160795..160863,160906..160974,161035..161103,
                     161116..161184,161245..161313,161341..161394,
                     161431..161499,161527..161595,161632..161700)
                     /locus_tag="YPTB0130"
                     /note="9 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(161756..162637)
                     /locus_tag="YPTB0131"
                     /db_xref="GeneID:2953091"
     CDS             complement(161756..162637)
                     /locus_tag="YPTB0131"
                     /note="Negatively regulates the transcription of the
                     flagellar master operon flhDC by binding to the upstream
                     region of the operon"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator HdfR"
                     /protein_id="YP_068680.1"
                     /db_xref="GI:51594489"
                     /db_xref="GeneID:2953091"
                     /translation="MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLG
                     ANLFTRHRNNIRLTPAGERLVPYAEMLLNTWRLAKKEVIHSLQHTELSIGATASLWEA
                     YLTPWLQQLYEQQEELRLEARIALRNSLVKQLHERQLDLLITTEPPKMDELACLLLGH
                     FSLRLYSSFSLDLPKEDDTPNEHKNASEVPYIKLEWGADFHQQENRLLDSEQAPILTT
                     TSAHLTRQLLETTGGCAFLPEHWQKEYPQLVIHPDIPPIVRPLYAVWLQNSDQQALIR
                     QLLKTPMNNATQSVTRE"
     misc_feature    complement(161777..162637)
                     /locus_tag="YPTB0131"
                     /note="transcriptional regulator HdfR; Provisional;
                     Region: PRK03601"
                     /db_xref="CDD:235137"
     misc_feature    complement(162452..162628)
                     /locus_tag="YPTB0131"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(161798..162370)
                     /locus_tag="YPTB0131"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(161948..161953,161957..161962,
                     161978..161995,162266..162286,162290..162292,
                     162302..162304,162311..162316,162320..162325))
                     /locus_tag="YPTB0131"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            162756..163094
                     /locus_tag="YPTB0132"
                     /db_xref="GeneID:2953092"
     CDS             162756..163094
                     /locus_tag="YPTB0132"
                     /note="similar to Yersinia pestis YPO3903 conserved
                     hypothetical protein (100% evalue=3.E-62); Escherichia
                     coli JW3737 yifE; Hypothetical protein (83%
                     evalue=1.E-52)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068681.1"
                     /db_xref="GI:51594490"
                     /db_xref="GeneID:2953092"
                     /translation="MADSFITTNRFFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNE
                     LDSGKREPVTEEEQRFVAVCRGEREPVSAEEKVWSKYVIRTRQPKRFHTLSGGKPQMD
                     AVEDYTDSDD"
     misc_feature    162756..163091
                     /locus_tag="YPTB0132"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11027"
                     /db_xref="CDD:236825"
     gene            complement(163475..164998)
                     /locus_tag="YPTB0133"
                     /db_xref="GeneID:2953093"
     CDS             complement(163475..164998)
                     /locus_tag="YPTB0133"
                     /note="similar to Yersinia pestis YPO3902  magnesium
                     chelatase family protein (99.8% evalue=0); Salmonella
                     typhimurium STM3899 yifB; magnesium chelatase, subunit
                     ChlI (62.7% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium chelatase family protein"
                     /protein_id="YP_068682.1"
                     /db_xref="GI:51594491"
                     /db_xref="GeneID:2953093"
                     /translation="MSLATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKE
                     ARDRVRSALINSGFNFPAKRITVSLAPADLPKEGGRYDLPIALAILAASEQIPADKLA
                     HYEFLGELALSGALRRVSGAIPAALACSEANRQLILPTANGLEIGLIPQGNSWVADHL
                     LAVCGFLQGENPLAQGQPFEPAPSPDNHLDLHDIIGQSQAKRALEIAAAGGHNLLLLG
                     PPGTGKTMLATRLTGLLPPLTDQEALEAAAITGLLHSNALPTQWRCRAFRAPHHSASM
                     AALIGGGSIPRPGEISLAHNGVLFLDELPEFERRVLDSLREPLESGEIIISRAAAKIC
                     FPAKVQLIAAMNPSPSGHYQGVHNRTPPQQILRYLAKLSGPFLDRFDLSIEVPLLPAG
                     MLGAQKNQGESSATVKQRVLQARQRQMDRAGKINTQLTSQEVAEFCYLAPEDAAFLEQ
                     VLLTLGLSVRAWHHILKVARTIADLAQEKTIQKSHLSEALSYRCMDRLLLQLHKSLM"
     misc_feature    complement(163481..164998)
                     /locus_tag="YPTB0133"
                     /note="putative ATP-dependent protease; Provisional;
                     Region: PRK09862"
                     /db_xref="CDD:182120"
     misc_feature    complement(164573..164938)
                     /locus_tag="YPTB0133"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     misc_feature    complement(163835..164416)
                     /locus_tag="YPTB0133"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(164324..164347)
                     /locus_tag="YPTB0133"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(163961..163963,164093..164095,
                     164321..164344))
                     /locus_tag="YPTB0133"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(164090..164107)
                     /locus_tag="YPTB0133"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(163862..163864)
                     /locus_tag="YPTB0133"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(163520..163801)
                     /locus_tag="YPTB0133"
                     /note="Magnesium chelatase, subunit ChlI; Region:
                     Mg_chelatase_2; pfam13335"
                     /db_xref="CDD:257665"
     gene            165622..167268
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /db_xref="GeneID:2955875"
     CDS             165622..167268
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /EC_number="2.2.1.6"
                     /note="catalyzes the formation of 2-acetolactate from
                     pyruvate; also known as acetolactate synthase large
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase 2 catalytic subunit"
                     /protein_id="YP_068683.1"
                     /db_xref="GI:51594492"
                     /db_xref="GeneID:2955875"
                     /translation="MNGAQWVVQALRAQGVDTVFGYPGGAIMPVYDALYDGGVEHLLC
                     RHEQGAAIAAIGYARATGKVGVCIATSGPGATNLITGLADALLDSVPVIAITGQVGSA
                     LIGTDAFQEIDVLGLSLACTKHSFLVESLDALPEIMAEAFAIATSGRPGPVLIDIPKD
                     IQLAVGELTPHLKPVEEHSVDSAAELQHAWDMLANAQKPMLYVGGGVGMAQAVPALRD
                     FIAMTGIPAVATLKGLGAPDIAHPCYLGMLGMHGTKAANFAVQDCDLLVAVGARFDDR
                     VTGKLNTFASKAKVIHMDIDPAELGKLRQVHVALQGNLNVLLPALQQPLNIQPWRDEV
                     MALKQQHHWRYDHPGQAIYAPLLLKQISERKAPETVVTTDVGQHQMWTAQHMNFTRPE
                     NFITSSGLGTMGFGVPAAVGAQMARPDDMVICVSGDGSFMMNVQELGTIKRKQLPLKI
                     VLLDNQRLGMVRQWQQLFFDGRYSETNLSDNPDFITLASAFDIPGQRITRKDQVDAAL
                     DALFNSEGPYLLQVSIDELENVWPLVPPGAGNETMLEKIS"
     misc_feature    165622..167265
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /note="acetolactate synthase 2 catalytic subunit;
                     Reviewed; Region: PRK08978"
                     /db_xref="CDD:181601"
     misc_feature    165634..166098
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    order(165673..165675,165688..165693,165703..165705,
                     165715..165717,165739..165759,165766..165768,
                     165775..165780,165787..165792,165796..165804,
                     165838..165840,165859..165861,165871..165873,
                     165880..165885)
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(165688..165696,165703..165705,165715..165717,
                     165742..165744,165748..165759,165763..165765,
                     165838..165840,165847..165852,165856..165861,
                     165868..165870,165970..165972,165979..165981)
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(165688..165690,165760..165762,165838..165840,
                     165850..165852)
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    166177..166584
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    166675..167232
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /note="Thiamine pyrophosphate (TPP) family,
                     Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding
                     module; composed of proteins similar to the large
                     catalytic subunit of AHAS. AHAS catalyzes the condensation
                     of two molecules of pyruvate to give the...; Region:
                     TPP_AHAS; cd02015"
                     /db_xref="CDD:238973"
     misc_feature    order(166744..166755,166822..166824,166828..166830,
                     166903..166911,166918..166920,166984..166986)
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238973"
     misc_feature    order(166813..166815,166822..166824,166828..166830,
                     166915..166920,166924..166929,166948..166950,
                     167065..167070,167080..167082,167089..167091)
                     /gene="ilvG"
                     /locus_tag="YPTB0134"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238973"
     gene            167265..167522
                     /gene="ilvM"
                     /locus_tag="YPTB0135"
                     /db_xref="GeneID:2955878"
     CDS             167265..167522
                     /gene="ilvM"
                     /locus_tag="YPTB0135"
                     /EC_number="2.2.1.6"
                     /note="similar to Yersinia pestis YPO3900 ilvM;
                     acetolactate synthase isozyme II small subunit (100%
                     evalue=1.E-41); Escherichia coli Z5280 ilvM; acetolactate
                     synthase II, valine insensitive, small subunit (67.8%
                     evalue=2.E-24)"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase 2 regulatory subunit"
                     /protein_id="YP_068684.1"
                     /db_xref="GI:51594493"
                     /db_xref="GeneID:2955878"
                     /translation="MIQHQLSIQARFRPEMLERVLRVVRHRGFQVCAMNMSPMIDAGN
                     VNIELTVASQRPVDLLSSQLSKLMDVACVEILQPNTLQIRA"
     misc_feature    167265..167492
                     /gene="ilvM"
                     /locus_tag="YPTB0135"
                     /note="acetolactate synthase 2 regulatory subunit;
                     Provisional; Region: ilvM; PRK11152"
                     /db_xref="CDD:236862"
     gene            167545..168471
                     /gene="ilvE"
                     /locus_tag="YPTB0136"
                     /db_xref="GeneID:2955874"
     CDS             167545..168471
                     /gene="ilvE"
                     /locus_tag="YPTB0136"
                     /EC_number="2.6.1.42"
                     /note="catalyzes the transamination of the branched-chain
                     amino acids to their respective alpha-keto acids"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="YP_068685.1"
                     /db_xref="GI:51594494"
                     /db_xref="GeneID:2955874"
                     /translation="MTKKADYIWFNGEMVPWAEAKVHVMSHALHYGTSVFEGVRCYES
                     HKGPVVFRHREHMQRLHDSAKIYRMPVSQSVDELMEACRATLRKNNLTSAYIRPLVFI
                     GDVGMGVNPPEGYNTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRVAPNTIPTAAKA
                     GGNYLSSLLVGSEARRHGYQEGIALDVHGYLSEGAGENLFEVKDGILFTPPFTSSALP
                     GITRDAIIKLAKDMGLEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGIGK
                     RGPVTAKIQQAFFGLFTGETEDKWGWLDQVNP"
     misc_feature    167605..168426
                     /gene="ilvE"
                     /locus_tag="YPTB0136"
                     /note="BCAT_beta_family: Branched-chain aminotransferase
                     catalyses the transamination of the branched-chain amino
                     acids  leusine, isoleucine and valine to their respective
                     alpha-keto acids, alpha-ketoisocaproate,
                     alpha-keto-beta-methylvalerate and...; Region:
                     BCAT_beta_family; cd01557"
                     /db_xref="CDD:238798"
     misc_feature    order(167605..167619,167626..167640,167644..167646,
                     167650..167652,167740..167742,167833..167835,
                     167839..167841,167857..167865,167875..167877,
                     167902..167904,168025..168027,168040..168042,
                     168046..168048,168058..168060,168100..168102)
                     /gene="ilvE"
                     /locus_tag="YPTB0136"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238798"
     misc_feature    order(167635..167637,167650..167652,167719..167721,
                     167869..167871,168019..168021,168034..168036,
                     168121..168123,168202..168207,168313..168315)
                     /gene="ilvE"
                     /locus_tag="YPTB0136"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238798"
     misc_feature    168019..168021
                     /gene="ilvE"
                     /locus_tag="YPTB0136"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238798"
     gene            168782..170632
                     /gene="ilvD"
                     /locus_tag="YPTB0137"
                     /db_xref="GeneID:2955873"
     CDS             168782..170632
                     /gene="ilvD"
                     /locus_tag="YPTB0137"
                     /EC_number="4.2.1.9"
                     /note="catalyzes the dehydration of
                     2,3-dihydroxy-3-methylbutanoate to 3-methyl-2-oxobutanoate
                     in valine and isoleucine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="YP_068686.1"
                     /db_xref="GI:51594495"
                     /db_xref="GeneID:2955873"
                     /translation="MPKYRSHTTTHGRNMAGARALWRATGMTDDDFGKPIIAVVNSFT
                     QFVPGHVHLRDLGKLVAEQIVASGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIAD
                     SVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDKII
                     KLDLIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTANSMNCLNEALGLALPGN
                     GSLLATHADRKQLFLDAGKYIVALTKRYYEQDDVSALPRNIANKAAFENAMILDIAMG
                     GSTNTVLHLLAAAQEGEIDFSMTDIDRLSRKVPHLCKVAPSTQKYHMEDVHRAGGVIG
                     ILGELDRAGLLNRDVSNVLGLNLTQTLEAYDVMLTQDEGVKQMYAAGPAGIRTTKAFS
                     QDCRYPSLDTDREEGCIRTREHAYSQDGGLAVLYGNIAADGCIVKTAGVDKDSLTFRG
                     PAKVFESQDEAVEAILGGKVVAGDVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSC
                     ALLTDGRFSGGTSGLSIGHVSPEAASGGLIGLVQDGDFINIDIPNRGIVLDVSEAELA
                     ARRETEEAHGDAAWSPKGRERQVSYALRAYAMLATSADKGAVRDKSKLGG"
     misc_feature    168785..170629
                     /gene="ilvD"
                     /locus_tag="YPTB0137"
                     /note="dihydroxy-acid dehydratase; Provisional; Region:
                     PRK12448"
                     /db_xref="CDD:237104"
     gene            170638..172182
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /db_xref="GeneID:2955870"
     CDS             170638..172182
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /EC_number="4.3.1.19"
                     /note="threonine deaminase; threonine dehydratase; in
                     Escherichia coli, IlvA is part of the isoleucine
                     biosynthetic pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase"
                     /protein_id="YP_068687.1"
                     /db_xref="GI:51594496"
                     /db_xref="GeneID:2955870"
                     /translation="MAVSQPLSAAPCGAEYLRAILRAPVYEVAQVTPLQVMEKISSRV
                     GNTVLVKREDRQPVHSFKLRGAYAMISSLTEEQKACGVVTASAGNHAQGVALSAHKMG
                     IKALIVMPVATADIKVDAVRAFGGEVLLFGANFDEAKTKAIALAQEQGYTFVPPFDHP
                     AVIAGQGTLAMELLQQDAHLDRVFVPVGGGGLVAGVAVLIKQLMPQIKVIGVEAEDSA
                     CLRAALDAGQPVDLARVGLFAEGVAVKRIGDEPFRLCQEYLDDVITVDSDAICAAVKD
                     LFEDVRAIAEPSGALALAGLKKYVQQHNIQGERLAHVLSGANVNFHGLRYVSERCELG
                     EQREALLAVTIPEQKGSFLRFCELLGGRSVTEFNYRYADAENACIFVGVRLTRGYAER
                     VEILAELQDKGYQVVDLSDDEMAKLHVRYMVGGRPSKPLRERLFSFEFPESPGALLKF
                     LHTLGTHWNISLFHYRSHGTDFGRVLAAFELSATEPQFEERLAALGYYCHDETDNPAF
                     KFFLAG"
     misc_feature    170671..172176
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /note="threonine dehydratase; Reviewed; Region: PRK09224"
                     /db_xref="CDD:236417"
     misc_feature    170686..171597
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /note="Threonine dehydratase: The first step in amino acid
                     degradation is the removal of nitrogen. Although the
                     nitrogen atoms of most amino acids are transferred to
                     alpha-ketoglutarate before removal, the alpha-amino group
                     of threonine can be directly...; Region: Thr-dehyd;
                     cd01562"
                     /db_xref="CDD:107205"
     misc_feature    order(170686..170691,170698..170700,170707..170712,
                     170797..170802,171238..171243,171448..171450,
                     171457..171462,171469..171471,171481..171489,
                     171586..171597)
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107205"
     misc_feature    order(170821..170823,170902..170904,171199..171213,
                     171580..171582)
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107205"
     misc_feature    170821..170823
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107205"
     misc_feature    171649..171903
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /note="First of two tandem C-terminal ACT domains of
                     threonine dehydratase I (ThrD-I; L-threonine hydrolyase);
                     Region: ACT_ThrD-I_1; cd04906"
                     /db_xref="CDD:153178"
     misc_feature    171685..171702
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /note="putative Ile/Val binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153178"
     misc_feature    171934..172173
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /note="Second of two tandem C-terminal ACT domains of
                     threonine dehydratase I (ThrD-I; L-threonine hydrolyase);
                     Region: ACT_ThrD-I_2; cd04907"
                     /db_xref="CDD:153179"
     misc_feature    171970..171987
                     /gene="ilvA"
                     /locus_tag="YPTB0138"
                     /note="putative Ile/Val binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153179"
     gene            complement(172313..172777)
                     /locus_tag="YPTB0139"
                     /db_xref="GeneID:2953094"
     CDS             complement(172313..172777)
                     /locus_tag="YPTB0139"
                     /note="similar to Yersinia pestis YPO3935  membrane
                     protein (72.7% evalue=2.E-63)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068688.1"
                     /db_xref="GI:51594497"
                     /db_xref="GeneID:2953094"
                     /translation="MKVKNKKNLCALLLIGSVLLGYFFWLSRHPVEIISVHQRNNYSD
                     ILVRNFPFTEKGKINWWLENRDMLKAKYSIPKPASDGFYTIIFWDFGDGYKEEGKYDR
                     LCFSDMNTTKNCIEKEKYMTIYKIKNDEPLFSFDGNRYFLNENNKIVKMKRE"
     misc_feature    complement(172316..172777)
                     /locus_tag="YPTB0139"
                     /note="Enterobacterial putative membrane protein (DUF943);
                     Region: DUF943; pfam06092"
                     /db_xref="CDD:253556"
     misc_feature    complement(172700..172750)
                     /locus_tag="YPTB0139"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(172795..173259)
                     /locus_tag="YPTB0140"
                     /db_xref="GeneID:2953095"
     CDS             complement(172795..173259)
                     /locus_tag="YPTB0140"
                     /note="similar to Yersinia pestis YPO3894  membrane
                     protein (82.4% evalue=2.E-70)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068689.1"
                     /db_xref="GI:51594498"
                     /db_xref="GeneID:2953095"
                     /translation="MKAKSKKIICALLLLGSILLGYFFWLSLRPVEIVAIHKDGNFSA
                     VLVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITFWDFGEGYKEEGKYDR
                     RCFEDMKTDKNCIDKKSVFSVRRINNDRILFITYEGRYSLNDNGEIIKIKRK"
     misc_feature    complement(172801..173259)
                     /locus_tag="YPTB0140"
                     /note="Enterobacterial putative membrane protein (DUF943);
                     Region: DUF943; pfam06092"
                     /db_xref="CDD:253556"
     misc_feature    complement(173182..173238)
                     /locus_tag="YPTB0140"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(173339..173800)
                     /locus_tag="YPTB0141"
                     /db_xref="GeneID:2953096"
     CDS             complement(173339..173800)
                     /locus_tag="YPTB0141"
                     /note="similar to Yersinia pestis YPO3894  membrane
                     protein (94.7% evalue=5.E-83)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068690.1"
                     /db_xref="GI:51594499"
                     /db_xref="GeneID:2953096"
                     /translation="MKAKSKKTLYALLLIGSVLLGYFFWLSLRPVEIVAVHKDRNFSA
                     VLVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEEGKYDR
                     RCFEDMKTSKNCIDKNSLMIIRNSQYNVMSFTLDSGIYQLKNGEIVKMKHE"
     misc_feature    complement(173342..173800)
                     /locus_tag="YPTB0141"
                     /note="Enterobacterial putative membrane protein (DUF943);
                     Region: DUF943; pfam06092"
                     /db_xref="CDD:253556"
     misc_feature    complement(173717..173773)
                     /locus_tag="YPTB0141"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(173784..174662)
                     /locus_tag="YPTB0142"
                     /db_xref="GeneID:2953097"
     CDS             complement(173784..174662)
                     /locus_tag="YPTB0142"
                     /note="similar to Yersinia pestis YPO3983 conserved
                     hypothetical protein (49.6% evalue=1.E-72)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068691.1"
                     /db_xref="GI:51594500"
                     /db_xref="GeneID:2953097"
                     /translation="MLETTKSTVQALYFPCTVFKTQKRMDDYGADDMRCGDLSATQLK
                     TDFNLHNISSKVNPYTLTLFQQLKPMPYGYAYDKNPESKKITRQECVRILFNEFRHES
                     RSFAFYGPYKHLIEKMIDHMQNGNGTPFRDLSLDAALKEQILSDYTEKNSTRLLLRKV
                     LNENIDWRNKLYPAEKKDDIRKFILDGRLPKFDRFQDNFNGMGITVHDTWATDITIKS
                     LQIDNDRYRAMVHYKIQDHFGLDNNDIKNTKFNRFHFFRIWFVLQRFNQFGFKPFMTN
                     MEATIEITGGRNESKK"
     misc_feature    complement(173808..174632)
                     /locus_tag="YPTB0142"
                     /note="conserved hypothetical protein; Region: TIGR03034"
                     /db_xref="CDD:132079"
     gene            175310..175519
                     /locus_tag="YPTB0143"
                     /db_xref="GeneID:2953098"
     CDS             175310..175519
                     /locus_tag="YPTB0143"
                     /note="similar to Yersinia pestis YPO3890 hypothetical
                     protein. 100% identical"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068692.1"
                     /db_xref="GI:51594501"
                     /db_xref="GeneID:2953098"
                     /translation="MEDNGAVAKETIEGTVGYIGDDISLLTSAMNNFSSQVSEQVSML
                     GAIQSNVTGSIAMISCYSIGRVIAA"
     gene            complement(175574..176455)
                     /gene="ilvY"
                     /locus_tag="YPTB0144"
                     /db_xref="GeneID:2955880"
     CDS             complement(175574..176455)
                     /gene="ilvY"
                     /locus_tag="YPTB0144"
                     /note="participates in controlling several genes involved
                     in isoleucine and valine biosynthesis; activates the
                     transcription of the ilvC gene in the presence of
                     acetolactate or acetohydroxybutyrate"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator IlvY"
                     /protein_id="YP_068693.1"
                     /db_xref="GI:51594502"
                     /db_xref="GeneID:2955880"
                     /translation="MDLRDLKVFLHLAESRHFGRSAKAMHVSPSTLSRQIQRLEETIG
                     QPLFLRDNRTVQLTDAGNQLKAFAQQTLLQYQQLLHALGQHGPSLSGELRLFCSVTAA
                     YSHLPPILDRFRARHPLVEIKLTTGDAADAVNKVQSNEADLGIAGRPEVLPTSVAFTQ
                     IGEIPLVLIAPALPCAVRSQVAVEKPDWAMIPFILPEHGPSRKRIDLWFRRQRITNPL
                     IYATVSGHEAIVSMVALGCGVALIPSVVVDNSPEPVRNRISLLDDVSLVEPFELGVCV
                     PKKRLQEPLIDAFWGLL"
     misc_feature    complement(176273..176449)
                     /gene="ilvY"
                     /locus_tag="YPTB0144"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(175577..176383)
                     /gene="ilvY"
                     /locus_tag="YPTB0144"
                     /note="DNA-binding transcriptional regulator IlvY;
                     Provisional; Region: PRK11716"
                     /db_xref="CDD:236961"
     misc_feature    complement(175580..176182)
                     /gene="ilvY"
                     /locus_tag="YPTB0144"
                     /note="The C-terminal substrate binding of LysR-type
                     transcriptional regulator IlvY, which activates the
                     expression of ilvC gene that encoding acetohydroxy acid
                     isomeroreductase for the biosynthesis of branched amino
                     acids; contains the type 2 periplasmic bindin; Region:
                     PBP2_IlvY; cd08430"
                     /db_xref="CDD:176121"
     misc_feature    complement(order(175751..175756,175760..175765,
                     175781..175798,176078..176098,176102..176104,
                     176114..176116,176123..176128,176132..176137))
                     /gene="ilvY"
                     /locus_tag="YPTB0144"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176121"
     gene            176746..178224
                     /gene="ilvC"
                     /locus_tag="YPTB0145"
                     /db_xref="GeneID:2955872"
     CDS             176746..178224
                     /gene="ilvC"
                     /locus_tag="YPTB0145"
                     /EC_number="1.1.1.86"
                     /note="catalyzes the formation of
                     (R)-2,3-dihydroxy-3-methylbutanoate from
                     (S)-2-hydroxy-2-methyl-3-oxobutanoate in valine and
                     isoleucine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="YP_068694.1"
                     /db_xref="GI:51594503"
                     /db_xref="GeneID:2955872"
                     /translation="MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVG
                     CGAQGLNQGLNMRDSGLDVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLV
                     VNLTPDKQHSAVVKAVQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTE
                     VREEYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDL
                     MGEQTILCGMLQAGSLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDR
                     LSNPAKLRAYALSEQLKEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREET
                     GRTAFENAPQFEGKISEQEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLH
                     ELPLIANTIARKRLYEMNVVISDTAEYGNYLFANAAVPLLKEKFMDSLQAGDLGKSIP
                     GSAVDNAQLRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG"
     misc_feature    176749..178212
                     /gene="ilvC"
                     /locus_tag="YPTB0145"
                     /note="ketol-acid reductoisomerase; Validated; Region:
                     PRK05225"
                     /db_xref="CDD:235368"
     misc_feature    176845..177357
                     /gene="ilvC"
                     /locus_tag="YPTB0145"
                     /note="Acetohydroxy acid isomeroreductase, catalytic
                     domain; Region: IlvN; pfam07991"
                     /db_xref="CDD:116601"
     misc_feature    177817..178203
                     /gene="ilvC"
                     /locus_tag="YPTB0145"
                     /note="Acetohydroxy acid isomeroreductase, catalytic
                     domain; Region: IlvC; pfam01450"
                     /db_xref="CDD:250630"
     gene            178801..180249
                     /locus_tag="YPTB0146"
                     /pseudo
                     /db_xref="GeneID:2953099"
     misc_feature    178801..180249
                     /locus_tag="YPTB0146"
                     /note="similar to Yersinia pestis YPO3886 colicin
                     (partial) (99.3% evalue=0); Ralstonia solanacearum RS01806
                     probable transmembrane protein (43.4%
                     evalue=6.E-21);colicin (partial)"
                     /pseudo
                     /db_xref="PSEUDO:CAH19386.1"
     gene            180249..180512
                     /locus_tag="YPTB0147"
                     /db_xref="GeneID:2953100"
     CDS             180249..180512
                     /locus_tag="YPTB0147"
                     /note="similar to Yersinia pestis YPO3885 hypothetical
                     protein (100% evalue=4.E-45)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068695.1"
                     /db_xref="GI:51594504"
                     /db_xref="GeneID:2953100"
                     /translation="MSIMEKIIQNETVEDVLLAFTPNTAYQGIERMYVRYRFNIVSNR
                     ELLFTYQRLIKEAKLAEDEKGHTLKGPNWKEPKFVTDKKYGIE"
     gene            180813..181019
                     /locus_tag="YPTB0148"
                     /pseudo
                     /db_xref="GeneID:2953101"
     misc_feature    180813..181019
                     /locus_tag="YPTB0148"
                     /note="similar to Yersinia pestis YPO3884 colicin
                     (partial) (52.2% evalue=6.E-16); Pseudomonas aeruginosa
                     PA1150 pys2; pyocin S2 (43.5% evalue=9.E-09);colicin
                     (partial)"
                     /pseudo
                     /db_xref="PSEUDO:CAH19388.1"
     gene            181028..181282
                     /locus_tag="YPTB0149"
                     /db_xref="GeneID:2953102"
     CDS             181028..181282
                     /locus_tag="YPTB0149"
                     /note="similar to Yersinia pestis YPO3883 imm; colicin
                     immunity protein (49.4% evalue=1.E-21); Salmonella typhi
                     STY3281 bacteriocin immunity protein (44.1%
                     evalue=2.E-16)"
                     /codon_start=1
                     /transl_table=11
                     /product="colicin immunity protein"
                     /protein_id="YP_068696.1"
                     /db_xref="GI:51594505"
                     /db_xref="GeneID:2953102"
                     /translation="MKLKNSISEYAEGEFLDFLNKIWSVDVSESEHDALIRHFVMITE
                     HPQGNGVLFYPPEGVENSPEGVLDFIKKWRSENGKPSFKE"
     misc_feature    181028..181279
                     /locus_tag="YPTB0149"
                     /note="Colicin immunity protein / pyocin immunity protein;
                     Region: Colicin_Pyocin; pfam01320"
                     /db_xref="CDD:250530"
     gene            181435..181854
                     /gene="pys2"
                     /locus_tag="YPTB0150"
                     /db_xref="GeneID:2956392"
     CDS             181435..181854
                     /gene="pys2"
                     /locus_tag="YPTB0150"
                     /EC_number="3.1.21.1"
                     /note="similar to Yersinia pestis YPO3884 colicin
                     (partial) (48% evalue=1.E-15); Pseudomonas aeruginosa
                     PA1150 pys2; pyocin S2 (47.4% evalue=4.E-35)"
                     /codon_start=1
                     /transl_table=11
                     /product="pyocin S2 (partial)"
                     /protein_id="YP_068697.1"
                     /db_xref="GI:51594506"
                     /db_xref="GeneID:2956392"
                     /translation="MYVYLKSPRDEPGVVTGRGERITGIWLAGAGKDMGAPIPAQIAD
                     KLRGRRFSHFGRFRAAFWKVVGEDPNLVKYFKSGNLGNIKNGKVPSPKEREQVGRRVK
                     YELHHLKPISKNGAVYHIENIRVLTPKRHIDIHKGAE"
     misc_feature    181453..181845
                     /gene="pys2"
                     /locus_tag="YPTB0150"
                     /note="DNase/tRNase domain of colicin-like bacteriocin;
                     Region: Colicin-DNase; pfam12639"
                     /db_xref="CDD:257184"
     misc_feature    <181726..181839
                     /gene="pys2"
                     /locus_tag="YPTB0150"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    order(181744..181746,181750..181758,181762..181764,
                     181798..181803,181813..181818,181825..181827,
                     181837..181839)
                     /gene="pys2"
                     /locus_tag="YPTB0150"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            181856..182110
                     /gene="imm2"
                     /locus_tag="YPTB0151"
                     /db_xref="GeneID:2955882"
     CDS             181856..182110
                     /gene="imm2"
                     /locus_tag="YPTB0151"
                     /note="similar to Yersinia pestis YPO3883 imm; colicin
                     immunity protein (51.9% evalue=2.E-19); Pseudomonas
                     aeruginosa PA1151 imm2; pyocin S2 immunity protein (60.4%
                     evalue=6.E-23)"
                     /codon_start=1
                     /transl_table=11
                     /product="pyocin S2 immunity protein"
                     /protein_id="YP_068698.1"
                     /db_xref="GI:51594507"
                     /db_xref="GeneID:2955882"
                     /translation="MEDKSICDYTESEFLELVKELFNVEKTTEEEDINNLIEFKRLCE
                     HPAGSDLIFYPDNNREDSPEGVVKEVKKWRAENGKPGFKK"
     misc_feature    181865..182107
                     /gene="imm2"
                     /locus_tag="YPTB0151"
                     /note="Colicin immunity protein / pyocin immunity protein;
                     Region: Colicin_Pyocin; pfam01320"
                     /db_xref="CDD:250530"
     gene            182263..182691
                     /gene="pys2"
                     /locus_tag="YPTB0152"
                     /db_xref="GeneID:2956393"
     CDS             182263..182691
                     /gene="pys2"
                     /locus_tag="YPTB0152"
                     /EC_number="3.1.21.1"
                     /note="similar to Yersinia pestis YPO3884 colicin
                     (partial) (55.5% evalue=3.E-19); Pseudomonas aeruginosa
                     PA1150 pys2; pyocin S2 (48.2% evalue=5.E-31)"
                     /codon_start=1
                     /transl_table=11
                     /product="pyocin S2 (partial)"
                     /protein_id="YP_068699.1"
                     /db_xref="GI:51594508"
                     /db_xref="GeneID:2956393"
                     /translation="MYVYLKSLRDEPGVVTGRGERITGIWLAGAGKDMGVPIPSQIAD
                     KLRGRWFSHFGRFRAAFWREVANDPELVGQFIISNRERMSVGKAPKAKKIDSGGKRIP
                     FEIHHVKFIKDNGEVYNIDNLRILTPKLHIELHSKNKGKQ"
     misc_feature    182287..182667
                     /gene="pys2"
                     /locus_tag="YPTB0152"
                     /note="DNase/tRNase domain of colicin-like bacteriocin;
                     Region: Colicin-DNase; pfam12639"
                     /db_xref="CDD:257184"
     misc_feature    <182545..182667
                     /gene="pys2"
                     /locus_tag="YPTB0152"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    order(182572..182574,182578..182586,182590..182592,
                     182626..182631,182641..182646,182653..182655,
                     182665..182667)
                     /gene="pys2"
                     /locus_tag="YPTB0152"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            182688..182951
                     /gene="imm"
                     /locus_tag="YPTB0153"
                     /db_xref="GeneID:2955881"
     CDS             182688..182951
                     /gene="imm"
                     /locus_tag="YPTB0153"
                     /note="similar to Yersinia pestis YPO3883 imm; colicin
                     immunity protein (50.5% evalue=5.E-19); Salmonella typhi
                     STY3281 bacteriocin immunity protein (58.8%
                     evalue=6.E-23)"
                     /codon_start=1
                     /transl_table=11
                     /product="colicin immunity protein (E7)"
                     /protein_id="YP_068700.1"
                     /db_xref="GI:51594509"
                     /db_xref="GeneID:2955881"
                     /translation="MKLKNSISEYTEEEFIDFLKEIFKENIADTDARLNELLEHFECV
                     TEHPEGTDLIYYPLSDYECTPRKILEKVKKWRAENGKPGFKNK"
     misc_feature    182688..182942
                     /gene="imm"
                     /locus_tag="YPTB0153"
                     /note="Colicin immunity protein / pyocin immunity protein;
                     Region: Colicin_Pyocin; pfam01320"
                     /db_xref="CDD:250530"
     gene            183509..183880
                     /locus_tag="YPTB0154"
                     /db_xref="GeneID:2953103"
     CDS             183509..183880
                     /locus_tag="YPTB0154"
                     /note="similar to Yersinia pestis YPO1234 probable phage
                     antitermination protein Q (52.9% evalue=3.E-27);
                     Salmonella typhimurium STM2239  phage protein; homology to
                     antiterminator protein Q of phage P5 (40% evalue=4.E-19)"
                     /codon_start=1
                     /transl_table=11
                     /product="phage antitermination protein Q"
                     /protein_id="YP_068701.1"
                     /db_xref="GI:51594510"
                     /db_xref="GeneID:2953103"
                     /translation="MSYIQTVLARWGVWARDNSCLDYPHISSGFKGLVTRNKPAESCC
                     DHDGLVIDNTVGNLQRAAREKELELILRHYVYGQSKSSIARLKKCNEREIRRQLQIAE
                     SFIEGCITQSDILLEMHKELF"
     misc_feature    183509..183874
                     /locus_tag="YPTB0154"
                     /note="Phage antitermination protein Q; Region:
                     Phage_antitermQ; pfam06530"
                     /db_xref="CDD:115202"
     gene            184491..184826
                     /locus_tag="YPTB0155"
                     /db_xref="GeneID:2953104"
     CDS             184491..184826
                     /locus_tag="YPTB0155"
                     /note="not present in pestis"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068702.1"
                     /db_xref="GI:51594511"
                     /db_xref="GeneID:2953104"
                     /translation="MSYKILGGIITALVASFLLLLVQWSNLSKQIENKEKELVTVREA
                     NVVLKNILDIYHVNDMSNRVATARQLENERVLRNEYEENIRQFKAATIDDFCAAQHMP
                     DRIINLLQE"
     misc_feature    184503..184571
                     /locus_tag="YPTB0155"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(185085..185831)
                     /locus_tag="YPTB0156"
                     /db_xref="GeneID:2953105"
     CDS             complement(185085..185831)
                     /locus_tag="YPTB0156"
                     /note="similar to Yersinia pestis YPO3881  chaperone
                     protein (99.5% evalue=1.E-137); Pseudomonas aeruginosa
                     PA2132 probable pili assembly chaperone (46.4%
                     evalue=2.E-43)"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein"
                     /protein_id="YP_068703.1"
                     /db_xref="GI:51594512"
                     /db_xref="GeneID:2953105"
                     /translation="MLLLMTTCRVLTLPALTIGVLIMSALATSAVASVIAERTRIVFS
                     EGSTEESLQLVNSNSYPVAVQVWVDDGNLMATPDKAVSPILVLPPVFRLQPQAQRSLR
                     LILSGGSKLPADRESAFWLNIYEIPPKATPKSGDESFVTLALRMQYKVFYRPKNLPAP
                     GDILGKALTFSLERNGDSALIKVNNPTPYYASFAALTIGSAEGPPEMVAPFSQLDFPL
                     NRAPISDNKTVNFDLIDDLGNRNSFSHELK"
     misc_feature    complement(185091..185825)
                     /locus_tag="YPTB0156"
                     /note="P pilus assembly protein, chaperone PapD [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: FimC; COG3121"
                     /db_xref="CDD:225663"
     misc_feature    complement(185358..185735)
                     /locus_tag="YPTB0156"
                     /note="Pili and flagellar-assembly chaperone, PapD
                     N-terminal domain; Region: PapD_N; pfam00345"
                     /db_xref="CDD:249787"
     misc_feature    complement(185106..185291)
                     /locus_tag="YPTB0156"
                     /note="Pili assembly chaperone PapD, C-terminal domain;
                     Region: PapD_C; pfam02753"
                     /db_xref="CDD:251514"
     misc_feature    complement(185727..185792)
                     /locus_tag="YPTB0156"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(185869..187236)
                     /locus_tag="YPTB0157"
                     /db_xref="GeneID:2953106"
     CDS             complement(185869..187236)
                     /locus_tag="YPTB0157"
                     /note="similar to Yersinia pestis YPO3880  exported
                     protein (100% evalue=0); Pseudomonas aeruginosa PA2131
                     hypothetical protein (44.6% evalue=9.E-94)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068704.1"
                     /db_xref="GI:51594513"
                     /db_xref="GeneID:2953106"
                     /translation="MLRPTKPLISSGISQSTTAVYCRRPYFLAGMTLLIGLFSTSAWS
                     NCTRITAQNQISSSDGTAASWLGSRDDNNGSLNLPSIVDLSTNANFQPDGTLLASATS
                     DFTTFAVNTGYALDQVLFRCDAADVDQLYEMYATNGDSTYGGRYEDGTIAGNVSYGYA
                     TTVMNVVIRFTNLATGEYYARIWKGRRLTGLDTDSSGRILVKAKNFSNVYTELFRIDY
                     ARSGANNTPSYLYGRSQPNAYIAFKGPGITGPIEGTDSYSNWPGWYSTWPASLGLYKY
                     VTFRRTTICAVSNFTPTVVLPRISVAELNNGNTSSADFNVDFQCQTGINSGVTAGTVA
                     MGFLVPAANAAKAQALGLMNGNGGVSHLVSDNYGAAGTAGGVGIRIYRNNSPMYLLSK
                     NVTQTGNNGGWYGILQGAQETTGSVDGGNSYTETFRAELSKISGQTVTAGAVNAHAQV
                     VIRVQ"
     misc_feature    complement(185872..187182)
                     /locus_tag="YPTB0157"
                     /note="Fimbrial protein; Region: Fimbrial; cl01416"
                     /db_xref="CDD:260929"
     gene            complement(187253..189904)
                     /locus_tag="YPTB0158"
                     /db_xref="GeneID:2953107"
     CDS             complement(187253..189904)
                     /locus_tag="YPTB0158"
                     /note="similar to Yersinia pestis YPO3879  outer membrane
                     usher protein (98.8% evalue=0); Pseudomonas aeruginosa
                     PA2130 probable fimbrial biogenesis usher protein (46.7%
                     evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane fimbrial usher porin"
                     /protein_id="YP_068705.1"
                     /db_xref="GI:51594514"
                     /db_xref="GeneID:2953107"
                     /translation="MVQARVILKKNFSGRRKALTLCITLILHIDTAFGQEEPQNFEFD
                     ESLFLGTKYASGLTQLNKKNSITAGNYDAVDVLVNNKLFKRMSVQFIKDANSSEVYPC
                     LSDELLTAAGVELGRENSTPPKEPHVTEANTPITETHAPTNQCLPLSTRVKGASFRFD
                     QAKLRLELSIPQALLQKRPRGYIERAEWQEGEKLAFINYSANAYRSDTRGQQKRTSDF
                     GFIGLKSGINLGLWQVRQQSNVRYASNDSGSDTQWNSIRTYVQRPIPQLDSQLTLGET
                     FTDSTLFGSMSFLGAKMATDQRMWPVSMRGFSPEVRGVASTNARVIIRQNGREIYETN
                     VAPGPFVINDLFSTSSQGDLNVEVIEANGSRSTFTVPFSAVPDSMRPGVSRYNAVIGE
                     SRDFTNIDNYFTDFTYERGLTNQLTANSGVRLAKDYTALLAGGVLGTPVGALGLNATY
                     SHAKVENDKTQDGWRMQATYSQTFNQTGTTFSLAGYRYSTKGYRDLNDVFGVRSMQKN
                     GGTWDSSTYKQRSQFTTTINQDLGNWGQLYASASTSDYYNDTARDTQLQLGYSNSYQQ
                     ISYNLAVSRQRSVYTSTLYNWDSPDTDETATTTRYGNTENIATFTVSIPLNIGSNNQY
                     LSMSASRNPKSGNNYQTSLSGTAGERNSFNYALNAGYDDSNIGSSSNNWGANVQKQFP
                     NATVNGSYSRGNNYTQYGAGARGAAVIHRQGVTLGPYLGETFGLIEANGAQGATVRNA
                     QGARIDSNGFALVPALTPYNYNTIGLDTKGINRNTELKENQGRVVPYAGAAVKVKFET
                     LTGYAVLIQAEGERLPLGADVYNSKDELVGMVGQGNQIYARIADNKGTLDVRWGESSG
                     DQCQLPYAFNRQDTEQDIIHITASCRR"
     misc_feature    complement(187259..189877)
                     /locus_tag="YPTB0158"
                     /note="P pilus assembly protein, porin PapC [Cell motility
                     and secretion / Intracellular trafficking and secretion];
                     Region: FimD; COG3188"
                     /db_xref="CDD:225729"
     misc_feature    complement(189293..189784)
                     /locus_tag="YPTB0158"
                     /note="PapC N-terminal domain; Region: PapC_N; pfam13954"
                     /db_xref="CDD:258209"
     misc_feature    complement(187517..189247)
                     /locus_tag="YPTB0158"
                     /note="Outer membrane usher protein; Region: Usher;
                     pfam00577"
                     /db_xref="CDD:249973"
     misc_feature    complement(187313..187498)
                     /locus_tag="YPTB0158"
                     /note="PapC C-terminal domain; Region: PapC_C; pfam13953"
                     /db_xref="CDD:258208"
     gene            complement(189932..190663)
                     /locus_tag="YPTB0159"
                     /db_xref="GeneID:2953108"
     CDS             complement(189932..190663)
                     /locus_tag="YPTB0159"
                     /note="similar to Yersinia pestis YPO3878  fimbrial
                     chaperone (99.5% evalue=1.E-134); Pseudomonas aeruginosa
                     PA2129 probable pili assembly chaperone (44.1%
                     evalue=3.E-49)"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial chaperone"
                     /protein_id="YP_068706.1"
                     /db_xref="GI:51594515"
                     /db_xref="GeneID:2953108"
                     /translation="MLSIYARHYHYLFVTLLVAMSLSFANASVVMTGSRIIYPAAASE
                     HSIQLTNNDNFPNAVQVWLDSGDEKSTPETGKAPFIVTPPFFRIEANSGQTLRLKYTG
                     SGLPTDRESVFYLNFLQIPPVNKVEKDNKMLVLLRNRIKVFYRPESIIGRVDQVSTAL
                     TFSLRKQGTNLVLTGKNPTGFYATIASGEIVSGSIKLKVKSNMIAPMSQVEWVIPNAS
                     VPSSATINFLIMNDFGGQDAGSYRI"
     misc_feature    complement(189941..190663)
                     /locus_tag="YPTB0159"
                     /note="P pilus assembly protein, chaperone PapD [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: FimC; COG3121"
                     /db_xref="CDD:225663"
     misc_feature    complement(190217..190582)
                     /locus_tag="YPTB0159"
                     /note="Pili and flagellar-assembly chaperone, PapD
                     N-terminal domain; Region: PapD_N; pfam00345"
                     /db_xref="CDD:249787"
     misc_feature    complement(189956..190147)
                     /locus_tag="YPTB0159"
                     /note="Pili assembly chaperone PapD, C-terminal domain;
                     Region: PapD_C; pfam02753"
                     /db_xref="CDD:251514"
     misc_feature    complement(190571..190636)
                     /locus_tag="YPTB0159"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(190727..191257)
                     /locus_tag="YPTB0160"
                     /db_xref="GeneID:2953109"
     CDS             complement(190727..191257)
                     /locus_tag="YPTB0160"
                     /note="similar to Yersinia pestis YPO3877  fimbrial
                     protein (100% evalue=8.E-93); Salmonella typhimurium
                     STM0340 stbA; fimbriae; major subunit (49.1%
                     evalue=2.E-37)"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="YP_068707.1"
                     /db_xref="GI:51594516"
                     /db_xref="GeneID:2953109"
                     /translation="MKKITLAIALFSASTTVAMSASNNTITFQGEVTAQTCSVTVNGL
                     EANPVVLLPTVSSSDLDASGQTKGKTTFTLGVSGCTSGSDDLDIKTVFIGSLVTATGN
                     LQNTGTAGNVELQLLKDATTTTGIDLNSGLAQDGIVLLAGDTSAEHDFAVQYYATGQS
                     TPGSVIASVQYAVSYL"
     misc_feature    complement(190733..191257)
                     /locus_tag="YPTB0160"
                     /note="P pilus assembly protein, pilin FimA [Cell motility
                     and secretion / Intracellular trafficking and secretion];
                     Region: FimA; COG3539"
                     /db_xref="CDD:226069"
     gene            complement(192049..192840)
                     /locus_tag="YPTB0161"
                     /db_xref="GeneID:2953110"
     CDS             complement(192049..192840)
                     /locus_tag="YPTB0161"
                     /note="similar to Yersinia pestis YPO3874  exported
                     protein (99.6% evalue=1.E-151); Caulobacter crescentus
                     CC2650 glutamine cyclotransferase (37.6% evalue=5.E-42)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068708.1"
                     /db_xref="GI:51594517"
                     /db_xref="GeneID:2953110"
                     /translation="MEILNIPRRCFTFLLIIITYSFPLSFADSKPLKYTFEVIRKIPH
                     DETSFTQGLVIDDGKLYETTGLYKNSKIRELDLTNGKVIRSVDLPDNIFGEGITKLGD
                     SFYVLTWKEKKAFVINPNDLKIIKTFNYEGEGWGLTTDGINLIMGDGSDTLYFRNPAD
                     FSIIKKISVTFDGRRIEKINELEWIDGMIYANVWYSDAILVIEPENGRVVKWIELSGL
                     QFMLDSVNRNTNTLNGIAYDKSKNKIYLTGKNWSNIFEVKFLTSK"
     misc_feature    complement(192052..192840)
                     /locus_tag="YPTB0161"
                     /note="Glutamine cyclotransferase [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG3823"
                     /db_xref="CDD:226344"
     gene            complement(193079..193360)
                     /gene="ppiC"
                     /locus_tag="YPTB0162"
                     /db_xref="GeneID:2956308"
     CDS             complement(193079..193360)
                     /gene="ppiC"
                     /locus_tag="YPTB0162"
                     /EC_number="5.2.1.8"
                     /note="similar to Yersinia pestis YPO3873 ppiC;
                     peptidyl-prolyl cis-trans isomerase C (100%
                     evalue=2.E-49); Escherichia coli JW3748 ppiC;
                     peptidyl-prolyl cis/trans isomerases (67.7%
                     evalue=4.E-31)"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_068709.1"
                     /db_xref="GI:51594518"
                     /db_xref="GeneID:2956308"
                     /translation="MANKASALHILVDDEKQANDILAQLNNGANFQELAKKFSNCPSK
                     RNGGDLGEFNKGDMVPAFDKAVFSCELLQPYGPVKTQFGYHIIKVLYRS"
     misc_feature    complement(193082..193360)
                     /gene="ppiC"
                     /locus_tag="YPTB0162"
                     /note="PPIC-type PPIASE domain; Region: Rotamase_2;
                     cl08278"
                     /db_xref="CDD:263564"
     misc_feature    complement(193085..>193360)
                     /gene="ppiC"
                     /locus_tag="YPTB0162"
                     /note="Parvulin-like peptidyl-prolyl isomerase
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: SurA; COG0760"
                     /db_xref="CDD:223831"
     gene            193564..195585
                     /gene="rep"
                     /locus_tag="YPTB0163"
                     /db_xref="GeneID:2956424"
     CDS             193564..195585
                     /gene="rep"
                     /locus_tag="YPTB0163"
                     /EC_number="3.6.1.-"
                     /note="single-stranded DNA-dependent ATPase; initiates
                     unwinding at a nick in the DNA; involved in DNA
                     replication"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase Rep"
                     /protein_id="YP_068710.1"
                     /db_xref="GI:51594519"
                     /db_xref="GeneID:2956424"
                     /translation="MRLNPSQQEAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRQCG
                     YQPKHIAAVTFTNKAAREMKERVAQTLGRKEARGLMIATFHTLGLEIIKKEYVALGMK
                     SNFSLFDAQDQMGLLKDLTHKWLEDDKTLLQQLVSAISNWKNDLLDPAAAAATARSER
                     DKLFVHCYGLYDAHLKACNVLDFDDLISLPTLLLQKNLEVRERWQNRLRYLLVDEYQD
                     TNTSQYQMVKLLVGNRARFTVVGDDDQSIYSWRGARPQNLVLLNEDFPALRVIKLEQN
                     YRSSGRILKAANILIANNPHVFEKKLFSELSYGDELKVITANNEDHEAERVVGELIAH
                     HFVKKTQYSDYAILYRGNHQSRLFEKLLMQNRIPYRISGGDSFFSRPEIKDLLAYLRV
                     LTNQDDDSAFLRIVNTPKREIGAATVQKLGEWANLRNKSLFRASFDLGLGEHLKGRGL
                     ESLQRFTHWMDGIIRLVEREPVAAVRDLIHGIDYESWLFETAPSPKAAEMRMKNVNLL
                     FSWMTEMLEGSELDEPMTLTQVVTRFTLRDMMERGESDEELDQVQLMTLHASKGLEFP
                     YVFLVGMEEGLLPHQSSIDEDNVDEERRLAYVGITRAQRELFFTLCKERRQYGELIRP
                     EPSRFLMELPQDDLNWENERKAVSPEERMQKGQSHLANLRAQLANAKKP"
     misc_feature    193564..195579
                     /gene="rep"
                     /locus_tag="YPTB0163"
                     /note="ATP-dependent DNA helicase Rep; Provisional;
                     Region: PRK10919"
                     /db_xref="CDD:182838"
     misc_feature    193588..193827
                     /gene="rep"
                     /locus_tag="YPTB0163"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    <195226..195393
                     /gene="rep"
                     /locus_tag="YPTB0163"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            complement(195753..197249)
                     /locus_tag="YPTB0164"
                     /db_xref="GeneID:2953111"
     CDS             complement(195753..197249)
                     /locus_tag="YPTB0164"
                     /EC_number="3.6.1.40"
                     /note="catalyzes the conversion of guanosine
                     5'-triphosphate,3'-diphosphate (pppGpp) to guanosine
                     5'-diphosphate,3'-diphosphate (ppGpp); pppGpp and ppGpp
                     control the stringent response during amino acid
                     starvation"
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine pentaphosphate phosphohydrolase"
                     /protein_id="YP_068711.1"
                     /db_xref="GI:51594520"
                     /db_xref="GeneID:2953111"
                     /translation="MMLSSTSLYAAIDLGSNSFHMLVVREVAGSIQTLARIKRKVRLA
                     AGLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRVVATATLRLASNADEFLRTAT
                     EILGCPIQVISGEEEARLIYHGVAHTTGGPEQRLVVDIGGGSTELVTGNGAQANILVS
                     LSMGCVTWLERYFGDRHLAKENFERAELAAHEMIKPVAQRFREHGWQVCVGASGTVQA
                     LQEIMVAQGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAI
                     FQELSIESMTLAGGALREGLVYGMLHLPVEQDIRRRTLRNLQRRYLLDTEQAKRVSCL
                     ADNFFLQVEKEWHLDGRCREFLQNACLIHEIGLSVDFKHAPQHAAYLIRNLDLPGFTP
                     AQKLLLSALLQNQSDTIDLSLLNQQNALPADMAQHLCRLLRLAIIFSSRRRDDTLPAV
                     RLRADNNALYVLVPQGWLEQHPYRAEALEQESHWQSYVQWPLLLEELS"
     misc_feature    complement(195759..197246)
                     /locus_tag="YPTB0164"
                     /note="guanosine pentaphosphate phosphohydrolase;
                     Provisional; Region: PRK11031"
                     /db_xref="CDD:236826"
     misc_feature    complement(196347..197228)
                     /locus_tag="YPTB0164"
                     /note="exopolyphosphatase; Region: exo_poly_only;
                     TIGR03706"
                     /db_xref="CDD:234320"
     gene            complement(197253..198539)
                     /gene="rhlB"
                     /locus_tag="YPTB0165"
                     /gene_synonym="mmrA"
                     /db_xref="GeneID:2956445"
     CDS             complement(197253..198539)
                     /gene="rhlB"
                     /locus_tag="YPTB0165"
                     /gene_synonym="mmrA"
                     /note="enables ATP-dependent unwinding of double stranded
                     RNA as a component of the RNA degradosome, a multi-enzyme
                     complex important in RNA processing and messenger RNA
                     degradation"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase RhlB"
                     /protein_id="YP_068712.1"
                     /db_xref="GI:51594521"
                     /db_xref="GeneID:2956445"
                     /translation="MSKTHLTEQKFSDFALHPLVVEALENKGFQYCTPIQALALPLTL
                     SGRDVAGQAQTGTGKTLAFLASTFHYLLSHPAEEGRQTNQPRALIMAPTRELAVQIHS
                     DAESLSQVTGLKLGLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNYINLGAIQ
                     VVVLDEADRMYDLGFIKDIRWLFRRMPSVDKRLNMLFSATLSYRVRELAFEQMNNAEY
                     VEVEPLQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWPDRCIIFANTKHRCEEIWGHL
                     AADGHRVGLLTGDVAQKKRLRILEDFTKGDLDILVATDVAARGLHIPLVTHVFNYDLP
                     DDCEDYVHRIGRTGRAGESGHSISLACEEYALNLPAIETYTGHSIPVSKYNSDALLTD
                     LPAPKRLARTRTGNGPRRNSAPRRSGAPRNNRKRPG"
     misc_feature    complement(197256..198536)
                     /gene="rhlB"
                     /locus_tag="YPTB0165"
                     /gene_synonym="mmrA"
                     /note="ATP-dependent RNA helicase RhlB; Provisional;
                     Region: PRK04837"
                     /db_xref="CDD:235314"
     misc_feature    complement(197880..198509)
                     /gene="rhlB"
                     /locus_tag="YPTB0165"
                     /gene_synonym="mmrA"
                     /note="DEAD-box helicases. A diverse family of proteins
                     involved in ATP-dependent RNA unwinding, needed in a
                     variety of cellular processes including splicing, ribosome
                     biogenesis and RNA degradation. The name derives from the
                     sequence of the Walker  B motif; Region: DEADc; cd00268"
                     /db_xref="CDD:238167"
     misc_feature    complement(198360..198374)
                     /gene="rhlB"
                     /locus_tag="YPTB0165"
                     /gene_synonym="mmrA"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(198036..198047)
                     /gene="rhlB"
                     /locus_tag="YPTB0165"
                     /gene_synonym="mmrA"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(197940..197948)
                     /gene="rhlB"
                     /locus_tag="YPTB0165"
                     /gene_synonym="mmrA"
                     /note="motif III; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(197463..197843)
                     /gene="rhlB"
                     /locus_tag="YPTB0165"
                     /gene_synonym="mmrA"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(197595..197603,197676..197681,
                     197739..197750))
                     /gene="rhlB"
                     /locus_tag="YPTB0165"
                     /gene_synonym="mmrA"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(197493..197495,197502..197504,
                     197514..197516,197577..197579))
                     /gene="rhlB"
                     /locus_tag="YPTB0165"
                     /gene_synonym="mmrA"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            198658..198984
                     /gene="trxA"
                     /locus_tag="YPTB0166"
                     /gene_synonym="fipA; tsnC"
                     /db_xref="GeneID:2956836"
     CDS             198658..198984
                     /gene="trxA"
                     /locus_tag="YPTB0166"
                     /gene_synonym="fipA; tsnC"
                     /note="similar to Yersinia pestis YPO3868 trxA, tsnC,
                     fipA; thioredoxin 1 (100% evalue=2.E-57); Escherichia coli
                     JW3754 trxA; Thioredoxin (87% evalue=2.E-51)"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="YP_068713.1"
                     /db_xref="GI:51594522"
                     /db_xref="GeneID:2956836"
                     /translation="MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILD
                     EIAEEYEGRLTIAKLNIDDNQGTAPKYGIRGIPTLLLFRDGEVVATKVGALSKGQLKA
                     FLDANL"
     misc_feature    198688..198972
                     /gene="trxA"
                     /locus_tag="YPTB0166"
                     /gene_synonym="fipA; tsnC"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    order(198754..198756,198763..198765)
                     /gene="trxA"
                     /locus_tag="YPTB0166"
                     /gene_synonym="fipA; tsnC"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            199464..200723
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /db_xref="GeneID:2956447"
     CDS             199464..200723
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /note="An RNA-DNA helicase that actively releases nascent
                     mRNAs from paused transcription complexes"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="YP_068714.1"
                     /db_xref="GI:51594523"
                     /db_xref="GeneID:2956447"
                     /translation="MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFSILKQHAK
                     SGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIR
                     PPKEGERYFALLKVNEVNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTAR
                     VLDLASPIGRGQRGLIVAPPKAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTE
                     MQRLVKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNT
                     VVPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEE
                     FKGTGNMELHLSRKIAEKRVFPAIDFNRSGTRKEELLTTTDELQKMWILRRILHPMGE
                     IDAMEFLISKLATAKTNDQFFDNMRRS"
     misc_feature    199464..200717
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /note="transcription termination factor Rho; Provisional;
                     Region: rho; PRK09376"
                     /db_xref="CDD:236490"
     misc_feature    199476..199604
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /note="Rho termination factor, N-terminal domain; Region:
                     Rho_N; smart00959"
                     /db_xref="CDD:198027"
     misc_feature    199614..199817
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /note="Rho_CSD: Rho protein cold-shock domain (CSD). Rho
                     protein is a transcription termination factor in most
                     bacteria. In bacteria, there are two distinct mechanisms
                     for mRNA transcription termination. In intrinsic
                     termination, RNA polymerase and nascent mRNA...; Region:
                     Rho_CSD; cd04459"
                     /db_xref="CDD:239906"
     misc_feature    order(199629..199631,199635..199637,199647..199649,
                     199653..199655,199659..199661,199695..199697,
                     199701..199703,199776..199778,199785..199793)
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239906"
     misc_feature    199929..200675
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /note="Transcription termination factor rho is a bacterial
                     ATP-dependent RNA/DNA helicase. It is a homohexamer. Each
                     monomer consists of an N-terminal domain of the OB fold,
                     which is responsible for binding to cysteine rich
                     nucleotides. This alignment is of the...; Region:
                     rho_factor; cd01128"
                     /db_xref="CDD:238548"
     misc_feature    order(199980..199982,200313..200315,200346..200348,
                     200355..200360,200367..200369,200376..200378,
                     200385..200387,200460..200465,200469..200483,
                     200487..200489,200559..200564,200604..200606,
                     200616..200618)
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238548"
     misc_feature    199995..200018
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238548"
     misc_feature    order(200004..200006,200010..200021,200526..200528)
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238548"
     misc_feature    200244..200258
                     /gene="rho"
                     /locus_tag="YPTB0167"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238548"
     gene            201257..202354
                     /gene="rfe"
                     /locus_tag="YPTB0168"
                     /db_xref="GeneID:2956431"
     CDS             201257..202354
                     /gene="rfe"
                     /locus_tag="YPTB0168"
                     /EC_number="2.4.1.-"
                     /note="similar to Yersinia pestis YPO3866 rfe;
                     undecaprenyl-phosphate
                     alpha-N-acetylglucosaminyltransferase (100% evalue=0);
                     Escherichia coli ECs4717 UDP-GlcNAc:undecaprenylphosphate
                     GlcNAc-1-phosphate transferase (80.9% evalue=1.E-166)"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl-phosphate alpha-GlcNAc transferase"
                     /protein_id="YP_068715.1"
                     /db_xref="GI:51594524"
                     /db_xref="GeneID:2956431"
                     /translation="MNLLTMSTELIYIFLFSMAFLFVARKVAIKIGLVDKPNYRKRHQ
                     GLIPLVGGISVFAGVCFAFLITNQQIPHFRLYLACAGLLVFVGALDDRFDISVKIRAF
                     VQALVGIAMMAVAGLYLRSLGHAFGPWEMVLGPFGYVVTLFAVWAAINAFNMVDGIDG
                     LLGGLSCVSFGAMGILLYQSGQMSLALWCFAMIATIIPYILLNLGLLGRRYKVFMGDA
                     GSTLIGFTAIWILLQATQGNAHPINPVTALWIIAIPLMDMIAIMYRRLRKGMSPFSPD
                     RQHIHHLIMRAGFTSRQAFVLITLAAALLAMIGVIGERLTFIPEWVMLALFLLAFLLY
                     GYCIKRAWRVARFIKRFKRRMRRASKNKHES"
     misc_feature    201275..202309
                     /gene="rfe"
                     /locus_tag="YPTB0168"
                     /note="undecaprenyl-phosphate alpha-N-acetylglucosaminyl
                     1-phosphatetransferase; Region: ECA_wecA; TIGR02380"
                     /db_xref="CDD:131433"
     misc_feature    201374..202123
                     /gene="rfe"
                     /locus_tag="YPTB0168"
                     /note="This subfamily contains Escherichia coli WecA,
                     Bacillus subtilis TagO and related proteins. WecA is an
                     UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate
                     (Und-P) GlcNAc-1-phosphate transferase that catalyzes the
                     formation of a phosphodiester bond...; Region:
                     GT_WecA_like; cd06853"
                     /db_xref="CDD:133463"
     misc_feature    201524..201529
                     /gene="rfe"
                     /locus_tag="YPTB0168"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:133463"
     misc_feature    201896..201907
                     /gene="rfe"
                     /locus_tag="YPTB0168"
                     /note="putative catalytic motif [active]"
                     /db_xref="CDD:133463"
     misc_feature    order(202049..202051,202091..202102)
                     /gene="rfe"
                     /locus_tag="YPTB0168"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133463"
     misc_feature    join(201269..201328,201389..201457,201470..201523,
                     201560..201619,201647..201715,201734..201793,
                     201806..201874,201893..201961,201989..202045,
                     202136..202189,202217..202270)
                     /gene="rfe"
                     /locus_tag="YPTB0168"
                     /note="11 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            202390..203451
                     /gene="wzzE"
                     /locus_tag="YPTB0169"
                     /gene_synonym="wzz"
                     /db_xref="GeneID:2956903"
     CDS             202390..203451
                     /gene="wzzE"
                     /locus_tag="YPTB0169"
                     /gene_synonym="wzz"
                     /note="Enterobacterial Common Antigen (ECA) polysaccharide
                     chain length modulation protein"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein WzzE"
                     /protein_id="YP_068716.1"
                     /db_xref="GI:51594525"
                     /db_xref="GeneID:2956903"
                     /translation="MSTDKTGSTNNEPSVDNELDIRGLCRTLWRGKVWIIGMAIIFAA
                     IALGVSYLVKQQWSATAITDKPTVNNLGGYYSQQQFLRNLDIRLNSGLVSEQPGISDE
                     AYGEFITQLAAYDTRRDFWLQSDYYKQRLEGDAKADAALLDELVNNIVFTARDDKKIP
                     NDSIKLTAETASDANKLLRGYIDFASQRASSHLNDEIQGAWAARTQSMKAQVKRQEAV
                     AQAVFDREVAAVKQALKVAGQQGITRSQTDTPAEQLADSKMFMLGKPMLEARLETLLA
                     TGPSFDIDYDQNRAMLATLNVGPTLDDKFQTYRYLRTPEDPVTRDSPRRVFLLIMWGA
                     IGALVGAGVVLVRRSNKAL"
     misc_feature    202417..203442
                     /gene="wzzE"
                     /locus_tag="YPTB0169"
                     /gene_synonym="wzz"
                     /note="lipopolysaccharide biosynthesis protein WzzE;
                     Provisional; Region: PRK11638"
                     /db_xref="CDD:236943"
     misc_feature    202438..>202677
                     /gene="wzzE"
                     /locus_tag="YPTB0169"
                     /gene_synonym="wzz"
                     /note="Chain length determinant protein; Region: Wzz;
                     pfam02706"
                     /db_xref="CDD:251487"
     misc_feature    join(202480..202548,203368..203427)
                     /gene="wzzE"
                     /locus_tag="YPTB0169"
                     /gene_synonym="wzz"
                     /note="2 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            203800..204930
                     /gene="rffE"
                     /locus_tag="YPTB0170"
                     /gene_synonym="nfrC; wecB"
                     /db_xref="GeneID:2956435"
     CDS             203800..204930
                     /gene="rffE"
                     /locus_tag="YPTB0170"
                     /gene_synonym="nfrC; wecB"
                     /EC_number="5.1.3.14"
                     /note="similar to Yersinia pestis YPO3864 rffE, wecB,
                     nfrC; UDP-N-acetylglucosamine 2-epimerase (99.7%
                     evalue=0); Escherichia coli ECs4719 UDP-N-acetyl
                     glucosamine -2-epimerase (78.6% evalue=1.E-172)"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="YP_068717.1"
                     /db_xref="GI:51594526"
                     /db_xref="GeneID:2956435"
                     /translation="MKVLTVFGTRPEAIKMAPLVHALAQDDAFESRVCVTAQHREMLD
                     QVLRLFEIQPDYDLDIMRPGQGLTEITCRILEGLKPVLEEFKPDVILVHGDTTTTLSA
                     SLAGFYHRIPVGHVEAGLRTGDLYSPWPEEANRQLTGHLAMYHFAPTENSRQNLLREL
                     VPENRIFVTGNTVIDALFWVRDRVMNTPDLRANLAQRYAFLDTNKKMILVTGHRRESF
                     GGGFERICSALAEIARKHPEVQVVYPVHLNPNVSEPVNRILKGIDNIILIDPQDYLPF
                     VYLMNHAYLILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDSGTVLLVGTNINKIVD
                     AVTRLLTDETAYHQMTRAHNPYGDGYACQRILKALKNHQVTL"
     misc_feature    203800..204915
                     /gene="rffE"
                     /locus_tag="YPTB0170"
                     /gene_synonym="nfrC; wecB"
                     /note="UDP-N-acetylglucosamine 2-epimerase [Cell envelope
                     biogenesis, outer membrane]; Region: WecB; COG0381"
                     /db_xref="CDD:223458"
     misc_feature    203803..204909
                     /gene="rffE"
                     /locus_tag="YPTB0170"
                     /gene_synonym="nfrC; wecB"
                     /note="Bacterial members of the UDP-N-Acetylglucosamine
                     (GlcNAc) 2-Epimerase  family are known to catalyze the
                     reversible interconversion of UDP-GlcNAc and
                     UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to
                     produce an activated form of ManNAc residues; Region:
                     GT1_UDP-GlcNAc_2-Epimerase; cd03786"
                     /db_xref="CDD:99962"
     misc_feature    order(203827..203829,204610..204612,204616..204618,
                     204625..204627,204673..204675,204685..204687)
                     /gene="rffE"
                     /locus_tag="YPTB0170"
                     /gene_synonym="nfrC; wecB"
                     /note="active site"
                     /db_xref="CDD:99962"
     misc_feature    order(204004..204006,204010..204015,204034..204036,
                     204118..204123,204127..204129,204133..204135,
                     204184..204186,204196..204198,204271..204273)
                     /gene="rffE"
                     /locus_tag="YPTB0170"
                     /gene_synonym="nfrC; wecB"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99962"
     gene            204927..206189
                     /gene="wecC"
                     /locus_tag="YPTB0171"
                     /db_xref="GeneID:2956434"
     CDS             204927..206189
                     /gene="wecC"
                     /locus_tag="YPTB0171"
                     /note="catalyzes the oxidation of
                     UDP-N-acetyl-D-mannosamine to UDP-N-acetylmannosaminuronic
                     acid"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetyl-D-mannosamine dehydrogenase"
                     /protein_id="YP_068718.1"
                     /db_xref="GI:51594527"
                     /db_xref="GeneID:2956434"
                     /translation="MSFETISVIGLGYIGLPTAAAFASRKKKVIGVDVNAHAVETINR
                     GAIHIVEPDLDKVVKIAVEGGYLQAATKPQAADAFLIAVPTPFKGDHEPDMIFVESAA
                     KSIAPVLKKGDLVILESTSPVGATEQMAQWLAEARPDLSFPQQAGEAADINIAYCPER
                     VLPGQVMVELIQNDRVIGGMTPKCSARASALYKIFLEGECVVTNSRTAEMCKLTENSF
                     RDVNIAFANELSLICDEQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVS
                     QNPQLARLIHTARLVNDGKPLWVVDRVKAAVADCLAASDKRASEVKIACFGLAFKPDI
                     DDLRESPAVGVARLIAEWHVGETLVVEPNVEQLPKSLMGLVTLKDTATALQQADVLVM
                     LVDHKQFKAIKPEDIKQQWIVDTKGVWR"
     misc_feature    204927..206171
                     /gene="wecC"
                     /locus_tag="YPTB0171"
                     /note="UDP-N-acetyl-D-mannosamine dehydrogenase;
                     Provisional; Region: wecC; PRK11064"
                     /db_xref="CDD:182940"
     misc_feature    204939..205490
                     /gene="wecC"
                     /locus_tag="YPTB0171"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family, NAD
                     binding domain; Region: UDPG_MGDP_dh_N; pfam03721"
                     /db_xref="CDD:252123"
     misc_feature    205542..205814
                     /gene="wecC"
                     /locus_tag="YPTB0171"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family,
                     central domain; Region: UDPG_MGDP_dh; pfam00984"
                     /db_xref="CDD:250272"
     misc_feature    205896..206183
                     /gene="wecC"
                     /locus_tag="YPTB0171"
                     /note="UDP binding domain; Region: UDPG_MGDP_dh_C;
                     smart00984"
                     /db_xref="CDD:214954"
     gene            206186..207253
                     /gene="rffG"
                     /locus_tag="YPTB0172"
                     /db_xref="GeneID:2956436"
     CDS             206186..207253
                     /gene="rffG"
                     /locus_tag="YPTB0172"
                     /note="similar to Yersinia pestis YPO3862 rffG;
                     dTDP-D-glucose-4,6-dehydratase (99.4% evalue=0);
                     Salmonella typhimurium STM3922 rffG; dTDP-glucose
                     4,6-dehydratase (83% evalue=1.E-175)"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-D-glucose-4,6-dehydratase"
                     /protein_id="YP_068719.1"
                     /db_xref="GI:51594528"
                     /db_xref="GeneID:2956436"
                     /translation="MRRILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLESL
                     SVVAGSERYAFEQVDICDRSELDRVFAQYQPNVVMHLAAESHVDRSIDGPAAFIETNV
                     VGTYTLLEAARHYWQQLSVEAKQAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPY
                     SASKASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYG
                     NGAQVRDWLYVEDHARALYQVVTEGVVGETYNIGGHNERKNIEVVETICALLDELVPA
                     KPAGIAHYRDLITYVKDRPGHDMRYAIDAGKIERELGWRPQETFESGIRKTVLWYLNN
                     ESWWRRVQDGSYAGERLGLSD"
     misc_feature    206186..207244
                     /gene="rffG"
                     /locus_tag="YPTB0172"
                     /note="dTDP-glucose 4,6-dehydratase; Provisional; Region:
                     PRK10217"
                     /db_xref="CDD:182313"
     misc_feature    206189..207193
                     /gene="rffG"
                     /locus_tag="YPTB0172"
                     /note="dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs;
                     Region: dTDP_GD_SDR_e; cd05246"
                     /db_xref="CDD:187557"
     misc_feature    order(206207..206209,206213..206224,206282..206293,
                     206297..206302,206357..206365,206426..206434,
                     206438..206440,206483..206485,206579..206587,
                     206663..206665,206675..206677,206744..206755)
                     /gene="rffG"
                     /locus_tag="YPTB0172"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187557"
     misc_feature    order(206438..206446,206585..206593,206663..206665,
                     206744..206752,206777..206785,206792..206797,
                     206828..206836,206849..206851,206855..206857,
                     206960..206962,207065..207067,207074..207076,
                     207086..207088)
                     /gene="rffG"
                     /locus_tag="YPTB0172"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187557"
     misc_feature    order(206450..206452,206456..206458,206465..206470,
                     206477..206479,206489..206494,206501..206503,
                     206513..206515,206522..206524,206603..206605,
                     206636..206638,206642..206647,206651..206662,
                     206669..206671,206678..206683,206690..206695,
                     206702..206707,206711..206719,207077..207079)
                     /gene="rffG"
                     /locus_tag="YPTB0172"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187557"
     misc_feature    order(206486..206488,206585..206587,206663..206665,
                     206675..206677)
                     /gene="rffG"
                     /locus_tag="YPTB0172"
                     /note="active site"
                     /db_xref="CDD:187557"
     gene            207548..208429
                     /gene="rffH"
                     /locus_tag="YPTB0173"
                     /db_xref="GeneID:2956437"
     CDS             207548..208429
                     /gene="rffH"
                     /locus_tag="YPTB0173"
                     /EC_number="2.7.7.24"
                     /note="similar to Yersinia pestis YPO3861 rffH;
                     glucose-1-phosphate thymidylyltransferase (100%
                     evalue=1.E-169); Escherichia coli b3789 rffH;
                     glucose-1-phosphate thymidylyltransferase (dtdp-glucose
                     synthase) (dtdp-glucose pyrophosphorylase) (86.6%
                     evalue=1.E-148)"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="YP_068720.1"
                     /db_xref="GI:51594529"
                     /db_xref="GeneID:2956437"
                     /translation="MKGIILAGGSGSRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLA
                     GIRDVLIISTPEDLPSFQRLLGNGDEFGINLSYAAQPSPDGLAQAFIIGEAFIDNEPC
                     CLVLGDNIYFGQGFSPKLKAVAARQQGATVFGYQVMDPERFGVVEFDDNFRALSIEEK
                     PSQPKSNWAVTGLYFYDNQVVDFAKQVKPSARGELEITSINQMYLDRGELTVELLGRG
                     FAWLDTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLDDDGVKRAATALAKT
                     GYGKYLLDLLHARPRQY"
     misc_feature    207548..208267
                     /gene="rffH"
                     /locus_tag="YPTB0173"
                     /note="G1P_TT_short is the short form of
                     glucose-1-phosphate thymidylyltransferase; Region:
                     G1P_TT_short; cd02538"
                     /db_xref="CDD:133019"
     misc_feature    207551..208405
                     /gene="rffH"
                     /locus_tag="YPTB0173"
                     /note="glucose-1-phosphate thymidylyltransferase, short
                     form; Region: rmlA; TIGR01207"
                     /db_xref="CDD:130274"
     misc_feature    order(207563..207565,207569..207574,207785..207787,
                     207794..207805,207869..207871,207977..207979,
                     208022..208027,208055..208057,208139..208141)
                     /gene="rffH"
                     /locus_tag="YPTB0173"
                     /note="substrate binding site; other site"
                     /db_xref="CDD:133019"
     misc_feature    order(207581..207583,207590..207598,207605..207610,
                     207620..207628,207632..207643,207650..207652,
                     207725..207727,207881..207886,207950..207961,
                     207971..207976,208208..208216,208226..208231,
                     208238..208240,208247..208255,208262..208267)
                     /gene="rffH"
                     /locus_tag="YPTB0173"
                     /note="tetramer interface; other site"
                     /db_xref="CDD:133019"
     gene            208476..209144
                     /gene="rffC"
                     /locus_tag="YPTB0174"
                     /gene_synonym="wecD"
                     /db_xref="GeneID:2956433"
     CDS             208476..209144
                     /gene="rffC"
                     /locus_tag="YPTB0174"
                     /gene_synonym="wecD"
                     /note="similar to Yersinia pestis YPO3860 rffC, wecD;
                     lipopolysaccharide biosynthesis protein (97.2%
                     evalue=1.E-120); Escherichia coli JW3764 yifH;
                     Hypothetical protein (49.2% evalue=6.E-44)"
                     /codon_start=1
                     /transl_table=11
                     /product="TDP-fucosamine acetyltransferase"
                     /protein_id="YP_068721.1"
                     /db_xref="GI:51594530"
                     /db_xref="GeneID:2956433"
                     /translation="MIFSDSAPPLNPAELAAFTLVQAKVPTHRLDLIDALSQLDFHLV
                     EGEIDLSLAVGEKEGIGTENATSEPNMGPYSQRVATEADIPQLRRVAASTFALSRFRA
                     PWYDAQDSGRFYALWVEKAVLGTFDHQCLLVLDSTDQPVGFVTLRDLQDGSARIGLLA
                     VFPGAQSKGIGLRLMSAAKQWCQHHGLHRLRVATQMSNIAALRLYIRSGASIESTAYW
                     LCRG"
     misc_feature    208704..209105
                     /gene="rffC"
                     /locus_tag="YPTB0174"
                     /gene_synonym="wecD"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    208866..209051
                     /gene="rffC"
                     /locus_tag="YPTB0174"
                     /gene_synonym="wecD"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(208950..208958,208986..208991)
                     /gene="rffC"
                     /locus_tag="YPTB0174"
                     /gene_synonym="wecD"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            209146..210276
                     /gene="rffA"
                     /locus_tag="YPTB0175"
                     /gene_synonym="wecE"
                     /db_xref="GeneID:2956432"
     CDS             209146..210276
                     /gene="rffA"
                     /locus_tag="YPTB0175"
                     /gene_synonym="wecE"
                     /note="catalyzes the formation of dTDP-D-fucosamine from
                     dTDP-4-oxo-6-deoxy-D-glucose in enterobacterial common
                     antigen biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="TDP-4-oxo-6-deoxy-D-glucose transaminase"
                     /protein_id="YP_068722.1"
                     /db_xref="GI:51594531"
                     /db_xref="GeneID:2956432"
                     /translation="MIPFNTPPIVGTELGYMQAAMSSGKLCGDGGFTRRCQQWMEKRF
                     NCPKVLLTPSCTASLEMAALLLDIKPGDEVIMPSFTFVSTANAFVLRGAKMVFVDIRP
                     DTMNIDETKIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMST
                     YKGKALGTIGHIGCFSFHETKNYTAGGEGGATLINDPSLIDRAEIIREKGTNRSQFFR
                     GQVDKYTWRDIGSSYLMSDLQAAYLWGQLEAAEQINERRLALWHGYYNAFKPLADAGR
                     IDLPVIPGNVVQNAHMFYIKLRDIEERSAFISYLKEADIMAVFHYIPLHACPAGEAFG
                     RMAGEDRFTSKESERLVRLPIFYNLTDVNQSTVINTVLSFFV"
     misc_feature    209182..210258
                     /gene="rffA"
                     /locus_tag="YPTB0175"
                     /gene_synonym="wecE"
                     /note="3-amino-5-hydroxybenzoic acid synthase family
                     (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate
                     (PLP)-dependent aspartate aminotransferase superfamily
                     (fold I). The members of this CD are involved in various
                     biosynthetic pathways for secondary...; Region: AHBA_syn;
                     cd00616"
                     /db_xref="CDD:99740"
     misc_feature    order(209308..209313,209599..209601,209608..209610,
                     209671..209673,209683..209688,210103..210105)
                     /gene="rffA"
                     /locus_tag="YPTB0175"
                     /gene_synonym="wecE"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99740"
     misc_feature    order(209308..209313,209383..209385,209599..209601,
                     209608..209610,209671..209673,209686..209688)
                     /gene="rffA"
                     /locus_tag="YPTB0175"
                     /gene_synonym="wecE"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99740"
     misc_feature    209686..209688
                     /gene="rffA"
                     /locus_tag="YPTB0175"
                     /gene_synonym="wecE"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99740"
     gene            210278..211534
                     /gene="wzxE"
                     /locus_tag="YPTB0176"
                     /gene_synonym="wzx"
                     /db_xref="GeneID:2956901"
     CDS             210278..211534
                     /gene="wzxE"
                     /locus_tag="YPTB0176"
                     /gene_synonym="wzx"
                     /note="similar to Yersinia pestis YPO3858 wzxE, wzx;
                     lipopolysaccharide biosynthesis protein (99.7% evalue=0);
                     Salmonella typhi STY3629  lipopolysaccharide biosynthesis
                     protein (75% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="PST family o-antigen export protein"
                     /protein_id="YP_068723.1"
                     /db_xref="GI:51594532"
                     /db_xref="GeneID:2956901"
                     /translation="MSLAKASIWTACSTLIKIGVGLLVVKLLAVTFGPSGVGQAGNFR
                     QLIIVLGVLSGAGIFNGITKYVAEYHQQPERLRAMLGTSSTIVLGFSTLLALVFLLAA
                     KPVSIALFGHADYQNVVRAIAFIQMGIAYGNLFLAILKGYRDAMGNALAIIGGSLIGV
                     VAYYICFQIGGYSGALVGLGLVPALVVLPAAAMLYRRRTIPLRYLKPHWDKALASHLG
                     KFTLMALITSVTLPVAYVMMRHLLANNYGWDAVGIWQGVSSISDAYLQFITASFTVYL
                     LPTLSRLKDKGAISREILRSLKFVLPAVAAASLTVWLLRDFAIWLLFSHQFTAMRDLF
                     AWQLVGDVLKVGSYVFGYLVIAKASLRFYILAEVSQFLLLTGFAYWLIPMNGSLGAAQ
                     AYMATYIVYFALCSCAFLVYRRHSAP"
     misc_feature    210278..211528
                     /gene="wzxE"
                     /locus_tag="YPTB0176"
                     /gene_synonym="wzx"
                     /note="Membrane protein involved in the export of
                     O-antigen and teichoic acid [General function prediction
                     only]; Region: RfbX; COG2244"
                     /db_xref="CDD:225153"
     misc_feature    210290..211519
                     /gene="wzxE"
                     /locus_tag="YPTB0176"
                     /gene_synonym="wzx"
                     /note="Uncharacterized subfamily of the multidrug and
                     toxic compound extrusion (MATE) proteins; Region:
                     MATE_like_10; cd13125"
                     /db_xref="CDD:240530"
     misc_feature    join(210314..210382,210410..210478,210515..210583,
                     210626..210694,210713..210781,210794..210862,
                     210923..210991,211034..211102,211163..211231,
                     211274..211342,211361..211429,211445..211513)
                     /gene="wzxE"
                     /locus_tag="YPTB0176"
                     /gene_synonym="wzx"
                     /note="12 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            211557..212642
                     /locus_tag="YPTB0177"
                     /db_xref="GeneID:2953112"
     CDS             211557..212642
                     /locus_tag="YPTB0177"
                     /note="catalyzes the synthesis of a lipid-linked
                     intermediate involved in ECA synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-L-fucosyltransferase"
                     /protein_id="YP_068724.1"
                     /db_xref="GI:51594533"
                     /db_xref="GeneID:2953112"
                     /translation="MITLTHVLGSDIPHHNLTVLRFFNDVLAKCLPVEQVRHFMVAAK
                     ETAPFSSFPQLDINTYSDKKALAEAVIARAQADRSARFFWHGQFNATLWLALLSGKIK
                     PGQVYWHVWGADLYEDAKSLKFRLFYLLRRIAQGRVGHVFATRGDLIHYQQRHPRVPA
                     SLLYFPTRMDPALTAINIDKPLAGPMTILVGNSGDTTNRHIEALKAIHQQFGPDVRVI
                     IPMGYPANNEAYIEQVRQAGLALFSQDNLRILTEQIPFDDYLNILRECDLGYFIFNRQ
                     QGIGTLCLLTQFGVPFVLSRKNPFWQDLAEQHIPVFFYGDTLDEPLIREAQRQLAGLD
                     KQAIAFFNPNYIEGWKQALALAAGEHP"
     misc_feature    211557..212639
                     /locus_tag="YPTB0177"
                     /note="4-alpha-L-fucosyltransferase glycosyl transferase
                     group 56; Region: Glyco_transf_56; pfam07429"
                     /db_xref="CDD:116050"
     gene            212639..214003
                     /gene="wecF"
                     /locus_tag="YPTB0178"
                     /gene_synonym="rffT"
                     /db_xref="GeneID:2956897"
     CDS             212639..214003
                     /gene="wecF"
                     /locus_tag="YPTB0178"
                     /gene_synonym="rffT"
                     /note="enterobacterial common antigen polymerase"
                     /codon_start=1
                     /transl_table=11
                     /product="common antigen polymerase"
                     /protein_id="YP_068725.1"
                     /db_xref="GI:51594534"
                     /db_xref="GeneID:2956897"
                     /translation="MTLGQFGGLFCIYLIAVIFILTLTYQEFRRVKFNFNVLFSMLYL
                     LTFYFGFPLTCMLVFQFGVAVVPVEYLLYAMLSATAFYGIYYVTYKTRLRQPRSQPRT
                     PIFTMNRVETNLTWVLLALVAVGTVGIFFMQNGFLLFKLDSYSKIFSSDVSGVALKRF
                     FYFFIPAMLVVYFLKQDRRAWFFFLASTVAFGILTYVIVGGTRANIIIAFSLFLFIGI
                     VRGWITLWMLAAAGVFGIVGMFWLALKRYGLDVNGAEAFYTFLYLTRDTFSPWENLGL
                     LLQNYDKIDFQGLAPIVRDFYVFIPSALWPERPDLVLNTANYFTWDVLDNHSGLAISP
                     TLIGSLVVMGGVLFIPLGAIVVGLIIKWFDWLYEQGKAESNRYKAAILQSFCFGAVFN
                     IIVLAREGLDSFVSRVVFFCVIFGACLVLAKLLYWLFDTAGLIKRQGIKSNRLSTPNA
                     GNQL"
     misc_feature    212639..213976
                     /gene="wecF"
                     /locus_tag="YPTB0178"
                     /gene_synonym="rffT"
                     /note="putative common antigen polymerase; Provisional;
                     Region: PRK02975"
                     /db_xref="CDD:179518"
     misc_feature    join(212654..212713,212750..212818,212846..212905,
                     212966..213034,213092..213160,213179..213238,
                     213248..213307,213311..213370,213647..213715,
                     213776..213829,213857..213925)
                     /gene="wecF"
                     /locus_tag="YPTB0178"
                     /gene_synonym="rffT"
                     /note="11 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            214012..214752
                     /gene="wecG"
                     /locus_tag="YPTB0179"
                     /gene_synonym="rffM"
                     /db_xref="GeneID:2956898"
     CDS             214012..214752
                     /gene="wecG"
                     /locus_tag="YPTB0179"
                     /gene_synonym="rffM"
                     /note="similar to Yersinia pestis YPO3855 wecG, rffM;
                     probable UDP-N-acetyl-D-mannosaminuronic acid transferase
                     (99.5% evalue=1.E-140); Escherichia coli b3794 wecg, rffM;
                     (UDP-mannaca transferase) (71.1% evalue=1.E-101)"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetyl-D-mannosaminuronic acid
                     transferase"
                     /protein_id="YP_068726.1"
                     /db_xref="GI:51594535"
                     /db_xref="GeneID:2956898"
                     /translation="MEPNTVIPKYNVRGFEIWGFRDMAQVLDHLLGSGPVKTGTLVAM
                     NAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQAELSRVAGADLWEALMQ
                     RAGQQGTPVFLVGGKPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFARIAASG
                     AAIVTVAMGSPKQEIFMRDCRKFYPDALYMGVGGTYDVFTGHVKRAPKIWQNMGLEWL
                     YRLLAQPSRIRRQLKLLKFVGYYYSGRL"
     misc_feature    214195..214704
                     /gene="wecG"
                     /locus_tag="YPTB0179"
                     /gene_synonym="rffM"
                     /note="The glycosyltransferase WecG/TagA superfamily
                     contains Escherichia coli WecG, Bacillus subtilis TagA and
                     related proteins. E. coli WecG is believed to be a
                     UDP-N-acetyl-D-mannosaminuronic acid transferase, and is
                     involved in enterobacterial common...; Region:
                     Glyco_transf_WecG_TagA; cd06533"
                     /db_xref="CDD:119439"
     gene            215316..216707
                     /locus_tag="YPTB0180"
                     /db_xref="GeneID:2953113"
     CDS             215316..216707
                     /locus_tag="YPTB0180"
                     /note="uncharacterized member of the amino
                     acid-polyamine-organocation (APC) superfamily of amino
                     acid transporters; unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_068727.1"
                     /db_xref="GI:51594536"
                     /db_xref="GeneID:2953113"
                     /translation="MADNAEKKGLHRGLEARHIELIALGGTIGVGLFMGSASTLKWAG
                     PSVLLAYIIAGLFVFFIMRAMGEMLYLEPVAGSFAVYAHKYLSPYFGYLTAWGYWFMW
                     IAVGISEITAIGVYVQFWFPEIPQWLPAIAGVAIVALANLAAVKLYGELEFWFAMIKV
                     TTIIVMILVGLGVIFFGFGNHGQPIGFDNLTAHGGFFAGGWKGFLFALCIVVASYQGV
                     ELVGITAGEARNPQVTLRRAINNILWRILIFYVGAIFVIVTIFPWNGIGTEGSPFVLT
                     FAKIGIVAAAGIINFVILTAALSGCNSGMYSGGRMLYALAKNRQLPAGLTKLSASGVP
                     VYCIAITILCLLVGSSLNYIIPNPQQVFVYVYSASVLPGMVPWFVVLVCQLRFRQVHK
                     AALQQHPFKSILFPYVNYLTIAFLICVLVGMGINPDTRLSLLVGAIFLALVTGCYFVL
                     GMHKPKAMEAERL"
     misc_feature    215316..216701
                     /locus_tag="YPTB0180"
                     /note="putative transport protein YifK; Provisional;
                     Region: PRK10746"
                     /db_xref="CDD:182694"
     misc_feature    join(215376..215429,215439..215498,215598..215666,
                     215694..215762,215781..215849,215892..215960,
                     216042..216110,216153..216221,216312..216380,
                     216393..216461,216522..216590,216600..216668)
                     /locus_tag="YPTB0180"
                     /note="12 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            216856..216932
                     /gene="tRNA-Arg1"
                     /locus_tag="YPTB_RNA_5"
                     /db_xref="GeneID:2956744"
     tRNA            216856..216932
                     /gene="tRNA-Arg1"
                     /locus_tag="YPTB_RNA_5"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2956744"
     gene            217016..217091
                     /gene="tRNA-His1"
                     /locus_tag="YPTB_RNA_6"
                     /db_xref="GeneID:2956770"
     tRNA            217016..217091
                     /gene="tRNA-His1"
                     /locus_tag="YPTB_RNA_6"
                     /product="tRNA-His"
                     /db_xref="GeneID:2956770"
     gene            217108..217194
                     /gene="tRNA-Leu1"
                     /locus_tag="YPTB_RNA_7"
                     /db_xref="GeneID:2956774"
     tRNA            217108..217194
                     /gene="tRNA-Leu1"
                     /locus_tag="YPTB_RNA_7"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2956774"
     gene            217270..217346
                     /gene="tRNA-Pro1"
                     /locus_tag="YPTB_RNA_8"
                     /db_xref="GeneID:2956799"
     tRNA            217270..217346
                     /gene="tRNA-Pro1"
                     /locus_tag="YPTB_RNA_8"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2956799"
     gene            complement(218227..219447)
                     /gene="hemY"
                     /locus_tag="YPTB0181"
                     /db_xref="GeneID:2955784"
     CDS             complement(218227..219447)
                     /gene="hemY"
                     /locus_tag="YPTB0181"
                     /EC_number="1.3.3.4"
                     /note="similar to Yersinia pestis YPO3852 hemY; protoheme
                     IX biogenesis protein (99.7% evalue=0); Escherichia coli
                     Z5316 hemY; a late step of protoheme IX synthesis (70.6%
                     evalue=1.E-163)"
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX biogenesis protein"
                     /protein_id="YP_068728.1"
                     /db_xref="GI:51594537"
                     /db_xref="GeneID:2955784"
                     /translation="MLRVLLLFLVLTVGIVLGPMLAGHQGYVLIQTDNYNVTTSVTGL
                     AIMLVLLLVAFFIVEWVLRRIFRTGARTRGWFLGRKRTRARNQMKAALIKLAEGDFLQ
                     VEKLLTRNADHAEQPMVNYLLAAEAAQQRGDEFRTNQYLERAAEVADGDQLPVNITRV
                     RIQLAQGHIHAARHGVDRLLDQAPRHPEVLRLAEQAYLRSGAYRSLLDILPAMSKTQI
                     HTPEEVAALEQQAYIGIMNQCMADEGSEGLKRWWKDQSRKVRNEIPLQVALAEHLIEC
                     DDHDVAQKIILDSLKHQYDERLVLLIPRLKAGNPEPLEKSLRQQIKQHGATPLLNSTL
                     GQLMLKHGEWEKASEAFKAALAQRPDGYDYAWLADALDKLHRPEDAAQARREGLLLTL
                     RQNGESSALTKLIH"
     misc_feature    complement(218254..219408)
                     /gene="hemY"
                     /locus_tag="YPTB0181"
                     /note="putative protoheme IX biogenesis protein;
                     Provisional; Region: PRK10747"
                     /db_xref="CDD:182695"
     misc_feature    complement(219049..219372)
                     /gene="hemY"
                     /locus_tag="YPTB0181"
                     /note="HemY protein N-terminus; Region: HemY_N; pfam07219"
                     /db_xref="CDD:191703"
     misc_feature    complement(join(219262..219327,219367..219432))
                     /gene="hemY"
                     /locus_tag="YPTB0181"
                     /note="2 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(219450..220574)
                     /gene="hemX"
                     /locus_tag="YPTB0182"
                     /db_xref="GeneID:2955783"
     CDS             complement(219450..220574)
                     /gene="hemX"
                     /locus_tag="YPTB0182"
                     /note="similar to Yersinia pestis YPO3851 hemX;
                     uroporphyrin-III C-methyltransferase (99.7% evalue=0);
                     Escherichia coli JW3775 hemX; uroporphyrin-III
                     C-methyltransferase (68.1% evalue=1.E-135)"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen III C-methyltransferase"
                     /protein_id="YP_068729.1"
                     /db_xref="GI:51594538"
                     /db_xref="GeneID:2955783"
                     /translation="MTEQNTPSAPVEEPTTAVERPQQPEPKGHREKRTGPILGVIAIA
                     LVIALGAGLYYHGQQQAQLQSAENIALQEQLVALKQTLLQEKQQLESLLQQQGKALES
                     AENQQASLTRQLNELQEKVATISGSDAKTWLLAQADFLVKMAGRKLWSDQDVTTAVTL
                     LKSADASLADMNDPSLIDVRRAITEDISALSAVSQVDFDGIILKLNQLSNQVDNLRLA
                     DNNIDDSPMDANSDELSSSLSEWRQNLSKSWRSFMSDFISIRRRDSSAEPLLAPNQDV
                     YLRENIRSRLLVAAQAVPRHQDEVYKQSLETISTWVRAYFDVNDPSTKAFLDELENLS
                     QQPISMDVPDQLKSQPILEKLMQTRVRNLLAQTPVDAQGE"
     misc_feature    complement(219453..220574)
                     /gene="hemX"
                     /locus_tag="YPTB0182"
                     /note="putative uroporphyrinogen III C-methyltransferase;
                     Provisional; Region: PRK10920"
                     /db_xref="CDD:236795"
     misc_feature    complement(220407..220463)
                     /gene="hemX"
                     /locus_tag="YPTB0182"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(220605..221354)
                     /gene="hemD"
                     /locus_tag="YPTB0183"
                     /db_xref="GeneID:2955776"
     CDS             complement(220605..221354)
                     /gene="hemD"
                     /locus_tag="YPTB0183"
                     /EC_number="4.2.1.75"
                     /note="catalyzes the formation of uroporphyrinogen-III
                     from hydroxymethylbilane; functions in tetrapyrrole and
                     heme biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="YP_068730.1"
                     /db_xref="GI:51594539"
                     /db_xref="GeneID:2955776"
                     /translation="MTILVTRPSPAGEQLVTRLRALGRVAYHAPLIDFSPGRDLPKLP
                     ELLQDMRAGDLVFALSQNAVRYANPLLKRNKLSWPVQLSYYAIGRTTALALHTASRLH
                     VTFPPMGETSEMLLSLPLLQNLAGKKALLLRGNGGRELLGASLAERGAAVTFCECYQR
                     SPIYYDGSEQSAHWQRAGVDILVVTSGEMLQQIYTLVPDYYRSSWLLRCRLIVVSDRL
                     AALATQMGWTEVRVAENADNDALIRALQDLQ"
     misc_feature    complement(220620..221348)
                     /gene="hemD"
                     /locus_tag="YPTB0183"
                     /note="Uroporphyrinogen-III synthase (HemD) catalyzes the
                     asymmetrical cyclization of tetrapyrrole (linear) to
                     uroporphyrinogen-III, the fourth step in the biosynthesis
                     of heme. This ubiquitous enzyme is present in eukaryotes,
                     bacteria and archaea. Mutations in...; Region: HemD;
                     cd06578"
                     /db_xref="CDD:119440"
     misc_feature    complement(order(220788..220802,220875..220877,
                     220881..220883,220953..220955,221085..221087,
                     221169..221177,221334..221336))
                     /gene="hemD"
                     /locus_tag="YPTB0183"
                     /note="active site"
                     /db_xref="CDD:119440"
     gene            complement(221351..222292)
                     /gene="hemC"
                     /locus_tag="YPTB0184"
                     /gene_synonym="popE"
                     /db_xref="GeneID:2955775"
     CDS             complement(221351..222292)
                     /gene="hemC"
                     /locus_tag="YPTB0184"
                     /gene_synonym="popE"
                     /EC_number="2.5.1.61"
                     /note="transformation of porphobilinogen to
                     hydroxymethylbilane in porphyrin biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase"
                     /protein_id="YP_068731.1"
                     /db_xref="GI:51594540"
                     /db_xref="GeneID:2955775"
                     /translation="MLDKIIRIATRQSPLALWQAHYVQHLLQANHPGLQIELVPMVTR
                     GDIILDTPLAKVGGKGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVAICERE
                     DPRDAFVSSHYAHLDDLPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLD
                     NGDYQAIILAVAGLKRLGLETRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAP
                     LNHRHTELRVCAERAMNIRLEGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGER
                     RGPAAEAEQMGIELADELLSRGAREILAAVYLDNPAR"
     misc_feature    complement(221405..222283)
                     /gene="hemC"
                     /locus_tag="YPTB0184"
                     /gene_synonym="popE"
                     /note="porphobilinogen deaminase; Reviewed; Region: hemC;
                     PRK00072"
                     /db_xref="CDD:234612"
     misc_feature    complement(221405..222277)
                     /gene="hemC"
                     /locus_tag="YPTB0184"
                     /gene_synonym="popE"
                     /note="Hydroxymethylbilane synthase (HMBS), also known as
                     porphobilinogen deaminase (PBGD), is an intermediate
                     enzyme in the biosynthetic pathway of tetrapyrrolic ring
                     systems, such as heme, chlorophylls, and vitamin B12.
                     HMBS catalyzes the conversion of...; Region: HMBS;
                     cd00494"
                     /db_xref="CDD:238276"
     misc_feature    complement(order(221474..221476,221480..221482,
                     221489..221491,221498..221500,221513..221515,
                     221549..221551,221555..221557,221567..221569,
                     221588..221590,221597..221602,221612..221614,
                     221621..221623,221642..221644,221696..221719,
                     221765..221770,221777..221779,221840..221842,
                     221879..221881,221891..221896,221900..221902,
                     221975..221992,221996..222001,222026..222028,
                     222032..222049,222239..222241,222254..222256))
                     /gene="hemC"
                     /locus_tag="YPTB0184"
                     /gene_synonym="popE"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238276"
     misc_feature    complement(order(221567..221569,221696..221701,
                     221708..221710,221765..221767,221774..221776,
                     221783..221791,221828..221830,221849..221851,
                     221897..221902,221906..221914,222041..222046,
                     222050..222052,222236..222238,222248..222250))
                     /gene="hemC"
                     /locus_tag="YPTB0184"
                     /gene_synonym="popE"
                     /note="active site"
                     /db_xref="CDD:238276"
     gene            222786..225338
                     /gene="cyaA"
                     /locus_tag="YPTB0185"
                     /gene_synonym="cyA"
                     /db_xref="GeneID:2955383"
     CDS             222786..225338
                     /gene="cyaA"
                     /locus_tag="YPTB0185"
                     /gene_synonym="cyA"
                     /EC_number="4.6.1.1"
                     /note="catalyzes transfer of adenylyl group of ATP from
                     pyrophosphate to the 3'-hydroxyl group to form cyclic AMP"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate cyclase"
                     /protein_id="YP_068732.1"
                     /db_xref="GI:51594541"
                     /db_xref="GeneID:2955383"
                     /translation="MYLYIETLKQRLDAINQLRVDRALAAMGPAFQKVYSLLPILLHC
                     HHPQMPGYLDGNVPHGVCLFTPNEIQQDYLADVEARWGEPLAPSAGGELPITGVYSMG
                     STSSIGQCHTSDLDIWVCHQAWLDTEERNQLQQKCSLLEKWAASMGVEVSFFLVDENR
                     FRHNASGSLGGEDCGSTQHILLLDEFYRSAVRLAGKRILWNMVPVKEEEHYDDYVLSL
                     YAQGVLTPNEWLDLGGLSTLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYP
                     NSQLLAMEIKQHLHAGEIVSFGLDAYCMMLDRVTRYLIQINDTTRLNLVRRCFYLKVC
                     EKLSRTPASTGWRREVLSQLVSEWGWSNEKLAVLDNRANWKIERVREAHNELLDAMMQ
                     SYRNLIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEEHLT
                     FIHVPAGRANRPGWYLYNQAPSMDAIVSHQPLEYNRYLNKLVSWAYFNGLLTSKTHLH
                     IKSANLCDTVKLQELVTDISHHFPLRLAAPTPKALYSPCEIRHLAIIVNLEHDPTTTF
                     RNQVVHFDFRKLDVFSFGEQQQCLVGSIDLLYRNSWNEVRTLHFSGEQAVLEALKTIL
                     GKMHQDAAPPESVDVFCYSQHLRGLIRTRIQQLVSECIDLRLSSTRQEPGRFKAVRVS
                     GQTWGLFFERLSVSVQKLENAVEFYGAISNNKLHGLSVQVATNQIHLPPVVDGFASEG
                     IIQFFFEGTADEKGFNIYILDEANRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGS
                     SFINFNLPQFYQIVQLDGRTQVIPFRSNTLSQLCANIAEKEASLPTKQCQLH"
     misc_feature    222786..225335
                     /gene="cyaA"
                     /locus_tag="YPTB0185"
                     /gene_synonym="cyA"
                     /note="Adenylate cyclase [Nucleotide transport and
                     metabolism]; Region: CyaA; COG3072"
                     /db_xref="CDD:225614"
     misc_feature    222786..223385
                     /gene="cyaA"
                     /locus_tag="YPTB0185"
                     /gene_synonym="cyA"
                     /note="Adenylate cyclase NT domain; Region: Adenyl_cycl_N;
                     pfam12633"
                     /db_xref="CDD:257178"
     misc_feature    223467..225275
                     /gene="cyaA"
                     /locus_tag="YPTB0185"
                     /gene_synonym="cyA"
                     /note="Adenylate cyclase, class-I; Region: Adenylate_cycl;
                     pfam01295"
                     /db_xref="CDD:250514"
     gene            complement(225858..227066)
                     /locus_tag="YPTB0186"
                     /db_xref="GeneID:2953114"
     CDS             complement(225858..227066)
                     /locus_tag="YPTB0186"
                     /note="similar to Yersinia pestis YPO1583 transposase for
                     the IS285 insertion element (100% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase for IS285 insertion element"
                     /protein_id="YP_068733.1"
                     /db_xref="GI:51594542"
                     /db_xref="GeneID:2953114"
                     /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELT
                     EHLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQ
                     MDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY
                     PIVYMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTEL
                     KNRGLQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSG
                     LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYT
                     TNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFII
                     EFGDRLSDHL"
     misc_feature    complement(225939..227066)
                     /locus_tag="YPTB0186"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     misc_feature    complement(225870..227039)
                     /locus_tag="YPTB0186"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            complement(227114..228151)
                     /locus_tag="YPTB0187"
                     /pseudo
                     /db_xref="GeneID:2953115"
     misc_feature    complement(227114..228151)
                     /locus_tag="YPTB0187"
                     /note="possible Pentapeptide repeats (8 copies)"
                     /pseudo
                     /db_xref="PSEUDO:CAH19427.1"
     gene            complement(228439..228762)
                     /gene="cyaY"
                     /locus_tag="YPTB0188"
                     /db_xref="GeneID:2955385"
     CDS             complement(228439..228762)
                     /gene="cyaY"
                     /locus_tag="YPTB0188"
                     /note="defects in the mitochondrial frataxin protein cause
                     Friedreich ataxis which is an autosomal recessive
                     neurodegenerative disease; based on phylogenomic
                     distribution this protein may have a role in iron-sulfur
                     cluster protein assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="frataxin-like protein"
                     /protein_id="YP_068734.1"
                     /db_xref="GI:51594543"
                     /db_xref="GeneID:2955385"
                     /translation="MNDSEFHQLADQLMLYIEETLDGFTGDSDIDYETNGGVMTLTFE
                     NGSKIVINRQEPLHQVWLATKAGGYHFNYRDGHWYCSRSGEEFFAKLSEAATTQAGEE
                     VSFSE"
     misc_feature    complement(228448..228762)
                     /gene="cyaY"
                     /locus_tag="YPTB0188"
                     /note="Frataxin is a nuclear-encoded mitochondrial protein
                     implicated in Friedreich's ataxia (FRDA), an human
                     autosomal recessive neurodegenerative disease; Frataxin is
                     found in eukaryotes and in purple bacteria; lack of
                     frataxin causes iron to accumulate...; Region: Frataxin;
                     cd00503"
                     /db_xref="CDD:238280"
     misc_feature    complement(order(228670..228672,228676..228678,
                     228694..228699,228706..228708,228718..228720,
                     228727..228732,228754..228756))
                     /gene="cyaY"
                     /locus_tag="YPTB0188"
                     /note="putative iron binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238280"
     gene            228914..229114
                     /locus_tag="YPTB0189"
                     /db_xref="GeneID:2953116"
     CDS             228914..229114
                     /locus_tag="YPTB0189"
                     /note="similar to Yersinia pestis YPO3846  lipoprotein.
                     90% identical"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068735.1"
                     /db_xref="GI:51594544"
                     /db_xref="GeneID:2953116"
                     /translation="MKKELRWPMAAMMVLALAGCGLKGPLYFPPADKPPVDAAPPESG
                     QVEKTQQDLSATPQTPSTAESQ"
     misc_feature    228914..229096
                     /locus_tag="YPTB0189"
                     /note="Predicted small periplasmic lipoprotein [Cell
                     motility and secretion]; Region: COG5567"
                     /db_xref="CDD:227854"
     misc_feature    228932..229000
                     /locus_tag="YPTB0189"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            229282..230106
                     /gene="dapF"
                     /locus_tag="YPTB0190"
                     /db_xref="GeneID:2955430"
     CDS             229282..230106
                     /gene="dapF"
                     /locus_tag="YPTB0190"
                     /EC_number="5.1.1.7"
                     /note="involved in lysine biosynthesis; DAP epimerase;
                     produces DL-diaminopimelate from LL-diaminopimelate"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="YP_068736.1"
                     /db_xref="GI:51594545"
                     /db_xref="GeneID:2955430"
                     /translation="MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQ
                     MLVVEPPYDPELDFHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKREISVSTQTG
                     RMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKTYILRAAEHTVLCGVVSMGNPHC
                     VMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYERGAGETQACG
                     SGACAAVAVGVVQDLLNENVHVELPGGSLHIRWQGPGHPLYMTGPATHVYDGFIHL"
     misc_feature    229282..230103
                     /gene="dapF"
                     /locus_tag="YPTB0190"
                     /note="diaminopimelate epimerase; Provisional; Region:
                     dapF; PRK00450"
                     /db_xref="CDD:234768"
     misc_feature    229288..229650
                     /gene="dapF"
                     /locus_tag="YPTB0190"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     pfam01678"
                     /db_xref="CDD:250792"
     misc_feature    229738..230082
                     /gene="dapF"
                     /locus_tag="YPTB0190"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     pfam01678"
                     /db_xref="CDD:250792"
     gene            230171..230875
                     /locus_tag="YPTB0191"
                     /db_xref="GeneID:2953117"
     CDS             230171..230875
                     /locus_tag="YPTB0191"
                     /note="similar to Yersinia pestis YPO3844 conserved
                     hypothetical protein (100% evalue=1.E-130); Escherichia
                     coli b3810 yigA; hypothetical 26.7 kD protein in dapF-xerC
                     intergenic region (ORF 235) (67.5% evalue=3.E-83)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068737.1"
                     /db_xref="GI:51594546"
                     /db_xref="GeneID:2953117"
                     /translation="MKNYEEQALAGIELDDDAVMQYLLQNPDFFIRNARLVEQMHIPH
                     PVRGSVSLVEWQLGRQRNQIGQLEEEITLLMEQAGLNEVLFSRLLQLQANLAAADSLQ
                     DMLNRLQRWARDFGLAGANIRLFSDRWQIGAPSDFTHLALSRHAFEPLRIQRLGNRHH
                     YLGSLNGPELLLLLPQAKLVGSVALSLLGADGDLGVVIFSSRDAQHYQQGMGTVMLNQ
                     LSTLLPGLLARWIEPV"
     misc_feature    230204..230872
                     /locus_tag="YPTB0191"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10963"
                     /db_xref="CDD:236808"
     gene            230872..231783
                     /gene="xerC"
                     /locus_tag="YPTB0192"
                     /db_xref="GeneID:2956906"
     CDS             230872..231783
                     /gene="xerC"
                     /locus_tag="YPTB0192"
                     /note="site-specific tyrosine recombinase which cuts and
                     rejoins DNA molecules; binds cooperatively to specific DNA
                     consensus sites; forms a heterotetrameric complex with
                     XerC; XerCD exhibit similar sequences; essential to
                     convert chromosome dimers to monomers during cell division
                     and functions during plasmid segregation; cell division
                     protein FtsK may regulate the XerCD complex; enzyme from
                     Streptococcus group has unusual active site motifs"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific tyrosine recombinase XerC"
                     /protein_id="YP_068738.1"
                     /db_xref="GI:51594547"
                     /db_xref="GeneID:2956906"
                     /translation="MTEFSASLAPQVEAFLRYLSIERQLSPLTVTSYRRQLSALMEIG
                     EQMGLAHWQTLDAAQVRSLVSRSKRTGLHASSLALRLSALRSFLNWLVSQGVLPANPA
                     KGVSTPRSGRHLPKNIDVDEINKLLSIDLNDPLAVRDRAMLEVMYGAGLRLSELVGMN
                     CKHVDLASGDVWVMGKGSKERKVPLGKTAVTWLQHWLALRELFEPQDDAIFLANTGKR
                     ISARNVQKRFAEWGVKQGVSSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLTTT
                     QIYTHLDFQHLATVYDAAHPRAKRGKS"
     misc_feature    230878..231774
                     /gene="xerC"
                     /locus_tag="YPTB0192"
                     /note="Site-specific recombinase XerC [DNA replication,
                     recombination, and repair]; Region: XerC; COG4973"
                     /db_xref="CDD:227307"
     misc_feature    230905..231744
                     /gene="xerC"
                     /locus_tag="YPTB0192"
                     /note="XerD and XerC integrases, DNA breaking-rejoining
                     enzymes, N- and C-terminal domains. XerD-like integrases
                     are involved in the site-specific integration and excision
                     of lysogenic bacteriophage genomes, transposition of
                     conjugative transposons, termination...; Region:
                     INT_XerDC; cd00798"
                     /db_xref="CDD:238413"
     misc_feature    order(231325..231327,231397..231399,231601..231603,
                     231610..231612,231679..231681,231706..231708)
                     /gene="xerC"
                     /locus_tag="YPTB0192"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238413"
     misc_feature    order(231325..231327,231601..231603,231610..231615,
                     231706..231708)
                     /gene="xerC"
                     /locus_tag="YPTB0192"
                     /note="active site"
                     /db_xref="CDD:238413"
     gene            231783..232499
                     /locus_tag="YPTB0193"
                     /db_xref="GeneID:2953118"
     CDS             231783..232499
                     /locus_tag="YPTB0193"
                     /note="YigB; member of the haloacid dehalogenase
                     (HAD)-like hydrolases superfamily of protein; unknown
                     function"
                     /codon_start=1
                     /transl_table=11
                     /product="flavin mononucleotide phosphatase"
                     /protein_id="YP_068739.1"
                     /db_xref="GI:51594548"
                     /db_xref="GeneID:2953118"
                     /translation="MHFYRPLERISAITFDLDDTLYDNRPVIARTEQQSVAFLQQYHP
                     NLALLQPVDFQRLRAELLAQDPGIYHDVTQWRWQAIELGLMRHGLSKAEAQAGADAAM
                     ANFALWRSRIDVPQATHDTLSALAEHYPLVAITNGNADPKACGLDRYFQFVLRSGPHG
                     RAKPFRDMYHKAANHLDIPLKHILHVGDDLTTDVAGSLRCGMQACWINDRQQNLMTAR
                     DSRLLPHIEISQLASLTALL"
     misc_feature    231783..232496
                     /locus_tag="YPTB0193"
                     /note="flavin mononucleotide phosphatase; Provisional;
                     Region: PRK10748"
                     /db_xref="CDD:182696"
     misc_feature    231801..232496
                     /locus_tag="YPTB0193"
                     /note="Predicted hydrolase (HAD superfamily) [General
                     function prediction only]; Region: COG1011"
                     /db_xref="CDD:223943"
     misc_feature    232122..232403
                     /locus_tag="YPTB0193"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    232185..232187
                     /locus_tag="YPTB0193"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            232598..234760
                     /gene="uvrD"
                     /locus_tag="YPTB0194"
                     /gene_synonym="mutU; pdeB; rad; recL"
                     /db_xref="GeneID:2956884"
     CDS             232598..234760
                     /gene="uvrD"
                     /locus_tag="YPTB0194"
                     /gene_synonym="mutU; pdeB; rad; recL"
                     /EC_number="3.6.1.-"
                     /note="unwinds DNA duplexes with 3' to 5' polarity with
                     respect to the bound strand and initiates unwinding most
                     effectively when a single-stranded region is present;
                     involved in the post-incision events of nucleotide
                     excision repair and methyl-directed mismatch repair."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-dependent helicase II"
                     /protein_id="YP_068740.1"
                     /db_xref="GI:51594549"
                     /db_xref="GeneID:2956884"
                     /translation="MDVSDLLDSLNEKQRDAVAAPRGNLLVLAGAGSGKTRVLVHRIA
                     WLLSVENASPYSIISVTFTNKAAAEMRHRIEHLIGTSQGGMWIGTFHGLAHRLLRAHH
                     LDANLPQDFQILDSDDQLRLLKRLVKALNLDEKQWPPRQAMWYINGKKDEGLRPQHIE
                     SYGNPVEATWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNIL
                     VDEFQDTNNIQYAWIRLLAGERSNVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAET
                     IRLEQNYRSTSIILAAANALIANNDGRMGKNLWTDGAEGEPISLYCAFNELDEARFVV
                     NRIKAWQDNGGALNDCAILYRSNAQSRVLEEALLQTATPYRIYGGQRFFDRQEIKDSL
                     AYLRLISNRNDDAAFERVVNTPTRGIGDRTLDVVRQTARDRQLTLWQSTRAMLQEKVL
                     AGRAASALQRFVELIDSLARETADMPLHVQTDRVIRDSGLWSMYEQEKGEKGQARIEN
                     LEELVTATRQYSYQDEDQDLMPLQAFLSHAALEAGDGQADAYQDAVQLMTLHSAKGLE
                     FPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAYVGLTRAMQKLTLCYAESRRLYGKE
                     VNHRPSRFIGELPQECVEEVRLRASVSRPVNHRRMGTPMHENDSGFSLGQRVRHPKFG
                     EGTIVNLEGSGEHNRLQVAFPGEGIKWLVAAYARLEPV"
     misc_feature    232598..234757
                     /gene="uvrD"
                     /locus_tag="YPTB0194"
                     /gene_synonym="mutU; pdeB; rad; recL"
                     /note="DNA-dependent helicase II; Provisional; Region:
                     uvrD; PRK11773"
                     /db_xref="CDD:236976"
     misc_feature    232643..232879
                     /gene="uvrD"
                     /locus_tag="YPTB0194"
                     /gene_synonym="mutU; pdeB; rad; recL"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    <234266..234436
                     /gene="uvrD"
                     /locus_tag="YPTB0194"
                     /gene_synonym="mutU; pdeB; rad; recL"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            complement(234874..235539)
                     /locus_tag="YPTB0195"
                     /db_xref="GeneID:2953119"
     CDS             complement(234874..235539)
                     /locus_tag="YPTB0195"
                     /note="similar to Yersinia pestis YPO3840  TetR-family
                     regulatory protein (96% evalue=1.E-118); Mesorhizobium
                     loti mll3386 transcriptional regulator (47.8%
                     evalue=9.E-43)"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family regulatory protein"
                     /protein_id="YP_068741.1"
                     /db_xref="GI:51594550"
                     /db_xref="GeneID:2953119"
                     /translation="MNTQNKQEGFSPSLTTIRARTRRLLIDTAMSMYERGAFPSITEV
                     ASAAQLSRATAYRYFPTQSALVSAMVDESLGPILAWQPTQPDARQRIAELLSFAYPRM
                     LQHEGVLRAALHLSLQQWADARSSDSNNSSNEEKLIRGNRKRLLKLAVEPLEETLAPE
                     ALQRVIHAFSLIYGSEVFMVLKDIWHLDEAGIQDVTQWMGKAILLQAETDSQLAAQDK
                     THS"
     misc_feature    complement(234928..235488)
                     /locus_tag="YPTB0195"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(235333..235467)
                     /locus_tag="YPTB0195"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            235967..237199
                     /locus_tag="YPTB0196"
                     /db_xref="GeneID:2953120"
     CDS             235967..237199
                     /locus_tag="YPTB0196"
                     /note="similar to Yersinia pestis YPO3839 conserved
                     hypothetical protein (98.7% evalue=0); Sinorhizobium
                     meliloti SMa1334 conserved hypothetical protein (55.7%
                     evalue=1.E-121)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068742.1"
                     /db_xref="GI:51594551"
                     /db_xref="GeneID:2953120"
                     /translation="MPRHIYIATTTDTKGQELAYVSELIQATGLTTVTVDLSTKESQR
                     DSGADICAETVAGYHPDGRQAVFCGDRGQAINAMAIAFERFMVSRVDVAALLGMGGSG
                     GTALITPAMQRLPIGIPKLMVSTMASGDVSGYIGASDIAMMYSVTDIAGLNRISRRVL
                     SNAAHQVAGAVYFAQEASPVDDKPALGLTMFGVTTPCIQAVSAELSDEYDCLVFHATG
                     SGGKAMEKLAESGLLAGVLDLTTTEVCDLLFDGVLACGPERFDAIAHTHIPYVGSCGA
                     LDMVNFGSPATIPAKYADRLFYKHNAQVTLMRTTEQENIEMARWIGEKLNRCQGEVRF
                     LIPEGGFSALDAPGQPFWDEKALTAFIRTLEETVIQTDKRRVVHYPFNINDPLFAQAA
                     IENFKEIVNKEIVNRPSH"
     misc_feature    235967..237172
                     /locus_tag="YPTB0196"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5441"
                     /db_xref="CDD:227728"
     gene            237213..238055
                     /locus_tag="YPTB0197"
                     /db_xref="GeneID:2953121"
     CDS             237213..238055
                     /locus_tag="YPTB0197"
                     /note="similar to Yersinia pestis YPO3838 conserved
                     hypothetical protein (100% evalue=1.E-161); Sinorhizobium
                     meliloti SMa1332 conserved hypothetical protein (71.6%
                     evalue=1.E-109)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068743.1"
                     /db_xref="GI:51594552"
                     /db_xref="GeneID:2953121"
                     /translation="MEKHMPKFQRQAILAKFREMIARREPIIGGGAGTGLSAKCEEAG
                     GIDLIVIYNSGRYRMAGRGSLAGLLAYGNANDIVVDMAKEVLPVVKNTPVLAGVNGTD
                     PFCQFDHFLDHLKALGFSGVQNFPTVGLIDGNFRANLEETGMGYGLEVEMIRLAHQKD
                     LLTTPYVFSAEDAIAMTQAGADIIVPHMGLTTGGNIGADTALKLADCVPLINDWAAAA
                     KSVREEVIVLCHGGPISTPEDAQYIMDHCPQCDGFYGASSMERLPTEIALTDTTQKFK
                     NITR"
     misc_feature    237243..238046
                     /locus_tag="YPTB0197"
                     /note="TIM-barrel signal transduction protein; Region:
                     TIM-br_sig_trns; pfam09370"
                     /db_xref="CDD:117912"
     gene            238705..239655
                     /gene="corA"
                     /locus_tag="YPTB0198"
                     /db_xref="GeneID:2955350"
     CDS             238705..239655
                     /gene="corA"
                     /locus_tag="YPTB0198"
                     /note="responsible for the influx of magnesium ions"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium/nickel/cobalt transporter CorA"
                     /protein_id="YP_068744.1"
                     /db_xref="GI:51594553"
                     /db_xref="GeneID:2955350"
                     /translation="MLSAFKLHNNRLSRLELDESDDLASSLWVDLVEPEEGERERVQT
                     ELGQSLATRPELDDIEASARFFEDEDGLHIHSFFYYEDADDHAGNSTVAFTIRDGRLY
                     TLRERELPAFRLYRMRARNQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLEALSR
                     VIMEGQQGDEYDAALSTLAEQEDIGWKVRLCLMDTQRALNFLVRKARLPSSQLEQARE
                     VLRDIESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSY
                     GMNFEFMPELRWSFGYPGAIALMIIAGLAPYLYFKRKNWL"
     misc_feature    238774..239640
                     /gene="corA"
                     /locus_tag="YPTB0198"
                     /note="CorA-like Mg2+ transporter protein; Region: CorA;
                     pfam01544"
                     /db_xref="CDD:250695"
     misc_feature    238786..239652
                     /gene="corA"
                     /locus_tag="YPTB0198"
                     /note="Escherichia coli Mg2+ transporter CorA_like
                     subgroup; Region: EcCorA-like_1; cd12835"
                     /db_xref="CDD:213369"
     misc_feature    order(238792..238794,238891..238893,238927..238929,
                     238933..238935,238975..238977,239017..239028,
                     239032..239037,239122..239124,239131..239133,
                     239290..239295,239302..239304,239362..239364)
                     /gene="corA"
                     /locus_tag="YPTB0198"
                     /note="Cl binding site [ion binding]; other site"
                     /db_xref="CDD:213369"
     misc_feature    order(238864..238866,238873..238878,238894..238896,
                     238900..238902,239044..239046,239056..239058,
                     239095..239097,239104..239106,239116..239118,
                     239128..239130,239137..239142,239149..239151,
                     239158..239163,239167..239172,239179..239181,
                     239227..239232,239236..239241,239248..239253,
                     239260..239265,239269..239274,239284..239286,
                     239290..239295,239302..239307,239314..239319,
                     239344..239349,239353..239358,239365..239370,
                     239374..239379,239386..239391,239395..239400,
                     239404..239412,239419..239442,239446..239484,
                     239488..239496,239500..239517,239521..239544,
                     239578..239583,239590..239595,239629..239631,
                     239638..239640)
                     /gene="corA"
                     /locus_tag="YPTB0198"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213369"
     misc_feature    join(239467..239523,239566..239634)
                     /gene="corA"
                     /locus_tag="YPTB0198"
                     /note="2 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(239753..240643)
                     /gene="rarD"
                     /locus_tag="YPTB0199"
                     /db_xref="GeneID:2956401"
     CDS             complement(239753..240643)
                     /gene="rarD"
                     /locus_tag="YPTB0199"
                     /note="similar to Yersinia pestis YPO3836 rarD; membrane
                     protein (100% evalue=1.E-168); Salmonella typhimurium
                     STM3955 rarD; chloramphenicol resistance (75.7%
                     evalue=1.E-129)"
                     /codon_start=1
                     /transl_table=11
                     /product="drug/metabolite transporter (DMT) superfamily
                     protein RarD"
                     /protein_id="YP_068745.1"
                     /db_xref="GI:51594554"
                     /db_xref="GeneID:2956401"
                     /translation="MDKQQTRQGIFFALAAYFIWGLAPAYFKLIQQVPADEILTHRVI
                     WSFFFMLILLTVSRHWPQVRDACKNRKRLLLLAVTAVLIASNWLLFIWAVNHNHMLEA
                     SLGYFINPLVNVLFGMLFLGERFRRMQWVAVALAFAGVLIQLWQFGSLPVIGLGLAIT
                     FALYGLLRKKLGVDAQTGMLIETMWLLPVAAVYLFFIADSPTSHLSANAWSLNLLLAA
                     AGVITTIPLLFFTAAATRLRLSTLGFFQYLGPTLMFILAVTFYGETIGNDKMVTFIFI
                     WAALLLFTLDALYTQRKLRR"
     misc_feature    complement(239756..240643)
                     /gene="rarD"
                     /locus_tag="YPTB0199"
                     /note="putative chloramphenical resistance permease RarD;
                     Provisional; Region: PRK15430"
                     /db_xref="CDD:185328"
     misc_feature    complement(240203..240520)
                     /gene="rarD"
                     /locus_tag="YPTB0199"
                     /note="Multidrug resistance efflux transporter; Region:
                     EmrE; cl19304"
                     /db_xref="CDD:267657"
     misc_feature    complement(join(239777..239833,239849..239914,
                     239954..240019,240050..240106,240143..240193,
                     240209..240259,240281..240346,240359..240424,
                     240464..240529,240560..240616))
                     /gene="rarD"
                     /locus_tag="YPTB0199"
                     /note="10 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(240730..241200)
                     /locus_tag="YPTB0200"
                     /db_xref="GeneID:2953122"
     CDS             complement(240730..241200)
                     /locus_tag="YPTB0200"
                     /note="similar to Yersinia pestis YPO3835 conserved
                     hypothetical protein (100% evalue=2.E-83); Escherichia
                     coli b3820 yigI; hypothetical 17.1 kD protein in rarD-pldA
                     intergenic region (66.8% evalue=2.E-55)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068746.1"
                     /db_xref="GI:51594555"
                     /db_xref="GeneID:2953122"
                     /translation="MSVTPLTLEDARRMIGETFVYHMPFNRELGLKLVRFEQDYAEIT
                     FDNDDKLVGNIAQKILHGGVIAAVLDVAAGLVCVGNSLIRHEPLIQEQLQIKLAKMGT
                     IDLRVDYLRPGRGEHFIARSSILRSGNKVAVARVELHNEKQIHIASATATYLVG"
     misc_feature    complement(240736..241116)
                     /locus_tag="YPTB0200"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    complement(<240736..241026)
                     /locus_tag="YPTB0200"
                     /note="Thioesterase-like superfamily; Region: 4HBT_3;
                     pfam13622"
                     /db_xref="CDD:257934"
     misc_feature    complement(order(240865..240876,240895..240897,
                     241021..241023))
                     /locus_tag="YPTB0200"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(240874..240876,240880..240894,
                     241003..241005,241012..241014,241018..241020))
                     /locus_tag="YPTB0200"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(240895..240897,240976..240981,
                     240988..240993,241015..241017))
                     /locus_tag="YPTB0200"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            241422..242300
                     /gene="pldA"
                     /locus_tag="YPTB0201"
                     /db_xref="GeneID:2956276"
     CDS             241422..242300
                     /gene="pldA"
                     /locus_tag="YPTB0201"
                     /EC_number="3.1.1.32"
                     /EC_number="3.1.1.4"
                     /note="catalyzes the hydrolysis of phosphatidylcholine"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase A"
                     /protein_id="YP_068747.1"
                     /db_xref="GI:51594556"
                     /db_xref="GeneID:2956276"
                     /translation="MARFWQILIALLLVPTLAQAEEATIEKIHDAPAVRGSIIAAMLQ
                     DHDNPFLLYPYETNYLLYTYTNEINKQAISSYDWAEQANKDEVKFQLSLAFPIWRGIA
                     GDNSLLGASYTQRSWWQASNSEESSPFRETNYEPQLFLAWSTDYELAGWTFREVEFGF
                     NHQSNGKADPTSRSWNRVYTRVMAQRGNLEIDLKPWYRIPESDSKDDNPDITKYMGYY
                     RLKVGYALGDSVFSLDGRYNWNTGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYN
                     FRQTRVGVGIMLNDVL"
     misc_feature    241569..242270
                     /gene="pldA"
                     /locus_tag="YPTB0201"
                     /note="The outer membrane phospholipase A (OMPLA) is an
                     integral membrane enzyme that catalyses the hydrolysis of
                     acylester bonds in phospholipids using calcium as a
                     cofactor. The enzyme has a fold of transmembrane
                     beta-barrels and is widespread among...; Region: OMPLA;
                     cd00541"
                     /db_xref="CDD:238302"
     misc_feature    order(241575..241577,241692..241694,241698..241700,
                     241761..241763,241806..241808)
                     /gene="pldA"
                     /locus_tag="YPTB0201"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238302"
     misc_feature    order(241599..241601,241692..241694,241698..241700,
                     241704..241706,241710..241712,241755..241757,
                     241773..241775,241797..241799,241806..241808,
                     241905..241907,241911..241913,241917..241919,
                     242193..242195)
                     /gene="pldA"
                     /locus_tag="YPTB0201"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238302"
     misc_feature    order(241905..241907,241911..241913,241947..241949)
                     /gene="pldA"
                     /locus_tag="YPTB0201"
                     /note="active site"
                     /db_xref="CDD:238302"
     misc_feature    order(241926..241928,241935..241937,242040..242042)
                     /gene="pldA"
                     /locus_tag="YPTB0201"
                     /note="calcium binding site [ion binding]; other site"
                     /db_xref="CDD:238302"
     gene            242377..244209
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /db_xref="GeneID:2956425"
     CDS             242377..244209
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /EC_number="3.6.1.-"
                     /note="functions in blocking illegitimate recombination,
                     enhancing topoisomerase activity, initiating SOS signaling
                     and clearing blocked replication forks; component of the
                     RecF recombinational pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="YP_068748.1"
                     /db_xref="GI:51594557"
                     /db_xref="GeneID:2956425"
                     /translation="MSTAAVINRELLAVQVLRDTFGYQQFRPGQQEIINATLSGQDCL
                     VVMPTGGGKSLCYQIPALVTDGLTLVVSPLISLMKDQVDQLLAYGVGAGCLNSSQTRE
                     QQLAVMDGCRSGQIKLLYIAPERLVMESFLDQLYQWRPALLAVDEAHCISQWGHDFRP
                     EYRALGQLKQRFPDLPVIALTATADEATRGDIVRLLNLDQPLIQISSFDRPNIRYTLV
                     EKFKPLDQLWRFVQDQRGKSGIIYCNSRAKVEDTTARLQSRGLSVAAYHAGLDNERRA
                     QVQEAFQRDDLQVVVATVAFGMGINKPNVRFVVHFDIPRTIESYYQETGRAGRDGLPA
                     EAVLLYDPADMAWLRRCLEEKPAGAQQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEG
                     KQQPCGNCDICLDPPKRYDGLADAQKALSCVYRVGQRFGLGYIVEVLRGANNQRIREM
                     GHDKLSVYGIGREQTHEHWVSVLRQLIHLGLLSQNIAQFSALQLTEAARPVLRAELPL
                     QLAVPRIQSLKVRSSANQKSYGGNYDRKLFAKLRKLRKSIADEGNIPPYVVFNDATLL
                     EMAEQMPITASELLSVNGVGQRKLERFGAPFMALIRDHVDNNDD"
     misc_feature    242377..244203
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /note="ATP-dependent DNA helicase RecQ; Provisional;
                     Region: PRK11057"
                     /db_xref="CDD:182933"
     misc_feature    242497..242925
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    242524..242538
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    242812..242823
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    243010..243393
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(243106..243117,243175..243180,243253..243261)
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(243277..243279,243340..243342,243352..243354,
                     243361..243363)
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    243607..243882
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /note="This DNA-binding domain is found in the RecQ
                     helicase among others and has a helix-turn-helix
                     structure; Region: RQC; smart00956"
                     /db_xref="CDD:214936"
     misc_feature    243976..244179
                     /gene="reqQ"
                     /locus_tag="YPTB0202"
                     /note="HRDC domain; Region: HRDC; pfam00570"
                     /db_xref="CDD:249966"
     gene            244316..244936
                     /gene="rhtC"
                     /locus_tag="YPTB0203"
                     /db_xref="GeneID:2956449"
     CDS             244316..244936
                     /gene="rhtC"
                     /locus_tag="YPTB0203"
                     /note="similar to Yersinia pestis YPO3832 rhtC; threonine
                     efflux protein (100% evalue=1.E-116); Salmonella typhi
                     STY3600 rhtC; threonine efflux protein (72.3%
                     evalue=2.E-85)"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine efflux system"
                     /protein_id="YP_068749.1"
                     /db_xref="GI:51594558"
                     /db_xref="GeneID:2956449"
                     /translation="MLMLFLTVAFIHLVALISPGPDFFFVSQTAASRSRGEAMMGVLG
                     ISLGIVIWAGVALMGLNLILQKMAWLHQIIMVGGGMYLCWMGWQLLKSARAKHDVAEE
                     EVQVVLPARGRTFIRGLLTNLSNPKAVIYFGSVFSWFVGDDVGAGARWGLFILIVGET
                     FLWFTVVACVFALPTMRRGYQRLSKWIDGLAGVLFAGFGIQLILSR"
     misc_feature    244316..244933
                     /gene="rhtC"
                     /locus_tag="YPTB0203"
                     /note="threonine efflux system; Provisional; Region:
                     PRK10229"
                     /db_xref="CDD:236665"
     misc_feature    join(244325..244393,244439..244507,244517..244585,
                     244670..244738,244766..244834,244871..244930)
                     /gene="rhtC"
                     /locus_tag="YPTB0203"
                     /note="6 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(244987..245607)
                     /gene="rhtB"
                     /locus_tag="YPTB0204"
                     /db_xref="GeneID:2956448"
     CDS             complement(244987..245607)
                     /gene="rhtB"
                     /locus_tag="YPTB0204"
                     /note="similar to Yersinia pestis YPO3831 rhtB;
                     homoserine/homoserine lactone efflux protein (100%
                     evalue=1.E-111); Escherichia coli ECs4754
                     homoserine/homoserine lactone effulux protein (75.4%
                     evalue=5.E-88)"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine/homoserine lactone efflux protein"
                     /protein_id="YP_068750.1"
                     /db_xref="GI:51594559"
                     /db_xref="GeneID:2956448"
                     /translation="MTLDWWLTYLLTTLILSLSPGSGAINTMSTAISHGTRGVVASIG
                     GLQLGLAVHIVLVGVGLGALVSQSLLAFEILKWLGAAYLIWLGIQQWRAAGSLDLHAL
                     ANSMPRRKLFKRAVFVNLTNPKSIVFLAALFPQFVLPQQPQVAQYLILGSTSVIVDII
                     VMIGYATLATRIARWIKSPQQMKLLNRIFGGLFMLIGALLATARKV"
     misc_feature    complement(244993..245607)
                     /gene="rhtB"
                     /locus_tag="YPTB0204"
                     /note="homoserine/homoserine lactone efflux protein;
                     Provisional; Region: rhtB; PRK10520"
                     /db_xref="CDD:182514"
     misc_feature    complement(join(245002..245058,245098..245163,
                     245194..245259,245350..245415,245428..245493,
                     245533..245592))
                     /gene="rhtB"
                     /locus_tag="YPTB0204"
                     /note="6 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            245803..246816
                     /gene="pldB"
                     /locus_tag="YPTB0205"
                     /db_xref="GeneID:2956277"
     CDS             245803..246816
                     /gene="pldB"
                     /locus_tag="YPTB0205"
                     /EC_number="3.1.1.5"
                     /note="lecithinase B; catalyzes the conversion of
                     1-lysophosphatidylcholine to glycerophosphocholine; can
                     also hydrolyze 2-acyl glycerophosphoethanolamine and other
                     substrates"
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase L2"
                     /protein_id="YP_068751.1"
                     /db_xref="GI:51594560"
                     /db_xref="GeneID:2956277"
                     /translation="MLLGHHMNNWLTREEQFAAFINGPLLDFWQQRDEQTFMGVDNIP
                     IRYVRFRAPHHTQVVVVVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRMLD
                     DHNRGHVIKFDDYIEDFAQLVQIEITGSHYQQRFALAHSMGGAILTRFLAREPDVFNA
                     VALCAPMFGIHLPLPGWLARRIVNWAEGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRE
                     RYRRYLRQYSDTPEIRVGGPTYHWLRESLLVGEQIIAEAEKITTPVLLLQASEDRVVH
                     NPAHDAFSQAMTLAGHPCEGGRPQVIQGARHEILFERDTLRAEALSAILRFFAQHQSS
                     VGH"
     misc_feature    245815..246798
                     /gene="pldB"
                     /locus_tag="YPTB0205"
                     /note="lysophospholipase L2; Provisional; Region:
                     PRK10749"
                     /db_xref="CDD:182697"
     misc_feature    245926..246174
                     /gene="pldB"
                     /locus_tag="YPTB0205"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     pfam12146"
                     /db_xref="CDD:256874"
     gene            246851..247660
                     /locus_tag="YPTB0206"
                     /db_xref="GeneID:2953123"
     CDS             246851..247660
                     /locus_tag="YPTB0206"
                     /note="purine and pyrimidine nucleotides are secondary
                     substrates; yigL expression is regulated by heat shock,
                     osmotic shock and starvation of glucose, phosphate or
                     ammonium"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphatase"
                     /protein_id="YP_068752.1"
                     /db_xref="GI:51594561"
                     /db_xref="GeneID:2953123"
                     /translation="MYHVVASDLDGTLLSPNHTLTPYTKETLKLLTQRDVHFVFATGR
                     HHIDVAQIRDNLEISAFMITSNGARVHNTEGELIFSHNLDADIARDLYNLEHHNPDIL
                     TNVYLGDEWFMNRECPEQEEFFRESVFNYQVFEPALLPTDGVCKVYFTCEDHDKLLIL
                     EEAINARWGDRVNVSFSFPTCLEVMGGGVSKGHALEQVAKIIGYSLKDCIAFGDGMND
                     VEMLSMSGKGCIMRDAHQRLKDVLPNLEVIGSNADDAVPHYLRKMFLGKEE"
     misc_feature    246851..247648
                     /locus_tag="YPTB0206"
                     /note="putative hydrolase; Provisional; Region: PRK10976"
                     /db_xref="CDD:182878"
     misc_feature    246860..>247090
                     /locus_tag="YPTB0206"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(246872..246880,246974..246979)
                     /locus_tag="YPTB0206"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    246872..246889
                     /locus_tag="YPTB0206"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    246974..246976
                     /locus_tag="YPTB0206"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <247358..247534
                     /locus_tag="YPTB0206"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            247936..249135
                     /locus_tag="YPTB0207"
                     /db_xref="GeneID:2953124"
     CDS             247936..249135
                     /locus_tag="YPTB0207"
                     /note="similar to Yersinia pestis YPO3828 hypothetical
                     protein (99.7% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068753.1"
                     /db_xref="GI:51594562"
                     /db_xref="GeneID:2953124"
                     /translation="MSDINVTSPHFIPMKSPITARLDNSDLIDERPQKINFLGNKLNS
                     IADVNIDSKNKKITINIAEKKFSSDYIPEEYIYIAVWDAKGKMVFQKKLSDAEIKEEK
                     IELPFEVGYQLEMYHPIPSRLVSSPDLYSIIDSNSPFTLLVMTPLGVTNPKMESYPTD
                     IIEADFIHPNSVSVGVNADVIEPASTAEPTTSTPIAPDIPSASTDPIVSTSTRTGIDS
                     TTKLMVSFQFKLLGVCDYDIATVTIDEESKLAGIKIVTDTPHCHFGDELYASIKVTDK
                     QGHITFEEKLYGTNANISNTIIPFEKGYKLDIFHAEPSRLRVSSGDSDTLIPESKQNS
                     FIMTSIGIENTRQGSAEAIISDQFDTEKLVQDMSSFGDSSIAPVDNVYGYMGEKNHYQ
                     NVVSHVE"
     misc_feature    <247996..248754
                     /locus_tag="YPTB0207"
                     /note="Peptidase M60-like family; Region: M60-like;
                     cl19940"
                     /db_xref="CDD:268293"
     misc_feature    <248617..248970
                     /locus_tag="YPTB0207"
                     /note="Peptidase M60-like family; Region: M60-like;
                     cl19940"
                     /db_xref="CDD:268293"
     gene            complement(249209..250324)
                     /gene="glpQ"
                     /locus_tag="YPTB0208"
                     /db_xref="GeneID:2955713"
     CDS             complement(249209..250324)
                     /gene="glpQ"
                     /locus_tag="YPTB0208"
                     /EC_number="3.1.4.46"
                     /note="hydrolyzes deacylated phospholipids to glycerol
                     3-phosphate and the corresponding alcohols; periplasmic"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="YP_068754.1"
                     /db_xref="GI:51594563"
                     /db_xref="GeneID:2955713"
                     /translation="MQTHVKTLLASLILAASMAAPAYAAKPASADKSASAIDKVVIAH
                     RGASGYLPEHSLPAKAMAYAQGADYLEQDLVMTKDNELVVLHDHYLDRVTDVAERFPD
                     RARKDGRYYAIDFTLPEIKSLKFTEGFDIDKNGKKVQSYPNRFPMGKSDFRVHTFQEE
                     IEFIQGLNHSTGKNTGIYPEIKAPWFHHQEGKDISTKVLEVLKEYGYTNKDDKVYLQS
                     FDVNELKRIKNELEPKMGMDLKLIQLIAYTDWNETYEQLPDGKWVNYNYDWMFKPGAM
                     KEVAHYADGIGPDYHMLVVKTSTAKDIKLTDLVKEAHASNMMVHPFTIRADRLPKYAT
                     DINQLFDIIYNQAQVDGVFTDFPDQGIQFLQKQQQHK"
     misc_feature    complement(249221..250228)
                     /gene="glpQ"
                     /locus_tag="YPTB0208"
                     /note="glycerophosphodiester phosphodiesterase;
                     Provisional; Region: glpQ; PRK11143"
                     /db_xref="CDD:236859"
     misc_feature    complement(249251..250210)
                     /gene="glpQ"
                     /locus_tag="YPTB0208"
                     /note="Glycerophosphodiester phosphodiesterase domain of
                     Escherichia coli (GlpQ) and similar proteins; Region:
                     GDPD_EcGlpQ_like; cd08600"
                     /db_xref="CDD:176542"
     misc_feature    complement(order(249359..249361,249674..249676,
                     249785..249787,250067..250069,250106..250108,
                     250112..250114,250193..250195))
                     /gene="glpQ"
                     /locus_tag="YPTB0208"
                     /note="active site"
                     /db_xref="CDD:176542"
     misc_feature    complement(order(250067..250069,250193..250195))
                     /gene="glpQ"
                     /locus_tag="YPTB0208"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176542"
     misc_feature    complement(order(249785..249787,250106..250108,
                     250112..250114))
                     /gene="glpQ"
                     /locus_tag="YPTB0208"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:176542"
     gene            250949..252604
                     /gene="glpA"
                     /locus_tag="YPTB0209"
                     /db_xref="GeneID:2955706"
     CDS             250949..252604
                     /gene="glpA"
                     /locus_tag="YPTB0209"
                     /EC_number="1.1.5.3"
                     /note="anaerobic, catalyzes the conversion of glycerol
                     3-phosphate to dihydroxyacetone using fumarate or nitrate
                     as electron acceptor"
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate dehydrogenase subunit A"
                     /protein_id="YP_068755.1"
                     /db_xref="GI:51594564"
                     /db_xref="GeneID:2955706"
                     /translation="MTNSSPYLETDVIIIGGGATGAGIARDCARRGLACTLLERHDIA
                     TGATGRNHGLLHSGARYAVTDGESARECIEENRILKRIARHCIEQTDGLFITLPEDSL
                     AYQLQFIARCRDAGIEAEAIDPAQALRLEPAVNPALIAAVRVPDGTVDPFRLTAANML
                     DAREHGANILTYHEVIGLLRQGSRINGVCVFDHKNQRKYDIHAQIVVNAAGIWGQHIA
                     EYADLRIRMFPAKGALLILGHRINNMVINRCRKPADADILVPGDTISLIGTTSTHINY
                     DQIDNMVVTAQEVDTLIREGAKLSPQLAQTRILRAYAGVRPLVASDDDPSGRNVSRGI
                     VLLDHASRDGVEGFITITGGKLMTYRLMAEWATDKVCEKLGISAACTTAQVPLPGSRQ
                     SAEQTLSKVISLPASIRGSAVYRHGDRATQLLVGNRLDNSLVCECEAVTAGEVRYAVE
                     SLSVNNLLDLRRRTRVGMGTCQGELCACRAAGLLSRFKVTTPQQSREQLTQFLNERWK
                     GVRPIAWGDALRESEFTQWVYQGLCGLDEIPATVNAREKHDEI"
     misc_feature    250958..252601
                     /gene="glpA"
                     /locus_tag="YPTB0209"
                     /note="sn-glycerol-3-phosphate dehydrogenase subunit A;
                     Provisional; Region: glpA; PRK11101"
                     /db_xref="CDD:236847"
     misc_feature    251024..252352
                     /gene="glpA"
                     /locus_tag="YPTB0209"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            252594..253868
                     /gene="glpB"
                     /locus_tag="YPTB0210"
                     /db_xref="GeneID:2955707"
     CDS             252594..253868
                     /gene="glpB"
                     /locus_tag="YPTB0210"
                     /EC_number="1.1.5.3"
                     /note="sn-glycerol-3-phosphate dehydrogenase (anaerobic);
                     catalyzes the formation of dihydroxyacetone from glycerol
                     3-phosphate; part of GlpABC complex; presumably this
                     subunit is responsible for membrane interactions and
                     contains iron-sulfur clusters"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic glycerol-3-phosphate dehydrogenase
                     subunit B"
                     /protein_id="YP_068756.1"
                     /db_xref="GI:51594565"
                     /db_xref="GeneID:2955707"
                     /translation="MKFDVIIIGGGLAGLACGIRLAEQGKYCAIVSAGQNALHFSSGS
                     LDLLAKLPDGRAVSQPLSALSALAELAPEHPYSKMRNITQLDELVQEAEALLRRCGLD
                     IVGSSAENHLRLTPLGSCRPTWLSLADIPVAPLNGPLPWQRVAVIGIEGFLDFQPQMV
                     ASALQDQGIDATADYLHLPALDRLRDNPSEFRAVNIARILDLPENRQPLADELSRLSS
                     TAEMILLPACIGLDKSAPLDALRAVVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGG
                     LVMPGDAVLRAELVDNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFDKVYEP
                     ILDLDILSLPHRADWSHSNLFAPQPYLQFGVNTDNHLRPLRGGVALENLHAIGAVLGG
                     YDPLQQGCGAGVSLTSAVFVAEQIISEMAVTL"
     misc_feature    252600..253844
                     /gene="glpB"
                     /locus_tag="YPTB0210"
                     /note="glycerol-3-phosphate dehydrogenase, anaerobic, B
                     subunit; Region: glycerol3P_GlpB; TIGR03378"
                     /db_xref="CDD:213807"
     misc_feature    252603..253805
                     /gene="glpB"
                     /locus_tag="YPTB0210"
                     /note="FAD binding domain; Region: FAD_binding_2;
                     pfam00890"
                     /db_xref="CDD:250207"
     gene            253865..255160
                     /gene="glpC"
                     /locus_tag="YPTB0211"
                     /db_xref="GeneID:2955708"
     CDS             253865..255160
                     /gene="glpC"
                     /locus_tag="YPTB0211"
                     /note="anaerobic; with GlpAB catalyzes the conversion of
                     glycerol-3-phosphate to dihydroxyacetone phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate dehydrogenase subunit C"
                     /protein_id="YP_068757.1"
                     /db_xref="GI:51594566"
                     /db_xref="GeneID:2955708"
                     /translation="MTGLPKHDASPEQDGTMVGDSRLTRDNSFESCIKCTVCTTYCPV
                     AKVNPLYPGPKQAGPDGERLRLKDPALYDDALKYCTNCKRCEVACPSDVKIGDIIQRA
                     KASHSTNKPKLRDAILSHTDIMGTLSTPFAPVINAVTGLKPVRVLLDKALKIDHRREL
                     PKYSFGTFRRWYRKQAEKQQQYTEQVAFFHGCFVNYNHPQLGKDLVSVFNAMNIGVQL
                     LKREKCCGVPLIVNGFIEQAKKQARVNLESLTDTVIGRDIPVVATSSSCTFTLRDEYP
                     HLLDVDTTPVRDKVELATRYLYRLLDQGRELPLKPLFSLNPLLASQEAPLRIAYHTPC
                     HMEKMGWTAYTLALLQRIPGVELVVLDSQCCGIAGTYGFKSENYATSQGIGASLFQQI
                     EDSGVDLVITDCETCKWQIEMSTSKKCEHPITLLARVLA"
     misc_feature    253940..255157
                     /gene="glpC"
                     /locus_tag="YPTB0211"
                     /note="glycerol-3-phosphate dehydrogenase, anaerobic, C
                     subunit; Region: glycerol3P_GlpC; TIGR03379"
                     /db_xref="CDD:132422"
     misc_feature    253946..254143
                     /gene="glpC"
                     /locus_tag="YPTB0211"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    254420..254680
                     /gene="glpC"
                     /locus_tag="YPTB0211"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     misc_feature    254846..255100
                     /gene="glpC"
                     /locus_tag="YPTB0211"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     gene            complement(255304..255831)
                     /gene="drcB"
                     /locus_tag="YPTB0212"
                     /db_xref="GeneID:2955485"
     CDS             complement(255304..255831)
                     /gene="drcB"
                     /locus_tag="YPTB0212"
                     /note="similar to Yersinia pestis YPO3823 dcrB;
                     lipoprotein (100% evalue=1.E-92); Salmonella typhimurium
                     STM3580  inner membrane lipoprotein (58.6% evalue=5.E-56)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068758.1"
                     /db_xref="GI:51594567"
                     /db_xref="GeneID:2955485"
                     /translation="MYKKIVRFLAVGLLVAGLSACDNSSDNNVGQTVSLLDGKVTFNL
                     PADLSDQSGKMGNQANNMHVYANNTGDKAVIVILGEGTNEKLEVLTNRLAEQQRARDA
                     NLQVVTNKTININGQPFQQLDSIITSSGQKAYSSIVMGTVGNQLMTLQITLPAENQQQ
                     AQTEAESIISTLKLK"
     misc_feature    complement(255307..255828)
                     /gene="drcB"
                     /locus_tag="YPTB0212"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11615"
                     /db_xref="CDD:183232"
     gene            complement(255961..256629)
                     /gene="yhhQ"
                     /locus_tag="YPTB0213"
                     /db_xref="GeneID:2957067"
     CDS             complement(255961..256629)
                     /gene="yhhQ"
                     /locus_tag="YPTB0213"
                     /note="similar to Yersinia pestis YPO3822 yhhQ; membrane
                     protein (99.5% evalue=1.E-123); Salmonella typhimurium
                     STM3579 yhhQ; integral membrane protein (75.2%
                     evalue=1.E-90)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068759.1"
                     /db_xref="GI:51594568"
                     /db_xref="GeneID:2957067"
                     /translation="MFSFTAQQRMTALVWLSLFHIVIITSSNYLVQLPIAIFGFHTTW
                     GAFTFPFIFLATDLTVRIFGAPLARRIILSVMVPALLISYLISALFYQGSWQGFPALT
                     SFNLVVARIAVASFMAYVLGQILDVQVFNRLRQRNAWWVAPTAAMFFGNISDTMAFFF
                     IAFYRSSDPFMAAHWVEIALVDYSFKLLICMLFFLPAYGVMLNVLLKYFARQTGQPVL
                     ATER"
     misc_feature    complement(256000..256629)
                     /gene="yhhQ"
                     /locus_tag="YPTB0213"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11212"
                     /db_xref="CDD:183041"
     misc_feature    complement(join(256012..256077,256138..256203,
                     256240..256305,256351..256416,256438..256494,
                     256525..256590))
                     /gene="yhhQ"
                     /locus_tag="YPTB0213"
                     /note="6 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            256913..257167
                     /locus_tag="YPTB0214"
                     /db_xref="GeneID:2953125"
     CDS             256913..257167
                     /locus_tag="YPTB0214"
                     /note="TusA; transfers sulfur to TusBCD complex; involved
                     in thiouridation of U34 position of some tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur transfer protein SirA"
                     /protein_id="YP_068760.1"
                     /db_xref="GI:51594569"
                     /db_xref="GeneID:2953125"
                     /translation="MTDIFANPDKTLDALGLRCPEPVMMVRKTVRHMEEGQTLLIIAD
                     DPATTRDIPGFCRFMDHQLLAQDTEQTPYRYLVRKGITAG"
     misc_feature    256943..257149
                     /locus_tag="YPTB0214"
                     /note="SirA (also known as UvrY,  and YhhP) belongs to a
                     family of two-component response regulators that controls
                     secondary metabolism and virulence. The other member of
                     this two-component system is a sensor kinase called BarA
                     which phosphorylates SirA.  A...; Region: SirA; cd03423"
                     /db_xref="CDD:239515"
     misc_feature    order(256946..256951,256958..256960,256967..256978,
                     256982..256984)
                     /locus_tag="YPTB0214"
                     /note="CPxP  motif; other site"
                     /db_xref="CDD:239515"
     gene            complement(257232..259598)
                     /gene="zntA"
                     /locus_tag="YPTB0215"
                     /db_xref="GeneID:2955266"
     CDS             complement(257232..259598)
                     /gene="zntA"
                     /locus_tag="YPTB0215"
                     /EC_number="3.6.3.3"
                     /EC_number="3.6.3.5"
                     /function="pumps out Pb++/Cd++/Zn++/Hg++"
                     /note="P-type ATPase involved in the export of lead,
                     cadmium, zinc and mercury"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc/cadmium/mercury/lead-transporting ATPase"
                     /protein_id="YP_068761.1"
                     /db_xref="GI:51594570"
                     /db_xref="GeneID:2955266"
                     /translation="MHSHSEHQKSVETNSNCGCGHTHDKHQTGCSNLATAANSDAISH
                     DSVSEHSHHDGESCSHTHADEADEESDRLDTTIVSGTQRFSWQVKGMDCPSCARKIEN
                     AISGLDGVEKVKVLFTTEKLVVDARADVRSLVQKAVIATGFSLVNTQTTAGQKNVATE
                     SRLREYLPLALLSTLMLISWGLSFFNTELSQTAFTITTIVGLIPFVIKSWKLIRSGTP
                     FAIETLMSVAAIGAVFIGATAEAAMVLLLFMVGELLESYAVNRARRGVTALMALVPEE
                     ALLLKDGKRTLVPVADLRPGDIIEIPPGGRLPADAELQASFASFDESALTGESIPVER
                     QQGEKVAAGCLSVDRAVEMCVVSEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIY
                     TPIIILFSILVILVPPLVFAAPWEPWIYRGLTLLLIGCPCALVISTPAAITSALAAAT
                     RRGALIKGGAALEQLGRSQIIAFDKTGTLTEGKPKVTDVLPISGISETRLLTLAAAVE
                     AGSHHPLAIAIIQCAQQNQRAQQNQRAQQNTPMLPLAEERRALAGVGIEGVVNGLMVR
                     VSAPSKLSPALLTDEWLAQIDQLESSGKTAVVVLEDEKFIGLLALRDTLRTDAKQAID
                     ALKKLGIQGVMLTGDNPRAAAAIAGELGIDYRAGLLPADKVQAVMALNALQPTVMVGD
                     GINDAPAMKASSIGVAMGSGTDVALETADAALTHNRLTGLAEIILLSRAANANIRQNI
                     TIALGLKAIFLVTTLLGLTGLWLAVLADSGATALVTANALRLLRKRDV"
     misc_feature    complement(257238..259556)
                     /gene="zntA"
                     /locus_tag="YPTB0215"
                     /note="zinc/cadmium/mercury/lead-transporting ATPase;
                     Provisional; Region: zntA; PRK11033"
                     /db_xref="CDD:236827"
     misc_feature    complement(259170..259340)
                     /gene="zntA"
                     /locus_tag="YPTB0215"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(259311..259313,259320..259328))
                     /gene="zntA"
                     /locus_tag="YPTB0215"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    complement(258207..258872)
                     /gene="zntA"
                     /locus_tag="YPTB0215"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    complement(257421..>257765)
                     /gene="zntA"
                     /locus_tag="YPTB0215"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     misc_feature    complement(join(257301..257366,258258..258323,
                     258369..258434,258846..258911,258957..259022,
                     259044..259100))
                     /gene="zntA"
                     /locus_tag="YPTB0215"
                     /note="6 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(260012..260638)
                     /gene="yhhN"
                     /locus_tag="YPTB0216"
                     /db_xref="GeneID:2957066"
     CDS             complement(260012..260638)
                     /gene="yhhN"
                     /locus_tag="YPTB0216"
                     /note="similar to Yersinia pestis YPO3819 yhhN; membrane
                     protein (100% evalue=1.E-117); Escherichia coli ECs4317
                     enzyme (66.8% evalue=4.E-78)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068762.1"
                     /db_xref="GI:51594571"
                     /db_xref="GeneID:2957066"
                     /translation="MSWPFLAVFFSGWLFVDATYRGPRWQRWVFKPVTLLLLLLLAWQ
                     APALGPAGYLIVLGLLATLLADALLLLPSERLLYALGAFFLSHLLYTISFASQMTLTL
                     FWPLPLVLIVVGALLLAALWTQLQDMRWPVVAFIGMTLLMVWMAGEQYFARSTDLGFS
                     LLAGSVLLLLSHAVWLLNRYRFSFRASDAIAAGCYFIGHFLIVRSLYL"
     misc_feature    complement(260015..260638)
                     /gene="yhhN"
                     /locus_tag="YPTB0216"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3714"
                     /db_xref="CDD:226237"
     misc_feature    complement(join(260018..260071,260111..260167,
                     260198..260251,260273..260338,260354..260410,
                     260426..260491,260504..260554))
                     /gene="yhhN"
                     /locus_tag="YPTB0216"
                     /note="7 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            260928..261248
                     /locus_tag="YPTB0217"
                     /db_xref="GeneID:2953126"
     CDS             260928..261248
                     /locus_tag="YPTB0217"
                     /note="similar to Yersinia pestis YPO3818 conserved
                     hypothetical protein (100% evalue=2.E-55); Pseudomonas
                     aeruginosa PA3979 hypothetical protein (45.6%
                     evalue=1.E-21)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068763.1"
                     /db_xref="GI:51594572"
                     /db_xref="GeneID:2953126"
                     /translation="MANEQLLYRIQFINNGKNYQLYVREIGSSSLFGFIEIADFVFDS
                     QSTLLVDPSTEKLKTEFSGVNRSYIPLHAVIRIDSVTEKGSARISELGNNVMNFPYLP
                     GNKP"
     misc_feature    260928..261245
                     /locus_tag="YPTB0217"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4517"
                     /db_xref="CDD:226900"
     gene            261460..261879
                     /locus_tag="YPTB0218"
                     /db_xref="GeneID:2953127"
     CDS             261460..261879
                     /locus_tag="YPTB0218"
                     /note="similar to Yersinia pestis YPO3817  membrane
                     protein (100% evalue=2.E-73); Salmonella typhimurium
                     STM3574 yhhM; inner membrane protein (38.4%
                     evalue=2.E-17)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068764.1"
                     /db_xref="GI:51594573"
                     /db_xref="GeneID:2953127"
                     /translation="MSKLPLLFIAVVVLIVVLATRQYWQKKQQDAENDRAPVRSVQVE
                     VVDKREVLAPNRRSRQREEIVAEEKRYEVYFRPLSSGIEIKNSLGLSGGNEIKSGSEI
                     KMVLPQQEYNRIEQGAQGILRLQGTRYIGFIPDAPHP"
     misc_feature    261523..261861
                     /locus_tag="YPTB0218"
                     /note="Protein of unknown function (DUF2500); Region:
                     DUF2500; pfam10694"
                     /db_xref="CDD:151190"
     misc_feature    261469..261522
                     /locus_tag="YPTB0218"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(262056..262328)
                     /gene="yhhL"
                     /locus_tag="YPTB0219"
                     /db_xref="GeneID:2957065"
     CDS             complement(262056..262328)
                     /gene="yhhL"
                     /locus_tag="YPTB0219"
                     /note="similar to Yersinia pestis YPO3816a yhhL; membrane
                     protein (100% evalue=5.E-48); Escherichia coli b3466 yhhL;
                     hypothetical 10.3 kD protein in ftsY-nikA intergenic
                     region (64.2% evalue=2.E-25)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068765.1"
                     /db_xref="GI:51594574"
                     /db_xref="GeneID:2957065"
                     /translation="MWINLGRLLMLGVWFFILLNLFQPYPKPLRYFIHVAMIFMVLMH
                     GLQLVLLKSTQPKDQPISGLQQFKIFVFGVFELLAWQKKQPQLPKK"
     misc_feature    complement(262065..262328)
                     /gene="yhhL"
                     /locus_tag="YPTB0219"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10910"
                     /db_xref="CDD:182831"
     misc_feature    complement(join(262089..262145,262176..262241,
                     262263..262313))
                     /gene="yhhL"
                     /locus_tag="YPTB0219"
                     /note="3 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(262318..262980)
                     /gene="rsmD"
                     /locus_tag="YPTB0220"
                     /db_xref="GeneID:2953128"
     CDS             complement(262318..262980)
                     /gene="rsmD"
                     /locus_tag="YPTB0220"
                     /note="catalyzes the methylation of 16S rRNA at position
                     G966"
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA m(2)G966-methyltransferase"
                     /protein_id="YP_068766.1"
                     /db_xref="GI:51594575"
                     /db_xref="GeneID:2953128"
                     /translation="MAKQPIAKRSIVKKASPQSAGQIRIIGGKWRGRKLPVPDSPGLR
                     PTTDRVRETLFNWLAPMIQGARCLDCFAGSGALGLEALSRYASETTLLEADRQVAKQL
                     SDNLTLLKAENGQVVNTNSLQWLAQPGQPFNLVFLDPPFRKGLLAETINLLEQFNWLA
                     ADAWIYVEAEAESAVADVPANWLLHREKIAGQVAYRLFIRQQTDLPACTSVAEQEQHH
                     VD"
     misc_feature    complement(<262558..262785)
                     /gene="rsmD"
                     /locus_tag="YPTB0220"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(262567..262569,262618..262626,
                     262699..262704,262753..262773))
                     /gene="rsmD"
                     /locus_tag="YPTB0220"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            263262..264986
                     /gene="ftsY"
                     /locus_tag="YPTB0221"
                     /db_xref="GeneID:2955662"
     CDS             263262..264986
                     /gene="ftsY"
                     /locus_tag="YPTB0221"
                     /note="similar to Yersinia pestis YPO3814 ftsY; cell
                     division protein (93.2% evalue=0); Escherichia coli JW3429
                     ftsY; signal recognition particle (ffh and ffs) receptor
                     (60.9% evalue=1.E-167)"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein"
                     /protein_id="YP_068767.1"
                     /db_xref="GI:51594576"
                     /db_xref="GeneID:2955662"
                     /translation="MAKEKKRGFFSWLGLGRQSEEPAAEPLATEKEGVTEQEDVIEQT
                     GVIEPTDVIEQTVEHVISEKTTEAPAENAFIEVELREQVAAVIPTEPNNAIMSEGVPD
                     TLPERAVAESVVAELVETGDNAAIVHDEIIEPITQVTEAGGELSLVKPGIEGDTTEQG
                     GPTDNLPKRSLTEDNLIIDVPTPQAVVEESRVDAVEQPTETSEVEEVEEVEEVEEVEE
                     VEEVEEVEEVEEVEEVEEVEEVEEVEEVEEVEEVEEKIIPVAAQEQERPTKEGFFARL
                     KRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTEHAS
                     RKQLKDADALYGKLKEEMSEILSKVDKPLDVSGKSPYVILMVGVNGVGKTTTIGKLAR
                     QFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA
                     RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQA
                     KLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEFI
                     EALFARED"
     misc_feature    264048..264983
                     /gene="ftsY"
                     /locus_tag="YPTB0221"
                     /note="signal recognition particle-docking protein FtsY;
                     Provisional; Region: PRK10416"
                     /db_xref="CDD:236686"
     misc_feature    264087..264317
                     /gene="ftsY"
                     /locus_tag="YPTB0221"
                     /note="SRP54-type protein, helical bundle domain; Region:
                     SRP54_N; pfam02881"
                     /db_xref="CDD:251589"
     misc_feature    264372..264908
                     /gene="ftsY"
                     /locus_tag="YPTB0221"
                     /note="The signal recognition particle (SRP) mediates the
                     transport to or across the plasma membrane in bacteria and
                     the endoplasmic reticulum in eukaryotes. SRP recognizes
                     N-terminal sighnal sequences of newly synthesized
                     polypeptides at the ribosome. The...; Region: SRP;
                     cd03115"
                     /db_xref="CDD:239389"
     misc_feature    264390..264413
                     /gene="ftsY"
                     /locus_tag="YPTB0221"
                     /note="P loop; other site"
                     /db_xref="CDD:239389"
     misc_feature    order(264480..264482,264645..264647,264828..264830,
                     264837..264842)
                     /gene="ftsY"
                     /locus_tag="YPTB0221"
                     /note="GTP binding site [chemical binding]; other site"
                     /db_xref="CDD:239389"
     gene            264992..265660
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /db_xref="GeneID:2955652"
     CDS             264992..265660
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /note="ATP-binding protein of an ATP-binding cassette
                     transporter; when bound to FtsX, FtsEX localizes to the
                     cell division site and plays a role in the assembly or
                     stability of the septal ring under low-salt growth
                     conditions"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsE"
                     /protein_id="YP_068768.1"
                     /db_xref="GI:51594577"
                     /db_xref="GeneID:2955652"
                     /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTL
                     LKLICGIERPSAGHIWFGGHDISRLKNREVPFLRRQIGMIFQDHHLLLDRTVYDNVAM
                     PLIIAGASTEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLL
                     ADEPTGNLDDALSEGILRLFEEFNRVGVTVLMATHDTSLIARRRYPILTLSQGRMSGA
                     HHGE"
     misc_feature    264992..265657
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /note="cell division protein FtsE; Provisional; Region:
                     PRK10908"
                     /db_xref="CDD:182829"
     misc_feature    264995..265636
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    265094..265117
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(265103..265108,265112..265120,265247..265249,
                     265475..265480,265574..265576)
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    265238..265249
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    265403..265432
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    265463..265480
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    265487..265498
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    265562..265582
                     /gene="ftsE"
                     /locus_tag="YPTB0222"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            265650..266603
                     /gene="ftsX"
                     /locus_tag="YPTB0223"
                     /gene_synonym="ftsS"
                     /db_xref="GeneID:2955661"
     CDS             265650..266603
                     /gene="ftsX"
                     /locus_tag="YPTB0223"
                     /gene_synonym="ftsS"
                     /note="ABC transporter, membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsX"
                     /protein_id="YP_068769.1"
                     /db_xref="GI:51594578"
                     /db_xref="GeneID:2955661"
                     /translation="MANNARKAKTKALKGGWREQWRYSWVNAIADMMRQPMATLLTVM
                     VISISLTLPSVCYIVWKNVSQAAEQWYPTPQLTVYLDKALDDNAAENVVVTLKAEAGV
                     EKVNYLSREEAMGEFRNWSGFGGALDMLEENPLPAVAIITPKLNFQSAETLNTLRDRI
                     SQVEGVAEVRMDDSWFARLAALTGLVGQVAAMVGVLMVVAVFLVIGNSVRLSIFSRRD
                     TINVMKLLGATDGFILRPFLNGGAMLGFGGAVLSLILSEALVWQLGSVVKQVATVFGT
                     QFTLHGLSWDESLLLVLISAMIGWIAAWLATVQHLRRFTPQ"
     misc_feature    265680..266600
                     /gene="ftsX"
                     /locus_tag="YPTB0223"
                     /gene_synonym="ftsS"
                     /note="cell division ABC transporter subunit FtsX;
                     Provisional; Region: ftsX; PRK11026"
                     /db_xref="CDD:182910"
     misc_feature    265704..266600
                     /gene="ftsX"
                     /locus_tag="YPTB0223"
                     /gene_synonym="ftsS"
                     /note="putative protein insertion permease FtsX; Region:
                     ftsX; TIGR00439"
                     /db_xref="CDD:129531"
     misc_feature    join(265761..265829,266214..266282,266343..266411,
                     266514..266573)
                     /gene="ftsX"
                     /locus_tag="YPTB0223"
                     /gene_synonym="ftsS"
                     /note="4 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            266914..267771
                     /gene="rpoH"
                     /locus_tag="YPTB0224"
                     /gene_synonym="fam; hin; htpR"
                     /db_xref="GeneID:2956525"
     CDS             266914..267771
                     /gene="rpoH"
                     /locus_tag="YPTB0224"
                     /gene_synonym="fam; hin; htpR"
                     /note="binds with the catalytic core of RNA polymerase to
                     produce the holoenzyme; this sigma factor is responsible
                     for the expression of heat shock promoters"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-32"
                     /protein_id="YP_068770.1"
                     /db_xref="GI:51594579"
                     /db_xref="GeneID:2956525"
                     /translation="MTKEMQTLALVPQGSLEAYIRAANAYPMLTAEEERELAERLHYQ
                     GDLGAAKQLILSHLRFVAHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLV
                     SFAVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVELVAKE
                     LGVTSKDVREMESRMSAQDMTFDPSPDDEARDGQFMAPVLYLQDKTSDFADGIEEDNW
                     DSHAADKLSYALEGLDERSQHIIRARWLDDENKSTLQELADQYGVSAERVRQLEKNAM
                     KKLRMAIEA"
     misc_feature    266914..267768
                     /gene="rpoH"
                     /locus_tag="YPTB0224"
                     /gene_synonym="fam; hin; htpR"
                     /note="RNA polymerase factor sigma-32; Reviewed; Region:
                     PRK06596"
                     /db_xref="CDD:235838"
     misc_feature    267070..267282
                     /gene="rpoH"
                     /locus_tag="YPTB0224"
                     /gene_synonym="fam; hin; htpR"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    267598..267753
                     /gene="rpoH"
                     /locus_tag="YPTB0224"
                     /gene_synonym="fam; hin; htpR"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(267613..267615,267643..267645,267670..267675,
                     267703..267705,267709..267714,267718..267726,
                     267730..267735,267739..267741)
                     /gene="rpoH"
                     /locus_tag="YPTB0224"
                     /gene_synonym="fam; hin; htpR"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(267978..268370)
                     /locus_tag="YPTB0225"
                     /db_xref="GeneID:2953129"
     CDS             complement(267978..268370)
                     /locus_tag="YPTB0225"
                     /note="similar to Yersinia pestis YPO3809 yhhK;
                     acetyltransferase (99.2% evalue=4.E-72); Salmonella typhi
                     STY4247 yhhK; conserved hypothetical protein (45.3%
                     evalue=2.E-24)"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_068771.1"
                     /db_xref="GI:51594580"
                     /db_xref="GeneID:2953129"
                     /translation="MKLTIERLITLTHQDVIDLAKIWPNQQPAAWQQWITEGRPLFAA
                     RFNERLLGAVKVAVYDQQAELQDLCVREVTRRRGVGLYLIEETLRQLPEIKHWYLNGG
                     DLTAAERPQINSFMLACGFSHEAQGWRR"
     misc_feature    complement(267984..268367)
                     /locus_tag="YPTB0225"
                     /note="Acetyltransferase (GNAT) domain; Region: DUF3749;
                     pfam12568"
                     /db_xref="CDD:204966"
     gene            268792..269907
                     /gene="livK"
                     /locus_tag="YPTB0226"
                     /gene_synonym="livJ"
                     /db_xref="GeneID:2955954"
     CDS             268792..269907
                     /gene="livK"
                     /locus_tag="YPTB0226"
                     /gene_synonym="livJ"
                     /note="similar to Yersinia pestis YPO3808 livK, livJ;
                     branched-chain amino acid-binding protein (99.4%
                     evalue=0); Escherichia coli Z4829 livK; high-affinity
                     leucine-specific transport system; periplasmic binding
                     protein (75.3% evalue=1.E-165)"
                     /codon_start=1
                     /transl_table=11
                     /product="branched chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="YP_068772.1"
                     /db_xref="GI:51594581"
                     /db_xref="GeneID:2955954"
                     /translation="MKLTKGKALLAGCMAMAMSHSVLAQDIKVAIVGAMSGPVAQYGD
                     MQFTGARQAIADINASGGIKGDKLVGVEYDDACDPKQAVAVANKVINDGIRYVIGHLC
                     SSSTQPASDIYEDEGVIMITPAATNADLTTRGYKMIMRTTGLDSDQGPTAAKYIVETI
                     KPKRIAVVHDKQQYGEGLARSVRDSLKEQGAEVVLFEGVTAGDKDFSTLVARLKKENV
                     DFVYFGGYYPEMGQILRQAKQAGLTARFMGPEGVGNSSLSNIAGEASEGMLVTLPKRY
                     DQVPANQPIVDALKAKKLDPTGPFVWTTYAALQSLTTAMERTGSKEPADLANDLKTGK
                     PVETVMGPLSWDDKGDLKGFEFGIFEWHAAGSSTAVK"
     misc_feature    268873..269874
                     /gene="livK"
                     /locus_tag="YPTB0226"
                     /gene_synonym="livJ"
                     /note="Type I periplasmic ligand-binding domain of ABC
                     (Atpase Binding Cassette)-type active transport systems
                     that are involved in the transport of all three branched
                     chain aliphatic amino acids (leucine, isoleucine and
                     valine); Region: PBP1_ABC_LIVBP_like; cd06342"
                     /db_xref="CDD:107337"
     misc_feature    order(268894..268896,268921..268923,268933..268935,
                     268942..268944,269494..269496,269557..269559,
                     269566..269568,269575..269580,269668..269670)
                     /gene="livK"
                     /locus_tag="YPTB0226"
                     /gene_synonym="livJ"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107337"
     misc_feature    268924..269877
                     /gene="livK"
                     /locus_tag="YPTB0226"
                     /gene_synonym="livJ"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     misc_feature    order(269092..269100,269161..269166,269311..269313,
                     269467..269469,269539..269541)
                     /gene="livK"
                     /locus_tag="YPTB0226"
                     /gene_synonym="livJ"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107337"
     gene            270088..271014
                     /gene="livH"
                     /locus_tag="YPTB0227"
                     /db_xref="GeneID:2955953"
     CDS             270088..271014
                     /gene="livH"
                     /locus_tag="YPTB0227"
                     /note="LivHMGF is the membrane component of the LIV-I/LS
                     branched-chain amino acid transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transporter permease
                     subunit LivH"
                     /protein_id="YP_068773.1"
                     /db_xref="GI:51594582"
                     /db_xref="GeneID:2955953"
                     /translation="MSEQFLYFLQQMFNGITLGSTYALIAIGYTMVYGIIGMINFAHG
                     EVYMISSYVSFIVIAALMMVGIDASWLLIGCAFLVSIVIASTYGWSIERVAYKPVRRS
                     KRLIALISAIGMSIFLQNYVSLTQGSRDLALPSLVTGQWTLGESNGFAATISTMQLTI
                     WIVTFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGINTDRVISLTFVIGALMAAV
                     AGVLLGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLVLGVAEALTSAYLS
                     TEYKDAVSFALLIVVLLVMPTGILGRPEVEKV"
     misc_feature    270130..270987
                     /gene="livH"
                     /locus_tag="YPTB0227"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    270661..270717
                     /gene="livH"
                     /locus_tag="YPTB0227"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     misc_feature    join(270130..270198,270217..270285,270295..270363,
                     270400..270468,270544..270612,270706..270774,
                     270817..270885,270931..270990)
                     /gene="livH"
                     /locus_tag="YPTB0227"
                     /note="8 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            271011..272297
                     /gene="livM"
                     /locus_tag="YPTB0228"
                     /db_xref="GeneID:2955955"
     CDS             271011..272297
                     /gene="livM"
                     /locus_tag="YPTB0228"
                     /note="Part of the ABC transporter complex LivFGHMJ and
                     LivFGHMK involved in the high-affinity transport of
                     branched-chain amino acids; LivFGHMK is specific for the
                     transport of leucine, while LivFGHMJ is a transporter for
                     leucine, isoleucine, and valine"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine transporter permease
                     subunit"
                     /protein_id="YP_068774.1"
                     /db_xref="GI:51594583"
                     /db_xref="GeneID:2955955"
                     /translation="MKQLNFVNAIISSFVLLVLASFVMGLQLQLDGTRLVVQGASEVR
                     WLWIGAGCLVVFCFQLVRPLIQQGIKKVSGPAWVLPSFDGTTPRQKLLAAVVIIAAVA
                     WPFLVSRGSVDIATLTLIYVMLGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLNHYY
                     GLGFWESLPLAGITAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGG
                     PNGISQIPKPTLFGLEFSRTAKDGGWDTFHNFFGLTYDPSHRIIFLYLVALLLVILTL
                     FVINRLLRMPLGRAWEALREDEIACRSLGLSPTKIKLTAFTISAAFAGFAGTLFAARQ
                     GFVSPESFTFVESAFVLAIVVLGGMGSQFAVILAAVLLVVSRELMRDLNAYSMLLLGA
                     LMVLMMIWRPQGLLPMKRPQLKLKVADVKAKQGEQA"
     misc_feature    271011..272258
                     /gene="livM"
                     /locus_tag="YPTB0228"
                     /note="leucine/isoleucine/valine transporter permease
                     subunit; Provisional; Region: livM; PRK11301"
                     /db_xref="CDD:236896"
     misc_feature    271014..271286
                     /gene="livM"
                     /locus_tag="YPTB0228"
                     /note="Domain of unknown function (DUF3382); Region:
                     DUF3382; pfam11862"
                     /db_xref="CDD:256682"
     misc_feature    271365..272231
                     /gene="livM"
                     /locus_tag="YPTB0228"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    271905..271961
                     /gene="livM"
                     /locus_tag="YPTB0228"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     misc_feature    join(271029..271094,271137..271205,271281..271340,
                     271350..271418,271422..271490,271500..271568,
                     271587..271640,271791..271859,271953..272021,
                     272064..272132,272151..272210)
                     /gene="livM"
                     /locus_tag="YPTB0228"
                     /note="11 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            272294..273061
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /db_xref="GeneID:2955952"
     CDS             272294..273061
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /note="Part of the ABC transporter complexes LivFGHMJ and
                     LivFGHMK involved in the high-affinity transport of
                     branched-chain amino acids; LivFGHMK is specific for the
                     transport of leucine, while LivFGHMJ is a transporter for
                     leucine, isoleucine, and valine"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine transporter
                     ATP-binding subunit"
                     /protein_id="YP_068775.1"
                     /db_xref="GI:51594584"
                     /db_xref="GeneID:2955952"
                     /translation="MNGQPLLTVEGLSMRFGGLLAVNNVGLTLNQGEIVSLIGPNGAG
                     KTTIFNCLTGFYRPTGGTIKLRERHLEGLPGQMIARMGVIRTFQHVRLFREMTVIENL
                     LVAQHQHLKSGIFAGLLKTPGFRRAEADALARAATWLERVGLLALANRQAGNLAYGQQ
                     RRLEIARCMVTRPELLMLDEPAAGLNPKETDELNQLIMELRDQHQVSVLLIEHDMKLV
                     MGISDRIYVVNQGTPLAQGIPAEIRNNPDVIRAYLGE"
     misc_feature    272303..273058
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /note="leucine/isoleucine/valine transporter ATP-binding
                     subunit; Provisional; Region: livG; PRK11300"
                     /db_xref="CDD:183080"
     misc_feature    272312..273037
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    272408..272431
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    order(272417..272422,272426..272434,272555..272557,
                     272828..272833,272930..272932)
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    272546..272557
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    272756..272785
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    272816..272833
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    272840..272851
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    272918..272938
                     /gene="livG"
                     /locus_tag="YPTB0229"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            273106..273807
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /db_xref="GeneID:2955951"
     CDS             273106..273807
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /note="with LivGHMJ and LivGHMK is part of the
                     high-affinity branched-chain amino acid transport system;
                     LivFGHMK is specific for the transport of leucine, while
                     LivFGHMJ is a transporter for leucine, isoleucine, and
                     valine"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine transporter
                     ATP-binding subunit"
                     /protein_id="YP_068776.1"
                     /db_xref="GI:51594585"
                     /db_xref="GeneID:2955951"
                     /translation="MLSFNQVSAHYGKIQALHQVSLHIQQGEIVTLIGANGAGKTTLL
                     GTLCGEPRATEGNIVFGEQDITHWQTARIMREAIAIVPEGRRVFSRMTVEENLAMGGF
                     FADRQQYQQRIERVYDLFPRLFERRIQRAGTMSGGEQQMLAIGRALMSQPKLLLLDEP
                     SLGLAPIIILQIFDTIQQLREEGMTIFLVEQNANQALKLADRGYVLENGRIVLEDTGA
                     ALLANEAVRSAYLGG"
     misc_feature    273106..273804
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /note="leucine/isoleucine/valine transporter ATP-binding
                     subunit; Provisional; Region: livF; PRK11614"
                     /db_xref="CDD:183231"
     misc_feature    273109..273774
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    273205..273228
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    order(273214..273219,273223..273231,273352..273354,
                     273577..273582,273676..273678)
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    273343..273354
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    273505..273534
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    273565..273582
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    273589..273600
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    273664..273684
                     /gene="livF"
                     /locus_tag="YPTB0230"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            274035..274496
                     /locus_tag="YPTB0231"
                     /db_xref="GeneID:2953130"
     CDS             274035..274496
                     /locus_tag="YPTB0231"
                     /note="similar to Yersinia pestis YPO3803 hypothetical
                     protein (86.2% evalue=7.E-72)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068777.1"
                     /db_xref="GI:51594586"
                     /db_xref="GeneID:2953130"
                     /translation="MIGGTSNTMDLHGLSAVCSFAFLTADLMLNITNKNGDNHEYKVT
                     SSHVNNDKLQGPKGILKATKNHAELNNKNIASGEKNAIKFDQLHVREIPNREQASYID
                     NLSLNRNIYLDTRADRECRIPTQVISPVQKVDSGTKEPSWFSKYLCITTLY"
     gene            complement(274611..275717)
                     /locus_tag="YPTB0232"
                     /db_xref="GeneID:2953131"
     CDS             complement(274611..275717)
                     /locus_tag="YPTB0232"
                     /note="similar to Yersinia pestis YPO3802  exported
                     protein (81.2% evalue=1.E-177)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068778.1"
                     /db_xref="GI:51594587"
                     /db_xref="GeneID:2953131"
                     /translation="MNIKNKSLFIGLLLLFLQPTTAVANKWAGIYFYPLASKYSNCKM
                     TLSEDNHLTVSFDVTLADHLFDISNSDHLQRWQELTRSQQHIMLAQNKALLYLYFYRA
                     DGSIDFSLQSGEVQDMSLNGVPAQHISNYIREAIFVSTPAFSNQSYHVSFSLAVSTLK
                     HIRMGATIGGVLHSEGQQYSVRSPNGVAFNQSGNQCEFFDPTTEIAPAHALYIEPKFR
                     LGSAIWQLKSLDLDHLLDSTADNHGLHAPLVNAPANRFCIHYSSVGIQNRRYMISASN
                     LNGLAESSRYFQLKDNQGEHIINYKVTLKNHEDSEADFSLPKEKKFVQLKSDTSSGGE
                     AQMCWSPRIRVYSTDTTDKGHYTDTLNFTITPLA"
     misc_feature    complement(275631..275696)
                     /locus_tag="YPTB0232"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(275942..276460)
                     /locus_tag="YPTB0233"
                     /db_xref="GeneID:2953132"
     CDS             complement(275942..276460)
                     /locus_tag="YPTB0233"
                     /note="similar to Yersinia pestis YPO3801  exported
                     protein (99.4% evalue=3.E-96)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068779.1"
                     /db_xref="GI:51594588"
                     /db_xref="GeneID:2953132"
                     /translation="MNTIKMAITLLLLSWHTCWAATPLGDIDVKLEVTAQPRIEIEKP
                     HGGWYDNIKLHNSPENHAVYEVEVPVAVKLRRQEGYQISIKNPLILTRQSDAFSAIEQ
                     TFSPAEVRWGNNRTNLRLLSAVPESFSVPPQATRHTTTDYVLHISAKAPAGDNTAGKY
                     HGQLTLVFEVNS"
     gene            complement(276522..277169)
                     /locus_tag="YPTB0234"
                     /db_xref="GeneID:2953133"
     CDS             complement(276522..277169)
                     /locus_tag="YPTB0234"
                     /note="similar to Yersinia pestis YPO3800  exported
                     protein (96.7% evalue=1.E-117)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068780.1"
                     /db_xref="GI:51594589"
                     /db_xref="GeneID:2953133"
                     /translation="MKNLVFAAISLLPLSAAGVIDIQPQVVELQQENTVVTVINHGMT
                     AEYITVQLYRLNNPGVAPELESLTPVGYQQQPLLFATPLKLTLGPRQSGKIFLHALGA
                     PEQEQVYRLAVVPGNHLKISGNNTAVVGVQISYMGLIRHLPASIQHQWTHRCIAGKPE
                     LHNTGNTRLYWHQLQAQGQMIDDFTLYPGQHRQLAFNELQGKVEDQAVSLQCPSG"
     misc_feature    complement(276588..277157)
                     /locus_tag="YPTB0234"
                     /note="putative fimbrial protein TcfA; Provisional;
                     Region: PRK15308"
                     /db_xref="CDD:237939"
     gene            complement(277141..277827)
                     /locus_tag="YPTB0235"
                     /db_xref="GeneID:2953134"
     CDS             complement(277141..277827)
                     /locus_tag="YPTB0235"
                     /note="similar to Yersinia pestis YPO3800  exported
                     protein (35.5% evalue=3.E-22)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068781.1"
                     /db_xref="GI:51594590"
                     /db_xref="GeneID:2953134"
                     /translation="MKYLYSILSIALLLAPGTATYGQLLATPTRIAVEAQEQKRTVQV
                     YNSGDTPLYLDITLQRVDNPGVNPERKTPISEISQPEMIFNPNRITLGPRQKRDITLI
                     PLKSPVQETLYRLYINPVLNIKAVGDGEDKSKVHAPMTISIGYGVLIHHLPPAAAQTR
                     HWQHQCSATGELALTATGTVHSKFKQLESGGNPALADSLNLYPGTALTLPVKQLNGEV
                     DGEKFSLRCH"
     misc_feature    complement(277192..277827)
                     /locus_tag="YPTB0235"
                     /note="P pilus assembly protein, chaperone PapD [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: FimC; COG3121"
                     /db_xref="CDD:225663"
     misc_feature    complement(277198..277809)
                     /locus_tag="YPTB0235"
                     /note="putative fimbrial protein TcfA; Provisional;
                     Region: PRK15308"
                     /db_xref="CDD:237939"
     gene            complement(277845..280178)
                     /locus_tag="YPTB0236"
                     /db_xref="GeneID:2953135"
     CDS             complement(277845..280178)
                     /locus_tag="YPTB0236"
                     /note="similar to Yersinia pestis YPO3798  exported
                     protein (99.2% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068782.1"
                     /db_xref="GI:51594591"
                     /db_xref="GeneID:2953135"
                     /translation="MAYYSKINHSLLFTLALFTLKLAHAEAVKIEYLVPMGFSAAEEN
                     NSLQLLGVLDSKTLPSPITFSEEKQQLQFNQQNDRHNNISEESIILLGKILSQIPYLQ
                     CKTGCDYTLSGHRVALDKVNNTLTITNNNNRYLMPTTTWGLVSNQSLDLRMTAAHYRA
                     MSVRGQSYIGLPWQSYGFASWFYNAIQSQNTLQSQNTMPSQSTYQPVNRPQYQRLTQK
                     GIGSWYLQKNFSALYLRTGRQNNLDNNAGSVHTLINPALDQFVTLGSQSYLAIDKPST
                     GSIVLYAAQDGDYEIYRDNQLIRRIPAQLGRNEIDYSQLPGGYYNVEIRLVDRLGRIV
                     SQENQTISNIGNQTNNGWFLTMGKGPAKGKKTPRLVQFGRSRVIESVQTNITLLKDDA
                     HHWAVEANVSRPLSLNKVNITPTGGLMSGEKRSGGYVRLNGGNNTLGYFSLARYQSPY
                     VSRYAPDSGSTSGSYTRRIGPTQLSYQFNQYRNNRQHRIQSGWDWQLPQFNLALSLGL
                     QNGGQWNSHNNYGVFLNTTLSFGQSNASINTAYTQQQLNTSASYQKEFIDNYGASTLG
                     VSGSASGKLNSVGGFAKRSGSRGDISGRVGIDNQITNGGISYNGMLALSSQGVALGRS
                     SYSGAALLIKAPALGGTPYSFHVEDSPITGGGIYAIPVPRYQDRFFVRTHTDRSDMDM
                     NIQLPVNIVRAHPGQVFSGKADITLNLLYSGFLKNAQGLPVSGVIEETGDTAYPNGLF
                     SINAQNRLQAITVQGPSGRYRCDMHSQPTHIYLCHAD"
     misc_feature    complement(278253..>278828)
                     /locus_tag="YPTB0236"
                     /note="Outer membrane usher protein; Region: Usher;
                     pfam00577"
                     /db_xref="CDD:249973"
     gene            complement(280445..280936)
                     /locus_tag="YPTB0237"
                     /db_xref="GeneID:2953136"
     CDS             complement(280445..280936)
                     /locus_tag="YPTB0237"
                     /note="similar to Yersinia pestis YPO3797  exported
                     protein (100% evalue=5.E-85)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068783.1"
                     /db_xref="GI:51594592"
                     /db_xref="GeneID:2953136"
                     /translation="MMKKTVIAIITMATLTSTAAYANTIEKDIRVEAEIISLMDVKRA
                     DDSNINKIKLTYDTVTNDGTYSHSEAIKVKARKQLGDKLKVSLAAPVILSEPNNNKEF
                     THVEVLLDGKKLLETADTRDLIAFHGSELNAELKVSAKEPNNAVGGEKYSGVIQLRLE
                     PSA"
     gene            281491..282810
                     /gene="ugpB"
                     /locus_tag="YPTB0238"
                     /db_xref="GeneID:2956860"
     CDS             281491..282810
                     /gene="ugpB"
                     /locus_tag="YPTB0238"
                     /note="with UgpACE is involved in the uptake of
                     glycerol-3-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter periplasmic
                     binding protein"
                     /protein_id="YP_068784.1"
                     /db_xref="GI:51594593"
                     /db_xref="GeneID:2956860"
                     /translation="MFNNSIHKVSICIALTLTFSANAMAVTEIPFWHSMEGELGKEVD
                     SIADRFNQSQPDYKIVPVYKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKA
                     IKPVYQVFKDANIDFDESVFVPTVAGYYTDSKTGRLLSQPFNSSTPVLYYNKEAFKKA
                     GLDPEQPPKTWQELAADTAKLRAAGSSCGYASGWQGWIQIENFSAWHGQPIASRNNGF
                     DGTDAVLEFNKPLQIKHIQLLSDMNKKGDFTYFGRKDESTSKFYNGDCAITTASSGSL
                     ASIRHYAKFNFGVGMMPYDADAKNAPQNAIIGGASLWVMDGKDKETYKGVAEFLQYLV
                     KPEIAAEWHQKTGYLPITTAAYELTKQQGFYEQNPGADVATRQMLNKPPLPYTKGLRL
                     GNMPQIRTVVDEELEAVWTGKKTPQAALDNSVKRGDVLLRRFEQANK"
     misc_feature    281491..282792
                     /gene="ugpB"
                     /locus_tag="YPTB0238"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    281494..282807
                     /gene="ugpB"
                     /locus_tag="YPTB0238"
                     /note="glycerol-3-phosphate transporter periplasmic
                     binding protein; Provisional; Region: PRK10974"
                     /db_xref="CDD:182876"
     gene            283108..283992
                     /gene="ugpA"
                     /locus_tag="YPTB0239"
                     /db_xref="GeneID:2956859"
     CDS             283108..283992
                     /gene="ugpA"
                     /locus_tag="YPTB0239"
                     /note="with UgpEC is involved in the uptake of
                     glycerol-3-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter permease"
                     /protein_id="YP_068785.1"
                     /db_xref="GI:51594594"
                     /db_xref="GeneID:2956859"
                     /translation="MSPSRPGFSCSWLPYLLVLPQLAITAIFFLWPAGEALWYSVQTL
                     DPFGLSSEFVGLSNFIQLFQDEYYLASFYTTLIFSALVAGIGLNVSLFLAAMVDYVLR
                     GSRLYQTLLILPYAVAPAVAAVLWIFLFDPGLGLITHALAKLGYSWNHAQNSGQAMFL
                     VVLASVWKQISYNFLFFLAALQSIPKSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFL
                     LVVNLVYAFFDTFPVIDAATGGGPVQATTTLIYKIYREGFAGLDLSSSAAQSVILMLL
                     VIGLTVIQFRFVERKVRY"
     misc_feature    283141..283980
                     /gene="ugpA"
                     /locus_tag="YPTB0239"
                     /note="2-aminoethylphosphonate transport system permease
                     PhnU; Provisional; Region: PRK15050"
                     /db_xref="CDD:237888"
     misc_feature    283321..283941
                     /gene="ugpA"
                     /locus_tag="YPTB0239"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(283369..283374,283381..283386,283396..283398,
                     283426..283437,283441..283470,283477..283482,
                     283486..283488,283603..283608,283615..283617,
                     283621..283623,283630..283635,283639..283641,
                     283651..283656,283663..283665,283714..283716,
                     283756..283761,283768..283770,283789..283800,
                     283816..283821,283858..283863,283891..283896,
                     283903..283908,283912..283917,283924..283929,
                     283936..283941)
                     /gene="ugpA"
                     /locus_tag="YPTB0239"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(283444..283488,283789..283806)
                     /gene="ugpA"
                     /locus_tag="YPTB0239"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(283486..283488,283588..283590,283816..283818,
                     283852..283854,283861..283863,283891..283893)
                     /gene="ugpA"
                     /locus_tag="YPTB0239"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(283666..283704,283720..283725,283735..283737)
                     /gene="ugpA"
                     /locus_tag="YPTB0239"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    join(283141..283209,283321..283389,283426..283494,
                     283576..283644,283723..283791,283903..283971)
                     /gene="ugpA"
                     /locus_tag="YPTB0239"
                     /note="6 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            283992..284837
                     /gene="ugpE"
                     /locus_tag="YPTB0240"
                     /db_xref="GeneID:2956862"
     CDS             283992..284837
                     /gene="ugpE"
                     /locus_tag="YPTB0240"
                     /note="with UgpABC is involved in uptake of
                     glycerol-3-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter membrane
                     protein"
                     /protein_id="YP_068786.1"
                     /db_xref="GI:51594595"
                     /db_xref="GeneID:2956862"
                     /translation="MIENRRGLDIFCHIMLIIGVLLILFPLYVAFVAASLDDSQVFQA
                     PMTLIPGPHLWQNISHIWHAGVGNNSTPFGLMLLNSFVMAFAITVGKITVSILSAYAI
                     VYFRFPLRNLFFWLIFLTLMLPVEVRIFPTIEVIANLNLLDSYTGLTLPLMASATATF
                     LFRQFFMTLPDELLEAARIDGAGAMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWP
                     ILITSDASMGTAVAGIRSMISTSGAPTQWNQVMAAMILTLIPPVVVVLLMQRWFVRGL
                     VDSEK"
     misc_feature    284004..284822
                     /gene="ugpE"
                     /locus_tag="YPTB0240"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    284220..284768
                     /gene="ugpE"
                     /locus_tag="YPTB0240"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(284268..284273,284280..284285,284298..284300,
                     284328..284339,284343..284372,284379..284384,
                     284388..284390,284445..284450,284454..284456,
                     284460..284462,284469..284474,284478..284480,
                     284490..284495,284502..284504,284553..284555,
                     284595..284600,284607..284609,284628..284639,
                     284646..284651,284697..284702,284730..284735,
                     284742..284747,284751..284756,284763..284768)
                     /gene="ugpE"
                     /locus_tag="YPTB0240"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(284346..284390,284628..284645)
                     /gene="ugpE"
                     /locus_tag="YPTB0240"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(284388..284390,284646..284648,284691..284693,
                     284700..284702,284730..284732)
                     /gene="ugpE"
                     /locus_tag="YPTB0240"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(284505..284543,284559..284564,284574..284576)
                     /gene="ugpE"
                     /locus_tag="YPTB0240"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    join(284025..284093,284235..284303,284322..284381,
                     284424..284492,284553..284621,284634..284702,
                     284739..284807)
                     /gene="ugpE"
                     /locus_tag="YPTB0240"
                     /note="7 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            284844..285917
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /db_xref="GeneID:2956861"
     CDS             284844..285917
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="part of the UgpABCE glycerol-3-phosphate uptake
                     system"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter ATP-binding
                     subunit"
                     /protein_id="YP_068787.1"
                     /db_xref="GI:51594596"
                     /db_xref="GeneID:2956861"
                     /translation="MACLKLQAVTKSYDGVTPVIKQIDLDVADGEFIVMVGPSGCGKS
                     TLLRMVAGLERTTTGDIYIGDQRVTDLEPKDRGIAMVFQNYALYPHMNVFDNMAYGLK
                     IRGFGKEQIRQRVDEAARILELQPLLKRKPRELSGGQRQRVAMGRAIVREPAVFLFDE
                     PLSNLDAKLRVQMRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVIVMNKGVAEQIGT
                     PSEVYKRPASLFVASFIGSPAMNLLDGTVSPDGRTFILSDGLTLPLEIPQPQWGGRRL
                     TLGIRPEHIQQTTSAQGVPMNLLTLELLGADNLAHGLWGGQSIIARLSHEEMPVAGST
                     LHLYLPPAALHFFDTDSGLRIEP"
     misc_feature    284844..285911
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="glycerol-3-phosphate transporter ATP-binding
                     subunit; Provisional; Region: ugpC; PRK11650"
                     /db_xref="CDD:236947"
     misc_feature    284853..285494
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    284952..284975
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(284961..284966,284970..284978,285090..285092,
                     285318..285323,285420..285422)
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    285081..285092
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    285246..285275
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    285306..285323
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    285330..285341
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    285408..285428
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    285675..285884
                     /gene="ugpC"
                     /locus_tag="YPTB0241"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            285914..286663
                     /gene="ugpQ"
                     /locus_tag="YPTB0242"
                     /db_xref="GeneID:2956863"
     CDS             285914..286663
                     /gene="ugpQ"
                     /locus_tag="YPTB0242"
                     /EC_number="3.1.4.46"
                     /note="hydrolyzes diesters during transport at the inner
                     face of the cytoplasmic membrane to glycerol-3-phosphate
                     and alcohol; induced when cells are starved for inorganic
                     phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="YP_068788.1"
                     /db_xref="GI:51594597"
                     /db_xref="GeneID:2956863"
                     /translation="MNRDWPYPPIVAHRGGGSLAPENTLAAIDVGARYGHKMIEFDAK
                     LSQDGQIFLLHDDTLERTSNGWGVAGELAWEKLIQLDAGDWFSKAFRGERLPLLSEVA
                     ARCAQHGMAANIEIKPTTGTDAPTGRAIALAARALWQGQPIPPLLSSFSVDALAAAQL
                     AAPELPRGLLLDKWDDNWAALTTQLDCVSLHINHKQLTAERVALLKAAGLRILVYTVN
                     QPERARELLNWGVDCICTDRIDLLGSDFTGC"
     misc_feature    285914..286660
                     /gene="ugpQ"
                     /locus_tag="YPTB0242"
                     /note="cytoplasmic glycerophosphodiester
                     phosphodiesterase; Provisional; Region: ugpQ; PRK09454"
                     /db_xref="CDD:236524"
     misc_feature    285941..286630
                     /gene="ugpQ"
                     /locus_tag="YPTB0242"
                     /note="Glycerophosphodiester phosphodiesterase domain in
                     Escherichia coli cytosolic glycerophosphodiester
                     phosphodiesterase UgpQ and similar proteins; Region:
                     GDPD_EcUgpQ_like; cd08562"
                     /db_xref="CDD:176505"
     misc_feature    order(285950..285952,286031..286033,286037..286039,
                     286076..286078,286256..286258,286355..286357,
                     286556..286558)
                     /gene="ugpQ"
                     /locus_tag="YPTB0242"
                     /note="putative active site [active]"
                     /db_xref="CDD:176505"
     misc_feature    order(285950..285952,286076..286078)
                     /gene="ugpQ"
                     /locus_tag="YPTB0242"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176505"
     misc_feature    order(286031..286033,286037..286039,286256..286258)
                     /gene="ugpQ"
                     /locus_tag="YPTB0242"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176505"
     gene            286764..287720
                     /locus_tag="YPTB0243"
                     /db_xref="GeneID:2953137"
     CDS             286764..287720
                     /locus_tag="YPTB0243"
                     /note="similar to Yersinia pestis YPO3791  membrane
                     protein (99.6% evalue=1.E-165); Agrobacterium tumefaciens
                     AGR_C_121 MdcF (27.6% evalue=1.E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="malonate permease"
                     /protein_id="YP_068789.1"
                     /db_xref="GI:51594598"
                     /db_xref="GeneID:2953137"
                     /translation="MPAFVVSLWHQIVLSSPLFVLLALGYALVRFGKWPSTITDGLTR
                     FVFSLALPAMLFRMMCDFSERPAVDARLLIAFFGSCLVVFIIGRVIAKRVFHLDGVSG
                     SVFALGGIFSNNVMLGLPIATIMLGEKSIPAVALVLVFNGLILWTLVTISVEWARNGS
                     PTMAGFVKTTRSVLTNPLIIGIISGTLFSLTGLHLPVFIDQPVSMLGQVAPPLSLIVL
                     GMGLAEYRVTEGWQISTAICFLKLIVQPMVIWALAWAMDLPALETQVVVLLGSMATGV
                     NVYLMSRQFNVLTGPAAASLVMSTVLAAVTTPLILTIIGVGI"
     misc_feature    286782..287708
                     /locus_tag="YPTB0243"
                     /note="Predicted permeases [General function prediction
                     only]; Region: COG0679"
                     /db_xref="CDD:223751"
     misc_feature    join(286791..286850,286887..286940,286977..287036,
                     287073..287141,287154..287222,287280..287348,
                     287376..287444,287463..287531,287541..287609,
                     287646..287714)
                     /locus_tag="YPTB0243"
                     /note="10 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            287857..288525
                     /locus_tag="YPTB0244"
                     /db_xref="GeneID:2953138"
     CDS             287857..288525
                     /locus_tag="YPTB0244"
                     /note="not present in pestis"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068790.1"
                     /db_xref="GI:51594599"
                     /db_xref="GeneID:2953138"
                     /translation="MNQVDVQKDISDLIVNAFPRALWLNIQDVFHAKYEAAQQVTMGS
                     ALKLDGPGQLRLRPQIRHYTLNAAFKEAALSCGVIHNSVETSPKGEHFVVLSSAGVKM
                     SRIGLNYDEPNIKGAKHRTLLAELNESLEGYTPDLFSERTIDHGPTGTLGVLILNINP
                     PYHEPQSRMLDLRVVVPFSNLKGFHFNWSLTQLLERYTGEQKIIIPDNVLPTLKRHLK
                     DQEN"
     gene            288538..289740
                     /locus_tag="YPTB0245"
                     /db_xref="GeneID:2953139"
     CDS             288538..289740
                     /locus_tag="YPTB0245"
                     /note="similar to Staphylococcus aureus_Mu50 SAV0141
                     hypothetical protein (25.8% evalue=1.E-26); Staphylococcus
                     aureus_N315 SA0142 hypothetical protein, similar to
                     DNA-binding protein (25.8% evalue=1.E-26)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068791.1"
                     /db_xref="GI:51594600"
                     /db_xref="GeneID:2953139"
                     /translation="MRVGISGFQPERLTQMREARGLSKINLGRLVERSPSTITKWENG
                     SHSPDAEGLASLGKVLNCPVSWFTKVAYERENNPVFFRTLSATAKDLCKSSEVYMGWL
                     QEISASLQEYLDYPNVNIPYLDVDDYRSIDDEAIERVASDCRKRWGLGIAPIQDLLLV
                     MENAGVVCSRFEQGSVMMDGYSQWNEKENRPYVVLASDKNNYFRSRFDAAHELGHLVL
                     HRYVKRLDSINFKPIEEQAHKFAACFMLPEEAFSAELPSFPSLENFVSLKSRWGMSAQ
                     SMILRARDLELISSIEYQRLYKSLSSRGWRKGEPLDDQRKPESVRLLPRCINLLLEST
                     IFSKHGFLEFVNLARGDVEDLCSLPKGFLAESAVLSFESKIQLKNSVKTLPEIDHRTN
                     VVDMFDRR"
     misc_feature    288568..288738
                     /locus_tag="YPTB0245"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(288577..288579,288589..288591,288664..288666)
                     /locus_tag="YPTB0245"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(288586..288588,288661..288663)
                     /locus_tag="YPTB0245"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(288607..288612,288643..288645,288652..288654,
                     288664..288669)
                     /locus_tag="YPTB0245"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    288955..289566
                     /locus_tag="YPTB0245"
                     /note="Predicted Zn peptidase [Amino acid transport and
                     metabolism]; Region: COG2856"
                     /db_xref="CDD:225412"
     gene            289947..290846
                     /gene="MadN"
                     /locus_tag="YPTB0246"
                     /db_xref="GeneID:2955982"
     CDS             289947..290846
                     /gene="MadN"
                     /locus_tag="YPTB0246"
                     /note="similar to Yersinia pestis YPO3790 yigM; membrane
                     protein (99.6% evalue=1.E-175); Escherichia coli JW3803
                     yigM; Hypothetical protein (73.7% evalue=1.E-129)"
                     /codon_start=1
                     /transl_table=11
                     /product="acetate efflux pump, MadN"
                     /protein_id="YP_068792.1"
                     /db_xref="GI:51594601"
                     /db_xref="GeneID:2955982"
                     /translation="MLLLVITTILWAFSFSLIGEYLAGQVDSWFSVLMRVGLAALVFL
                     PFLRWRNIPWRVILLYMAVGSIQLGIMYLFSFRAYLYLTVPEFLLFTVMTPLYVTLIY
                     DLLRRQRLRWGYALSALLAVLGAAIIRYDQLSEHFWWGLALVQAANICFAIGQVGYKR
                     LMEVHPIPQHVAFSWFYLGAFVVAVVAWFAFGNPQRLPTTGLQWGILVWLGVGASALG
                     YFMWNYGATQVDAGTLGIMNNVHVPAGLLVNLAIWQEKPHWPSFIIGAAVIMASLWVH
                     RRWIAPHPLQTANDRKRADEQNE"
     misc_feature    289971..290336
                     /gene="MadN"
                     /locus_tag="YPTB0246"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    289977..290765
                     /gene="MadN"
                     /locus_tag="YPTB0246"
                     /note="Carboxylate/Amino Acid/Amine Transporter; Region:
                     2A78; TIGR00950"
                     /db_xref="CDD:233205"
     misc_feature    290391..290771
                     /gene="MadN"
                     /locus_tag="YPTB0246"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    join(289950..290018,290028..290087,290100..290168,
                     290178..290246,290280..290339,290352..290420,
                     290454..290522,290550..290618,290637..290705,
                     290718..290771)
                     /gene="MadN"
                     /locus_tag="YPTB0246"
                     /note="10 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(290734..291687)
                     /gene="metR"
                     /locus_tag="YPTB0247"
                     /db_xref="GeneID:2956030"
     CDS             complement(290734..291687)
                     /gene="metR"
                     /locus_tag="YPTB0247"
                     /note="similar to Yersinia pestis YPO3789 metR;
                     lysR-family transcriptional regulatory protein (99.6%
                     evalue=0); Escherichia coli b3828 metR; transcriptional
                     activator protein metR (88.5% evalue=1.E-159)"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_068793.1"
                     /db_xref="GI:51594602"
                     /db_xref="GeneID:2956030"
                     /translation="MIELKHLRTLQALRNTGSLAAAATQLHQTQSALSHQFSDLEQRL
                     GFRLFVRKSQPLRFTTQGEILLQLAEQVLPQIKQALQTCNEPHQTALRIAIECHSCIQ
                     WLTPALDNFHKHWPQVTMDFKSGVTFDPQPALQQGELDLVLTSDILPRSGLHYSPMFD
                     FEVRLVLAPDHPLANKDRIEPEDLAPEVLMIYPVQRQRLDVWRHFLQPAGVSPSLKNV
                     DNTLLLIQMVSARMGIAALPHWVVESFERQGLVVTKTLGEGLWSRLYAAVRDGEQRQP
                     VTEAFIRSARQHACDHLPFVKDAVRSNAGVPTAKPLSPQLQ"
     misc_feature    complement(290737..291687)
                     /gene="metR"
                     /locus_tag="YPTB0247"
                     /note="DNA-binding transcriptional regulator MetR;
                     Provisional; Region: PRK15421"
                     /db_xref="CDD:185319"
     misc_feature    complement(291499..291678)
                     /gene="metR"
                     /locus_tag="YPTB0247"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(290833..291417)
                     /gene="metR"
                     /locus_tag="YPTB0247"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator metR, which regulates
                     the expression of methionine biosynthetic genes, contains
                     type 2 periplasmic binding fold; Region: PBP2_MetR;
                     cd08441"
                     /db_xref="CDD:176132"
     misc_feature    complement(order(290998..291003,291007..291012,
                     291028..291045,291316..291336,291340..291342,
                     291352..291354,291361..291366,291370..291375))
                     /gene="metR"
                     /locus_tag="YPTB0247"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176132"
     gene            291793..294069
                     /gene="metE"
                     /locus_tag="YPTB0248"
                     /db_xref="GeneID:2956023"
     CDS             291793..294069
                     /gene="metE"
                     /locus_tag="YPTB0248"
                     /EC_number="2.1.1.14"
                     /note="catalyzes the transfer of a methyl group from
                     5-methyltetrahydrofolate to homocysteine to form
                     methionine"
                     /codon_start=1
                     /transl_table=11
                     /product="5-
                     methyltetrahydropteroyltriglutamate/homocysteine
                     S-methyltransferase"
                     /protein_id="YP_068794.1"
                     /db_xref="GI:51594603"
                     /db_xref="GeneID:2956023"
                     /translation="MTILNHTLGFPRVGLKRELKKAQESYWAGNSTQEELLNVGRELR
                     ARHWQQQQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGSIDIDTLFRIGRG
                     RAPTGKPAAAAEMTKWFNTNYHYMVPEFQQGQQFKLGWTQLLDEVDEALALGHKIKPV
                     LLGPITYLWLGKVKGEQFDRLSLLNDILPVYQQVLAELAKRGIEWVQIDEPALVLELP
                     QEWLDAYQPAYQALQGQVKLLLTTYFDSIGHNIDTIRALPVQGLHVDVVAGHDDLAVL
                     NKNLPKEWLLSLGVINGRNVWRADLSSWFERLQPLVNSRPLWLGSSCSLLHSPIDLNE
                     ETRLDAEVKSWFAFALQKCAELALLTQALNAPNDAKLAELAAYSAPIRARRSSSRVHN
                     AQVEQRLAAITSQDIERQLPYEARAETQRKRFNLPAWPTTTIGSFPQTTEIRGLRLDF
                     KQGRLDGKNYRTGISEHIKQAIAEQERLGLDVLVHGEAERNDMVEYFGEHLDGFVFTQ
                     NGWVQSYGSRCVKPPVIIGDISRPEAITVEWAKYAQSLTEKPVKGMLTGPVTILCWSF
                     PREDVSRETIAKQIALALRDEVEDLEKAGIGIIQIDEPALREGLPLRRADWQAYLQWA
                     VDAFKLNAAVAQNDTQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELLESFED
                     FAYPNEIGPGVYDIHSPNVPSVEWIEALLRKAAQRIPAERLWVNPDCGLKTRGWPETR
                     QALANMVLAAQRLREEQI"
     misc_feature    291796..294060
                     /gene="metE"
                     /locus_tag="YPTB0248"
                     /note="5-methyltetrahydropteroyltriglutamate--homocysteine
                     S-methyltransferase; Provisional; Region: PRK05222"
                     /db_xref="CDD:235367"
     misc_feature    291802..292878
                     /gene="metE"
                     /locus_tag="YPTB0248"
                     /note="CIMS - Cobalamine-independent methonine synthase,
                     or MetE, N-terminal domain_like. Many members have been
                     characterized as
                     5-methyltetrahydropteroyltriglutamate-homocysteine
                     methyltransferases, EC:2.1.1.14, mostly from bacteria and
                     plants. This enzyme...; Region: CIMS_N_terminal_like;
                     cd03312"
                     /db_xref="CDD:239428"
     misc_feature    order(291841..291843,291850..291852,292141..292143,
                     292156..292158,292162..292164)
                     /gene="metE"
                     /locus_tag="YPTB0248"
                     /note="THF binding site; other site"
                     /db_xref="CDD:239428"
     misc_feature    293080..294045
                     /gene="metE"
                     /locus_tag="YPTB0248"
                     /note="CIMS - Cobalamine-independent methonine synthase,
                     or MetE, C-terminal domain_like. Many members have been
                     characterized as
                     5-methyltetrahydropteroyltriglutamate-homocysteine
                     methyltransferases, EC:2.1.1.14, mostly from bacteria and
                     plants. This enzyme...; Region: CIMS_C_terminal_like;
                     cd03311"
                     /db_xref="CDD:239427"
     misc_feature    order(293092..293100,293251..293253,293269..293271,
                     293590..293592,293596..293598,293722..293724,
                     293728..293730,293977..293982)
                     /gene="metE"
                     /locus_tag="YPTB0248"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239427"
     misc_feature    order(293344..293352,293482..293484,293602..293604)
                     /gene="metE"
                     /locus_tag="YPTB0248"
                     /note="THF binding site; other site"
                     /db_xref="CDD:239427"
     misc_feature    order(293722..293724,293728..293730,293794..293796,
                     293977..293979)
                     /gene="metE"
                     /locus_tag="YPTB0248"
                     /note="zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:239427"
     gene            complement(294124..294927)
                     /locus_tag="YPTB0249"
                     /db_xref="GeneID:2953140"
     CDS             complement(294124..294927)
                     /locus_tag="YPTB0249"
                     /EC_number="3.1.1.45"
                     /note="similar to Yersinia pestis YPO3787
                     carboxymethylenebutenolidase (99.6% evalue=1.E-159);
                     Escherichia coli ECs4760 carboxymethylenebutenolidase
                     (71.3% evalue=1.E-108)"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxymethylenebutenolidase"
                     /protein_id="YP_068795.1"
                     /db_xref="GI:51594604"
                     /db_xref="GeneID:2953140"
                     /translation="MATAHHTDQLHSLQTHGIHCGETTIPSQGDELPAYIAKPDQHTG
                     PYPVVIVVQEIFGVHEHIQDICRRLAKQGYLAIAPELYFRQGDAKDYSNINDLVNNLV
                     KKVPDRQVLVDLDHTAHWASRHGGDTKKLAITGFCWGGRIAWLYAAHNPQLKAAVAWY
                     GKLVGEKTLFLPKYPVDVAIDLCAPVLGLYGGKDTSIPAEHIETMRQALRAANADAEI
                     IVYPEAGHAFNADYRPSYHAESAQDGWQRMLDWFTQHGVSAIPIPEETQ"
     misc_feature    complement(294154..294867)
                     /locus_tag="YPTB0249"
                     /note="Dienelactone hydrolase and related enzymes
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG0412"
                     /db_xref="CDD:223489"
     misc_feature    complement(294163..>294378)
                     /locus_tag="YPTB0249"
                     /note="BAAT / Acyl-CoA thioester hydrolase C terminal;
                     Region: BAAT_C; pfam08840"
                     /db_xref="CDD:255066"
     gene            295424..296185
                     /gene="udp"
                     /locus_tag="YPTB0250"
                     /db_xref="GeneID:2956858"
     CDS             295424..296185
                     /gene="udp"
                     /locus_tag="YPTB0250"
                     /EC_number="2.4.2.3"
                     /note="catalyzes the reversible phosphorylytic cleavage of
                     uridine and deoxyuridine to uracil and ribose- or
                     deoxyribose-1-phosphate; involved in the pyrimidine
                     salvage pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="uridine phosphorylase"
                     /protein_id="YP_068796.1"
                     /db_xref="GI:51594605"
                     /db_xref="GeneID:2956858"
                     /translation="MAKSDVFHLGLTKNDLQGATLAIVPGDPQRVEKIAKLMDNPVHL
                     ASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHI
                     NVGDVLVTTAAVRLDGASLHFAPMEFPAVADFSCTTALVNAAKSVGATTHIGITASSD
                     TFYPGQERYDTFSGRVVRHFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAG
                     VIVNRTQQEIPNEETMKATESHAVKIVVEAARHLL"
     misc_feature    295433..296182
                     /gene="udp"
                     /locus_tag="YPTB0250"
                     /note="uridine phosphorylase; Provisional; Region:
                     PRK11178"
                     /db_xref="CDD:183018"
     gene            296306..297166
                     /locus_tag="YPTB0251"
                     /db_xref="GeneID:2953141"
     CDS             296306..297166
                     /locus_tag="YPTB0251"
                     /note="similar to Yersinia pestis YPO3785 conserved
                     hypothetical protein (96.5% evalue=1.E-155); C.
                     perfringens CPE1952 ptp; protein-tyrosine phosphatase (30%
                     evalue=2.E-31)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068797.1"
                     /db_xref="GI:51594606"
                     /db_xref="GeneID:2953141"
                     /translation="MTMTTFSHPSLIPLDGGINFRDLGGNLAADGRRIKPGLLFRSGS
                     LDRLSTNDCDFLSHSNVTQIIDYRDADEVQAKPDVLWPGAHYHNIPANPLSSEVNANL
                     EKLTNETLATFDVRAFMFELYHRLPFNSLAYQQLVNLLQNCASTDPVASSVVHSGDVV
                     HGDVVHSDVVHRGIVQHCAVGKDRTGVGAALVLFALGADESTVLEDYLLTETTLKPFR
                     EHMLAELALKLNDQALAQFTFVLSAREEFIQTTLRSIHERYGSRERWLKHEFGLGSIE
                     REKLQSYFLE"
     misc_feature    296339..297151
                     /locus_tag="YPTB0251"
                     /note="Protein tyrosine/serine phosphatase [Signal
                     transduction mechanisms]; Region: COG2365"
                     /db_xref="CDD:225240"
     misc_feature    296360..296938
                     /locus_tag="YPTB0251"
                     /note="Tyrosine phosphatase family; Region:
                     Y_phosphatase3; pfam13350"
                     /db_xref="CDD:257679"
     misc_feature    296963..297160
                     /locus_tag="YPTB0251"
                     /note="Tyrosine phosphatase family C-terminal region;
                     Region: Y_phosphatase3C; pfam13348"
                     /db_xref="CDD:257677"
     gene            297507..299324
                     /locus_tag="YPTB0252"
                     /db_xref="GeneID:2953142"
     CDS             297507..299324
                     /locus_tag="YPTB0252"
                     /note="similar to Yersinia pestis YPO3784  carbon
                     starvation protein (100% evalue=0); Bacillus subtilis
                     BG11924 cstA; carbon starvation protein (71% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon starvation protein"
                     /protein_id="YP_068798.1"
                     /db_xref="GI:51594607"
                     /db_xref="GeneID:2953142"
                     /translation="MLMQHAITFVIASACILTICYRLYGIFFVRKVLRVDDSEVTPSH
                     TFEDGKDYVPTKKWVNFGSHFAAIAAAGPLVGPVLAAQYGYLPGFLWLLIGCVIGGAV
                     HDTVVLFASMKHQGKSLSEVAKSELGPVAGWCTGLAMLFIITITMAGLSMVVVHALER
                     NPWGTFAVFMTIPIAICVGLWERMTGSMKGASYVGIAAIMVCVFVGPYIEGTWLGEWL
                     MLKADTVSIILPMYAFFATALPVWMLLTPRGYLSSFMKIGVFGALIVGVVFINPEIQF
                     PAVTQFIHGGGPVLAGPVWPFISITIACGAISGFHAFIGSGTTPKQIDKWSDILPVGF
                     GAMLAECMVGVMALIAATSLHPADYFAINSSAEAWSALGMEVVNLPKLSEEIGLDLYG
                     RTGGAVTLAVGMTDIFIRVPWFNSLAAYFFQFVVMFEAVFILTAVDSGTRVARYLLQD
                     FLGDIWAPLKRTDWLPGTLVCSVIACALWGYLLNSGDINSVWALFGVSNQLMASVGLI
                     IGATIILRLATKRVYMLTCVIPLAYLFVTVNYAGYWMITHVYFNSAAKGYNLFNGIIS
                     IIMMTLGVIILISALRKWRELWIRRSAEMAGNKVVTANA"
     misc_feature    297516..299321
                     /locus_tag="YPTB0252"
                     /note="Carbon starvation protein, predicted membrane
                     protein [Signal transduction mechanisms]; Region: CstA;
                     COG1966"
                     /db_xref="CDD:224877"
     misc_feature    297519..298667
                     /locus_tag="YPTB0252"
                     /note="Carbon starvation protein CstA; Region: CstA;
                     pfam02554"
                     /db_xref="CDD:251371"
     misc_feature    298761..299129
                     /locus_tag="YPTB0252"
                     /note="C-terminal domain on CstA (DUF4161); Region:
                     DUF4161; pfam13722"
                     /db_xref="CDD:258019"
     misc_feature    join(297516..297584,297687..297755,297768..297836,
                     297894..297962,297990..298049,298083..298151,
                     298179..298238,298275..298343,298386..298454,
                     298491..298559,298743..298811,298896..298955,
                     298983..299051,299070..299138,299181..299249)
                     /locus_tag="YPTB0252"
                     /note="15 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            299861..300391
                     /locus_tag="YPTB0253"
                     /db_xref="GeneID:2953143"
     CDS             299861..300391
                     /locus_tag="YPTB0253"
                     /note="similar to Yersinia pestis YPO3783  membrane
                     protein (97.7% evalue=1.E-100); Mesorhizobium loti mll0121
                     hypothetical protein (46.2% evalue=5.E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068799.1"
                     /db_xref="GI:51594608"
                     /db_xref="GeneID:2953143"
                     /translation="MTFNDAITTTIDFVRVHEAWAIPIVFILAFGESLAFLSLLLPAT
                     VILLGLGALIGESGIPFWPIWAAAATGAFFGDWASYWVGIHYKDRVATLWPLSRNPQL
                     LVRGHAFFERWGFFGAFFGRFFGPLRAIVPLVAGICAMPQRYFQLANIASALIWAFGI
                     LAPGAFGIQWLSNWIG"
     misc_feature    299879..300388
                     /locus_tag="YPTB0253"
                     /note="Uncharacterized membrane-associated protein
                     [Function unknown]; Region: DedA; COG0586"
                     /db_xref="CDD:223659"
     misc_feature    join(299918..299986,299999..300067,300203..300271,
                     300308..300376)
                     /locus_tag="YPTB0253"
                     /note="4 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            300599..302104
                     /gene="rumC"
                     /locus_tag="YPTB0254"
                     /db_xref="GeneID:2956561"
     CDS             300599..302104
                     /gene="rumC"
                     /locus_tag="YPTB0254"
                     /note="similar to Yersinia pestis YPO3782 rumC; DNA
                     recombination protein (99.7% evalue=0); Salmonella typhi
                     STY3590 yigN; membrane protein (73.5% evalue=1.E-173)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein"
                     /protein_id="YP_068800.1"
                     /db_xref="GI:51594609"
                     /db_xref="GeneID:2956561"
                     /translation="MDISLFYGLGGCLVGGLIGWLIASLSQQRTKAQQDIERRLLEQA
                     LQQAQQSIATLQMTQQRNEQQLRQSELEQRNLHSQLAANSEKLQQLAHWRNECEQLNQ
                     ELRAQREINSAQEAELREVTIRLEETRLATEEKQRLLLNSEQRLTTQFENLANRIFEQ
                     TGRRADEQNKQSLDRLLLPLREQLDGFRRQVQDSFGQEARERHTLTHEIRNLQQLNAQ
                     MAREALNLTKALKGDNKTQGNWGEVVLAKVLEASGLREGHEYQTQVSVKIDQTSRMQP
                     DVIVRLPQGKDVVIDAKMSLVAYERYFNSEDDAEREVALNEHLSSLRGHIRMLGRKDY
                     QQLPGLRSLDYVLMFIPVEPAFLVAIDRQPELINEALQHNIMLVSPTTLLVALRTITN
                     LWRYEHQSQNAQRIAERAARLYDKVRLFVDDMASLGQSLDKAQLSYHQAMNKLSQGRG
                     NLVGQVESFRTLGVEVKRPISPLLAEKACAEHQPEGDLALSDDAESGAFPE"
     misc_feature    300752..302098
                     /gene="rumC"
                     /locus_tag="YPTB0254"
                     /note="DNA recombination protein RmuC; Provisional;
                     Region: PRK10361"
                     /db_xref="CDD:182409"
     misc_feature    301109..302014
                     /gene="rumC"
                     /locus_tag="YPTB0254"
                     /note="RmuC family; Region: RmuC; pfam02646"
                     /db_xref="CDD:251445"
     misc_feature    300611..300670
                     /gene="rumC"
                     /locus_tag="YPTB0254"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            302196..302951
                     /gene="ubiE"
                     /locus_tag="YPTB0255"
                     /db_xref="GeneID:2956852"
     CDS             302196..302951
                     /gene="ubiE"
                     /locus_tag="YPTB0255"
                     /EC_number="2.1.1.-"
                     /note="Catalyzes the carbon methylation reaction in the
                     biosynthesis of ubiquinone"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /protein_id="YP_068801.1"
                     /db_xref="GI:51594610"
                     /db_xref="GeneID:2956852"
                     /translation="MVDQEKETTHFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMS
                     FGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVGEQGEVILADINESMLR
                     MGREKLRDKGIVGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMFRVL
                     KPGGRLLVLEFSKPLLEPLSKAYDAYSFHILPKIGELVAQDAESYRYLAESIRMHPDQ
                     ETLKGMMADAGFENVTYSNLTGGIVALHRGFKF"
     misc_feature    302232..302948
                     /gene="ubiE"
                     /locus_tag="YPTB0255"
                     /note="Methylase involved in ubiquinone/menaquinone
                     biosynthesis [Coenzyme metabolism]; Region: UbiE; COG2226"
                     /db_xref="CDD:225136"
     misc_feature    302391..302699
                     /gene="ubiE"
                     /locus_tag="YPTB0255"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(302403..302423,302478..302483,302559..302567,
                     302610..302612)
                     /gene="ubiE"
                     /locus_tag="YPTB0255"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     misc_feature    302544..>302888
                     /gene="ubiE"
                     /locus_tag="YPTB0255"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4627"
                     /db_xref="CDD:226975"
     gene            302983..303615
                     /locus_tag="YPTB0256"
                     /db_xref="GeneID:2953144"
     CDS             302983..303615
                     /locus_tag="YPTB0256"
                     /note="similar to Yersinia pestis YPO3780 conserved
                     hypothetical protein (100% evalue=1.E-113); Salmonella
                     typhimurium STM3971 yigP; inner membrane protein (56.8%
                     evalue=3.E-57)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068802.1"
                     /db_xref="GI:51594611"
                     /db_xref="GeneID:2953144"
                     /translation="MLKPFLLKPRLLTPLITAALETVLNGVLFNDKSLKAARSRLVGK
                     VLRIELREINFPLLFVFSERQVDVLSQWDDAADCLVKTDVAVLARLRDRQQLSPLMRT
                     GELVVEGDIQVVQQLVALLDLAEWDLAEWLAPYVGDVAAESLGQAIHKSSGFLSRQLR
                     QQQHYLAEAITEEWRMAPNLLEVMWFHEEVDATARATEALSSRLATMETK"
     misc_feature    303016..303612
                     /locus_tag="YPTB0256"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3165"
                     /db_xref="CDD:225706"
     gene            303615..305246
                     /gene="ubiB"
                     /locus_tag="YPTB0257"
                     /gene_synonym="aarF; yigQ; yigR"
                     /db_xref="GeneID:2955151"
     CDS             303615..305246
                     /gene="ubiB"
                     /locus_tag="YPTB0257"
                     /gene_synonym="aarF; yigQ; yigR"
                     /note="an Escherichia coli mutant results in accumulation
                     of octaprenylphenol and no ubiquinone; functions in the
                     formation of 2-octaprenyl-6-hydroxy-phenol from
                     2-octaprenylphenol in ubiquinone (coenzyme Q)
                     biosynthesis; similar to eukaryotic proteins that exhibit
                     kinase functions"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone biosynthesis protein UbiB"
                     /protein_id="YP_068803.1"
                     /db_xref="GI:51594612"
                     /db_xref="GeneID:2955151"
                     /translation="MTPGELRRLYLIIRVFLSYGLDELIPNIRLTLPLRVGRHLFFWL
                     SNRHKDKSLGERLRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDG
                     ALARKHIEIAMGGALETWFDDFDSQALASASIAQVHTARLKENGKEVVLKVIRPDILP
                     IIKADVRLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRN
                     FEDSPMLYIPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFT
                     QVFRDSFFHADMHPGNIFVSYEHPHDPLYIGIDCGIVGSLNKADKRYLAENFIAFFNR
                     DYRRVAELHVDSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARR
                     FNMEVQPQLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALK
                     EKAPFWAEKFPELPELVYDSLQQHKLLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATL
                     LVSGTILFLADATEVSTGFIVAGALAWFIGWRRTC"
     misc_feature    303621..305240
                     /gene="ubiB"
                     /locus_tag="YPTB0257"
                     /gene_synonym="aarF; yigQ; yigR"
                     /note="putative ubiquinone biosynthesis protein UbiB;
                     Reviewed; Region: ubiB; PRK04750"
                     /db_xref="CDD:235310"
     misc_feature    303630..304952
                     /gene="ubiB"
                     /locus_tag="YPTB0257"
                     /gene_synonym="aarF; yigQ; yigR"
                     /note="2-polyprenylphenol 6-hydroxylase; Region: UbiB;
                     TIGR01982"
                     /db_xref="CDD:233667"
     misc_feature    305163..305231
                     /gene="ubiB"
                     /locus_tag="YPTB0257"
                     /gene_synonym="aarF; yigQ; yigR"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            305426..305692
                     /gene="tatA"
                     /locus_tag="YPTB0258"
                     /gene_synonym="mttal"
                     /db_xref="GeneID:2956662"
     CDS             305426..305692
                     /gene="tatA"
                     /locus_tag="YPTB0258"
                     /gene_synonym="mttal"
                     /note="similar to Yersinia pestis YPO3778 tatA, mtta1;
                     Sec-independent protein translocase TatA (100%
                     evalue=6.E-44); Escherichia coli Z5358 tatA; twin arginine
                     translocation protein; sec-independent protein export
                     (64.1% evalue=7.E-21)"
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase TatA"
                     /protein_id="YP_068804.1"
                     /db_xref="GI:51594613"
                     /db_xref="GeneID:2956662"
                     /translation="MGSIGWAQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAMG
                     DDSQTPPTNVDKTSNDADFAKSITEKQQPVAKAEESKSHEKEQG"
     misc_feature    305426..305686
                     /gene="tatA"
                     /locus_tag="YPTB0258"
                     /gene_synonym="mttal"
                     /note="twin arginine translocase protein A; Provisional;
                     Region: tatA; PRK03554"
                     /db_xref="CDD:179592"
     misc_feature    305435..305488
                     /gene="tatA"
                     /locus_tag="YPTB0258"
                     /gene_synonym="mttal"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            305696..306358
                     /gene="tatB"
                     /locus_tag="YPTB0259"
                     /gene_synonym="mtta2"
                     /db_xref="GeneID:2956663"
     CDS             305696..306358
                     /gene="tatB"
                     /locus_tag="YPTB0259"
                     /gene_synonym="mtta2"
                     /note="similar to Yersinia pestis YPO3777 tatB, mtta2;
                     Sec-independent protein translocase TatB (99%
                     evalue=1.E-117); Salmonella typhimurium STM3974 tatB;
                     component of Sec-independent protein secretion pathway
                     (64.3% evalue=8.E-50)"
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase TatB"
                     /protein_id="YP_068805.1"
                     /db_xref="GI:51594614"
                     /db_xref="GeneID:2956663"
                     /translation="MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRTLRSLAA
                     TVQNELAQELKLQELQDSLKKVEQAGLQNLTPELKASMDELKEAAEALKRSYHVDAGS
                     EAPHTIHNPLVTEPEAIHDGVTPAEPATQVSALAQAPNILEAGTASVADSVVEAAPVT
                     TVKSVVQGEVLVKSTPVQEVGLADVMDKPVTKQQIDTIDSHGTDLSSAGPSRIHQPGG
                     DQ"
     misc_feature    305696..306196
                     /gene="tatB"
                     /locus_tag="YPTB0259"
                     /gene_synonym="mtta2"
                     /note="sec-independent translocase; Provisional; Region:
                     PRK01770"
                     /db_xref="CDD:179334"
     misc_feature    305696..306112
                     /gene="tatB"
                     /locus_tag="YPTB0259"
                     /gene_synonym="mtta2"
                     /note="sec-independent translocase; Provisional; Region:
                     tatB; PRK00404"
                     /db_xref="CDD:166942"
     gene            306361..307137
                     /gene="tatC"
                     /locus_tag="YPTB0260"
                     /gene_synonym="mttB"
                     /db_xref="GeneID:2956664"
     CDS             306361..307137
                     /gene="tatC"
                     /locus_tag="YPTB0260"
                     /gene_synonym="mttB"
                     /note="with TatABE forms the twin-arginine translocation
                     complex which is involved in the transport of proteins
                     across the cytoplasmic membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine protein translocation system
                     subunit TatC"
                     /protein_id="YP_068806.1"
                     /db_xref="GI:51594615"
                     /db_xref="GeneID:2956664"
                     /translation="MAVDDTQPLISHLIELRKRLLNCIITILVVFLVLVFFANDIYNL
                     VSAPLIKQLPAGASMIATDVASPFFTPIKLTMMVSVFVSAPMILYQVWAFIAPALYKH
                     ERRLMVPLLISSSLLFYLGMAFAYFVVFPLAFGFFAKTAPESVLIATDITKYLDFVMA
                     LFMAFGISFEVPIAIILLCWAGVTTPEALKKKRPYVFVGAFVVGMLLTPPDVLSQTLL
                     AIPMYLLFEVGVFFARFYTGKQRRAATEEDEGIDSHPKAP"
     misc_feature    306361..307134
                     /gene="tatC"
                     /locus_tag="YPTB0260"
                     /gene_synonym="mttB"
                     /note="twin-arginine protein translocation system subunit
                     TatC; Provisional; Region: PRK10921"
                     /db_xref="CDD:182840"
     misc_feature    join(306418..306486,306580..306648,306706..306774,
                     306832..306900,306937..306990,307000..307068)
                     /gene="tatC"
                     /locus_tag="YPTB0260"
                     /gene_synonym="mttB"
                     /note="6 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            307193..307975
                     /locus_tag="YPTB0261"
                     /db_xref="GeneID:2953145"
     CDS             307193..307975
                     /locus_tag="YPTB0261"
                     /note="magnesium dependent; not involved in the
                     Sec-independent protein export system"
                     /codon_start=1
                     /transl_table=11
                     /product="DNase TatD"
                     /protein_id="YP_068807.1"
                     /db_xref="GI:51594616"
                     /db_xref="GeneID:2953145"
                     /translation="MFDIGVNLTSVQFAKDYHQVVNRAKEAGVLGILITGTDADESLA
                     AQTLAAEYPGYCWSTTGVHPHHASSWQDSVEQKIRTLAATASVVAIGECGLDFNRNFS
                     TPAQQEVAFTAQLALAAELSLPVFLHCRDAHERFIDLLVPWLDKIPAAVVHCFTGNSG
                     ELDACLALGLSIGITGWVCDERRGLDLRALLPRIPVQQLLLETDAPYLLPRDLNPKPA
                     SRRNEPCFLPHIVQQVAAWRQEDPNWLGQKTDENARRVFRLV"
     misc_feature    307193..307966
                     /locus_tag="YPTB0261"
                     /note="TatD like proteins;  E.coli TatD is a cytoplasmic
                     protein, shown to have magnesium dependent DNase activity;
                     Region: TatD_DNAse; cd01310"
                     /db_xref="CDD:238635"
     misc_feature    order(307205..307207,307211..307213,307574..307576,
                     307649..307651,307802..307804)
                     /locus_tag="YPTB0261"
                     /note="active site"
                     /db_xref="CDD:238635"
     gene            307990..309012
                     /gene="hemB"
                     /locus_tag="YPTB0262"
                     /db_xref="GeneID:2955774"
     CDS             307990..309012
                     /gene="hemB"
                     /locus_tag="YPTB0262"
                     /EC_number="4.2.1.24"
                     /note="catalyzes the formation of porphobilinogen from
                     5-aminolevulinate"
                     /codon_start=1
                     /transl_table=11
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="YP_068808.1"
                     /db_xref="GI:51594617"
                     /db_xref="GeneID:2955774"
                     /translation="MSYAFPGTFPGRRMRRVRCHDFSRRLVAENHLTVNDLIYPVFVM
                     EGTHQQQAVSSMPGVSRMTIDLLLKEAEAIAKLGVPVISLFPVIEAGKKSLYAEEAYN
                     PDGLVQRTVRALKDAVPELGILTDVALDPYTTHGQDGVIDSDGYVINDVTKEILVRQA
                     LSHAEAGAEIIAPSDMMDGRIGAIRDQLERQGLVNTQIMAYSAKYASCYYGPFRDAIG
                     SSSNLKGGDKKTYQMDPANSDEALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFG
                     VPTFAYQVSGEYAMHMAAIQNGWLQEKPTVMESLLCFKRAGADGVLTYFAKQVAQWLH
                     DDQMQR"
     misc_feature    308023..308991
                     /gene="hemB"
                     /locus_tag="YPTB0262"
                     /note="Porphobilinogen synthase (PBGS), which is also
                     called delta-aminolevulinic acid dehydratase (ALAD),
                     catalyzes the condensation of two 5-aminolevulinic acid
                     (ALA) molecules to form the pyrrole porphobilinogen (PBG),
                     which is the second step in the...; Region:
                     ALAD_PBGS_aspartate_rich; cd04823"
                     /db_xref="CDD:240127"
     misc_feature    order(308026..308034,308041..308046,308071..308079,
                     308149..308151,308158..308160,308434..308439,
                     308518..308523,308608..308616,308677..308682,
                     308689..308700,308707..308709,308716..308721,
                     308773..308787,308857..308859,308902..308904,
                     308911..308913,308923..308925,308932..308934)
                     /gene="hemB"
                     /locus_tag="YPTB0262"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240127"
     misc_feature    order(308026..308028,308521..308523,308719..308721,
                     308731..308733)
                     /gene="hemB"
                     /locus_tag="YPTB0262"
                     /note="allosteric magnesium binding site [ion binding];
                     other site"
                     /db_xref="CDD:240127"
     misc_feature    order(308365..308367,308371..308373,308377..308379,
                     308401..308403,308509..308511,308599..308601,
                     308617..308619,308626..308631,308644..308646,
                     308671..308673,308683..308685,308764..308766,
                     308833..308835,308842..308844,308959..308961)
                     /gene="hemB"
                     /locus_tag="YPTB0262"
                     /note="active site"
                     /db_xref="CDD:240127"
     misc_feature    order(308377..308379,308401..308403,308512..308514)
                     /gene="hemB"
                     /locus_tag="YPTB0262"
                     /note="aspartate-rich active site metal binding site;
                     other site"
                     /db_xref="CDD:240127"
     misc_feature    order(308599..308601,308764..308766)
                     /gene="hemB"
                     /locus_tag="YPTB0262"
                     /note="Schiff base residues; other site"
                     /db_xref="CDD:240127"
     gene            complement(309122..309610)
                     /gene="rfaH"
                     /locus_tag="YPTB0263"
                     /gene_synonym="hlyT; sfrB"
                     /db_xref="GeneID:2956430"
     CDS             complement(309122..309610)
                     /gene="rfaH"
                     /locus_tag="YPTB0263"
                     /gene_synonym="hlyT; sfrB"
                     /note="similar to Yersinia pestis YPO3770 rfaH, hlyT,
                     sfrB; regulatory protein (99.3% evalue=8.E-89);
                     Escherichia coli b3842 rfaH, hlyT, sfrB; transcriptional
                     activator rfaH (64.5% evalue=1.E-58)"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator RfaH"
                     /protein_id="YP_068809.1"
                     /db_xref="GI:51594618"
                     /db_xref="GeneID:2956430"
                     /translation="MKSWYLLYCKRGQILRAKEHLERQTVNCWTPIVAIEKIVRGKRI
                     EVIEALFPNYLFAEFDPENIHTTTVSATRGVSHFVRFGTQPAVIPATVIADMQAHAVD
                     KIIAPEVPKPGDIVKIIDGVFAGLQAIYTEPDGEARSMLLLNMLNSQIKHSLDNRQFE
                     KQ"
     misc_feature    complement(309125..309610)
                     /gene="rfaH"
                     /locus_tag="YPTB0263"
                     /gene_synonym="hlyT; sfrB"
                     /note="transcriptional activator RfaH; Provisional;
                     Region: rfaH; PRK09014"
                     /db_xref="CDD:181611"
     misc_feature    complement(309317..309604)
                     /gene="rfaH"
                     /locus_tag="YPTB0263"
                     /gene_synonym="hlyT; sfrB"
                     /note="N-Utilization Substance G (NusG) N-terminal domain
                     in the NusG Specialized Paralog (SP), RfaH; Region:
                     NGN_SP_RfaH; cd09892"
                     /db_xref="CDD:193581"
     misc_feature    complement(309128..309280)
                     /gene="rfaH"
                     /locus_tag="YPTB0263"
                     /gene_synonym="hlyT; sfrB"
                     /note="KOW: an acronym for the authors' surnames
                     (Kyrpides, Ouzounis and Woese); Region: KOW; cl00354"
                     /db_xref="CDD:260377"
     gene            309858..311354
                     /locus_tag="YPTB0264"
                     /db_xref="GeneID:2953146"
     CDS             309858..311354
                     /locus_tag="YPTB0264"
                     /note="catalyzes the decarboxylation of
                     3-octaprenyl-4-hydroxy benzoate to 2-octaprenylphenol"
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="YP_068810.1"
                     /db_xref="GI:51594619"
                     /db_xref="GeneID:2953146"
                     /translation="MISMKYRDLRDFLSLLEQRGELKRISQPIDPYLEMTEIADRTLR
                     AGGPALLFENPKGYSMPVLCNLFGTAKRVAMGMGQEDVSALRDVGKLLAFLKEPDPPK
                     GFRDLFDKLPKFKQVLNMPTKRLNSAPCQEQVWQGEDVDLSRIPVMHCWPEDAAPLVS
                     WGLTITRGPHKERQNLGIYRQQVLGKNKLIMRWLSHRGGALDYQEWCEAHPGERFPVA
                     VALGADPATILAAVTPVPDTLSEYAFAGLLRGHKTEVVKCLSNDLEVPASAEIVLEGY
                     IEQGDMAPEGPYGDHTGYYNEIDNFPVFTVTHITQRQDAIYHSTYTGRPPDEPAVMGV
                     ALNEVFVPILQKQFPEIVDFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQF
                     MYTKFVIVCDDDINARDWNDVIWAITTRMDPSRDTVLIENTPIDYLDFASPVSGLGSK
                     MGLDATNKWPAETPREWGRPIKMDEDVRARIDALWDELAIFSDKDAKR"
     misc_feature    309858..311348
                     /locus_tag="YPTB0264"
                     /note="3-octaprenyl-4-hydroxybenzoate decarboxylase;
                     Provisional; Region: PRK10922"
                     /db_xref="CDD:236796"
     gene            311409..312110
                     /gene="fre"
                     /locus_tag="YPTB0265"
                     /gene_synonym="fadI; ubiB"
                     /db_xref="GeneID:2955526"
     CDS             311409..312110
                     /gene="fre"
                     /locus_tag="YPTB0265"
                     /gene_synonym="fadI; ubiB"
                     /note="NAD(P)H-flavin reductase; catalyzes the reversible
                     oxidation/reduction of NAD(P) and flavine mononucleotide;
                     in Salmonella and E. coli this protein also reduces
                     aquacob(III)alamin to cob(II)alamin"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="YP_068811.1"
                     /db_xref="GI:51594620"
                     /db_xref="GeneID:2955526"
                     /translation="MTTLSCKVTSVEAITDTVYRVQLVPESSFSFRAGQYLMVVMDER
                     DKRPFSMASTPFQQDFIELHIGASELNLYAMAVMDRILKEKKLDVDIPHGDAWFREGS
                     KRPLVLIAGGTGFSYARSILLAALAEQPDREVSIYWGGREAVHLYDLGELEALSIKYP
                     QLKVIPVVEQPEEGWRGRTGTVLSAVLQDYGSLAEQDIYIAGRFEMAKIARERFCVER
                     GAQEEHIFGDAFAFI"
     misc_feature    311412..312107
                     /gene="fre"
                     /locus_tag="YPTB0265"
                     /gene_synonym="fadI; ubiB"
                     /note="FMN reductase; Validated; Region: fre; PRK08051"
                     /db_xref="CDD:236142"
     misc_feature    311424..312098
                     /gene="fre"
                     /locus_tag="YPTB0265"
                     /gene_synonym="fadI; ubiB"
                     /note="NAD(P)H dependent flavin oxidoreductases use flavin
                     as a substrate in mediating electron transfer from iron
                     complexes or iron proteins. Structurally similar to
                     ferredoxin reductases, but with only 15% sequence
                     identity, flavin reductases reduce FAD, FMN; Region:
                     flavin_oxioreductase; cd06189"
                     /db_xref="CDD:99786"
     misc_feature    order(311514..311516,311547..311558,311598..311606,
                     311610..311612,311622..311630,311745..311747,
                     311754..311756,312090..312092,312096..312098)
                     /gene="fre"
                     /locus_tag="YPTB0265"
                     /gene_synonym="fadI; ubiB"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99786"
     misc_feature    order(311547..311549,311553..311558)
                     /gene="fre"
                     /locus_tag="YPTB0265"
                     /gene_synonym="fadI; ubiB"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99786"
     misc_feature    order(311619..311621,311628..311630,311637..311639,
                     311658..311660,311682..311684,311688..311690)
                     /gene="fre"
                     /locus_tag="YPTB0265"
                     /gene_synonym="fadI; ubiB"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99786"
     misc_feature    order(311730..311732,311742..311753,311757..311759)
                     /gene="fre"
                     /locus_tag="YPTB0265"
                     /gene_synonym="fadI; ubiB"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99786"
     misc_feature    order(311745..311750,311823..311831,312012..312017)
                     /gene="fre"
                     /locus_tag="YPTB0265"
                     /gene_synonym="fadI; ubiB"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99786"
     gene            complement(312270..313433)
                     /gene="fadA"
                     /locus_tag="YPTB0266"
                     /gene_synonym="oldA"
                     /db_xref="GeneID:2955521"
     CDS             complement(312270..313433)
                     /gene="fadA"
                     /locus_tag="YPTB0266"
                     /gene_synonym="oldA"
                     /EC_number="2.3.1.16"
                     /note="FadA; fatty acid oxidation complex component beta;
                     functions in a heterotetramer with FadB; similar to
                     FadI2J2 complex; functions in beta-oxidation of fatty
                     acids"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="YP_068812.1"
                     /db_xref="GI:51594621"
                     /db_xref="GeneID:2955521"
                     /translation="MENVVIIDAVRTPMGRSKGGAFRHVRAEDLSAHLMRAVISRNPG
                     LNAAEIDDIYWGCVQQTLEQGFNIARNASLLAEIPHSVPAVTVNRLCGSSMQALHDGA
                     RAIMVGDAKISLIGGVEHMGHVPMNHGVDFHPGMGRTVAKAAGMMGLTAEMLAKIHNI
                     SRQSQDEFAFRSHQRAYAATQAGHFAKEIVATNGHDAEGVLKRFDFDEVIRPETNLSG
                     LAALRPAFDPVNGTVTAGTSSALSDGASAMLIMSESRAKSLGLTPRARIRSMAVVGCD
                     PSIMGYGPVPASQLALKRAGLELADIGLFELNEAFAAQSLACLKGLGLLESMDDKVNL
                     NGGAIALGHPLGCSGARISTTLLNLMERRDVQFGLATMCIGLGQGIATVFERL"
     misc_feature    complement(312273..313433)
                     /gene="fadA"
                     /locus_tag="YPTB0266"
                     /gene_synonym="oldA"
                     /note="3-ketoacyl-CoA thiolase; Reviewed; Region: fadA;
                     PRK08947"
                     /db_xref="CDD:181592"
     misc_feature    complement(312276..313421)
                     /gene="fadA"
                     /locus_tag="YPTB0266"
                     /gene_synonym="oldA"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(312303..312308,312552..312554,
                     312612..312614,312618..312620,312624..312626,
                     313068..313070,313113..313115,313122..313127,
                     313146..313148,313170..313181,313212..313214,
                     313224..313226,313233..313235,313278..313280,
                     313362..313364))
                     /gene="fadA"
                     /locus_tag="YPTB0266"
                     /gene_synonym="oldA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(312315..312317,312405..312407,
                     313161..313163))
                     /gene="fadA"
                     /locus_tag="YPTB0266"
                     /gene_synonym="oldA"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            complement(313445..315634)
                     /gene="fadB"
                     /locus_tag="YPTB0267"
                     /gene_synonym="oldB"
                     /db_xref="GeneID:2955522"
     CDS             complement(313445..315634)
                     /gene="fadB"
                     /locus_tag="YPTB0267"
                     /gene_synonym="oldB"
                     /EC_number="1.1.1.35"
                     /EC_number="4.2.1.17"
                     /EC_number="5.1.2.3"
                     /EC_number="5.3.3.8"
                     /note="includes enoyl-CoA hydratase,
                     delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase,
                     3-hydroxyacyl-CoA dehydrogenase, and 3-hydroxybutyryl-CoA
                     epimerase; catalyzes the formation of an hydroxyacyl-CoA
                     by addition of water on enoyl-CoA; also exhibits
                     3-hydroxyacyl-CoA epimerase and 3-hydroxyacyl-CoA
                     dehydrogenase activities; forms a heterotetramer with
                     FadA; similar to FadI2J2 complex; functions in
                     beta-oxidation of fatty acids"
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional fatty acid oxidation complex
                     subunit alpha"
                     /protein_id="YP_068813.1"
                     /db_xref="GI:51594622"
                     /db_xref="GeneID:2955522"
                     /translation="MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTKTVANLGEALN
                     VLEKQSELKGLLLRSAKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLP
                     VPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGA
                     DSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPK
                     LEPLKLNPTEAAMCFTIAKGRVMQVAGKHYPAPLTAVKTIEAAAKFGRTEALNLETNS
                     FVPLAGSNEARALVGIFLNDQYVKAQAKKLSKGVAAPKLAAVLGAGIMGGGIAYQSAL
                     KSVPVIMKDINENSLDLGMNEAAKLLNKQLERGKVDGLKMASILATIRPTLDYAGIER
                     AQVIVEAVVENPKVKAAVLAEVEALIGEDTVLASNTSTIPIDQLAKSLKRPENFCGMH
                     FFNPVHQMPLVEIIRGAKTSDKTLAAVVAYATQMGKTPIVVNDCPGFFVNRVLFPYLA
                     GFGMLVRDGGDFHQIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPERMNK
                     DYRDAVDVMFDNQRFGQKNGQGFYRYTQDAKGKPRKENDEQVDKLLAEISQPLQEFSD
                     EDIIARTMIPMINEVVRCLEEGIIASAAEGDMALVYGLGFPPFHGGVFRYLDTLGSAN
                     YVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPVAAALLDVSTNQPA"
     misc_feature    complement(313490..315634)
                     /gene="fadB"
                     /locus_tag="YPTB0267"
                     /gene_synonym="oldB"
                     /note="multifunctional fatty acid oxidation complex
                     subunit alpha; Reviewed; Region: fadB; PRK11730"
                     /db_xref="CDD:183293"
     misc_feature    complement(315026..315607)
                     /gene="fadB"
                     /locus_tag="YPTB0267"
                     /gene_synonym="oldB"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(315209..315211,315218..315223,
                     315287..315295,315299..315301,315425..315439,
                     315449..315451,315545..315547,315551..315553))
                     /gene="fadB"
                     /locus_tag="YPTB0267"
                     /gene_synonym="oldB"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(315287..315289,315431..315433))
                     /gene="fadB"
                     /locus_tag="YPTB0267"
                     /gene_synonym="oldB"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(315026..315028,315035..315037,
                     315080..315082,315089..315091,315122..315124,
                     315131..315136,315140..315145,315149..315154,
                     315167..315172,315176..315184,315188..315190,
                     315206..315217,315251..315262,315323..315325,
                     315347..315349))
                     /gene="fadB"
                     /locus_tag="YPTB0267"
                     /gene_synonym="oldB"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(314153..314647)
                     /gene="fadB"
                     /locus_tag="YPTB0267"
                     /gene_synonym="oldB"
                     /note="3-hydroxyacyl-CoA dehydrogenase, NAD binding
                     domain; Region: 3HCDH_N; pfam02737"
                     /db_xref="CDD:251505"
     misc_feature    complement(313859..314149)
                     /gene="fadB"
                     /locus_tag="YPTB0267"
                     /gene_synonym="oldB"
                     /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
                     Region: 3HCDH; pfam00725"
                     /db_xref="CDD:250086"
     misc_feature    complement(<313598..313756)
                     /gene="fadB"
                     /locus_tag="YPTB0267"
                     /gene_synonym="oldB"
                     /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
                     Region: 3HCDH; pfam00725"
                     /db_xref="CDD:250086"
     gene            315961..317292
                     /gene="pepQ"
                     /locus_tag="YPTB0268"
                     /db_xref="GeneID:2956235"
     CDS             315961..317292
                     /gene="pepQ"
                     /locus_tag="YPTB0268"
                     /EC_number="3.4.13.9"
                     /note="catalyzes the hydrolysis of dipeptides with a
                     proline at the C-terminal; also catalyzes the low
                     efficiency hydrolysis of organophosphate di- and
                     tri-esters"
                     /codon_start=1
                     /transl_table=11
                     /product="proline dipeptidase"
                     /protein_id="YP_068814.1"
                     /db_xref="GI:51594623"
                     /db_xref="GeneID:2956235"
                     /translation="METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRLFLD
                     DRDYPFKVNPQFKAWVPVTEVPNCWLWVDGVNTPKLWFYSPVDYWHSVEPLPDSFWTK
                     NIDVQPLLNADDIAQQLPVQRERVAYIGYAQQRAQALGFSAENINPQPVLDYLHYYRS
                     YKTDYELACMREAQKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVPYDNIV
                     ALNEHSAVLHYTILQHQPPAEIRSFLIDAGAEYNGYAADLTRTYAADRDSDFAALISD
                     LNTEQLALIDTIKSGERYTDYHVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLP
                     HGLGHPLGLQVHDTAGFMQDDKGTNLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDS
                     LLAPWRIGEFSKHFNWDRIDALKPYGGIRIEDNIVIHDKRVENMTRDLKLA"
     misc_feature    315961..317289
                     /gene="pepQ"
                     /locus_tag="YPTB0268"
                     /note="proline dipeptidase; Provisional; Region: PRK13607"
                     /db_xref="CDD:237444"
     misc_feature    316459..317274
                     /gene="pepQ"
                     /locus_tag="YPTB0268"
                     /note="A family including aminopeptidase P, aminopeptidase
                     M, and prolidase. Also known as metallopeptidase family
                     M24. This family of enzymes is able to cleave amido-,
                     imido- and amidino-containing bonds. Members exibit
                     relatively narrow substrate specificity...; Region:
                     APP_MetAP; cl00279"
                     /db_xref="CDD:260321"
     misc_feature    order(316642..316644,316696..316698,316729..316731,
                     316975..316977,317110..317112,317227..317229)
                     /gene="pepQ"
                     /locus_tag="YPTB0268"
                     /note="active site"
                     /db_xref="CDD:238514"
     gene            317292..317903
                     /locus_tag="YPTB0269"
                     /db_xref="GeneID:2953147"
     CDS             317292..317903
                     /locus_tag="YPTB0269"
                     /note="similar to Escherichia coli ECs4776 hypothetical
                     protein (64.8% evalue=4.E-71); Escherichia coli Z5370
                     yigZ; orf, hypothetical protein (64.8% evalue=4.E-71)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068815.1"
                     /db_xref="GI:51594624"
                     /db_xref="GeneID:2953147"
                     /translation="MQPYLIPAMPVTISEEIKKSRFITLLAHTCGVNEAKDFIQQVKQ
                     QHPTARHHCWAFVAGPPTDSQQLGFSDDGEPSGTAGKPILAQLMGSDIGEITAVVVRY
                     YGGIKLGTGGLVKAYGSGVQQALKQVAVKYKVPQVEYTLQCDYAQLAMVEMLLQQVEG
                     QILRGEYTELVTLHLTLPATQASQVGDKLRDLSRGTLQLTPIS"
     misc_feature    317292..317900
                     /locus_tag="YPTB0269"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11568"
                     /db_xref="CDD:183205"
     misc_feature    317340..317669
                     /locus_tag="YPTB0269"
                     /note="Uncharacterized protein family UPF0029; Region:
                     UPF0029; pfam01205"
                     /db_xref="CDD:250442"
     misc_feature    317712..317876
                     /locus_tag="YPTB0269"
                     /note="Domain of unknown function (DUF1949); Region:
                     DUF1949; pfam09186"
                     /db_xref="CDD:255222"
     gene            317943..319394
                     /gene="trkH"
                     /locus_tag="YPTB0270"
                     /db_xref="GeneID:2956733"
     CDS             317943..319394
                     /gene="trkH"
                     /locus_tag="YPTB0270"
                     /note="similar to Yersinia pestis YPO3762 trkH; Trk system
                     potassium uptake protein TrkH (100% evalue=0); Escherichia
                     coli ECs4777 potassium uptake protein (88.6% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="YP_068816.1"
                     /db_xref="GI:51594625"
                     /db_xref="GeneID:2956733"
                     /translation="MHFRAITRIVGLLVILFSGTMFIPGLVALIYRDGAGRAFSETFF
                     VAVSIGLLLWLPNRKQKHELKPREGFLIVVLFWTVLGSVGALPFLFSERPNLSLTDAF
                     FESFSGLTTTGATTLVGLDSLPKAILFYRQMLQWLGGMGIIVLAVAILPILGVGGMQL
                     YRAEMPGPLKDNKMRPRIAETAKTLWLIYVLLTIACALALWGAGMSVFDAISHSFSTI
                     AIGGFSTHDASIGYFNSPTINTIIGIFLLISGCNFGLHFAVLSGRSLKVYWRDPEFRM
                     FIFVQLTLVIVCTLVLWQHSVYKSGIETLNQAFFQVVSMATTAGFTTDSIAKWPLFLP
                     LLLLCSAFIGGCAGSTGGGLKVIRILLLYLQGSRELKRLVHPNAVYTIKLGRRALPER
                     ILEAVWGFFSAYALVFIISMLAIVATGVDEFSAFAAVTATLNNLGPGLGVVADNFTSM
                     NPAAKWILVITMLFGRLEVFTLLVLFTPTFWRE"
     misc_feature    317943..319391
                     /gene="trkH"
                     /locus_tag="YPTB0270"
                     /note="potassium transporter; Provisional; Region:
                     PRK10750"
                     /db_xref="CDD:182698"
     misc_feature    317943..319391
                     /gene="trkH"
                     /locus_tag="YPTB0270"
                     /note="Trk-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: TrkG;
                     COG0168"
                     /db_xref="CDD:223246"
     misc_feature    join(317967..318035,318045..318113,318147..318215,
                     318339..318407,318495..318563,318654..318722,
                     318759..318827,318933..319001,319128..319196,
                     319206..319274,319308..319376)
                     /gene="trkH"
                     /locus_tag="YPTB0270"
                     /note="11 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            319416..319949
                     /gene="hemG"
                     /locus_tag="YPTB0271"
                     /db_xref="GeneID:2955779"
     CDS             319416..319949
                     /gene="hemG"
                     /locus_tag="YPTB0271"
                     /EC_number="1.3.3.4"
                     /note="catalyzes the oxidation of protoporphyrinogen IX to
                     form protoporphyrin IX"
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="YP_068817.1"
                     /db_xref="GI:51594626"
                     /db_xref="GeneID:2955779"
                     /translation="MKILILYSSRDGQTKTIASYIAKQLTEAATCEIQDLSQVGQIDL
                     SQYQQVIIGASVRYGHFSPVLNKFVNKHVAQLSQMPSAFFAVNLTARKPEKRSPQTNT
                     YVRKFLLNTPWQPTLCSVFAGALRYPRYSWIDRIMIQLIMRMTGGETDTSKEVEYTDW
                     QEVSRFTQDFLALQYKK"
     misc_feature    319416..319946
                     /gene="hemG"
                     /locus_tag="YPTB0271"
                     /note="protoporphyrinogen oxidase; Provisional; Region:
                     hemG; PRK11104"
                     /db_xref="CDD:182966"
     gene            320424..321970
                     /locus_tag="YPTB_RNA_99"
                     /db_xref="GeneID:2955148"
     rRNA            320424..321970
                     /locus_tag="YPTB_RNA_99"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:2955148"
     gene            322070..322146
                     /gene="tRNA-Ile1"
                     /locus_tag="YPTB_RNA_9"
                     /db_xref="GeneID:2956771"
     tRNA            322070..322146
                     /gene="tRNA-Ile1"
                     /locus_tag="YPTB_RNA_9"
                     /product="tRNA-Ile"
                     /note="anticodon GAT, Cove Score=94.77"
                     /db_xref="GeneID:2956771"
     gene            322198..322273
                     /gene="tRNA-Ala1"
                     /locus_tag="YPTB_RNA_10"
                     /db_xref="GeneID:2956739"
     tRNA            322198..322273
                     /gene="tRNA-Ala1"
                     /locus_tag="YPTB_RNA_10"
                     /product="tRNA-Ala"
                     /note="anticodon TGC, Cove Score=93.97"
                     /db_xref="GeneID:2956739"
     gene            322492..325399
                     /locus_tag="YPTB_RNA_100"
                     /db_xref="GeneID:2955121"
     rRNA            322492..325399
                     /locus_tag="YPTB_RNA_100"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:2955121"
     gene            325508..325627
                     /locus_tag="YPTB_RNA_101"
                     /db_xref="GeneID:2955122"
     rRNA            325508..325627
                     /locus_tag="YPTB_RNA_101"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:2955122"
     gene            326089..327126
                     /gene="murB"
                     /locus_tag="YPTB0272"
                     /db_xref="GeneID:2956099"
     CDS             326089..327126
                     /gene="murB"
                     /locus_tag="YPTB0272"
                     /EC_number="1.1.1.158"
                     /note="catalyzes the reduction of UDP-N-acetylglucosamine
                     enolpyruvate to form UDP-N-acetylmuramate in peptidoglycan
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="YP_068818.1"
                     /db_xref="GI:51594627"
                     /db_xref="GeneID:2956099"
                     /translation="MSNQRSSLKHLNTFALPAYASNVISAGSVETLIAAWHESKAKRQ
                     PVLLLGEGSNVLFIKNFSGTVLLNRIMGITSTEDSAAWHLHVGAGENWHQLVCHSLQN
                     NMPGLENLALIPGCVGSAPIQNIGAYGVELKQVCEYVDLLDMDKGTIQRISAEECQFG
                     YRDSIFKHRYGNGFAIVSVGIKLMKSWTPTLGYGDLIHMDPLTVTATDIFNSVCTMRR
                     SKLPDPMVTGNAGSFFKNPVVSAAIAEEIVHCYPNAPHYLQPDGSVKLAAGWLIDQCS
                     LKGYQIGGAAVHQQQALVLINQSEATGQDVIHLARYIRQQVAQRFSIWLEPEVRFIAD
                     NGEVNAVEHLS"
     misc_feature    326089..327084
                     /gene="murB"
                     /locus_tag="YPTB0272"
                     /note="UDP-N-acetylenolpyruvoylglucosamine reductase;
                     Provisional; Region: murB; PRK00046"
                     /db_xref="CDD:234593"
     misc_feature    326146..326547
                     /gene="murB"
                     /locus_tag="YPTB0272"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    326713..327084
                     /gene="murB"
                     /locus_tag="YPTB0272"
                     /note="UDP-N-acetylenolpyruvoylglucosamine reductase,
                     C-terminal domain; Region: MurB_C; pfam02873"
                     /db_xref="CDD:251582"
     gene            327123..328082
                     /gene="birA"
                     /locus_tag="YPTB0273"
                     /gene_synonym="bioR; dhbB"
                     /db_xref="GeneID:2955293"
     CDS             327123..328082
                     /gene="birA"
                     /locus_tag="YPTB0273"
                     /gene_synonym="bioR; dhbB"
                     /EC_number="6.3.4.15"
                     /note="catalyzes the formation of biotinyl-5'-AMP, also
                     acts as a transcriptional repressor of the biotin operon"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin--protein ligase"
                     /protein_id="YP_068819.1"
                     /db_xref="GI:51594628"
                     /db_xref="GeneID:2955293"
                     /translation="MKDIRVPLRLVSILSDGFFHSGEQLGETLGMSRAAINKHMQTIR
                     DWGLDVFTVPGKGYSLPTSIQLLDEQKILSYLPTGHVTVLPVVDSTNQYLLDRITELK
                     SGDACVAEYQQAGRGRRGRQWVSPFGANLYLSMYWRLEQGPAAAMGLSLVVGIVMAEV
                     LQNLGAEKVRVKWPNDLYLNDKKLAGILVELTGKTGDAAQLVIGAGINLTMRGSETNA
                     INQDWINLQDAGVTIDRNKLTAEILSELRLAVVKFENDGLSAFLSRWQKMDNYLNRPV
                     KLIIGNQEIFGIARGIDQQGALLLEQDGNIKPYIGGEISLRGV"
     misc_feature    327123..327359
                     /gene="birA"
                     /locus_tag="YPTB0273"
                     /gene_synonym="bioR; dhbB"
                     /note="Biotin operon repressor [Transcription]; Region:
                     BirA; COG1654"
                     /db_xref="CDD:224568"
     misc_feature    327126..328076
                     /gene="birA"
                     /locus_tag="YPTB0273"
                     /gene_synonym="bioR; dhbB"
                     /note="bifunctional biotin--[acetyl-CoA-carboxylase]
                     synthetase/biotin operon repressor; Provisional; Region:
                     PRK11886"
                     /db_xref="CDD:237010"
     misc_feature    327369..327746
                     /gene="birA"
                     /locus_tag="YPTB0273"
                     /gene_synonym="bioR; dhbB"
                     /note="Biotin/lipoate A/B protein ligase family; Region:
                     BPL_LplA_LipB; pfam03099"
                     /db_xref="CDD:251729"
     misc_feature    327933..328073
                     /gene="birA"
                     /locus_tag="YPTB0273"
                     /gene_synonym="bioR; dhbB"
                     /note="Biotin protein ligase C terminal domain; Region:
                     BPL_C; pfam02237"
                     /db_xref="CDD:251174"
     gene            complement(328117..329067)
                     /gene="coaA"
                     /locus_tag="YPTB0274"
                     /gene_synonym="panK; rts"
                     /db_xref="GeneID:2955344"
     CDS             complement(328117..329067)
                     /gene="coaA"
                     /locus_tag="YPTB0274"
                     /gene_synonym="panK; rts"
                     /EC_number="2.7.1.33"
                     /note="catalyzes the formation of
                     (R)-4'-phosphopantothenate in coenzyme A biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="YP_068820.1"
                     /db_xref="GI:51594629"
                     /db_xref="GeneID:2955344"
                     /translation="MTKREQSLATPYLQFDRTQWAALRDSVPLTLTEEEIVKLKGINE
                     DLSLDEVAQIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQRIPYVIGIAGSVAVGKS
                     TTARLLQALLSRWPEHRSVELITTDGFLHPNKVLNERGLMKKKGFPESYDMHNLVKFV
                     SEVKSGADYVTAPVYSHLIYDVVPDGNKVIKQPDILILEGLNVLQSGMDYPHDPHHVF
                     VSDFVDFSIYVDAPEDLLQSWYINRFLKFRQGAFSNPDSYFHNYAKLPETEAIKIATQ
                     LWNEINGLNLKQNILPTRERASLIMTKSANHAVESVRLRK"
     misc_feature    complement(328126..328800)
                     /gene="coaA"
                     /locus_tag="YPTB0274"
                     /gene_synonym="panK; rts"
                     /note="Pantothenate kinase (PanK) catalyzes the
                     phosphorylation of pantothenic acid to form
                     4'-phosphopantothenic, which is the first of five steps in
                     coenzyme A (CoA) biosynthetic pathway. The reaction
                     carried out by this enzyme is a key regulatory point...;
                     Region: PanK; cd02025"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(328147..328149,328159..328161,
                     328339..328341,328351..328353,328756..328767,
                     328774..328776))
                     /gene="coaA"
                     /locus_tag="YPTB0274"
                     /gene_synonym="panK; rts"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(328147..328149,328327..328329,
                     328339..328341,328537..328539,328750..328752,
                     328762..328767))
                     /gene="coaA"
                     /locus_tag="YPTB0274"
                     /gene_synonym="panK; rts"
                     /note="CoA-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(328471..328473,328762..328764))
                     /gene="coaA"
                     /locus_tag="YPTB0274"
                     /gene_synonym="panK; rts"
                     /note="Mg2+-binding site [ion binding]; other site"
                     /db_xref="CDD:238983"
     gene            complement(329278..329829)
                     /locus_tag="YPTB0275"
                     /db_xref="GeneID:2953148"
     CDS             complement(329278..329829)
                     /locus_tag="YPTB0275"
                     /EC_number="2.3.1.-"
                     /note="similar to Yersinia pestis YPO3757
                     acetyltransferase (99.4% evalue=1.E-100); Pseudomonas
                     aeruginosa PA1885 conserved hypothetical protein (42.2%
                     evalue=2.E-25)"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_068821.1"
                     /db_xref="GI:51594630"
                     /db_xref="GeneID:2953148"
                     /translation="MKIVLLNAATFPIYRSGLASLLIDAVTYGASVGYNTHTLSQEEA
                     EGYFHSLHPAIEREALLLWIARDEIGIIGTIQLVLCQKPNGLNRAEIQKLLVHSRSRR
                     TGIGHKLIIAAENTAVQLRRGLIYLDTQSGSSAESFYRAQGYRYVGEIPDYACTPNGN
                     YHPTAIYFKRLFTVVQPHTAIQN"
     misc_feature    complement(<329617..329730)
                     /locus_tag="YPTB0275"
                     /note="Phosphate metabolizm protein; Region: DUF3779;
                     pfam12621"
                     /db_xref="CDD:257168"
     misc_feature    complement(329446..329646)
                     /locus_tag="YPTB0275"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(329509..329514,329542..329550))
                     /locus_tag="YPTB0275"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            330225..330300
                     /gene="tRNA-Thr1"
                     /locus_tag="YPTB_RNA_11"
                     /db_xref="GeneID:2956810"
     tRNA            330225..330300
                     /gene="tRNA-Thr1"
                     /locus_tag="YPTB_RNA_11"
                     /product="tRNA-Thr"
                     /note="anticodon TGT, Cove Score=93.97"
                     /db_xref="GeneID:2956810"
     gene            330319..330403
                     /gene="tRNA-Tyr1"
                     /locus_tag="YPTB_RNA_12"
                     /db_xref="GeneID:2956815"
     tRNA            330319..330403
                     /gene="tRNA-Tyr1"
                     /locus_tag="YPTB_RNA_12"
                     /product="tRNA-Tyr"
                     /note="anticodon GTA, Cove Score=66.93"
                     /db_xref="GeneID:2956815"
     gene            330553..330627
                     /gene="tRNA-Gly1"
                     /locus_tag="YPTB_RNA_13"
                     /db_xref="GeneID:2956764"
     tRNA            330553..330627
                     /gene="tRNA-Gly1"
                     /locus_tag="YPTB_RNA_13"
                     /product="tRNA-Gly"
                     /note="anticodon TCC, Cove Score=63.22"
                     /db_xref="GeneID:2956764"
     gene            330634..330709
                     /gene="tRNA-Thr2"
                     /locus_tag="YPTB_RNA_14"
                     /db_xref="GeneID:2956811"
     tRNA            330634..330709
                     /gene="tRNA-Thr2"
                     /locus_tag="YPTB_RNA_14"
                     /product="tRNA-Thr"
                     /note="anticodon GGT, Cove Score=94.75"
                     /db_xref="GeneID:2956811"
     gene            330818..332002
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /db_xref="GeneID:2956842"
     CDS             330818..332002
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /EC_number="3.6.5.3"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="YP_068822.1"
                     /db_xref="GI:51594631"
                     /db_xref="GeneID:2956842"
                     /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQ
                     YDFPGDDTPVIRGSALKALEGDAEWEAKIIELAEALDSYIPQPERAIDRPFLLPIEDV
                     FSISGRGTVVTGRVERGIVKVGEEVEIVGIIDTIKTTCTGVEMFRKLLDEGRAGENVG
                     VLLRGTKRDDVQRGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNVNMVVNLIAPIAMDDGLRFAIREGGRTVGAGVVAKV
                     IE"
     misc_feature    330818..331999
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="elongation factor Tu; Reviewed; Region: PRK00049"
                     /db_xref="CDD:234596"
     misc_feature    330848..331426
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="Elongation Factor Tu (EF-Tu) GTP-binding proteins;
                     Region: EF_Tu; cd01884"
                     /db_xref="CDD:206671"
     misc_feature    330872..330895
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="G1 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    order(330875..330877,330881..330883,330893..330898,
                     330905..330907,330914..330919,330929..330931,
                     331013..331018,331070..331075,331142..331147,
                     331151..331162,331169..331171,331262..331264,
                     331274..331276,331352..331357)
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="GEF interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    order(330881..330898,330956..330958,331223..331228,
                     331232..331234,331337..331345)
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    330983..331015
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206671"
     misc_feature    331001..331003
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="G2 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    331058..331069
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="G3 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    331064..331120
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206671"
     misc_feature    331223..331234
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="G4 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    331337..331345
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="G5 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    331448..331708
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="EFTU_II: Elongation factor Tu domain II. Elongation
                     factors Tu (EF-Tu) are three-domain GTPases with an
                     essential function in the elongation phase of mRNA
                     translation. The GTPase center of EF-Tu is in the
                     N-terminal domain (domain I), also known as the...;
                     Region: EFTU_II; cd03697"
                     /db_xref="CDD:239668"
     misc_feature    331715..331984
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="Domain III of elongation factor (EF) Tu. Ef-Tu
                     consists of three structural domains, designated I, II and
                     III. Domain III adopts a beta barrel structure. Domain III
                     is involved in binding to both charged tRNA and binding to
                     elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707"
                     /db_xref="CDD:239678"
     misc_feature    order(331751..331753,331757..331765,331817..331819,
                     331937..331945,331973..331975)
                     /gene="tuf"
                     /locus_tag="YPTB0276"
                     /note="Antibiotic Binding Site [chemical binding]; other
                     site"
                     /db_xref="CDD:239678"
     gene            332253..332636
                     /gene="secE"
                     /locus_tag="YPTB0277"
                     /gene_synonym="prlG"
                     /db_xref="GeneID:2956583"
     CDS             332253..332636
                     /gene="secE"
                     /locus_tag="YPTB0277"
                     /gene_synonym="prlG"
                     /note="forms a complex with SecY and SecG; SecYEG forms a
                     protein-conducting channel to which secA binds and
                     translocates targeted polypeptides across the cytoplasmic
                     membrane, a process driven by ATP and a proton-motive
                     force"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="YP_068823.1"
                     /db_xref="GI:51594632"
                     /db_xref="GeneID:2956583"
                     /translation="MSANTEAPGSGRGLETAKWLIVAVLLVVAIVGNYYYREYSLPLR
                     ALAVVVIIAVAGAVALMTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTA
                     VMSLILWGLDGILVRLVSFITGLRF"
     misc_feature    332349..332624
                     /gene="secE"
                     /locus_tag="YPTB0277"
                     /gene_synonym="prlG"
                     /note="preprotein translocase subunit SecE; Reviewed;
                     Region: secE; PRK05740"
                     /db_xref="CDD:235587"
     misc_feature    join(332307..332360,332373..332441,332532..332600)
                     /gene="secE"
                     /locus_tag="YPTB0277"
                     /gene_synonym="prlG"
                     /note="3 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            332638..333183
                     /gene="nusG"
                     /locus_tag="YPTB0278"
                     /db_xref="GeneID:2956183"
     CDS             332638..333183
                     /gene="nusG"
                     /locus_tag="YPTB0278"
                     /note="Modulates Rho-dependent transcription termination"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein NusG"
                     /protein_id="YP_068824.1"
                     /db_xref="GI:51594633"
                     /db_xref="GeneID:2956183"
                     /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHDMEELFGEVMV
                     PTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAP
                     ISDKEVDAIMNRLQQVGDKPRPKTLFEPGELVRVSDGPFADFNGVVEEVDYEKSRLKV
                     SVSIFGRATPVELDFSQVEKG"
     misc_feature    332641..333177
                     /gene="nusG"
                     /locus_tag="YPTB0278"
                     /note="transcription antitermination protein NusG;
                     Validated; Region: nusG; PRK05609"
                     /db_xref="CDD:180161"
     misc_feature    332659..332982
                     /gene="nusG"
                     /locus_tag="YPTB0278"
                     /note="Bacterial N-Utilization Substance G (NusG)
                     N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1;
                     cd09891"
                     /db_xref="CDD:193580"
     misc_feature    order(332668..332670,332770..332772,332830..332832,
                     332839..332841,332845..332847,332944..332946,
                     332968..332970)
                     /gene="nusG"
                     /locus_tag="YPTB0278"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193580"
     misc_feature    333010..333177
                     /gene="nusG"
                     /locus_tag="YPTB0278"
                     /note="NusG contains an NGN domain at its N-terminus and
                     KOW motif at its C-terminus; Region: KOW_NusG; cd06091"
                     /db_xref="CDD:240515"
     misc_feature    order(333046..333060,333067..333069,333103..333105,
                     333130..333138,333142..333153,333163..333168)
                     /gene="nusG"
                     /locus_tag="YPTB0278"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     misc_feature    333046..333057
                     /gene="nusG"
                     /locus_tag="YPTB0278"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     gene            333374..333802
                     /gene="rplK"
                     /locus_tag="YPTB0279"
                     /gene_synonym="relC"
                     /db_xref="GeneID:2956495"
     CDS             333374..333802
                     /gene="rplK"
                     /locus_tag="YPTB0279"
                     /gene_synonym="relC"
                     /note="binds directly to 23S ribosomal RNA"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="YP_068825.1"
                     /db_xref="GI:51594634"
                     /db_xref="GeneID:2956495"
                     /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNA
                     KTESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGVPNKDKVGKVT
                     SAQVREIAETKAADMTGSDVDAMMRSIEGTAHSMGLVVEG"
     misc_feature    333374..333799
                     /gene="rplK"
                     /locus_tag="YPTB0279"
                     /gene_synonym="relC"
                     /note="50S ribosomal protein L11; Validated; Region: rplK;
                     PRK00140"
                     /db_xref="CDD:234661"
     misc_feature    333398..333793
                     /gene="rplK"
                     /locus_tag="YPTB0279"
                     /gene_synonym="relC"
                     /note="Ribosomal protein L11. Ribosomal protein L11,
                     together with proteins L10 and L7/L12, and 23S rRNA, form
                     the L7/L12 stalk on the surface of the large subunit of
                     the ribosome. The homologous eukaryotic cytoplasmic
                     protein is also called 60S ribosomal...; Region:
                     Ribosomal_L11; cd00349"
                     /db_xref="CDD:100101"
     misc_feature    order(333401..333403,333461..333463,333596..333604,
                     333614..333616,333635..333637,333710..333712,
                     333725..333733,333743..333745,333752..333757,
                     333764..333769,333773..333781)
                     /gene="rplK"
                     /locus_tag="YPTB0279"
                     /gene_synonym="relC"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100101"
     misc_feature    order(333401..333403,333545..333547,333551..333562,
                     333572..333574,333578..333583,333713..333718,
                     333725..333730)
                     /gene="rplK"
                     /locus_tag="YPTB0279"
                     /gene_synonym="relC"
                     /note="L7/L12 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(333449..333451,333461..333463)
                     /gene="rplK"
                     /locus_tag="YPTB0279"
                     /gene_synonym="relC"
                     /note="putative thiostrepton binding site; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(333653..333655,333662..333664)
                     /gene="rplK"
                     /locus_tag="YPTB0279"
                     /gene_synonym="relC"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     gene            333806..334510
                     /gene="rplA"
                     /locus_tag="YPTB0280"
                     /db_xref="GeneID:2956487"
     CDS             333806..334510
                     /gene="rplA"
                     /locus_tag="YPTB0280"
                     /note="in Escherichia coli and Methanococcus, this protein
                     autoregulates expression; the binding site in the mRNA
                     mimics the binding site in the 23S rRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="YP_068826.1"
                     /db_xref="GI:51594635"
                     /db_xref="GeneID:2956487"
                     /translation="MAKLTKRMRVIRDKVDVTKQYDINEAVALLKELATAKFVESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFAQGANAEAAKEAGAELVGMDDLAD
                     QIKKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQ
                     VRYRNDKNGIIHTTIGKVDFDSDKLKENLESLVVALKKAKPATAKGIYIKKISLSTTM
                     GAGVAIDQSGLTAVVN"
     misc_feature    333872..334477
                     /gene="rplA"
                     /locus_tag="YPTB0280"
                     /note="Ribosomal protein L1.  The L1 protein, located near
                     the E-site of the ribosome, forms part of the L1 stalk
                     along with 23S rRNA.  In bacteria and archaea, L1
                     functions both as a ribosomal protein that binds rRNA, and
                     as a translation repressor that binds...; Region:
                     Ribosomal_L1; cd00403"
                     /db_xref="CDD:238235"
     misc_feature    order(333911..333919,333926..333928,333932..333934,
                     333938..333940,333944..333946,334307..334309,
                     334313..334315,334319..334321,334457..334462,
                     334466..334468)
                     /gene="rplA"
                     /locus_tag="YPTB0280"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
     gene            334875..335372
                     /gene="rplJ"
                     /locus_tag="YPTB0281"
                     /db_xref="GeneID:2956494"
     CDS             334875..335372
                     /gene="rplJ"
                     /locus_tag="YPTB0281"
                     /note="binds the two ribosomal protein L7/L12 dimers and
                     anchors them to the large ribosomal subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_068827.1"
                     /db_xref="GI:51594636"
                     /db_xref="GeneID:2956494"
                     /translation="MALNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRRA
                     GREAGVHMQVVRNTLLRRIVEGTPFECLKDTFVGPTLIAFSAEHPGAAARLFKAFAKD
                     NAKFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRD
                     QKEAA"
     misc_feature    334884..335357
                     /gene="rplJ"
                     /locus_tag="YPTB0281"
                     /note="Ribosomal protein L10 family, L10 subfamily;
                     composed of bacterial 50S ribosomal protein and eukaryotic
                     mitochondrial 39S ribosomal protein, L10. L10 occupies the
                     L7/L12 stalk of the ribosome. The N-terminal domain (NTD)
                     of L10 interacts with L11 protein...; Region:
                     Ribosomal_L10; cd05797"
                     /db_xref="CDD:240223"
     misc_feature    order(334896..334901,334908..334910,335040..335051,
                     335058..335060)
                     /gene="rplJ"
                     /locus_tag="YPTB0281"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    order(335142..335144,335211..335213,335220..335222,
                     335268..335270,335277..335282,335289..335294,
                     335298..335306,335310..335318,335322..335330,
                     335337..335342,335346..335351,335355..335357)
                     /gene="rplJ"
                     /locus_tag="YPTB0281"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            335439..335807
                     /gene="rplL"
                     /locus_tag="YPTB0282"
                     /db_xref="GeneID:2956496"
     CDS             335439..335807
                     /gene="rplL"
                     /locus_tag="YPTB0282"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="YP_068828.1"
                     /db_xref="GI:51594637"
                     /db_xref="GeneID:2956496"
                     /translation="MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPA
                     AAVEAAEEQTEFDVVLASFGENKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNK
                     DEAETLKKSLEEAGASVEIK"
     misc_feature    335448..335801
                     /gene="rplL"
                     /locus_tag="YPTB0282"
                     /note="Ribosomal protein L7/L12. Ribosomal protein L7/L12
                     refers to the large ribosomal subunit proteins L7 and L12,
                     which are identical except that L7 is acetylated at the N
                     terminus. It is a component of the L7/L12 stalk, which is
                     located at the surface of...; Region: Ribosomal_L7_L12;
                     cd00387"
                     /db_xref="CDD:100102"
     misc_feature    order(335448..335450,335487..335495,335502..335507,
                     335514..335516,335523..335525,335562..335570,
                     335598..335603,335664..335666,335670..335675,
                     335679..335681,335685..335690,335730..335735,
                     335739..335741,335748..335750)
                     /gene="rplL"
                     /locus_tag="YPTB0282"
                     /note="core dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100102"
     misc_feature    order(335457..335459,335466..335468,335478..335480,
                     335517..335519,335532..335534)
                     /gene="rplL"
                     /locus_tag="YPTB0282"
                     /note="peripheral dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100102"
     misc_feature    order(335499..335501,335508..335513,335523..335525,
                     335532..335534)
                     /gene="rplL"
                     /locus_tag="YPTB0282"
                     /note="L10 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(335637..335642,335649..335654,335661..335663,
                     335682..335687,335694..335696)
                     /gene="rplL"
                     /locus_tag="YPTB0282"
                     /note="L11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(335640..335642,335652..335654,335661..335663,
                     335682..335687,335694..335696)
                     /gene="rplL"
                     /locus_tag="YPTB0282"
                     /note="putative EF-Tu interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(335640..335642,335649..335654,335661..335663)
                     /gene="rplL"
                     /locus_tag="YPTB0282"
                     /note="putative EF-G interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     gene            336150..340178
                     /gene="rpoB"
                     /locus_tag="YPTB0283"
                     /db_xref="GeneID:2956521"
     CDS             336150..340178
                     /gene="rpoB"
                     /locus_tag="YPTB0283"
                     /EC_number="2.7.7.6"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="YP_068829.1"
                     /db_xref="GI:51594638"
                     /db_xref="GeneID:2956521"
                     /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPE
                     GQHGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRL
                     VIYEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSD
                     KGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNFTTA
                     QILDLFFEKVVFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKARRITARHIRQ
                     LEKDGIDRIEVPVEYIAGKVVAKDYVDASTGELICAANMELSLDLLAKLSQAGHKQIE
                     TLFTNDLDHGAYISETLRVDPTSDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSE
                     DRYDLSAVGRMKFNRSLLRDEIEGSGILSKEDITEVMKKLIDIRNGRGEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEG
                     PNIGLINSLSVYAQTNEYGFLETPYRRVRDGVVTDEINYLSAIEEGNFVIAQANSNLD
                     DEGRFLEDLVTCRSKGESSLFSREQVDYMDVSTQQIVSVGASLIPFLEHDDANRALMG
                     ANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTSVAKRGGTVQYVDASRIVIKVNEDE
                     MHPGEAGIDIYNLTKYTRSNQNTCINQMPCVNLGEPIERGDVLADGPSTDLGELALGQ
                     NMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPN
                     VGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLF
                     ARIHAVLVSGGIEAEKLSKLPRERWLELGLTDEDKQNQLEQLAEQYDEMKSEFEKKMD
                     AKRRKITQGDDLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYD
                     ENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGEKINAMLKKQEEVAKLREFIQ
                     KAYDLGDNVCQKVDLSTFTDDEVLRLAENLKKGMPIATPVFDGATEKEIKELLQLGGL
                     PTSGQITLFDGRTGEQFERQVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGK
                     AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMP
                     ESFNVLLKEIRSLGINIELEEE"
     misc_feature    336150..340175
                     /gene="rpoB"
                     /locus_tag="YPTB0283"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     misc_feature    336228..340169
                     /gene="rpoB"
                     /locus_tag="YPTB0283"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cd00653"
                     /db_xref="CDD:238353"
     misc_feature    order(336411..336413,338634..338636,338745..338747,
                     338751..338753,338763..338771,338775..338777)
                     /gene="rpoB"
                     /locus_tag="YPTB0283"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(337785..337787,337791..337799,337803..337805,
                     337812..337814,337827..337829,338109..338111,
                     338163..338171,338175..338177,338559..338570,
                     338577..338579,338583..338591,339366..339368,
                     339372..339374,339378..339380,339444..339446,
                     339450..339452,339459..339461,339468..339470,
                     339483..339485,339495..339497,339708..339710,
                     339789..339791,339813..339821,339825..339827,
                     339864..339866,339873..339881,339885..339890,
                     339951..339959,339969..339971,339975..339980,
                     339984..339986,339990..340007,340011..340028,
                     340038..340040,340107..340109,340119..340121,
                     340125..340127,340131..340136,340140..340142,
                     340146..340157,340161..340163,340167..340169)
                     /gene="rpoB"
                     /locus_tag="YPTB0283"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    337920..338117
                     /gene="rpoB"
                     /locus_tag="YPTB0283"
                     /note="RNA polymerase beta subunit external 1 domain;
                     Region: RNA_pol_Rpb2_45; pfam10385"
                     /db_xref="CDD:255954"
     misc_feature    order(338235..338240,338544..338546,338550..338552,
                     338613..338615,338622..338624,339393..339395,
                     339432..339434,339513..339515,339678..339680,
                     339684..339686,339777..339779,339828..339830)
                     /gene="rpoB"
                     /locus_tag="YPTB0283"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(338577..338579,338619..338621,339390..339392,
                     339795..339797)
                     /gene="rpoB"
                     /locus_tag="YPTB0283"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(338619..338624,338634..338636,339312..339314,
                     339318..339320,339393..339401,339408..339410,
                     339414..339419,339792..339815,339819..339821)
                     /gene="rpoB"
                     /locus_tag="YPTB0283"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            340307..344527
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /db_xref="GeneID:2956522"
     CDS             340307..344527
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /EC_number="2.7.7.6"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. Subunit beta'
                     binds to sigma factor allowing it to bind to the -10
                     region of the promoter"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="YP_068830.1"
                     /db_xref="GI:51594639"
                     /db_xref="GeneID:2956522"
                     /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERRQIL
                     TEEQYLDALEEFGDEFDAKMGAEAIQALLKNMDLEAECEILREELNETNSETKRKKLT
                     KRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTRDCVNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEEIRNTEGESITR
                     TSIIDTTVGRAILWMIVPQGLPYSIVNQPLGKKAISKMLNTCYRILGLKPTVIFADQI
                     MYTGFAYAARSGASVGIDDMVIPEAKAGIIEEAETEVAEIQEQFQSGLVTAGERYNKV
                     IDIWAAANERVAKAMMDNLSVEDVVNRDGVVEQQVSFNSIFMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEDDCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVIKPGSADI
                     LVPRNTLLDEKWCDLLEENSVDSVKVRSVVSCETDFGVCANCYGRDLARGHIINKGEA
                     VGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSLKLSNVKFVTNAAGK
                     LVITSRNTELKLIDEFGRTKESYKVPYGAVMAKGDGAEVQGGETVANWDPHIMPVVTE
                     VSGFIRFADMVDGQTITRQTDELTGLSSLVVLDSAERTGSGKDLRPALKIVDAKGNDV
                     LIPGTDMPAQYFLPGKAIVQLEDGIQIGAGDTLARIPQESSGTKDITGGLPRVADLFE
                     ARRPKEPAILAEISGIISFGKETKGKRRLVISPLDGSDAYEEMIPKWRQLNVFEGEVV
                     ERGDVVSDGPESPHDILRLRGVHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLR
                     KGTIVDAGSTDFLEGEQAEMSRVKIANRKLAAEGKIEATFTRDLLGITKASLATESFI
                     SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRKAQGEA
                     PVVPQVSADEATANLAELLNAGFGNNKG"
     misc_feature    340349..342745
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="Largest subunit (beta') of bacterial DNA-dependent
                     RNA polymerase (RNAP), N-terminal domain; Region:
                     RNAP_beta'_N; cd01609"
                     /db_xref="CDD:259845"
     misc_feature    order(340349..340375,340379..340381,340391..340393,
                     340400..340411,340445..340447,340451..340453,
                     340502..340504,340535..340537,340592..340597,
                     340601..340612,340643..340645,340649..340651,
                     341021..341023,341033..341035,341039..341041,
                     341048..341053,341057..341059,341063..341065,
                     341072..341077,341225..341227,341285..341287,
                     341294..341299,341315..341377,341381..341383,
                     341417..341422,341429..341434,341441..341446,
                     341450..341455,341498..341500,341576..341578,
                     341588..341590,341597..341602,341606..341611,
                     341639..341644,341657..341659,341684..341692,
                     341699..341701,341711..341734,341741..341743,
                     341753..341758,341771..341773,341813..341821,
                     341828..341830,341840..341842,341855..341857,
                     342191..342196,342200..342235,342461..342463,
                     342479..342481,342497..342499,342512..342514,
                     342521..342526,342536..342538,342551..342556,
                     342575..342577,342593..342616,342620..342625,
                     342632..342637,342641..342649,342653..342661,
                     342665..342670,342698..342700,342707..342709)
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="beta and beta' interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259845"
     misc_feature    340352..344443
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="DNA-directed RNA polymerase subunit beta';
                     Provisional; Region: PRK00566"
                     /db_xref="CDD:234794"
     misc_feature    order(340430..340438,340442..340444,340499..340501,
                     340505..340507,340535..340537,340541..340543,
                     340589..340591,340724..340729,341057..341062,
                     341069..341071,341081..341098,341105..341107,
                     341114..341116,341126..341131,341138..341140,
                     341144..341155,341165..341191,341195..341200,
                     341207..341209,341240..341242,341270..341272,
                     341279..341281,341306..341311,341495..341497,
                     341501..341506)
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="beta' and sigma factor interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(340514..340516,340520..340522,340559..340561,
                     340568..340570)
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="Zn-binding [ion binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(340667..340669,341237..341239,341306..341308,
                     341321..341323,341342..341344,341360..341362,
                     341579..341587,341684..341686,341690..341692,
                     341696..341698,342674..342679,342686..342691)
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="active site region [active]"
                     /db_xref="CDD:259845"
     misc_feature    order(341684..341686,341690..341692,341696..341698)
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="catalytic site [active]"
                     /db_xref="CDD:259845"
     misc_feature    343025..344395
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="Largest subunit (beta') of Bacterial DNA-dependent
                     RNA polymerase (RNAP), C-terminal domain; Region:
                     RNAP_beta'_C; cd02655"
                     /db_xref="CDD:132721"
     misc_feature    order(343025..343027,343034..343039,343043..343045,
                     344387..344389)
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="Rpb1 (beta') - Rpb6 (omega) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(343055..343057,343067..343069,344327..344329,
                     344345..344347,344363..344365,344372..344377,
                     344387..344389)
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="Rpb1 (beta') - Rpb2 (beta) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    343100..343126
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="G-loop; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(343748..343750,344237..344239,344282..344287)
                     /gene="rpoC"
                     /locus_tag="YPTB0284"
                     /gene_synonym="tabB"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132721"
     gene            complement(344833..345963)
                     /gene="thiH"
                     /locus_tag="YPTB0285"
                     /db_xref="GeneID:2956693"
     CDS             complement(344833..345963)
                     /gene="thiH"
                     /locus_tag="YPTB0285"
                     /note="in Escherichia coli this enzyme functions in
                     thiamine biosynthesis along with thiFSGI and iscS; with
                     ThiFSG catalyzes the formation of thiazole phosphate from
                     tyrosine, cysteine and 1-deoxy-D-xylulose-5-phosphate;
                     forms a complex with ThiG; contains an iron-sulfur center"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiH"
                     /protein_id="YP_068831.1"
                     /db_xref="GI:51594640"
                     /db_xref="GeneID:2956693"
                     /translation="MSEDFNQRWQQLDWDDISLTINSKKPADVERALNAIKPTREDLM
                     ALISPAALAYLEPMAQKAQQLTRQRFGNTVSFYVPLYLSNLCANDCTYCGFSMSNRIK
                     RKTLDEAEIIRECEAIKALGFEHLLLVTGEHQTKVGMDYFRRHLPTIRSRFSSLMMEV
                     QPLAEDEYTELKALGLDGVMVYQETYHPATYQQHHLRGHKQDFHWRLATPDRLGRAGI
                     DKIGLGALIGLSNSWRTDCYMLAEHLFYLQQTYWQTRYSISFPRLRPCAGGIEPASIM
                     SEPQLLQLICAFRLFAPDVELSLSTRESPFFRDNVIPVAINNVSAGSKTQPGGYADDH
                     PELEQFAPHDNRSPEQVAQALTKAGLQPVWKDWDSHLGRSLR"
     misc_feature    complement(344842..345954)
                     /gene="thiH"
                     /locus_tag="YPTB0285"
                     /note="thiamine biosynthesis protein ThiH; Reviewed;
                     Region: thiH; PRK09240"
                     /db_xref="CDD:236425"
     misc_feature    complement(345103..345726)
                     /gene="thiH"
                     /locus_tag="YPTB0285"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(345175..345180,345286..345288,
                     345418..345420,345481..345489,345568..345573,
                     345577..345579,345682..345690,345694..345696,
                     345700..345702,345706..345708))
                     /gene="thiH"
                     /locus_tag="YPTB0285"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(344878..345195)
                     /gene="thiH"
                     /locus_tag="YPTB0285"
                     /note="Biotin and Thiamin Synthesis associated domain;
                     Region: BATS; pfam06968"
                     /db_xref="CDD:253996"
     gene            complement(345956..346771)
                     /gene="thiG"
                     /locus_tag="YPTB0286"
                     /db_xref="GeneID:2956692"
     CDS             complement(345956..346771)
                     /gene="thiG"
                     /locus_tag="YPTB0286"
                     /note="functions in thiamine (vitamin B1) biosynthesis; in
                     Bacillus subtilis this enzyme catalyzes the formation of
                     thiazole from dehydroxyglycine and
                     1-deoxy-D-xylulose-5-phosphate and ThiS-thiocarboxylate"
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase"
                     /protein_id="YP_068832.1"
                     /db_xref="GI:51594641"
                     /db_xref="GeneID:2956692"
                     /translation="MLKIADTTFTSRLFTGTGKFSSPELMLEALRASGSQLITMAMKR
                     VDLQSGNDAILAPLRQLGVRLLPNTSGAKTAEEAIFAARLAREALNTHWVKLEIHPDV
                     RYLLPDPIETLKAAEVLVKEGFVVLPYCGADPVLCKRLEEVGCAAVMPLGSPIGSNLG
                     LRTRDFLQIIIEQSKVPVVVDAGIGAPSHALEALELGADAVLVNTAIAVAHSPVQMAH
                     AFRLAVESGERARLAGLGASPFNPSQPDTLQLRATATSPLTGFLSQLEEQDHV"
     misc_feature    complement(345998..346768)
                     /gene="thiG"
                     /locus_tag="YPTB0286"
                     /note="Thiazole synthase (ThiG) is the tetrameric enzyme
                     that is involved in the formation of the thiazole moiety
                     of thiamin pyrophosphate, an essential ubiquitous cofactor
                     that plays an important role in carbohydrate and amino
                     acid metabolism. ThiG catalyzes...; Region: ThiG; cd04728"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(346604..346606,346613..346615,
                     346649..346651))
                     /gene="thiG"
                     /locus_tag="YPTB0286"
                     /note="ThiS interaction site; other site"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(346229..346231,346481..346483,
                     346487..346489))
                     /gene="thiG"
                     /locus_tag="YPTB0286"
                     /note="putative active site [active]"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(346001..346003,346007..346015,
                     346019..346021,346025..346030,346064..346078,
                     346082..346087,346094..346096,346115..346117,
                     346124..346129,346136..346144,346157..346159,
                     346184..346189,346196..346198,346208..346216,
                     346256..346258,346268..346270,346286..346288,
                     346295..346303,346355..346360,346367..346375,
                     346379..346381,346448..346456,346463..346465,
                     346472..346474))
                     /gene="thiG"
                     /locus_tag="YPTB0286"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240079"
     gene            complement(346773..346988)
                     /gene="thiS"
                     /locus_tag="YPTB0287"
                     /db_xref="GeneID:2956699"
     CDS             complement(346773..346988)
                     /gene="thiS"
                     /locus_tag="YPTB0287"
                     /note="with ThiF, ThiG, and ThiO catalyzes the formation
                     of the thiazole moiety of thiamine pyrophosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur carrier protein ThiS"
                     /protein_id="YP_068833.1"
                     /db_xref="GI:51594642"
                     /db_xref="GeneID:2956699"
                     /translation="MKTNYIPIMLNDQPLEVECNLTAEMLLNQLKHHQPGTALAINQV
                     IIPRADWQNHRLQAGDHILLFQAIAGG"
     misc_feature    complement(346776..346967)
                     /gene="thiS"
                     /locus_tag="YPTB0287"
                     /note="ThiaminS ubiquitin-like sulfur carrier protein;
                     Region: ThiS; cd00565"
                     /db_xref="CDD:176353"
     misc_feature    complement(order(346794..346802,346854..346856))
                     /gene="thiS"
                     /locus_tag="YPTB0287"
                     /note="thiS-thiF/thiG interaction site; other site"
                     /db_xref="CDD:176353"
     gene            complement(346985..347782)
                     /gene="thiF"
                     /locus_tag="YPTB0288"
                     /db_xref="GeneID:2956691"
     CDS             complement(346985..347782)
                     /gene="thiF"
                     /locus_tag="YPTB0288"
                     /note="catalyzes the adenylation of ThiS which is involved
                     in the formation of 5-methyl-4-(beta-hydroxyethyl)thiazole
                     phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiF"
                     /protein_id="YP_068834.1"
                     /db_xref="GI:51594643"
                     /db_xref="GeneID:2956691"
                     /translation="MKNDQTLSDSEFLRYSRQLLLEDIGPEGQRKLKGASVLIVGLGG
                     LGSPAALYLAAAGVGQLLLADDDQLDLTNLQRQILYRTADIGQTLSNPTSSVSHNKAR
                     LAQRHLQQLNPQIRIVALDTRLTGQVLTDAVANADLVLDCSDNMETRHQVNAACVTAQ
                     KPLISGSAVGFSGQLLVIEPPYAQGCYACIYPDKELPQRNCRTAGVLGPVVGVIGTLQ
                     ALEAIKMLAGIPLALSGKLRLFDGKQQSWSTLQLTRAAHCPACGGGL"
     misc_feature    complement(347009..347773)
                     /gene="thiF"
                     /locus_tag="YPTB0288"
                     /note="molybdopterin biosynthesis protein MoeB;
                     Provisional; Region: PRK05690"
                     /db_xref="CDD:180204"
     misc_feature    complement(347027..347743)
                     /gene="thiF"
                     /locus_tag="YPTB0288"
                     /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
                     in molybdopterin and thiamine biosynthesis family. The
                     common reaction mechanism catalyzed by MoeB and ThiF, like
                     other E1 enzymes, begins with a nucleophilic attack of the
                     C-terminal carboxylate of MoaD...; Region:
                     ThiF_MoeB_HesA_family; cd00757"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(347339..347341,347357..347359,
                     347483..347485,347555..347557,347582..347584,
                     347588..347590,347648..347650,347654..347656,
                     347660..347662))
                     /gene="thiF"
                     /locus_tag="YPTB0288"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(347030..347035,347039..347041,
                     347060..347062,347072..347074,347261..347263,
                     347267..347269,347279..347284,347336..347338,
                     347348..347356,347648..347650))
                     /gene="thiF"
                     /locus_tag="YPTB0288"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    complement(347606..347671)
                     /gene="thiF"
                     /locus_tag="YPTB0288"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            complement(347772..348419)
                     /gene="thiE"
                     /locus_tag="YPTB0289"
                     /db_xref="GeneID:2956690"
     CDS             complement(347772..348419)
                     /gene="thiE"
                     /locus_tag="YPTB0289"
                     /EC_number="2.5.1.3"
                     /note="catalyzes the formation of thiamine monophosphate
                     from 4-methyl-5-(beta-hydroxyethyl)-thiazole monophosphate
                     and 4-amino-5-hydroxymethyl pyrimidine pyrophosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="YP_068835.1"
                     /db_xref="GI:51594644"
                     /db_xref="GeneID:2956690"
                     /translation="MATPGFPSTEQRLGLYPVVDSLLWIERLLAAGVTTLQLRIKNAD
                     DAQVEQDIVAAIELGKRYQARLFINDYWQLAVKHGAYGVHLGQEDLETADLAAIQQAG
                     LRLGISTHDEHELAVAKTLRPSYIALGHIFPTQTKQMPSSPQGLASLSRQVKNTPDYP
                     TVAIGGISIERVPHVLATGVGSVAVVSAITLASDWQRATAQLLHLIEGKELADEK"
     misc_feature    complement(347811..348377)
                     /gene="thiE"
                     /locus_tag="YPTB0289"
                     /note="Thiamine monophosphate synthase (TMP
                     synthase)/TenI. TMP synthase catalyzes an important step
                     in the thiamine biosynthesis pathway, the substitution of
                     the pyrophosphate of 2-methyl-4-amino-5-
                     hydroxymethylpyrimidine pyrophosphate by 4-methyl-5-;
                     Region: TMP_TenI; cd00564"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(347859..347870,347922..347924,
                     347934..347936,348012..348014,348018..348020,
                     348039..348041,348045..348047,348096..348098,
                     348168..348170,348303..348305,348309..348311,
                     348366..348368,348372..348374))
                     /gene="thiE"
                     /locus_tag="YPTB0289"
                     /note="thiamine phosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(347859..347864,347922..347924,
                     348009..348014,348018..348020,348096..348098,
                     348153..348155,348210..348215,348297..348299,
                     348303..348305,348309..348311))
                     /gene="thiE"
                     /locus_tag="YPTB0289"
                     /note="active site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(348009..348011,348096..348098,
                     348153..348155,348162..348164,348210..348215,
                     348297..348299,348303..348305))
                     /gene="thiE"
                     /locus_tag="YPTB0289"
                     /note="pyrophosphate binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238317"
     gene            complement(348433..350478)
                     /gene="thiC"
                     /locus_tag="YPTB0290"
                     /db_xref="GeneID:2956688"
     CDS             complement(348433..350478)
                     /gene="thiC"
                     /locus_tag="YPTB0290"
                     /note="required for the synthesis of the
                     hydromethylpyrimidine moiety of thiamine"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiC"
                     /protein_id="YP_068836.1"
                     /db_xref="GI:51594645"
                     /db_xref="GeneID:2956688"
                     /translation="MSNNTTSLPAENSSHPRKGTPIRKKQREEAQQFINTLQGVTFPN
                     SQRIYLQGSRPDIQVPMREIQLSPTQIGGSKNEPRYEDNEAIPVYDTSGPYGDPQAKL
                     DVHNGLPKLRAAWVADRQDTEALASVSSGFTQQRLADEGLDHLRFEHLPRPRKAATGQ
                     CVTQLHYARQGKITPEMEFIALRENMGRERIRGEVLLQQHPGQAFGAHLPENITAEFV
                     RQEVAAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTR
                     WGADTVMDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGVAENLTWEMFRDTL
                     LEQAEQGVDYFTLHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFR
                     EICQICAAYDVSLSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGP
                     GHVPMQMIRRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAML
                     CYVTPKEHLGLPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWED
                     QFNLALDPATARAYHDETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAAAQEQAAA
                     QAQAATPTTAAQPIDITQPINMLQSGMEKMSAEFRSRGSELYHRPANLSAEANNEPT"
     misc_feature    complement(348478..350409)
                     /gene="thiC"
                     /locus_tag="YPTB0290"
                     /note="thiamine biosynthesis protein ThiC; Provisional;
                     Region: PRK09284"
                     /db_xref="CDD:236451"
     misc_feature    complement(350107..350355)
                     /gene="thiC"
                     /locus_tag="YPTB0290"
                     /note="ThiC-associated domain; Region: ThiC-associated;
                     pfam13667"
                     /db_xref="CDD:257973"
     misc_feature    complement(348640..349992)
                     /gene="thiC"
                     /locus_tag="YPTB0290"
                     /note="ThiC family; Region: ThiC; pfam01964"
                     /db_xref="CDD:250998"
     misc_feature    complement(350471..350730)
                     /product="pseudogene"
                     /note="similar to Yersinia pestis YPO3738 with a
                     frameshift"
                     /pseudo
     gene            complement(350853..351362)
                     /gene="rsd"
                     /locus_tag="YPTB0291"
                     /db_xref="GeneID:2956552"
     CDS             complement(350853..351362)
                     /gene="rsd"
                     /locus_tag="YPTB0291"
                     /note="binds specifically to the major sigma factor sigma
                     70; active in stationary phase"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-RNA polymerase sigma 70 factor"
                     /protein_id="YP_068837.1"
                     /db_xref="GI:51594646"
                     /db_xref="GeneID:2956552"
                     /translation="MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKE
                     KHTPLNAKTLENFCHNLVDYLSSGHFHIYDRIIKEVEGASSPKMALTAKIHPALKNNT
                     QTIMAFHDRYTNIEIDDDSCTEYQQALSDIGEALDARFKLEDQLIQWAAESWQAAQLA
                     DADKKSQVN"
     misc_feature    complement(350892..351362)
                     /gene="rsd"
                     /locus_tag="YPTB0291"
                     /note="Regulator of sigma D [Transcription]; Region: Rsd;
                     COG3160"
                     /db_xref="CDD:225702"
     gene            351459..352241
                     /gene="nudC"
                     /locus_tag="YPTB0292"
                     /db_xref="GeneID:2953149"
     CDS             351459..352241
                     /gene="nudC"
                     /locus_tag="YPTB0292"
                     /note="can catalyze hydrolysis of broad range of
                     dinucleotide pyrophosphates but prefers reduced form of
                     NADH; requires divalent metal ions such as magnesium and
                     manganese and produces two mononucleoside 5'-phosphates"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH pyrophosphatase"
                     /protein_id="YP_068838.1"
                     /db_xref="GI:51594647"
                     /db_xref="GeneID:2953149"
                     /translation="MELQLTGKESGWWIVSHENKLWLPKGELPQGNAANWSLQGATAR
                     QIGEWQGQPVWLIRQMMPSGMGSVRQLLDVDRGLFQLAGRGVQLAEFYRSHRFCGYCG
                     HEMHASRTEWASLCNHCRERYYPQIAPCVIVAIRRGDEILLAQHVRHRGGINTVLAGF
                     VEVGETLEQAVSREVLEESNIHIKNLRYVTSQPWPFPHSLMMAFMADYDSGELCHDPK
                     ELLNAGWYRYDQLPLLPPPGTVARRLIEDTVVLCREHSDLSQ"
     misc_feature    351459..352214
                     /gene="nudC"
                     /locus_tag="YPTB0292"
                     /note="NADH pyrophosphatase; Reviewed; Region: nudC;
                     PRK00241"
                     /db_xref="CDD:234699"
     misc_feature    351486..351731
                     /gene="nudC"
                     /locus_tag="YPTB0292"
                     /note="NADH pyrophosphatase-like rudimentary NUDIX domain;
                     Region: NUDIX-like; pfam09296"
                     /db_xref="CDD:255270"
     misc_feature    351735..351830
                     /gene="nudC"
                     /locus_tag="YPTB0292"
                     /note="NADH pyrophosphatase zinc ribbon domain; Region:
                     zf-NADH-PPase; pfam09297"
                     /db_xref="CDD:255271"
     misc_feature    351843..352205
                     /gene="nudC"
                     /locus_tag="YPTB0292"
                     /note="NADH pyrophosphatase, a member of the Nudix
                     hydrolase superfamily, catalyzes the cleavage of NADH into
                     reduced nicotinamide mononucleotide (NMNH) and AMP. Like
                     other members of the Nudix family, it requires a divalent
                     cation, such as Mg2+ or Mn2+, for...; Region:
                     NADH_pyrophosphatase; cd03429"
                     /db_xref="CDD:239521"
     misc_feature    order(351846..351848,351930..351938,352038..352040,
                     352047..352049,352053..352055,352059..352061)
                     /gene="nudC"
                     /locus_tag="YPTB0292"
                     /note="putative NADH binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239521"
     misc_feature    order(351933..351938,351942..351944,351978..351980,
                     351987..351992,352038..352040,352047..352049,
                     352053..352055,352059..352061)
                     /gene="nudC"
                     /locus_tag="YPTB0292"
                     /note="putative active site [active]"
                     /db_xref="CDD:239521"
     misc_feature    351933..352001
                     /gene="nudC"
                     /locus_tag="YPTB0292"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239521"
     misc_feature    order(351978..351980,351987..351992,352113..352115)
                     /gene="nudC"
                     /locus_tag="YPTB0292"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239521"
     gene            352334..353119
                     /locus_tag="YPTB0293"
                     /db_xref="GeneID:2953150"
     CDS             352334..353119
                     /locus_tag="YPTB0293"
                     /note="similar to Yersinia pestis YPO3735 hypothetical
                     protein (100% evalue=1.E-139)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068839.1"
                     /db_xref="GI:51594648"
                     /db_xref="GeneID:2953150"
                     /translation="MRPIITQTVQPVTSMYPSLPKAFIQDKVMLSLHNKAALDSTIKG
                     DAVRALLLHAYVDIKGNEVERRTTAVGIQKLYEEVLQELLYQDPKCISVMISHTANPP
                     TPLSIASPERVMQMMHQNIRQDIASQKTITDRTQTLHNLLSYKNQFQYKAIYDQPRLK
                     PEENYNFKMVNDVHENLHSIQTDSCCKAGALTGATYFLQDSPGEIHVFGIRITQANEE
                     SGKVELFQGLKSDVQTNNKLDSLYLLLRGNSHQSPDDISSSVG"
     gene            353238..354305
                     /gene="hemE"
                     /locus_tag="YPTB0294"
                     /db_xref="GeneID:2955777"
     CDS             353238..354305
                     /gene="hemE"
                     /locus_tag="YPTB0294"
                     /EC_number="4.1.1.37"
                     /note="catalyzes the formation of coproporphyrinogen from
                     uroporphyrinogen III"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="YP_068840.1"
                     /db_xref="GI:51594649"
                     /db_xref="GeneID:2955777"
                     /translation="MNELKNDRYLRALLRQPVDMTPVWMMRQAGRYLPEYKATRAIAG
                     DFMSLCKNAELACEVTMQPLRRYPLDAAILFSDILTIPDAMGLGLYFETGEGPRFQSP
                     ITCRADVEKLPIPDPEQELGYVMNAVRTIRRELAGSVPLIGFSGSPWTLATYMVEGGS
                     SKAFTKLKKMMYAEPQTLHLLLDKLADSVILYLNAQIKAGAQSVMIFDTWGGVLTGRD
                     YHEFSLNYMHKIVDGLIRENEGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWTTDIA
                     DARRRVGDKVALQGNMDPSVLYAPPARIEQEVSTILASFGQGEGHVFNLGHGIHQDVP
                     PAHAGAFVNAVHALSRPYHQK"
     misc_feature    353265..354278
                     /gene="hemE"
                     /locus_tag="YPTB0294"
                     /note="Uroporphyrinogen decarboxylase (URO-D) is a dimeric
                     cytosolic enzyme that decarboxylates the four acetate side
                     chains of uroporphyrinogen III (uro-III) to create
                     coproporphyrinogen III, without requiring any prosthetic
                     groups or cofactors. This reaction...; Region: URO-D;
                     cd00717"
                     /db_xref="CDD:238368"
     misc_feature    order(353313..353330,353343..353345,353355..353357,
                     353373..353375,353454..353474,353508..353510,
                     353523..353525,353667..353669,353697..353699,
                     353715..353717,353856..353858,353862..353867,
                     353979..353981,354216..354218)
                     /gene="hemE"
                     /locus_tag="YPTB0294"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238368"
     misc_feature    order(353316..353318,353328..353330,353466..353468,
                     353697..353699,353862..353864,354216..354218)
                     /gene="hemE"
                     /locus_tag="YPTB0294"
                     /note="active site"
                     /db_xref="CDD:238368"
     gene            354371..355075
                     /gene="nfi"
                     /locus_tag="YPTB0295"
                     /db_xref="GeneID:2956135"
     CDS             354371..355075
                     /gene="nfi"
                     /locus_tag="YPTB0295"
                     /EC_number="3.1.21.7"
                     /note="Selectively cleaves double-stranded DNA at the
                     second phosphodiester bond 3' to a deoxyinosine leaving
                     behind the intact lesion on the nicked DNA; cleaves DNA
                     containing urea residues, AP sites, base mismatches,
                     insertion/deletion mismatches, flaps, and pseudo-Y
                     structures"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="YP_068841.1"
                     /db_xref="GI:51594650"
                     /db_xref="GeneID:2956135"
                     /translation="MFDTKALQAEQRQRASEISLHDGIDNQFVRFIAGADVGFEQHGE
                     ITRAAIAILRYPSLALVEYQVARVATSLPYIPGLLSFREYPALLAAWAQLQQRPDLIL
                     VDGQGIAHPRRLGVASHFGLLVDVPTIGVAKSRLCGDFLPLHQDVGAVQPLFDNDEQL
                     GWVWRSKIRCNPLFISPGHRVSVGSALAWVQRCMAGYRLPEPTRWADAIASNRPQFQR
                     WLRKNPDFLGKRRDMI"
     misc_feature    354383..355003
                     /gene="nfi"
                     /locus_tag="YPTB0295"
                     /note="Endonuclease_V, a DNA repair enzyme that initiates
                     repair of nitrosative deaminated purine bases; Region:
                     Endonuclease_V; cd06559"
                     /db_xref="CDD:143472"
     misc_feature    order(354476..354478,354482..354487,354590..354592,
                     354596..354607,354680..354688,354698..354700,
                     354713..354718,354764..354778,354989..354991,
                     355001..355003)
                     /gene="nfi"
                     /locus_tag="YPTB0295"
                     /note="Active_site [active]"
                     /db_xref="CDD:143472"
     gene            355121..355711
                     /locus_tag="YPTB0296"
                     /db_xref="GeneID:2953151"
     CDS             355121..355711
                     /locus_tag="YPTB0296"
                     /note="similar to Yersinia pestis YPO3732 conserved
                     hypothetical protein (99.4% evalue=1.E-109); Salmonella
                     typhi STY3716 yjaG; conserved hypothetical protein (80.6%
                     evalue=4.E-91)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068842.1"
                     /db_xref="GI:51594651"
                     /db_xref="GeneID:2953151"
                     /translation="MLRNPIHLRLEKLESWQHLTFMACLCERMYPNYQQFCLETGFGD
                     PAVYRRILDLIWETLVVKDAKVNFDSQLEKLEEAIPSSDDYAIYGVYPAIDACIALSE
                     AIHSRLSGETLEHAIAISEASIRTVAMLEMTLAGKEMTDEELKILPAIEEEWDIQWEI
                     FRLLADCEERDLDLIKGLRSDLREAAVSNIGINLTQ"
     misc_feature    355121..355702
                     /locus_tag="YPTB0296"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3068"
                     /db_xref="CDD:225610"
     gene            355900..356175
                     /gene="hupA"
                     /locus_tag="YPTB0297"
                     /db_xref="GeneID:2955849"
     CDS             355900..356175
                     /gene="hupA"
                     /locus_tag="YPTB0297"
                     /note="histone-like DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator HU subunit alpha"
                     /protein_id="YP_068843.1"
                     /db_xref="GI:51594652"
                     /db_xref="GeneID:2955849"
                     /translation="MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQL
                     VGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVKS"
     misc_feature    355903..356160
                     /gene="hupA"
                     /locus_tag="YPTB0297"
                     /note="histone-like DNA-binding protein HU; Region: HU;
                     cd13831"
                     /db_xref="CDD:259853"
     misc_feature    order(355915..355917,355924..355929,355936..355938,
                     355963..355974,355978..355986,355990..355998,
                     356002..356007,356017..356031,356038..356040,
                     356122..356130,356134..356136,356140..356142,
                     356152..356157)
                     /gene="hupA"
                     /locus_tag="YPTB0297"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259853"
     misc_feature    order(356056..356058,356062..356067,356071..356073,
                     356077..356088,356101..356106,356110..356112)
                     /gene="hupA"
                     /locus_tag="YPTB0297"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259853"
     gene            356177..356878
                     /gene="yjaH"
                     /locus_tag="YPTB0298"
                     /db_xref="GeneID:2957080"
     CDS             356177..356878
                     /gene="yjaH"
                     /locus_tag="YPTB0298"
                     /note="similar to Yersinia pestis YPO3730 yjaH; exported
                     protein (99.5% evalue=1.E-121); Salmonella typhimurium
                     STM4171 yjaH; inner membrane protein (42.5%
                     evalue=5.E-43)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068844.1"
                     /db_xref="GI:51594653"
                     /db_xref="GeneID:2957080"
                     /translation="MSVKIISRGGIKPLLFMRRVLITFGLTLGLSACSSLSDPPQFSA
                     SGYIADSGVVRLWRQDNAQQQPQVLMSVYSPYFGGNTRVTFYEYQNGILREIRRNDLG
                     ATPQSVQLRFDEQGQVSFMQRQLASRRESLSADDIAVYQLEAKRILELSRVLRAGDVR
                     LIQGRWQDGMLTTCAGKTLRLNLDDNSQAWLTTRGEKNTQPLGVAWLDSSEGQQLLLV
                     ANQDFCRWEPQAGSL"
     misc_feature    356225..356281
                     /gene="yjaH"
                     /locus_tag="YPTB0298"
                     /note="Prokaryotic membrane lipoprotein lipid attachment
                     site; Region: LPAM_1; pfam08139"
                     /db_xref="CDD:149279"
     misc_feature    356306..356863
                     /gene="yjaH"
                     /locus_tag="YPTB0298"
                     /note="Protein of unknown function (DUF1481); Region:
                     DUF1481; pfam07356"
                     /db_xref="CDD:148775"
     gene            complement(357064..358350)
                     /gene="purD"
                     /locus_tag="YPTB0299"
                     /db_xref="GeneID:2956369"
     CDS             complement(357064..358350)
                     /gene="purD"
                     /locus_tag="YPTB0299"
                     /EC_number="6.3.4.13"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="YP_068845.1"
                     /db_xref="GI:51594654"
                     /db_xref="GeneID:2956369"
                     /translation="MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLE
                     NVDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLE
                     GSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMT
                     LEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRV
                     GDGDTGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMI
                     SADGQPKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGV
                     VLAAGGYPADYRQGDVIHGLPQQEVKDGKVFHAGTKLNGNHEVVTNGGRVLCVTALGE
                     TVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAIARGK"
     misc_feature    complement(357073..358350)
                     /gene="purD"
                     /locus_tag="YPTB0299"
                     /note="phosphoribosylamine--glycine ligase; Provisional;
                     Region: PRK00885"
                     /db_xref="CDD:234856"
     misc_feature    complement(358045..358347)
                     /gene="purD"
                     /locus_tag="YPTB0299"
                     /note="Phosphoribosylglycinamide synthetase, N domain;
                     Region: GARS_N; pfam02844"
                     /db_xref="CDD:251569"
     misc_feature    complement(357463..358044)
                     /gene="purD"
                     /locus_tag="YPTB0299"
                     /note="Phosphoribosylglycinamide synthetase, ATP-grasp (A)
                     domain; Region: GARS_A; pfam01071"
                     /db_xref="CDD:250341"
     misc_feature    complement(357079..357363)
                     /gene="purD"
                     /locus_tag="YPTB0299"
                     /note="Phosphoribosylglycinamide synthetase, C domain;
                     Region: GARS_C; pfam02843"
                     /db_xref="CDD:251568"
     gene            complement(358410..359999)
                     /gene="purH"
                     /locus_tag="YPTB0300"
                     /db_xref="GeneID:2956372"
     CDS             complement(358410..359999)
                     /gene="purH"
                     /locus_tag="YPTB0300"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /note="involved in de novo purine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="YP_068846.1"
                     /db_xref="GI:51594655"
                     /db_xref="GeneID:2956372"
                     /translation="MQQRRPIRRALLSVSDKAGIIEFAQALSQRGIELLSTGGTARLL
                     ADAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDGIMAQHGIQPIDIVV
                     VNLYPFAQTVARPDCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYPAIITEL
                     DNNDGSLTYPTRFNLAIKAFEHTAAYDSMIANYFGTLVPPYHGDTEQPSGHFPRTLNL
                     NYIKKQDMRYGENSHQQAAFYIEEDVKEASVATAQQLQGKALSYNNIADTDAALECVK
                     EFSEPACVIVKHANPCGVAIGDSILAAYERAYQTDPTSAFGGIIAFNRELDAATANAI
                     ISRQFVEVIIAPTVSSDALALLAAKQNVRVLTCGQWQARSAGLDFKRVNGGLLVQERD
                     LGMVTAADLRVVSKRQPTEQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSR
                     VYSAKIAGIKAADEGLEVAGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEV
                     IAAADEHGIAMIFTDMRHFRH"
     misc_feature    complement(358413..359990)
                     /gene="purH"
                     /locus_tag="YPTB0300"
                     /note="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase; Provisional; Region:
                     purH; PRK00881"
                     /db_xref="CDD:234854"
     misc_feature    complement(359418..359978)
                     /gene="purH"
                     /locus_tag="YPTB0300"
                     /note="Inosine monophosphate cyclohydrolase domain. This
                     is the N-terminal domain in the purine biosynthesis
                     pathway protein ATIC (purH). The bifunctional ATIC protein
                     contains a C-terminal  ATIC formylase domain that
                     formylates...; Region: IMPCH; cd01421"
                     /db_xref="CDD:238709"
     misc_feature    complement(order(359619..359621,359688..359690,
                     359790..359795,359880..359882,359889..359891,
                     359949..359951,359955..359957))
                     /gene="purH"
                     /locus_tag="YPTB0300"
                     /note="purine monophosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    complement(order(359418..359420,359427..359432,
                     359436..359444,359466..359474,359481..359483,
                     359583..359585,359592..359597,359607..359609,
                     359616..359624,359760..359762,359769..359774,
                     359781..359789,359796..359801,359808..359813,
                     359820..359822))
                     /gene="purH"
                     /locus_tag="YPTB0300"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    complement(order(359619..359621,359793..359795))
                     /gene="purH"
                     /locus_tag="YPTB0300"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:238709"
     misc_feature    complement(358617..359591)
                     /gene="purH"
                     /locus_tag="YPTB0300"
                     /note="AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas;
                     smart00798"
                     /db_xref="CDD:214822"
     gene            360682..362227
                     /locus_tag="YPTB_RNA_102"
                     /db_xref="GeneID:2955123"
     rRNA            360682..362227
                     /locus_tag="YPTB_RNA_102"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:2955123"
     gene            362361..362436
                     /gene="tRNA-Glu3"
                     /locus_tag="YPTB_RNA_15"
                     /db_xref="GeneID:2956762"
     tRNA            362361..362436
                     /gene="tRNA-Glu3"
                     /locus_tag="YPTB_RNA_15"
                     /product="tRNA-Glu"
                     /note="anticodon TTC, Cove Score=56.95"
                     /db_xref="GeneID:2956762"
     gene            362689..365598
                     /locus_tag="YPTB_RNA_103"
                     /db_xref="GeneID:2955124"
     rRNA            362689..365598
                     /locus_tag="YPTB_RNA_103"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:2955124"
     gene            365706..365825
                     /locus_tag="YPTB_RNA_104"
                     /db_xref="GeneID:2955125"
     rRNA            365706..365825
                     /locus_tag="YPTB_RNA_104"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:2955125"
     gene            366224..366490
                     /locus_tag="YPTB0301"
                     /db_xref="GeneID:2953152"
     CDS             366224..366490
                     /locus_tag="YPTB0301"
                     /note="similar to Yersinia pestis YPCD1.93  transposase
                     (100% evalue=2.E-44); Ralstonia solanacearum RS00015
                     tISRso12a, RSc2707; ISRSO12-transposase orfA protein
                     (79.3% evalue=2.E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068847.1"
                     /db_xref="GI:51594656"
                     /db_xref="GeneID:2953152"
                     /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKK
                     FGGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKF"
     misc_feature    366227..366439
                     /locus_tag="YPTB0301"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:250686"
     gene            366568..367323
                     /locus_tag="YPTB0302"
                     /db_xref="GeneID:2953153"
     CDS             366568..367323
                     /locus_tag="YPTB0302"
                     /note="similar to Yersinia pestis YPCD1.94  transposase
                     (99.2% evalue=1.E-146)"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068848.1"
                     /db_xref="GI:51594657"
                     /db_xref="GeneID:2953153"
                     /translation="MMQSRTVYNYRSHRDDRAITQRIREIAETRIRYGCPRIHILLRR
                     EGWLVNHKKTHRIYCLEGLNLRSKRPRRHVTAKHRHARPEVTALEQCWSMDFVADNLF
                     NGRRVRALTIVDNFSRECLAIEVGQGLRGDDVVAVMDRLKHSLGRIPQRLQTDNGSEF
                     ISKSMDRWAYENRVTMDCSRPGKPTDNAFIESFNGSLRDECLNVHGFLSLEDAQEKIE
                     QWRQEYNHFRPYSSLNNLTPAEFARSHQKGPDL"
     misc_feature    366604..367296
                     /locus_tag="YPTB0302"
                     /note="insertion element IS2 transposase InsD;
                     Provisional; Region: PRK14702"
                     /db_xref="CDD:237792"
     misc_feature    366607..366780
                     /locus_tag="YPTB0302"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    366841..367170
                     /locus_tag="YPTB0302"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    367081..367281
                     /locus_tag="YPTB0302"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     misc_feature    complement(367650..369603)
                     /product="IS100 insertion sequence"
     gene            complement(367716..368495)
                     /locus_tag="YPTB0303"
                     /db_xref="GeneID:2953154"
     CDS             complement(367716..368495)
                     /locus_tag="YPTB0303"
                     /note="similar to Yersinia pestis YPO3592 insertion
                     sequence IS100, ATP-binding protein (100% evalue=1.E-142)"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase/IS protein"
                     /protein_id="YP_068849.1"
                     /db_xref="GI:51594658"
                     /db_xref="GeneID:2953154"
                     /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
                     HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERN
                     ENIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQR
                     GVMAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDA
                     ALTSAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
     misc_feature    complement(367719..368495)
                     /locus_tag="YPTB0303"
                     /note="transposase/IS protein; Provisional; Region:
                     PRK09183"
                     /db_xref="CDD:181681"
     misc_feature    complement(<367935..368237)
                     /locus_tag="YPTB0303"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(368148..368171)
                     /locus_tag="YPTB0303"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(367983..367985,368145..368168))
                     /locus_tag="YPTB0303"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(367980..367997)
                     /locus_tag="YPTB0303"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            complement(368495..369517)
                     /locus_tag="YPTB0304"
                     /db_xref="GeneID:2953155"
     CDS             complement(368495..369517)
                     /locus_tag="YPTB0304"
                     /note="similar to Yersinia pestis YPO3591 transposase for
                     insertion sequence IS100 (100% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068850.1"
                     /db_xref="GI:51594659"
                     /db_xref="GeneID:2953155"
                     /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEP
                     PKYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIR
                     SLSVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMR
                     YDTLETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFS
                     PRLCRPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVA
                     NQRKHETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDS
                     FCRGVA"
     misc_feature    complement(368645..369517)
                     /locus_tag="YPTB0304"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    complement(369395..>369493)
                     /locus_tag="YPTB0304"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cl17393"
                     /db_xref="CDD:266662"
     misc_feature    complement(order(369407..369415,369419..369424))
                     /locus_tag="YPTB0304"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     misc_feature    complement(368792..369166)
                     /locus_tag="YPTB0304"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            369677..370834
                     /gene="ytaP"
                     /locus_tag="YPTB0305"
                     /db_xref="GeneID:2957123"
     CDS             369677..370834
                     /gene="ytaP"
                     /locus_tag="YPTB0305"
                     /note="similar to Bacillus subtilis BG11786 ytaP;
                     hypothetical protein (28.9% evalue=5.E-26)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068851.1"
                     /db_xref="GI:51594660"
                     /db_xref="GeneID:2957123"
                     /translation="MNGAAFVSSMILAVIFTTTTVQASPVAYQKEAITENNLPVFYPQ
                     LKQQMNYQSSWLAGKYTDFALWRSDTRKILRQALLTPNSTITFSAEKIEQQDRGSYIA
                     EKIALNITDESRVLGLLLTPKTKGPHPAIVLLHDHGSKFDIGKEKMIRPWGDSAKLAS
                     AQAWSDKFFSGKFVGDELAKRGYVVFSIDSIGWGDRGPMSYERQQALASNFFNLGRSL
                     AGTMAYEDMRTVDFMTTLPSVDRKRIGVLGFSMGAYRAWQLAALSDQVAATAAISWFG
                     NYKGLMTPDNNVLRGQSSFYMLHPGIANKLDFPDIASLAAPRPMLLFNGGKDKLFPAQ
                     AVEQAYDKVHAIWRSQNAEPRLVTRSWPTLGHVFYQEQQDVVFLWLDRWLK"
     misc_feature    369860..370696
                     /gene="ytaP"
                     /locus_tag="YPTB0305"
                     /note="Abhydrolase family; Region: Abhydrolase_7;
                     pfam12715"
                     /db_xref="CDD:257242"
     misc_feature    370196..370807
                     /gene="ytaP"
                     /locus_tag="YPTB0305"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(370908..372563)
                     /gene="actP"
                     /locus_tag="YPTB0306"
                     /gene_synonym="YjcG"
                     /db_xref="GeneID:2956247"
     CDS             complement(370908..372563)
                     /gene="actP"
                     /locus_tag="YPTB0306"
                     /gene_synonym="YjcG"
                     /note="member of the sodium:solute symporter family;
                     cotranscribed with the acs gene which encodes acetyl
                     coenzyme A synthase; mutations affect acetate uptake"
                     /codon_start=1
                     /transl_table=11
                     /product="acetate permease"
                     /protein_id="YP_068852.1"
                     /db_xref="GI:51594661"
                     /db_xref="GeneID:2956247"
                     /translation="MKIRHWSALSLFVLPALAQAEALTGEVHRQPLNIQAIVMFLLFV
                     GGTLYITYWASKRTRSRQDYYTAGGRITGFQNGLAIAGDYMSAASFLGISALVYASGY
                     DGLIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSACGSLVVVA
                     LYLIAQMVGAGKLIQLLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAVMLLS
                     GATFMAIMVMKSVNFNFNTLFSEAVKVHPKGLSIMSPGGLVSDPISALSLGLALMFGT
                     AGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVGPNQTFKDAA
                     GALLGGNNMAAVHLANAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASV
                     IKKGKANERDELRVSKITVIILGIVAIGLGILFEKQNIAFMVGLAFSIAASCNFPIII
                     ISMYWDKLTTRGAMIGGWLGLSTAVILMILGPTIWVTILGHEKPIYPYEYPALFSMIA
                     AFVGTWFFSITDNSETGKQERLLFKSQFVRSQTGLGASKGGAH"
     misc_feature    complement(371013..372455)
                     /gene="actP"
                     /locus_tag="YPTB0306"
                     /gene_synonym="YjcG"
                     /note="Uncharacterized bacterial solute carrier 5
                     subfamily; putative solute-binding domain; Region:
                     SLC5sbd_u4; cd11480"
                     /db_xref="CDD:212050"
     misc_feature    complement(order(371448..371453,371460..371462,
                     372309..372311,372318..372320))
                     /gene="actP"
                     /locus_tag="YPTB0306"
                     /gene_synonym="YjcG"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212050"
     misc_feature    complement(join(371007..371057,371103..371168,
                     371208..371273,371289..371345,371409..371474,
                     371598..371663,371703..371768,371880..371945,
                     371961..372026,372057..372122,372186..372251,
                     372267..372332,372396..372461,372492..372542))
                     /gene="actP"
                     /locus_tag="YPTB0306"
                     /gene_synonym="YjcG"
                     /note="14 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(372560..372871)
                     /locus_tag="YPTB0307"
                     /db_xref="GeneID:2953156"
     CDS             complement(372560..372871)
                     /locus_tag="YPTB0307"
                     /note="similar to Yersinia pestis YPO0252  membrane
                     protein (100% evalue=3.E-53); Salmonella typhimurium
                     STM4274 yjcH; inner membrane protein (66.6%
                     evalue=2.E-35)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068853.1"
                     /db_xref="GI:51594662"
                     /db_xref="GeneID:2953156"
                     /translation="MNDSIYQEIEDNPRFQELVKKRSRFAWLLSLITLTMYVAFIFLI
                     AFEPQWLGTPIYTGSSVTRGIPVGVGLIVTSFILTGIYVIRANGEFDRLTAEIIREVK
                     Q"
     misc_feature    complement(372563..372871)
                     /locus_tag="YPTB0307"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3162"
                     /db_xref="CDD:225704"
     misc_feature    complement(join(372620..372685,372731..372796))
                     /locus_tag="YPTB0307"
                     /note="2 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(372928..374886)
                     /gene="rcs"
                     /locus_tag="YPTB0308"
                     /db_xref="GeneID:2956405"
     CDS             complement(372928..374886)
                     /gene="rcs"
                     /locus_tag="YPTB0308"
                     /EC_number="6.2.1.1"
                     /note="Acs; catalyzes the conversion of acetate and CoA to
                     acetyl-CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthetase"
                     /protein_id="YP_068854.1"
                     /db_xref="GI:51594663"
                     /db_xref="GeneID:2956405"
                     /translation="MSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGK
                     IIDWIKPYKTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDP
                     NQSKTVTYKQLHHDVCQFANVLKSLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
                     VIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVV
                     VFQRTGNASYWEDGRDVWWHDLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVH
                     TTGGYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVP
                     NYPGVNRLSQVVDKHKVNILYTAPTAIRALMAEGDKAIEGTKRDSLRIMGSVGEPINP
                     EAWEWYYNKIGNSKCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVD
                     NLGNPQEGVAEGNLVITDSWPGQARTLFGDHDRFEQTYFSTFKGMYFSGDGARRDEDG
                     YYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLN
                     HGEEPTPELYTEVRNWVRKEIGPLATPDILHWTDSLPKTRSGKIMRRILRKIATGDTS
                     NLGDTSTLADPSVVEKLLEEKQSMQTPS"
     misc_feature    complement(372940..374871)
                     /gene="rcs"
                     /locus_tag="YPTB0308"
                     /note="acetyl-CoA synthetase; Provisional; Region:
                     PRK00174"
                     /db_xref="CDD:234677"
     misc_feature    complement(372985..374805)
                     /gene="rcs"
                     /locus_tag="YPTB0308"
                     /note="Acetyl-CoA synthetase (also known as acetate-CoA
                     ligase and acetyl-activating enzyme); Region: ACS;
                     cd05966"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(373117..373122,373135..373137,
                     373309..373320,373342..373344,373351..373353,
                     373387..373389,373639..373656,373720..373731,
                     373798..373800,373807..373812,373882..373890,
                     373954..373959,373972..373974,374299..374301,
                     374305..374307,374314..374316,374392..374400))
                     /gene="rcs"
                     /locus_tag="YPTB0308"
                     /note="active site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(373120..373122,373135..373137,
                     373312..373320,373798..373800,373807..373812,
                     373882..373890,373954..373956,373972..373974,
                     374299..374301,374305..374307,374314..374316,
                     374392..374400))
                     /gene="rcs"
                     /locus_tag="YPTB0308"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(374071..374076,374080..374097,
                     374104..374106))
                     /gene="rcs"
                     /locus_tag="YPTB0308"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(373309..373311,373342..373344,
                     373351..373353,373387..373389,373639..373656,
                     373720..373731,373954..373959))
                     /gene="rcs"
                     /locus_tag="YPTB0308"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(373645..373647,373726..373731,
                     373954..373959))
                     /gene="rcs"
                     /locus_tag="YPTB0308"
                     /note="acetate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213313"
     gene            375741..377057
                     /gene="gltP"
                     /locus_tag="YPTB0309"
                     /db_xref="GeneID:2955722"
     CDS             375741..377057
                     /gene="gltP"
                     /locus_tag="YPTB0309"
                     /note="carrier protein part of the Na(+)-independent,
                     binding-protein-independent glutamate-aspartate transport
                     system"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/aspartate:proton symporter"
                     /protein_id="YP_068855.1"
                     /db_xref="GI:51594664"
                     /db_xref="GeneID:2955722"
                     /translation="MKSIKISLAWQILIALVLGILVGAVLHNQIESREWLVSNILSPA
                     GDIFIRLIKMIVVPIVISTLIVGIAGVGDAKKLGRIGLKTIIYFEVITTIAIIIGITL
                     ANVFQPGVGIDMSALTVVDISQYEKTTEQVQSGSHSLVSTILSLIPANVFASMAKGDM
                     LPIIFFSVLFGLGLSSLPKETKEPLLNVFKAVSESMFKVTHMIMRYAPIGVFGLISVT
                     VANFGFASLIPLAKLVILVYAAILFFALVILGTVARLCKLRIWILIRILKDELILAYS
                     TASSETVLPRIIEKMEAYGAPKAITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIE
                     LSIGQEIILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMA
                     RTALNVVGNALAVLVIAKWENQFDDKKAKAYEKALFAAEQTPANQS"
     misc_feature    375741..377051
                     /gene="gltP"
                     /locus_tag="YPTB0309"
                     /note="glutamate/aspartate:proton symporter; Provisional;
                     Region: gltP; PRK11283"
                     /db_xref="CDD:183075"
     misc_feature    join(375759..375827,375885..375953,375990..376058,
                     376218..376271,376356..376424,376437..376505,
                     376716..376784,376827..376895)
                     /gene="gltP"
                     /locus_tag="YPTB0309"
                     /note="8 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(377235..377867)
                     /locus_tag="YPTB0310"
                     /db_xref="GeneID:2953157"
     CDS             complement(377235..377867)
                     /locus_tag="YPTB0310"
                     /note="similar to Yersinia pestis YPO0255  two-component
                     response regulator (98% evalue=1.E-113); Salmonella
                     typhimurium STM1391 ssrB; Secretion system regulator:
                     transcriptonal activator, homologous with degU/uvrY/bvgA
                     (54.6% evalue=3.E-57)"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="YP_068856.1"
                     /db_xref="GI:51594665"
                     /db_xref="GeneID:2953157"
                     /translation="MNTKLLIVDDHELIIHGIKNMLAAYPRYLIVGQADNGLEVYNLC
                     RQTEPDMVILDLGLPGMDGLDVIIQLLRRWPAMKILTLTARNEEHYASRTFNSGALGY
                     VLKKSPQQILMAAIQTVAIGKRYIDPALDASMVIKLTQGPANTPTVLTPRERQILKLI
                     TEGSCNRVIAAQLSISQKTVETHRLNMMKKLDVHKVAELIHWSYRLGLNV"
     misc_feature    complement(377238..377867)
                     /locus_tag="YPTB0310"
                     /note="two component system sensor kinase SsrB;
                     Provisional; Region: PRK15369"
                     /db_xref="CDD:185267"
     misc_feature    complement(377508..377852)
                     /locus_tag="YPTB0310"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(377550..377555,377562..377564,
                     377619..377621,377679..377681,377703..377705,
                     377838..377843))
                     /locus_tag="YPTB0310"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(377703..377705)
                     /locus_tag="YPTB0310"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(377679..377687,377691..377696))
                     /locus_tag="YPTB0310"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(377547..377555)
                     /locus_tag="YPTB0310"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(377262..377423)
                     /locus_tag="YPTB0310"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(377280..377282,377313..377327,
                     377331..377336,377340..377345,377367..377375,
                     377412..377420))
                     /locus_tag="YPTB0310"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(377265..377267,377274..377282,
                     377373..377375,377379..377381,377385..377387))
                     /locus_tag="YPTB0310"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(377880..380699)
                     /locus_tag="YPTB0311"
                     /db_xref="GeneID:2953158"
     CDS             complement(377880..380699)
                     /locus_tag="YPTB0311"
                     /note="similar to Yersinia pestis YPO0256 two-component
                     sensor/regulator (98.8% evalue=0); Salmonella typhi
                     STY1728 ssrA, spiR; two-component sensor kinase (44.1%
                     evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor/regulator"
                     /protein_id="YP_068857.1"
                     /db_xref="GI:51594666"
                     /db_xref="GeneID:2953158"
                     /translation="MGKASSLVTRLTLLLGVTLTVIWLILIATTAFFSYENTRQILIN
                     ELTHMASMRADLSNHQFEGAERDAASLISRRESLQSTSPLPEISIKHYDSCYIPFNLD
                     SCNINQHKNDLWIIQAYGTAGQTYYLDSFIIKQKEGIVLFPPQKSSSDYLNQRRKDLL
                     LLPKFPTHNNIYWGAPTYTPQGGWHVSVAVCDKVGTLAGFALKLNDLIAYNHPVEQRD
                     INLLLDKNGELLPISQQATSSNQLHEILNQLKNSKLHDGWQQTPDYLVLRTQLKGPGW
                     QQLVIYPRIGFAWEALKPALYQLPFALVILLLLTSVLSLLLRYYLAIPLWNFINIIGA
                     TGPQAMEPRLPINRIDELGHIARAYNNLLDTLNEQYDTLEMKVKERTLALAKAKRAAE
                     QANRRKSDHLTTISHEIRTPLNGALGAVELLQNTPLDAGQMRLAETAHQCSLSLLAII
                     NNLLDFSRIESGQMTLSLEKTALLPLLDQAMLTIHSQALSKSLALSTFISADIPLELE
                     LDTLRLRQILVNLLGNAVKFTPQGRIQLRVRRQNQTLCFTVEDTGCGIDVQHQQTIFQ
                     PFMQTSDHEQGTGLGLAIADNLAKMMGGHLTVFSEPGQGSCFSLCLPFNAITPPMPFH
                     GELFAPQRLHAQLSAWGMTCQPELANQPSRYFVDNALCYLPGRLYANLKQYLQGAETE
                     VLKSLPLQPWQMHILLVDDSETNRDITGMMLQQLGHQVTLADSGTTALAIGRQHRFDL
                     VLMDIRMPVLDGLATTARWRHDPANIDSHCMITALSANASPDEQIKTSQAGMNHYLSK
                     PVTLGQLAEMLDLTAQFQLERGVDLSPQLSEPQPLLDLADSALSLKLYQSLQVLIQQA
                     KDAIENLPVLSHTLHTIKGCAGQAGLIELQDAVIQLEHALDTHETLTQQDIIQLDEII
                     HVLLQPPTTCESTFIISQGQSLMVK"
     misc_feature    complement(377928..380699)
                     /locus_tag="YPTB0311"
                     /note="two component system sensor kinase SsrA;
                     Provisional; Region: PRK15347"
                     /db_xref="CDD:237951"
     misc_feature    complement(379326..379517)
                     /locus_tag="YPTB0311"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(379341..379343,379353..379355,
                     379362..379364,379374..379376,379383..379385,
                     379395..379397,379443..379445,379452..379454,
                     379464..379466,379473..379475,379485..379487,
                     379497..379499))
                     /locus_tag="YPTB0311"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(379479..379481)
                     /locus_tag="YPTB0311"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(378864..379160)
                     /locus_tag="YPTB0311"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(378876..378878,378882..378887,
                     378900..378902,378906..378908,378954..378965,
                     379032..379037,379041..379043,379047..379049,
                     379053..379055,379119..379121,379128..379130,
                     379140..379142))
                     /locus_tag="YPTB0311"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(379128..379130)
                     /locus_tag="YPTB0311"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(378957..378959,378963..378965,
                     379035..379037,379041..379043))
                     /locus_tag="YPTB0311"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(378273..378611)
                     /locus_tag="YPTB0311"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(378303..378308,378315..378317,
                     378372..378374,378444..378446,378468..378470,
                     378597..378602))
                     /locus_tag="YPTB0311"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(378468..378470)
                     /locus_tag="YPTB0311"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(378444..378452,378456..378461))
                     /locus_tag="YPTB0311"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(378300..378308)
                     /locus_tag="YPTB0311"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(377943..378161)
                     /locus_tag="YPTB0311"
                     /note="Hpt domain; Region: Hpt; pfam01627"
                     /db_xref="CDD:250756"
     misc_feature    complement(order(378021..378023,378030..378032,
                     378075..378080,378087..378089))
                     /locus_tag="YPTB0311"
                     /note="putative binding surface; other site"
                     /db_xref="CDD:238041"
     misc_feature    complement(378087..378089)
                     /locus_tag="YPTB0311"
                     /note="active site"
                     /db_xref="CDD:238041"
     misc_feature    complement(join(379692..379742,379749..379814,
                     380595..380660))
                     /locus_tag="YPTB0311"
                     /note="3 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            380872..382443
                     /locus_tag="YPTB0312"
                     /db_xref="GeneID:2953159"
     CDS             380872..382443
                     /locus_tag="YPTB0312"
                     /note="similar to Yersinia pestis YPO0257 possible type
                     III secretion protein (99.8% evalue=0); Salmonella
                     typhimurium STM1394 ssaC; Secretion system apparatus
                     (51.5% evalue=1.E-138)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion protein EscC/SpiA, outer
                     membrane pore"
                     /protein_id="YP_068858.1"
                     /db_xref="GI:51594667"
                     /db_xref="GeneID:2953159"
                     /translation="MIVGLRQKPYLNLRNYKWMSLIYIMRKITGLILLFFATLLPYGK
                     FSYGKAIPWQGEPFFIYSRGMTVSELLKDLGMNYGIPVVISSEINEHFTGKIRDKTPE
                     KILSELAGRYNITWYYDGETLYFYPVQSIKREFISPDGLAANTLVKYLQRGDVLAGKN
                     CAIKAIPHLDTLEVKGVPICIERVKSVSKMLSEQVRHQNQNKETVKVFPLKYASAADS
                     DYQYRDQNVRLPGLVSVLRELNQGNNLPLAGGNQPDGNQASSPVFSADPRQNAVIIRD
                     RQANMPIYRSLITQLDQRPIQIEISVTIIDVDAGDISQLGVDWSASASIGGTGVSFNS
                     TFAKNNAEGFSTVIGDTGNFMVRLNALQKNSRARILSQPSVVTLNNIQAVLDKNVTFY
                     TKLQGEKVAKLESVTSGSLLRVTPRMIETEGVQEVLLNLNIQDGQQQASTNSNEPLPE
                     IRNSDISTQATLQVGQSLLLGGFIQDTQIESQNKIPLLGDIPLLGGLFRSTDKQSHSV
                     VRLFLIKAVPVNAGE"
     misc_feature    380953..382440
                     /locus_tag="YPTB0312"
                     /note="outer membrane secretin SsaC; Provisional; Region:
                     PRK15346"
                     /db_xref="CDD:237950"
     misc_feature    <381082..>381273
                     /locus_tag="YPTB0312"
                     /note="Prophage endopeptidase tail; Region: Prophage_tail;
                     cl19379"
                     /db_xref="CDD:267732"
     misc_feature    381484..381756
                     /locus_tag="YPTB0312"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    381949..382431
                     /locus_tag="YPTB0312"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; pfam00263"
                     /db_xref="CDD:249725"
     misc_feature    380932..381000
                     /locus_tag="YPTB0312"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            382445..383659
                     /locus_tag="YPTB0313"
                     /db_xref="GeneID:2953160"
     CDS             382445..383659
                     /locus_tag="YPTB0313"
                     /note="similar to Yersinia pestis YPO0258  type-III
                     secretion protein (99.7% evalue=0); Salmonella typhi
                     STY1725 ssaD; pathogenicity island protein (31%
                     evalue=4.E-52)"
                     /codon_start=1
                     /transl_table=11
                     /product="type-III secretion protein, EscD/SpiB"
                     /protein_id="YP_068859.1"
                     /db_xref="GI:51594668"
                     /db_xref="GeneID:2953160"
                     /translation="MTTVFKLRLLNGDLNGRELILPEGEFTLGEQGCDVLLPLSDGNI
                     VTLCVNEYQVMIQVAEEVWINGAQHDLHTPLPLLQSIEIAGLVFVLGEQTDILSGIKV
                     THRARFPLLVWLAIAICVPLSLLFVFLFWLTTQPETLRASIPADVPTQLAERLREPAL
                     QGIKGTWLADGSVTLSGHCASSSMMEPLQHFLLRNHIAFRNQLVCDDRLIASVSDLLH
                     QHGYHDIEVRIGDEPGNIVIYGAVQMGDQWLTVQDTLAAVSGLKGWLVVNAHSGQIQQ
                     LVERLRAAGLLGFLSMTESNKELAISGVLSSEQQQQLKETLAALSQQQPGFPSVRYQN
                     IPASDRTDQFLPAKVVSYGGNTQSAFVRLANGGRLQQGSVLANGYKVVFIGEQGLTLL
                     KANNLVHIPMDF"
     misc_feature    382445..383656
                     /locus_tag="YPTB0313"
                     /note="type III secretion system protein SsaD;
                     Provisional; Region: PRK15367"
                     /db_xref="CDD:185265"
     misc_feature    382457..383650
                     /locus_tag="YPTB0313"
                     /note="type III secretion apparatus protein, YscD/HrpQ
                     family; Region: type_III_yscD; TIGR02500"
                     /db_xref="CDD:233898"
     misc_feature    382772..382840
                     /locus_tag="YPTB0313"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            383678..383899
                     /locus_tag="YPTB0314"
                     /db_xref="GeneID:2953161"
     CDS             383678..383899
                     /locus_tag="YPTB0314"
                     /note="similar to Yersinia pestis YP0259  type III
                     secretion apparatus"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068860.1"
                     /db_xref="GI:51594669"
                     /db_xref="GeneID:2953161"
                     /translation="MQHITVLEEDIKHDPTAIQQRKEILARGRRLITCQLSLLQTPEN
                     YQSLNNMMLALQRAEEIIEILTLRYGNKE"
     misc_feature    383687..383887
                     /locus_tag="YPTB0314"
                     /note="type III secretion system protein, YseE family;
                     Region: type_III_yscE; TIGR02501"
                     /db_xref="CDD:233899"
     gene            383934..384713
                     /locus_tag="YPTB0315"
                     /db_xref="GeneID:2953162"
     CDS             383934..384713
                     /locus_tag="YPTB0315"
                     /note="similar to Yersinia pestis YPO0260  AraC-family
                     regulatory protein (99.5% evalue=1.E-115)"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_068861.1"
                     /db_xref="GI:51594670"
                     /db_xref="GeneID:2953162"
                     /translation="MNTGYALAVLLVKLHKINCSLRNIMKSIQFILFRQEGVLRSDGE
                     RYVIPAGKLVIADEQASASAFANSAITSILCYPIDLFPIYQDLARRTLPLNKGHLPHA
                     VNDKYKVLPANVEIIQAAEELINIERVASLRFLYLYCLGIDNVYFSKLLDSIVGTNNE
                     LLEFFEKNRLNPWSVSRYANELGISTRKLNFLFYEKFGMSAKQWLLDQRLKKGCELLL
                     STRLRVADIAMECGFSNHAHFSDSFRRRFQQCPSHMRSLIE"
     misc_feature    384465..384698
                     /locus_tag="YPTB0315"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     misc_feature    384585..384698
                     /locus_tag="YPTB0315"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            384723..384938
                     /locus_tag="YPTB0316"
                     /db_xref="GeneID:2953163"
     CDS             384723..384938
                     /locus_tag="YPTB0316"
                     /note="similar to Yersinia pestis YPO0260a  type III
                     secretion apparatus (95.7% evalue=6.E-32)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion apparatus"
                     /protein_id="YP_068862.1"
                     /db_xref="GI:51594671"
                     /db_xref="GeneID:2953163"
                     /translation="MQISSPMGQLTNDIQQARQAYQNQMAAVNINEPEQMLKSQFTMN
                     QYSAFLDLKSIEMKMINDIRNRILSRI"
     misc_feature    384723..384935
                     /locus_tag="YPTB0316"
                     /note="Type III secretion needle MxiH like; Region: MxiH;
                     cl09641"
                     /db_xref="CDD:263829"
     gene            384935..385183
                     /locus_tag="YPTB0317"
                     /db_xref="GeneID:2953164"
     CDS             384935..385183
                     /locus_tag="YPTB0317"
                     /note="similar to Yersinia pestis YPO0261  type III
                     secretion apparatus (100% evalue=5.E-39)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion apparatus"
                     /protein_id="YP_068863.1"
                     /db_xref="GI:51594672"
                     /db_xref="GeneID:2953164"
                     /translation="MSLLSADCRQLVVEAALAGVNHSLLAEAHDIVNALPLLIPDPQV
                     RLVCEAMLRFGLGDKVQARALLATSGEEDAQILLGLLQ"
     misc_feature    384944..385180
                     /locus_tag="YPTB0317"
                     /note="type III secretion system protein, SsaH family;
                     Region: type_III_ssaH; TIGR02498"
                     /db_xref="CDD:131550"
     gene            385281..385532
                     /locus_tag="YPTB0318"
                     /db_xref="GeneID:2953165"
     CDS             385281..385532
                     /locus_tag="YPTB0318"
                     /note="similar to Yersinia pestis YPO0262  type III
                     secretion apparatus (100% evalue=2.E-40)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion apparatus"
                     /protein_id="YP_068864.1"
                     /db_xref="GI:51594673"
                     /db_xref="GeneID:2953165"
                     /translation="MNMSSAQAVAGLFQATEPPVGNTQQVAKFTQLMAQPASTELMMT
                     PESLLMQQAEWMHASLAIDLTAKVAGVMGQNINKLVNMQ"
     misc_feature    385413..385529
                     /locus_tag="YPTB0318"
                     /note="Type III secretion needle MxiH like; Region: MxiH;
                     cl09641"
                     /db_xref="CDD:263829"
     gene            385529..386260
                     /locus_tag="YPTB0319"
                     /db_xref="GeneID:2953166"
     CDS             385529..386260
                     /locus_tag="YPTB0319"
                     /note="similar to Yersinia pestis YPO0263 type III
                     secretion system apparatus lipoprotein (99.5%
                     evalue=1.E-133); Salmonella typhi STY1711 ssaJ;
                     pathogenicity island lipoprotein (45.3% evalue=9.E-56)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system apparatus lipoprotein,
                     EscJ/SsaJ"
                     /protein_id="YP_068865.1"
                     /db_xref="GI:51594674"
                     /db_xref="GeneID:2953166"
                     /translation="MKSLRQMLAIVLMTLSLSGCDMELYSGLSEGEANQMLALLMLHQ
                     INAEKQIEKSGMVGLTVDKRQFINAVELLRQNGFPRQRFITVDELFPANQLVTSPTQE
                     QAKMVFLKEQQLENMLSHMDGVIHADVTVAMPMSVDGKNPLPHTASVFIKYSPEVNLQ
                     SYQSQIKGLVRDAVPGIDYAKISVVMQPANYRFSASEAEQQQGPQTTVQWLLRHVGMV
                     QNMVGVAFISLIVLMFVGWFYSRRR"
     misc_feature    385529..386257
                     /locus_tag="YPTB0319"
                     /note="Type III secretory pathway, lipoprotein EscJ
                     [Intracellular trafficking and secretion]; Region: EscJ;
                     COG4669"
                     /db_xref="CDD:227015"
     misc_feature    386177..386245
                     /locus_tag="YPTB0319"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     gene            386455..387048
                     /locus_tag="YPTB0320"
                     /db_xref="GeneID:2953167"
     CDS             386455..387048
                     /locus_tag="YPTB0320"
                     /note="similar to Yersinia pestis YPO0264 conserved
                     hypothetical protein (100% evalue=1.E-110); Salmonella
                     typhi STY1710  pathogenicity island protein (34.7%
                     evalue=2.E-18)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068866.1"
                     /db_xref="GI:51594675"
                     /db_xref="GeneID:2953167"
                     /translation="MAFSPSIDVQYLHQLAWRPAQFAHPLWLAAVGVNPENYGYGRSR
                     ALDSALNGMLIQRRKFPQQRLPAVLNPRQQRQIAQRQRLPALCLALGVVSLQCDDYLR
                     LRRYRQVLSPLLNDDDIQQIIGMGYRGQWQASLSPQQLPDVALRLGQSLACQVRSNNI
                     IWQAVSILLPPNPRALCLSRSMQAQTEAWLSRLERLL"
     misc_feature    386482..386967
                     /locus_tag="YPTB0320"
                     /note="Type III secretion system subunit; Region:
                     T3SS_LEE_assoc; pfam13327"
                     /db_xref="CDD:257657"
     gene            387045..387692
                     /locus_tag="YPTB0321"
                     /db_xref="GeneID:2953168"
     CDS             387045..387692
                     /locus_tag="YPTB0321"
                     /note="similar to Yersinia pestis YPO0265  type III
                     secretion system apparatus protein (97.2% evalue=1.E-114);
                     Salmonella typhimurium STM1411 ssaK; Secretion system
                     apparatus (27.4% evalue=2.E-14)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system apparatus protein"
                     /protein_id="YP_068867.1"
                     /db_xref="GI:51594676"
                     /db_xref="GeneID:2953168"
                     /translation="MNPFHLDIEKYGYPLPPGVVIPAAYLAEAMHSQDLLAQANAQAA
                     EILQAAEQARVLLLDQAAEQADALIGQARVQMETALLAQHVRWLVGAEQLESLLITQV
                     RHRILAAITSVVTTWSGEQPMSQILIQRLGDQAEKMAQQGELTLRVHPQHLPAVTTAL
                     GERLRCVGNTEMAADQAQLSSPMLQLTLSLHHHLSQLVLWLQQSPDLFDEENVYE"
     misc_feature    387177..387629
                     /locus_tag="YPTB0321"
                     /note="type III secretion apparatus protein, HrpE/YscL
                     family; Region: HrpE_YscL_not; TIGR02499"
                     /db_xref="CDD:233897"
     misc_feature    <387267..387662
                     /locus_tag="YPTB0321"
                     /note="type III secretion system protein SsaK;
                     Provisional; Region: PRK15354"
                     /db_xref="CDD:185252"
     gene            387685..389733
                     /locus_tag="YPTB0322"
                     /db_xref="GeneID:2953169"
     CDS             387685..389733
                     /locus_tag="YPTB0322"
                     /note="with SsaC forms part of a protein export system
                     across the inner and outer cell membranes; part of the
                     Salmonella pathogenicity island 2; part of the type III
                     secretion system"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion system apparatus protein SsaV"
                     /protein_id="YP_068868.1"
                     /db_xref="GI:51594677"
                     /db_xref="GeneID:2953169"
                     /translation="MSKSALVRGLTMITARQDIFLAVMLLVAVFMMILPLPTTMVDLL
                     IAINLAFSVILLMISIYLRDPLEFSVFPSLLLITTLYRLALTISTTRLVLLQHDAGEI
                     VEAFGQFVVGGNLAVGMIIFTIITVVQFIVITKGSERVAEVSARFSLDGMPGKQMSID
                     GDMRAGAIDSVEAKRLRERVQKESRLFGAMDGAMKFVKGDAIAGIIVILVNIIGGITI
                     GVMQHKMSAEEAMNTYAVLSIGDGLCAQIPSLLISITAGIIVTRVPGSNKQSLANELA
                     VQVGRQPDALWLAAAILTVFALLPGFPFLIFITLAAAVAAPAFLLYRKNRRISQDGRA
                     NGGGEEGAATGQRMTPGAVPLMLHCASNLHHPHLGRDIDGLRWRWFEHLGVPLPEVEI
                     RCDPTLAENTLSVQVYQERVLEVVLPPDSLLLTRPCSSLVTNNQALGAKMGSFDWLDA
                     KQAMQARTLGIPYVEGHQRIITCLTRVFERYTAEFIGVQETRYLMDAMEGRYGELVKE
                     LQRQIPVGKVAEILQRLVEENISIRDLRTIFGALVVWAPKEKDIVMLTEYVRIALRRH
                     LCRRFSHNKTWISVLRLGDGVEHLIRDSIRQTSSGTYSALEERQSLLILNKIKNAFAE
                     NQDAVLLTTLDVRRFVRKIIERDLFVLPVLSWQELGDEMNLKVAGTIELIGDELDETA
                     "
     misc_feature    387691..389715
                     /locus_tag="YPTB0322"
                     /note="secretion system apparatus protein SsaV;
                     Provisional; Region: PRK12720"
                     /db_xref="CDD:183699"
     misc_feature    join(387739..387792,387802..387870,387889..387957,
                     388015..388083,388285..388353,388411..388479,
                     388540..388644)
                     /locus_tag="YPTB0322"
                     /note="7 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            389720..391057
                     /locus_tag="YPTB0323"
                     /db_xref="GeneID:2953170"
     CDS             389720..391057
                     /locus_tag="YPTB0323"
                     /EC_number="3.6.3.14"
                     /note="similar to Yersinia pestis YPO0267  type III
                     secretion system ATP synthase (100% evalue=0); Salmonella
                     typhi STY1705 ssaN; type III secretion ATP synthase (59.4%
                     evalue=1.E-133)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system ATPase"
                     /protein_id="YP_068869.1"
                     /db_xref="GI:51594678"
                     /db_xref="GeneID:2953170"
                     /translation="MKLPDIARLTPRLQQQLTRPSAPPEGLRYRGPIVEIGPTLLRAS
                     LPNVAQGELCRIEPQGMLAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVG
                     ADLAGRILDGLGAPIDGGPPLTGQWRELDCPPPSPLTRQPVEQMLTTGIRAIDGILSC
                     GEGQRIGIFAAAGVGKSTLLSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARA
                     RTVVVVATSDRPALERLKGLSTATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAA
                     GEPPAAGSFPPSVFANLPRLLERTGNSDRGSITAFYTVLVEGDDMNEPVADEVRSLLD
                     GHIVLSRRLAGAGHYPAIDIAASVSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQ
                     IGEYQAGEDLQADEALQRYPAICAFLQQDHSLTRDPDTAHLDTTLEHLAQVVG"
     misc_feature    389720..391054
                     /locus_tag="YPTB0323"
                     /note="type III secretion system ATPase; Validated;
                     Region: PRK06820"
                     /db_xref="CDD:180712"
     misc_feature    390008..390979
                     /locus_tag="YPTB0323"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    order(390227..390232,390242..390250)
                     /locus_tag="YPTB0323"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(390230..390232,390242..390250,390299..390301,
                     390305..390310,390497..390502)
                     /locus_tag="YPTB0323"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    390485..390499
                     /locus_tag="YPTB0323"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            391054..391455
                     /locus_tag="YPTB0324"
                     /db_xref="GeneID:2953171"
     CDS             391054..391455
                     /locus_tag="YPTB0324"
                     /note="similar to Yersinia pestis YPO0268 type III
                     secretion system apparatus protein (99.2% evalue=1.E-70);
                     M. musculus 108655 Foxp1, 4932443N09Rik; forkhead box P1
                     (28.6% evalue=1.E-08)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system apparatus protein"
                     /protein_id="YP_068870.1"
                     /db_xref="GI:51594679"
                     /db_xref="GeneID:2953171"
                     /translation="MNHSQQRTLQRLLALRQRQERRLRQQLGQLRREQQQQEQQLENG
                     RRRHQQLCQQLQQLAQWCGMLTPREADEQKVLRQAVYQAERQAKKQLNAWVAQGRQQV
                     SAIERQQARLRRNQREQEKLRMLTEDESNRY"
     misc_feature    <391255..>391440
                     /locus_tag="YPTB0324"
                     /note="ATPase components of ABC transporters with
                     duplicated ATPase domains [General function prediction
                     only]; Region: Uup; COG0488"
                     /db_xref="CDD:223562"
     gene            391619..391834
                     /locus_tag="YPTB0325"
                     /db_xref="GeneID:2953172"
     CDS             391619..391834
                     /locus_tag="YPTB0325"
                     /note="similar to Yersinia pestis YPO0268a hypothetical
                     protein (98.5% evalue=3.E-35)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068871.1"
                     /db_xref="GI:51594680"
                     /db_xref="GeneID:2953172"
                     /translation="METHYRIVSGPLCGTKVSVSMTAHGLRIVLSHTESKLIERLQRI
                     QNRWQRQLHQLGFPCLLEVTCADESDA"
     gene            391854..392774
                     /locus_tag="YPTB0326"
                     /db_xref="GeneID:2953173"
     CDS             391854..392774
                     /locus_tag="YPTB0326"
                     /note="similar to Yersinia pestis YPO0269 type III
                     secretion system apparatus protein (98% evalue=1.E-176);
                     Salmonella typhimurium STM1418 ssaQ; Secretion system
                     apparatus (26.4% evalue=2.E-25)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system protein"
                     /protein_id="YP_068872.1"
                     /db_xref="GI:51594681"
                     /db_xref="GeneID:2953173"
                     /translation="MIGSGRQTAGVSVALTEIDGEGVYLPLHYGGQECGLWLSQSCWQ
                     HWLNTTLATDNPQLLAAELVIAMANWAVTPLLAPFTDLVVLAESPQKRSLPKQWAVTV
                     AFELEGQPIIGVLQDWPQAALADTLSHWPHEAVTAPDLLWQSGLVAGWCHLSLRQLRQ
                     LGPGEGLRLSMAAELDKEACWVWHHASPQIYIKLEGGNRMTIQQINEASDPLACGSRA
                     ESPPLAAVQLEDLPQTLVMEIGRLTLPLGEIKQLAVGQTLACQTHCYGEVNICLNGQS
                     VGRGSLLRCDEKLVVRIAQWGLQNGENIME"
     misc_feature    391854..392762
                     /locus_tag="YPTB0326"
                     /note="type III secretion system protein SsaQ; Validated;
                     Region: PRK08035"
                     /db_xref="CDD:181204"
     misc_feature    392241..392741
                     /locus_tag="YPTB0326"
                     /note="Flagellar motor switch/type III secretory pathway
                     protein [Cell motility and secretion / Intracellular
                     trafficking and secretion]; Region: FliN; COG1886"
                     /db_xref="CDD:224798"
     gene            392841..393551
                     /locus_tag="YPTB0327"
                     /db_xref="GeneID:2953174"
     CDS             392841..393551
                     /locus_tag="YPTB0327"
                     /note="part of a set of proteins involved in the infection
                     of eukaryotic cells; in plant pathogens involved in the
                     hypersensitivity response"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system protein"
                     /protein_id="YP_068873.2"
                     /db_xref="GI:161760592"
                     /db_xref="GeneID:2953174"
                     /translation="MRNSLLFILSETDDLYETDHMELLNSSYQLIALLFMLSVLPLLV
                     VMGTAFLKLSVVFSLLRNALGVQQVPPNIAIYGLALVLTIFIMAPVGLDVQARLQNEE
                     LSNDIGALAHQIDQNALVPYRDFLQRNTDIEQVTFFNDIVQNKWPERYRDSVKPDSLL
                     ILMPAFTLSQLNEAFKIGLLLFLPFVAIDLIVSNILLAMGMMMVSPMTLSLPFKLLVF
                     VLVDGWSLVLGQLVGSYL"
     misc_feature    392910..393548
                     /locus_tag="YPTB0327"
                     /note="Type III secretory pathway, component EscR
                     [Intracellular trafficking and secretion]; Region: EscR;
                     COG4790"
                     /db_xref="CDD:227128"
     misc_feature    join(392919..392987,393057..393116,393375..393443,
                     393486..393545)
                     /locus_tag="YPTB0327"
                     /note="4 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            393548..393841
                     /locus_tag="YPTB0328"
                     /db_xref="GeneID:2953175"
     CDS             393548..393841
                     /locus_tag="YPTB0328"
                     /note="similar to Yersinia pestis YPO0271  type III
                     secretion apparatus protein (100% evalue=4.E-48);
                     Salmonella typhimurium STM1420 ssaS; Secretion system
                     apparatus: homology with YscS of the secretion system of
                     Yersinia (60.7% evalue=1.E-22)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion apparatus protein
                     EscS/SsaS/YscS"
                     /protein_id="YP_068874.1"
                     /db_xref="GI:51594683"
                     /db_xref="GeneID:2953175"
                     /translation="MNNHMSSYHENAIIVHLATELLWLVLLLSLPVVVVASTVGLVIS
                     LVQALTQIQDQTLQFLIKLLAVSATLLMTYHWMGATLLNYTQQSFLQITSMRP"
     misc_feature    393572..393838
                     /locus_tag="YPTB0328"
                     /note="Type III secretory pathway, component EscS
                     [Intracellular trafficking and secretion]; Region: EscS;
                     COG4794"
                     /db_xref="CDD:227131"
     misc_feature    join(393608..393676,393734..393802)
                     /locus_tag="YPTB0328"
                     /note="2 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            393843..394637
                     /locus_tag="YPTB0329"
                     /db_xref="GeneID:2953176"
     CDS             393843..394637
                     /locus_tag="YPTB0329"
                     /note="similar to Yersinia pestis YPO0272  type III
                     secretion apparatus protein (100% evalue=1.E-145);
                     Salmonella typhi STY1699 ssaT; type III secretion protein
                     (51.7% evalue=2.E-66)"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion apparatus protein
                     EscT/SsaT/YscT"
                     /protein_id="YP_068875.1"
                     /db_xref="GI:51594684"
                     /db_xref="GeneID:2953176"
                     /translation="MTDVLPGLTALALAMMRPYGILLILPLFTARSLGSSLLRNGLIV
                     AIALPVTPLFLSAPIITNSSPVTWIGVLCTELLIGVVMGFVAALPFWAMNMAGFLIDT
                     LRGATMSTLFNPGMGVESSLFGVLFTQILTVLFLISGGFNQVLAALYGSYDSLPIGQG
                     IQPAADLLLFLQTEWQMMFELCLCFALPALLVMVLADLSLGLINRSARQLNVFFLAMP
                     IKSALALFLLLISLPYGLHHYLSRMSDTEQKIGTLIPLIKGGNDVH"
     misc_feature    393843..394619
                     /locus_tag="YPTB0329"
                     /note="Type III secretory pathway, component EscT
                     [Intracellular trafficking and secretion]; Region: EscT;
                     COG4791"
                     /db_xref="CDD:227129"
     misc_feature    join(393855..393923,393960..394028,394071..394139,
                     394200..394268,394383..394451,394470..394538)
                     /locus_tag="YPTB0329"
                     /note="6 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            394627..395694
                     /locus_tag="YPTB0330"
                     /db_xref="GeneID:2953177"
     CDS             394627..395694
                     /locus_tag="YPTB0330"
                     /note="member of a type III secretion system which is part
                     of a pathogenicity island in Salmonella, Yersinia and
                     pathogenic Escherichia coli"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion system apparatus protein SsaU"
                     /protein_id="YP_068876.1"
                     /db_xref="GI:51594685"
                     /db_xref="GeneID:2953177"
                     /translation="MSTEKNEKPTPKRLKEAKEKGQVVKSVEITSGVQLVALVIYFLL
                     TGYSLVEQAKALIRSSIIQLQQPLTLALARIGAECMTVLMHIVVVLGGALIVVTIIAG
                     IAQVGPLLATKAVSFKGERINPIQNAKQLFSLRSVFELMKSLLKVGVLTLIFGYLLMQ
                     YAPSFGYLTHCGSRCALPVFSTLMGWLLGSLIACYLVFSLMDYAFQRYTIMKQLKMSH
                     DEVKREHKDSNGDPHIKQKRRQLQHEVQSGSFATNVRRSTAVVRNPTHFAVCLIYHPE
                     ETPLPIVIEKGHDEQAALIVSLAEQSGIPVVENIALARALHRDVACGDTIPEQFFEPV
                     AALLRMALELDYQPSSDDPPR"
     misc_feature    394633..395676
                     /locus_tag="YPTB0330"
                     /note="secretion system apparatus protein SsaU; Reviewed;
                     Region: PRK12721"
                     /db_xref="CDD:183700"
     misc_feature    join(394708..394776,394870..394938,395065..395133,
                     395152..395220)
                     /locus_tag="YPTB0330"
                     /note="4 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            396077..397291
                     /locus_tag="YPTB0331"
                     /db_xref="GeneID:2953178"
     CDS             396077..397291
                     /locus_tag="YPTB0331"
                     /note="similar to Yersinia pestis YPO0274  integral
                     membrane protein (100% evalue=0); Escherichia coli b1929
                     yedE; hypothetical 44.4 kD protein in amyA-fliE intergenic
                     region (ORF 48) (78.3% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068877.1"
                     /db_xref="GI:51594686"
                     /db_xref="GeneID:2953178"
                     /translation="MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGE
                     FTRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRIDGMMIIGMFAGCIAAALWANNIK
                     LRKPQHTIRIAQALVGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAAGSY
                     FGAKFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQ
                     PKLGIAMLCGIGFGLLIERAQICFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYV
                     QLGVEPKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQIHYWWVGLGNIIGA
                     TLLAYYWDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQ
                     KATTSALIKESL"
     misc_feature    396089..397270
                     /locus_tag="YPTB0331"
                     /note="putative inner membrane protein; Provisional;
                     Region: PRK11099"
                     /db_xref="CDD:236845"
     misc_feature    396473..397195
                     /locus_tag="YPTB0331"
                     /note="Predicted transporter component [General function
                     prediction only]; Region: COG2391"
                     /db_xref="CDD:225264"
     misc_feature    join(396137..396205,396317..396385,396422..396490,
                     396518..396586,396665..396724,396737..396796,
                     396854..396913,396926..396994,397031..397099,
                     397157..397225)
                     /locus_tag="YPTB0331"
                     /note="10 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            397288..397557
                     /locus_tag="YPTB0332"
                     /db_xref="GeneID:2953179"
     CDS             397288..397557
                     /locus_tag="YPTB0332"
                     /note="similar to Yersinia pestis YPO0275 conserved
                     hypothetical protein (98.8% evalue=3.E-47); Escherichia
                     coli b1930 yedF; hypothetical 8.6 kD protein in amyA-fliE
                     intergenic region (ORF 9) (93.2% evalue=3.E-36)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068878.1"
                     /db_xref="GI:51594687"
                     /db_xref="GeneID:2953179"
                     /translation="MSHSPSVETPQLAAPIVPDYRLDMVGEPCPYPAVATLEAMPQLK
                     PGEILEVISDCPQSINNIPLDARNYGYTVLDIQQDGPTVRYLIQR"
     misc_feature    397348..397554
                     /locus_tag="YPTB0332"
                     /note="YedF is a bacterial SirA-like protein of unknown
                     function.  SirA  (also known as UvrY,  and YhhP) belongs
                     to a family of a two-component response regulators that
                     controls secondary metabolism and virulence. The other
                     member of this two-component system...; Region: YedF;
                     cd03422"
                     /db_xref="CDD:239514"
     misc_feature    order(397351..397356,397363..397365,397372..397383,
                     397387..397389)
                     /locus_tag="YPTB0332"
                     /note="CPxP  motif; other site"
                     /db_xref="CDD:239514"
     gene            complement(397635..398621)
                     /locus_tag="YPTB0333"
                     /db_xref="GeneID:2953180"
     CDS             complement(397635..398621)
                     /locus_tag="YPTB0333"
                     /note="similar to Yersinia pestis YPO0276  LysR-family
                     transcriptional regulator (100% evalue=0); Ralstonia
                     solanacearum RS01682 probable transcription regulator
                     protein (31% evalue=2.E-42)"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_068879.1"
                     /db_xref="GI:51594688"
                     /db_xref="GeneID:2953180"
                     /translation="MMSIDENTFAFSAKINNHAIYKHLENFIKIVECNSLSIAAHKLN
                     ITPSSTSRSLAQLEEKLGVVLLKRTTRSIVLTDAGDYLFHQARQLLLDLDETLVNTHS
                     FYNHPQGQLKITCSIAFGVCHLMHLFSQYKETNSDVCLSVDLNDQLVNLNEEHFDIAL
                     RITSIPPPNFAIRRICTINWVYCGSKEYLMKRGVPATIEDLEQHDCLVNPNVSDAWLY
                     KSTEGESVPLKIKNTVQANSSLGLLHAALHHQGIVCLPTYMLGDYITSGKLVPILLDY
                     NAKDKEYGLYALYYPSKYNDPKIRSFIDFMLDELSMDVPWDKWRADYQISLS"
     misc_feature    complement(397674..398558)
                     /locus_tag="YPTB0333"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(398385..398558)
                     /locus_tag="YPTB0333"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(397704..398297)
                     /locus_tag="YPTB0333"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(397767..397769,397854..397856,
                     397905..397907,398088..398090,398094..398096,
                     398136..398138,398253..398255,398265..398267))
                     /locus_tag="YPTB0333"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(397878..397880,397887..397892,
                     397911..397925,398007..398009,398190..398210,
                     398214..398216,398226..398228,398235..398240,
                     398244..398249,398259..398264))
                     /locus_tag="YPTB0333"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            398788..400074
                     /locus_tag="YPTB0334"
                     /db_xref="GeneID:2953181"
     CDS             398788..400074
                     /locus_tag="YPTB0334"
                     /note="similar to Yersinia pestis YPO0277  transmembrane
                     transport protein (100% evalue=0); Escherichia coli b3539
                     yhjV; hypothetical 47.3 kD protein in dctA-dppF intergenic
                     region (O423) (62.6% evalue=1.E-157)"
                     /codon_start=1
                     /transl_table=11
                     /product="HAAAP (hydroxy/aromatic amino acid permease)
                     family protein"
                     /protein_id="YP_068880.1"
                     /db_xref="GI:51594689"
                     /db_xref="GeneID:2953181"
                     /translation="MSEISSSKSELKKLYKSVPFTQYDVGWVILCIGMAIGSGIVFMP
                     VQVGIKGIWVFIAAVIISYPAIYLLQNLYLRTLSESDNCTDYTSVITQYLGKNWGVGL
                     GIAYFLMLLHGMFSYSLAVTFDSASYIKTFGLTEGLLSDSIWYGLIILTVLVAIAAQG
                     EKILFKVSGPMVCVKFGIIVVLGVVMVPYWDFNNISAFPELFSFLRDVLLTLPFTLFS
                     ILFVQILSPMNIAYRKVESDKRIATYRAIRANRVAYIILAVAVLFFAFSFTFSISHEQ
                     AVSAFEQNISALAIAAQVIPGSIVRIMTALLNIFAILTAFLGIYLGFQEAIKGIVVNI
                     ISRFIPEENINQKVLHIGVCVGVILTLWLWVSTRFSILFFLQLGGPLFGVVSCLIPCY
                     LVYKVPVLHKLKGPTIWFISFFGILLCLSPFFKFFE"
     misc_feature    398833..400068
                     /locus_tag="YPTB0334"
                     /note="Amino acid permeases [Amino acid transport and
                     metabolism]; Region: SdaC; COG0814"
                     /db_xref="CDD:223884"
     misc_feature    398845..400038
                     /locus_tag="YPTB0334"
                     /note="threonine/serine transporter TdcC; Provisional;
                     Region: PRK13629; cl17672"
                     /db_xref="CDD:248226"
     misc_feature    join(398860..398928,398941..399009,399088..399156,
                     399214..399282,399301..399357,399415..399483,
                     399541..399609,399652..399720,399733..399801,
                     399829..399885,399904..399972,400000..400068)
                     /locus_tag="YPTB0334"
                     /note="12 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            400120..401301
                     /gene="metC"
                     /locus_tag="YPTB0335"
                     /db_xref="GeneID:2956021"
     CDS             400120..401301
                     /gene="metC"
                     /locus_tag="YPTB0335"
                     /EC_number="4.4.1.8"
                     /note="similar to Yersinia pestis YPO0278 metC;
                     cystathionine beta-lyase (100% evalue=0); Saccharomyces
                     cerevisiae YFR055W cystathionine beta-lyase (64.1%
                     evalue=1.E-131)"
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase"
                     /protein_id="YP_068881.1"
                     /db_xref="GI:51594690"
                     /db_xref="GeneID:2956021"
                     /translation="MNKKDISSFGISTQITQLGRNPQEQTGFVNTPIYRGSTVIFNTV
                     DDIVNNRAVFNYGTAGTPTIANLESAWTALAGAAGTVISPSGLGVIALALLTTLKAGD
                     HLLMPDSVYKPTRLLCAGLIARMGVETTYYDPLIGAEIETLMKPNTSTLFLESPGSQS
                     FEIQDIPMMTAITKRRGIATIIDNTWASPLFFAAHKHGCDLSLEAGTKYLGGHSDLLM
                     GLVSANEQWWPKLRETYDSMAMLPGAEDCFLALRGLRTLHLRIKEAEKRGLEMAQWLK
                     ERPEVLRVLHPAFPDCPGHEFWKRDFTGSSGLFSIVLKPEFTQKGLAEMLDNMSIFAM
                     GFSWGGYESLVIPFDCSEYRTVTKWNPGGLTIRLQIGLEDMEDLKEDLAQGFIRLASN
                     S"
     misc_feature    400141..401283
                     /gene="metC"
                     /locus_tag="YPTB0335"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     misc_feature    order(400375..400380,400387..400389,400579..400581,
                     400666..400668,400675..400677,400732..400734,
                     400741..400743)
                     /gene="metC"
                     /locus_tag="YPTB0335"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    400741..400743
                     /gene="metC"
                     /locus_tag="YPTB0335"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(401442..402242)
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /db_xref="GeneID:2955814"
     CDS             complement(401442..402242)
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /note="with HmuTU is involved in the transport of hemin"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin importer ATP-binding subunit"
                     /protein_id="YP_068882.1"
                     /db_xref="GI:51594691"
                     /db_xref="GeneID:2955814"
                     /translation="MVDMAVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIG
                     PNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSV
                     SEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLW
                     QPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRI
                     MLLAQGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ"
     misc_feature    complement(401448..402215)
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /note="hemin importer ATP-binding subunit; Provisional;
                     Region: hmuV; PRK13548"
                     /db_xref="CDD:237422"
     misc_feature    complement(401553..402206)
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    complement(402090..402113)
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(order(401625..401627,401724..401729,
                     401871..401873,402087..402095,402099..402104))
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(order(401871..401879,401976..401978))
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(401790..401819)
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(401724..401741)
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(401706..401717)
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(401619..401639)
                     /gene="hmuV"
                     /locus_tag="YPTB0336"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            complement(402235..403239)
                     /gene="hmuU"
                     /locus_tag="YPTB0337"
                     /db_xref="GeneID:2955813"
     CDS             complement(402235..403239)
                     /gene="hmuU"
                     /locus_tag="YPTB0337"
                     /note="similar to Yersinia pestis YPO0280 hmuU; hemin
                     transport system permease HmuU (100% evalue=0);
                     Escherichia coli Z4918 chuU; permease of iron compound ABC
                     transport system (66.5% evalue=1.E-115)"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter permease HmuU"
                     /protein_id="YP_068883.1"
                     /db_xref="GI:51594692"
                     /db_xref="GeneID:2955813"
                     /translation="MNGRVQPRLMLGFLLILLVILALGSANMGALSLSFRTLWNTSTN
                     DAMWHIWLNIRLPRVLLAVVVGCALAVSGTIMQGLFRNPLADPGLLGISSGAALCVGL
                     IIVMPFSLPPLLALYSHMVGAFIGSLAISTIIFTLSRWGHGNLARLLLAGIAINALCG
                     AAVGVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPTCILGLLQARQLNLL
                     QLGDEEAHYLGVNVRQAKLRLLLLSAILIGAAVAVSGVIGFIGLVVPHLIRMRIGADH
                     RWLLPGAALGGACLLLTADTLARTLVAPAEMPVGLLTSLLGGPYFLWLILRQREQRSG
                     "
     misc_feature    complement(402265..403065)
                     /gene="hmuU"
                     /locus_tag="YPTB0337"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(402412..402414,402433..402435,
                     402556..402564,402568..402585,402589..402594,
                     402598..402606,402610..402615,402991..402999,
                     403009..403011))
                     /gene="hmuU"
                     /locus_tag="YPTB0337"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(402265..402267,402274..402279,
                     402286..402288,402295..402300,402307..402309,
                     402463..402465,402691..402693,402700..402705,
                     402739..402741,402745..402750,402757..402759,
                     402766..402771,402778..402783,402790..402795,
                     402799..402801,402973..402975,402988..402990,
                     402994..402996))
                     /gene="hmuU"
                     /locus_tag="YPTB0337"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(402316..402318,402343..402345,
                     402475..402477,402487..402489,402661..402663,
                     402739..402741))
                     /gene="hmuU"
                     /locus_tag="YPTB0337"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(join(402262..402318,402457..402522,
                     402604..402669,402730..402795,402817..402882,
                     402913..402978,403000..403065,403147..403212))
                     /gene="hmuU"
                     /locus_tag="YPTB0337"
                     /note="8 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(403236..404075)
                     /gene="hmuT"
                     /locus_tag="YPTB0338"
                     /db_xref="GeneID:2955812"
     CDS             complement(403236..404075)
                     /gene="hmuT"
                     /locus_tag="YPTB0338"
                     /note="similar to Yersinia pestis YPO0281 hmuT;
                     hemin-binding periplasmic protein (99.2% evalue=1.E-150);
                     Agrobacterium tumefaciens AGR_C_4467 hemin-binding
                     periplasmic protein HmuT precursor (41.7% evalue=6.E-44)"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin-ABC transporter substrate-binding protein
                     hmuT"
                     /protein_id="YP_068884.1"
                     /db_xref="GI:51594693"
                     /db_xref="GeneID:2955812"
                     /translation="MRLRLLSLPLILSLCAPLLPLNTLAAERIVTIGGDVTEIAYALG
                     AGDEIVARDSTSQQPQAAQKLPDVGYMRTLNAEGILAMKPTMLLVSELAQPSLVLTQI
                     ASSGVNVVTVPGQTTPESVAMKINAVATALHQTEKGQKLIEDYQQRLAAVNKTPLPVK
                     VLFVMSHGGLTPMAAGQNTAADAMIRAAGGSNAMQGFSRYRPLSQEGVIASAPDLLLI
                     TTDGVKALGSSANIWKLPGMALTPAGKHKRLLVVDDMALLGFGLETPQVLAQLREKME
                     QMQ"
     misc_feature    complement(403308..404000)
                     /gene="hmuT"
                     /locus_tag="YPTB0338"
                     /note="Hemin binding protein HutB.  These proteins have
                     been shown to function as initial receptors in ABC
                     transport of hemin and hemoproteins in many eubacterial
                     species.  They belong to the TroA superfamily of
                     periplasmic metal binding proteins that share a...;
                     Region: HutB; cd01149"
                     /db_xref="CDD:238569"
     misc_feature    complement(403314..403991)
                     /gene="hmuT"
                     /locus_tag="YPTB0338"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:250662"
     misc_feature    complement(403893..403895)
                     /gene="hmuT"
                     /locus_tag="YPTB0338"
                     /note="putative hemin binding site; other site"
                     /db_xref="CDD:238569"
     gene            complement(404072..405109)
                     /gene="hmuS"
                     /locus_tag="YPTB0339"
                     /db_xref="GeneID:2955811"
     CDS             complement(404072..405109)
                     /gene="hmuS"
                     /locus_tag="YPTB0339"
                     /note="similar to Yersinia pestis YPO0282 hmuS; hemin
                     transport protein (100% evalue=0); Escherichia coli
                     ECs4379 hypothetical protein (67% evalue=1.E-130)"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin degradation/transport protein hmuS"
                     /protein_id="YP_068885.1"
                     /db_xref="GI:51594694"
                     /db_xref="GeneID:2955811"
                     /translation="MNASLYQQYVQAKAEHPGKYARDLATLMGISEAELTHSRVGHDA
                     KRLQSDARALLAALESVGEVKAITRNTYAVHEQVGRYENQHLNGHAGLILNPRALDLR
                     LFLNQWASAFTLTEETRHGVRHSIQFFDHQGDALHKVYVTEQTDMSAWEALLAQFIIP
                     ENPALQLEPLSTPEAVEPTADDATVDSEWRAMTDVHQFFQLLKRNNLTRQQAFRAVGD
                     DLAYQVDNNSLTQLLHIAQQDQNEIMIFVGNRGCVQIFTGLIEKVTPHNEWINVFNQR
                     FTLHLIETAIAESWITRKPTKDGFVTSLELFAADGTQLAQLYGQRTEGQPEQNQWREQ
                     IARLINKDIAA"
     misc_feature    complement(404075..405109)
                     /gene="hmuS"
                     /locus_tag="YPTB0339"
                     /note="Putative heme degradation protein [Inorganic ion
                     transport and metabolism]; Region: HemS; COG3720"
                     /db_xref="CDD:226243"
     misc_feature    complement(404639..405025)
                     /gene="hmuS"
                     /locus_tag="YPTB0339"
                     /note="Haemin-degrading HemS.ChuX domain; Region: HemS;
                     pfam05171"
                     /db_xref="CDD:253058"
     misc_feature    complement(404096..404494)
                     /gene="hmuS"
                     /locus_tag="YPTB0339"
                     /note="Haemin-degrading HemS.ChuX domain; Region: HemS;
                     pfam05171"
                     /db_xref="CDD:253058"
     gene            complement(405228..407258)
                     /gene="hmuR"
                     /locus_tag="YPTB0340"
                     /db_xref="GeneID:2955810"
     CDS             complement(405228..407258)
                     /gene="hmuR"
                     /locus_tag="YPTB0340"
                     /note="similar to Yersinia pestis YPO0283 hmuR; hemin
                     receptor precursor (99.4% evalue=0); Escherichia coli
                     ECs4380 heme utilization/transport protein (67.8%
                     evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="tonB dependent outer membrane hemin receptor,
                     hmuR"
                     /protein_id="YP_068886.1"
                     /db_xref="GI:51594695"
                     /db_xref="GeneID:2955810"
                     /translation="MLRSTSDRFRWSSLSLAIACTLPLATQAADTTTTQTSSKKHSTD
                     TMVVTATGNERSSFEAPMMVTVIEGNAPTSQTAATAADMLRQVPGLTVTGSGRTNGQD
                     VVMRGYGKQGVLTLVDGVRQGTDTGHLNSTFLDPALVKRIEIVRGPAALLYGSGALGG
                     VIAYETVDAADMLQPGQNSGYRVYSSAATGDHSFGLGASAFGRTDDLDGILSFGTRDI
                     GNIRQSDGFNAPNDETISNVLAKGTWQIDSIQSLSANLRYYNNSAIEPKNPQTSAPSS
                     TNVMTNRSTIQRDAQLRYNIKPLDQEWLNATAQVYYSEVEINARPQGSAEEGRKQTTE
                     GVKLENRTRLFIESPASHLLTYGTETYKQEQTPGGATESFPQAKIRFSSGWLQDEITL
                     RDLPVSILAGTRYDNYSGSSDGYADVDADKWSSRGAISITPTDWLMLFGSYAQAFRAP
                     TMGEMYNDSKHFAIPIRPGLTLTNYWVPNPNLKPETNETQEYGFGLRFSDLLMAEDDL
                     QFKVSYFDTKAKDYISTRVDMQAMTTTSVNIDQAKIWGWDASMSYKTALFNWDLAYNR
                     TRGKNQNTDEWLDTINPDTVTSIVDVPVANSGFSVGWIGTFANRSSRVSSSTPQAGYG
                     VNDFYVSYKGQEAFKGMTTTMLLGNAFEKEYYAPQGIPQDGRNVKFFVSYQW"
     misc_feature    complement(405231..407132)
                     /gene="hmuR"
                     /locus_tag="YPTB0340"
                     /note="TonB-dependent heme/hemoglobin receptor family
                     protein; Region: TonB-hemin; TIGR01785"
                     /db_xref="CDD:233576"
     misc_feature    complement(405231..407072)
                     /gene="hmuR"
                     /locus_tag="YPTB0340"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(406761..406787,406821..406853,
                     406893..406916,406935..406952,406986..407015,
                     407043..407072))
                     /gene="hmuR"
                     /locus_tag="YPTB0340"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(406269..406271,406308..406310))
                     /gene="hmuR"
                     /locus_tag="YPTB0340"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            complement(407389..407580)
                     /locus_tag="YPTB0341"
                     /db_xref="GeneID:2953182"
     CDS             complement(407389..407580)
                     /locus_tag="YPTB0341"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin uptake protein HEMP"
                     /protein_id="YP_068887.1"
                     /db_xref="GI:51594696"
                     /db_xref="GeneID:2953182"
                     /translation="MDKQLNKVPMLNDEPATEYSVARKPLSIASEQLLGEHGVAFIVH
                     QGECYQLRQTKSGKLILTK"
     misc_feature    complement(407392..407499)
                     /locus_tag="YPTB0341"
                     /note="Hemin uptake protein hemP; Region: hemP; pfam10636"
                     /db_xref="CDD:256099"
     gene            complement(407666..408316)
                     /locus_tag="YPTB0342"
                     /db_xref="GeneID:2953183"
     CDS             complement(407666..408316)
                     /locus_tag="YPTB0342"
                     /note="similar to Yersinia pestis YPO0284 conserved
                     hypothetical protein (99.5% evalue=1.E-120); Escherichia
                     coli ECs4385 ShuY-like protein (55.4% evalue=2.E-55)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068888.1"
                     /db_xref="GI:51594697"
                     /db_xref="GeneID:2953183"
                     /translation="MRPWLIFGAGRGVGAHLLALANQHADSASNPRPVTLLIRNQQQA
                     EELRNKGLTVVCGDACDPASVREACQLAGEDAAIISTLGNNNANYQGNRLIIDTAEQL
                     GLKRMLLVTSIGCGDSWPTLSPAARAAFGQAVRETSLAESWLQTSNLIYTLIRPGGLL
                     DQPATGNAIRLQTEAHGMVTRADVAHHISQMIEDPATYYQAYALIEPGLARKVKMN"
     misc_feature    complement(407693..408316)
                     /locus_tag="YPTB0342"
                     /note="Predicted nucleoside-diphosphate-sugar epimerases
                     [Cell envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: COG0702"
                     /db_xref="CDD:223774"
     misc_feature    complement(407693..408310)
                     /locus_tag="YPTB0342"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(407840..407851,407906..407908,
                     407918..407920,407981..407989,408068..408076,
                     408197..408205,408278..408280,408284..408289,
                     408293..408295))
                     /locus_tag="YPTB0342"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(407906..407908,407918..407920,
                     407981..407983,408053..408055))
                     /locus_tag="YPTB0342"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(408350..408913)
                     /locus_tag="YPTB0343"
                     /db_xref="GeneID:2953184"
     CDS             complement(408350..408913)
                     /locus_tag="YPTB0343"
                     /note="similar to Yersinia pestis YPO0285 conserved
                     hypothetical protein (98.3% evalue=5.E-99); Escherichia
                     coli ECs4384 ShuX-like protein (59.3% evalue=1.E-53)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068889.1"
                     /db_xref="GI:51594698"
                     /db_xref="GeneID:2953184"
                     /translation="MNTSSSINTSSSMNRSSSMNRSPLAEFLATQPDGTLEQIAQDYQ
                     VSVLDVVRALPERVLVGAEHFDRIWDSMTEWGDVTTLVHTADVILEHKGPLPSGTHRH
                     GYFNLRSKQGLSGHIRAQNCQAIALLERPFMGMATASVQFFNQQGEVMFKVYVGRDEH
                     RQLRADGLAAFHQLAQQLLIEDPTLVK"
     misc_feature    complement(408374..408847)
                     /locus_tag="YPTB0343"
                     /note="Putative heme iron utilization protein [Inorganic
                     ion transport and metabolism]; Region: HugX; COG3721"
                     /db_xref="CDD:226244"
     gene            complement(408910..410223)
                     /locus_tag="YPTB0344"
                     /db_xref="GeneID:2953185"
     CDS             complement(408910..410223)
                     /locus_tag="YPTB0344"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_068890.1"
                     /db_xref="GI:51594699"
                     /db_xref="GeneID:2953185"
                     /translation="MNIDLMPYYAQPGPLPFPKRWATMPWRDSRPLPAESLQDSWQSL
                     LQKALPRNKRLLYLHIPFCATHCTFCGFYQNPLQSGSTERYTDYLLRELSMEADSPLL
                     QGGPIHAIYFGGGTPSALSAQQLHSIISQLRKSLPLAPDCEITVEGRIFNFDDERIDA
                     CLEAGANRFSIGVQTFNTRIRQRMGRKADRDQAIRFLTDLATRDRAAVVCDLMFGLPH
                     QTPEIWQEDLAIVRQLPLDGVDLYALNLLPTTPLAKSVENNRVELPTLAQQCDFYCSG
                     ADSLAQAGWHQLSNSHWARTTRERNLYNLLIKQGADCLALGSGAGGSLQGHAYMQHRS
                     LDNYYRLIDSGQKPLMMMTQASGEHPWRAKLQSGIEVGRLDLSELIADPYPLMPLISQ
                     WYQSNLLKDNSFCLRLTDSGRFWASNIMQALQNIIPSLITAESHS"
     misc_feature    complement(408913..410223)
                     /locus_tag="YPTB0344"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK09058"
                     /db_xref="CDD:236368"
     misc_feature    complement(409435..410037)
                     /locus_tag="YPTB0344"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(409492..409497,409585..409587,
                     409708..409710,409777..409785,409876..409881,
                     409885..409887,410011..410019,410023..410025,
                     410029..410031,410035..410037))
                     /locus_tag="YPTB0344"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(410564..411364)
                     /locus_tag="YPTB0345"
                     /db_xref="GeneID:2953186"
     CDS             complement(410564..411364)
                     /locus_tag="YPTB0345"
                     /note="similar to Yersinia pestis YPO0287
                     methylenetetrahydrofolate reductase (99.6%
                     evalue=1.E-153); Pseudomonas aeruginosa PA0430 metF;
                     5,10-methylenetetrahydrofolate reductase (25.2%
                     evalue=1.E-21)"
                     /codon_start=1
                     /transl_table=11
                     /product="methylenetetrahydrofolate reductase"
                     /protein_id="YP_068891.1"
                     /db_xref="GI:51594700"
                     /db_xref="GeneID:2953186"
                     /translation="MERKLSFEMNSAKNEKEMENIFKLIEFTDTLDPIYYTVNTEIGS
                     SVWSDTYRTVIELREKTDVSLIPHITINNKKEREIMQIIEKYINVGICEFFVIRGDKH
                     VYDQDNPINYGVELIELIRRSHKHIGIKTSLYPDFHKETTEVKEEIDWNERKYQLGVN
                     EFISQLTLNTNALDFLSHWVDKERPFTPSIMPLGNFSFIEKFTSSNSIDYPLWIKKFA
                     NSKSNSNEDKENIGIEIIRFLCREYLNQRERLHVFTLNKVDVMKKIFQ"
     misc_feature    complement(410588..411352)
                     /locus_tag="YPTB0345"
                     /note="Methylenetetrahydrofolate reductase (MTHFR).
                     5,10-Methylenetetrahydrofolate is reduced to
                     5-methyltetrahydrofolate by methylenetetrahydrofolate
                     reductase, a cytoplasmic, NAD(P)-dependent enzyme.
                     5-methyltetrahydrofolate is utilized by methionine
                     synthase...; Region: MTHFR; cd00537"
                     /db_xref="CDD:238299"
     misc_feature    complement(order(410606..410608,410870..410872,
                     410876..410878,410903..410908,410915..410917,
                     410924..410926,410945..410947,410951..410953,
                     410963..410965,410969..410971,411026..411031,
                     411068..411076,411161..411163,411245..411247))
                     /locus_tag="YPTB0345"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:238299"
     gene            complement(411679..412167)
                     /locus_tag="YPTB0346"
                     /db_xref="GeneID:2953187"
     CDS             complement(411679..412167)
                     /locus_tag="YPTB0346"
                     /note="similar to Yersinia pestis YPO0288  exported
                     protein (100% evalue=9.E-85); Escherichia coli Z1603
                     terW_2; unknown associated with  tellurite resistance
                     (51.6% evalue=7.E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068892.1"
                     /db_xref="GI:51594701"
                     /db_xref="GeneID:2953187"
                     /translation="MLLSTKQFRHYTLALLLASGKPVDADDIYDKLSCSGPTLTRALK
                     ELRETYNAEIRYSKSTHSYQLTEKGTLTPKVLRHIKDAIASHMIIKSHEELVASHVIL
                     DKEKKRSISLSLRMSVIRKIDRVVNQLEITRSEAVEILVNTYISELMLSVSQPPKGKK
                     SV"
     misc_feature    complement(<412003..412128)
                     /locus_tag="YPTB0346"
                     /note="Putative transcriptional regulators (Ypuh-like);
                     Region: DUF387; cl00612"
                     /db_xref="CDD:260531"
     gene            complement(412564..413523)
                     /locus_tag="YPTB0347"
                     /db_xref="GeneID:2953188"
     CDS             complement(412564..413523)
                     /locus_tag="YPTB0347"
                     /note="similar to Yersinia pestis YPO0289  ATP/GTP-binding
                     protein (100% evalue=1.E-173); Escherichia coli Z1605
                     hypothetical protein (66.7% evalue=1.E-111)"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP/GTP-binding protein"
                     /protein_id="YP_068893.1"
                     /db_xref="GI:51594702"
                     /db_xref="GeneID:2953188"
                     /translation="MKSTPSAYALGATLYMPATRTDIADIIIHNKISGLRSLVICLED
                     AVSEDDVPLAISQLSTLLGTLAVEKKRDGSAHWPLIFVRPRHEAMGLALITRFNLSAI
                     NGFVLPKFTQASITTWWEIMKETHLCMMPTLETEDVFDVAKMSTLARELENHPSRQRI
                     VALRIGGNDLMSVISMRRSRKLTLYDGPMGYVIKMLVSVFCPKNFALTAPVCEQIDNP
                     QLLETELALDIAHGLVGKTAIHPSQIEVIQRALMVDTHDHADALRILNSTQAVFKSQG
                     AMCEPSTHKRWAAAILERAQYYGIMPDFTAMAVRDAPRKHQSG"
     misc_feature    complement(412606..413514)
                     /locus_tag="YPTB0347"
                     /note="C-C_Bond_Lyase of the TIM-Barrel fold; Region:
                     C-C_Bond_Lyase; pfam15617"
                     /db_xref="CDD:259748"
     gene            complement(413523..414602)
                     /locus_tag="YPTB0348"
                     /db_xref="GeneID:2953189"
     CDS             complement(413523..414602)
                     /locus_tag="YPTB0348"
                     /note="similar to Yersinia pestis YPO0290 conserved
                     hypothetical protein (100% evalue=0); Escherichia coli
                     Z1606 hypothetical protein (70.5% evalue=1.E-144)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068894.1"
                     /db_xref="GI:51594703"
                     /db_xref="GeneID:2953189"
                     /translation="MHDITPFSGSYLPDDIQFLLKPIQIEMTPVEVKEKLIQSGARHY
                     SDMLSQEPAPTEHHLTLFARALDQGATRMAREVVMLAKALINRFGDTPIVLASLVRAG
                     VPLGVMLHHTLRALGKTSFHYGISIIRDRGIDEVALSYIEQKHGTEGLVFVDGWTGKG
                     AITGELTRSLQGRPGYPELPRLVVLADPCGCSWLSATDDDWLIPFGIMGAPVSGLVSR
                     SLWSEKGLHGCVHCEHLQEFECSQLLVNTVADCRQQLDLSQIPAAEWDYQQNAALRIQ
                     SHQVVKKMAEQFEINSVNRIKPGIAEATRAVLRRVPDHVLVRHIDDPDVSLLVYLAKQ
                     KKIAIKEVGNELGQYRAITIIKKVI"
     misc_feature    complement(413847..414578)
                     /locus_tag="YPTB0348"
                     /note="Phosphoribosyl transferase (PRTase); Region:
                     PRTase_1; pfam11202"
                     /db_xref="CDD:256350"
     misc_feature    complement(413529..413837)
                     /locus_tag="YPTB0348"
                     /note="PELOTA RNA binding domain; Region: PELOTA_1;
                     pfam15608"
                     /db_xref="CDD:259739"
     gene            complement(414595..415407)
                     /locus_tag="YPTB0349"
                     /db_xref="GeneID:2953190"
     CDS             complement(414595..415407)
                     /locus_tag="YPTB0349"
                     /note="similar to Yersinia pestis YPO0291 conserved
                     hypothetical protein (100% evalue=1.E-160); Escherichia
                     coli Z1607 hypothetical protein (65.4% evalue=1.E-102)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068895.1"
                     /db_xref="GI:51594704"
                     /db_xref="GeneID:2953190"
                     /translation="MNKPVFLCDLDDTLFQTRRKMVDELDLPPFRVGALDRSLTPRSF
                     MTEEQSMLVDWLLEHAEFIPVTARGTEEISRVNIPFSSWAITTHGAVILTPDRQPDAG
                     WQDTVLTNLQPYRDRLIAMESRINDMMAERGLNAWCRINYEYGDTPVYFVMKHRDSTQ
                     IAELYAFNDQLESLFSTDGFYIHRNSNNIAWLPVCIEKGLATTYLLDKLRHEHGAFPV
                     LGFGDSLSDFSFMRHCHWFGMPAKSQFSQALTSHLFDNTTFNKNNVNGDNDA"
     gene            complement(415400..416536)
                     /locus_tag="YPTB0350"
                     /db_xref="GeneID:2953191"
     CDS             complement(415400..416536)
                     /locus_tag="YPTB0350"
                     /note="similar to Yersinia pestis YPO0292 conserved
                     hypothetical protein (100% evalue=0); Escherichia coli
                     Z1608 hypothetical protein (68.2% evalue=1.E-145)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068896.1"
                     /db_xref="GI:51594705"
                     /db_xref="GeneID:2953191"
                     /translation="MMTTQPPVYRRELSGGTLTVIPNSSNIPLDSLFDIAERRNPKRA
                     FLFVSKVLGRHIPVSPATMRNVYRQLAERFPADLPGPVLFIGMAETAVGLAAGVFQEL
                     RGTVAEPVFLTSTRHPVDGDLLCEFKENHSHATDHLLYLPSDPVLRARLQRARSVVLI
                     DDEATTGNTFINLLQALRDANLNGLEKVVAVTLTDWSGSALTERCPLPVTTVSLITGE
                     WNWSPIPDAPVPVMPACNVTARGKVAITDKQNWGRLGMDETRADIGHKVHVLAGEKVL
                     VLGTSEFVWQPFLLAERLEHAGANVKFSSITRSPIAQGHAINSIIAFSDNYGLGIPNF
                     LYNVAHQHFDRIIVCVETPAESIDPTLIEQLRTVAPCVEVIAYE"
     misc_feature    complement(415952..416335)
                     /locus_tag="YPTB0350"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(416030..416044,416048..416056,
                     416267..416269,416273..416275))
                     /locus_tag="YPTB0350"
                     /note="active site"
                     /db_xref="CDD:206754"
     misc_feature    complement(415442..415852)
                     /locus_tag="YPTB0350"
                     /note="TRSP domain C terminus to PRTase_2; Region: TRSP;
                     pfam12500"
                     /db_xref="CDD:257091"
     gene            complement(416548..417609)
                     /locus_tag="YPTB0351"
                     /db_xref="GeneID:2953192"
     CDS             complement(416548..417609)
                     /locus_tag="YPTB0351"
                     /note="similar to Yersinia pestis YPO0293 conserved
                     hypothetical protein (99.7% evalue=0); Escherichia coli
                     ECs1350 hypothetical protein (55.1% evalue=1.E-106)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068897.1"
                     /db_xref="GI:51594706"
                     /db_xref="GeneID:2953192"
                     /translation="MKKNIWFMGGLSSQRDIISGVKNTSELHGNAIQVFASHHQHRYE
                     ILEKADVAFIEPSDLDTKMAFIRHIVKAFDIEAIHTGRSCLWFEQHRAAIEGLGVKLT
                     TGAQCPATFTLADNKVEYAAYMAQKGLPVVPSIQIASPDELREWLANPPFDTEKLCIK
                     PVTGIYGMGFWKLDQSISAMDCFDRTDNRVVHPDLYLAALERTEKMQPMVLMPYLPGP
                     ESSVDMLVEKGKVIAAVARRKEGSVQHLHQSGAAFELAKSSAELMQADGLVNVQTRCD
                     HHGQPLLLEINLRPSGGIGYTRHSGVNLPGLFALRQLDLMSQDEVSSQAVAHFKPVSV
                     RAMTDALPFPAELQNLTHF"
     misc_feature    complement(416578..417597)
                     /locus_tag="YPTB0351"
                     /note="ATP-grasp in the biosynthetic pathway with Ter
                     operon; Region: ATPgrasp_Ter; pfam15632"
                     /db_xref="CDD:259762"
     misc_feature    complement(416731..417273)
                     /locus_tag="YPTB0351"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; pfam13535"
                     /db_xref="CDD:257854"
     gene            417885..418478
                     /gene="terZ"
                     /locus_tag="YPTB0352"
                     /db_xref="GeneID:2956683"
     CDS             417885..418478
                     /gene="terZ"
                     /locus_tag="YPTB0352"
                     /note="similar to Yersinia pestis YPO0294 terZ; tellurium
                     resistance protein (99.4% evalue=1.E-109); Escherichia
                     coli ECs1351  tellurium resistance protein TerZ (76.6%
                     evalue=2.E-82)"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein"
                     /protein_id="YP_068898.1"
                     /db_xref="GI:51594707"
                     /db_xref="GeneID:2956683"
                     /translation="MISLSKNQTISLAKESSALSRVQFGLGWDPVKKKKSFLGGLFGG
                     GSASDSIDLDASCVMLSQTGKPVDTVSFRHLTSKCRSVQHTGDNLTGEGDGDDEVINV
                     DLSRLPAEVEYLAFTVNSFRGQTFNEVENAFCRVVDQTGKELARYVLTEQGSHTGIVI
                     SSLRRNNGQWDFTAHGRACRGRTIEDMMSEIIETVVR"
     misc_feature    417939..418430
                     /gene="terZ"
                     /locus_tag="YPTB0352"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(418038..418040,418044..418046,418176..418178)
                     /gene="terZ"
                     /locus_tag="YPTB0352"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            418478..419662
                     /gene="terA"
                     /locus_tag="YPTB0353"
                     /db_xref="GeneID:2956676"
     CDS             418478..419662
                     /gene="terA"
                     /locus_tag="YPTB0353"
                     /note="similar to Yersinia pestis YPO0295 terA; tellurite
                     resistance protein (99.7% evalue=0); Escherichia coli
                     Z1172 terA; phage inhibition, colicin resistance and
                     tellurite resistance protein (69.2% evalue=1.E-155)"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein"
                     /protein_id="YP_068899.1"
                     /db_xref="GI:51594708"
                     /db_xref="GeneID:2956676"
                     /translation="MNLMPGGNAPVASQTLTVRVLSGASVDVSAFRLYASGKVRGDTD
                     MVFYGQPVTDDSTIRLSGQGVNTAFSVNLQAINHDVQKIAFTATCDSNQTLSQLGNLS
                     IQVELNGSVLMKGDVETQGRQEAALILGELYRRNTEWKFRFVAQGFNGGLKPLAEHFG
                     VVVEDEPAAPTPVPTPVSTPAPTAPPVAKPINLSKVSLTKEKPVISLTKRDDFGEIRV
                     NLNWHRGGGAPAKGFLQGIFNSNKGIDLDLGAFVALNDGSRGVIQALGNNFGSYHSEP
                     YVQLQGDDRTGDVSDGEWMHINGREWKHVKEVLIFAFIYEGVPSWGSTDGIVTINVPG
                     QAPIETQMNEGNDRKNMCAVARLVNESGNIKVERINRYFSGHKEMDEAFGWGFRWKAG
                     SK"
     misc_feature    418553..418957
                     /gene="terA"
                     /locus_tag="YPTB0353"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(418556..418558,418676..418678)
                     /gene="terA"
                     /locus_tag="YPTB0353"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     misc_feature    419114..419629
                     /gene="terA"
                     /locus_tag="YPTB0353"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(419210..419212,419216..419218,419354..419356)
                     /gene="terA"
                     /locus_tag="YPTB0353"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            419695..420150
                     /gene="terB"
                     /locus_tag="YPTB0354"
                     /db_xref="GeneID:2956677"
     CDS             419695..420150
                     /gene="terB"
                     /locus_tag="YPTB0354"
                     /note="similar to Yersinia pestis YPO0296 terB; tellurite
                     resistance protein (100% evalue=2.E-80); Escherichia coli
                     ECs1353  tellurium resistance protein TerB (71.5%
                     evalue=6.E-57)"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein"
                     /protein_id="YP_068900.1"
                     /db_xref="GI:51594709"
                     /db_xref="GeneID:2956677"
                     /translation="MSFFNKVKNAISAGRTELTNQVGRFKNRKFMEGTVAVCAHISMA
                     SNGAGPEEKQKMIMFIKQSPELSVFDTNEVIEFFNKLVTSYEFDADIGKGEAMKYIMA
                     LKSQPEAAQLALRVGIAVAKSDGVFDEMEEAAAREICVTLGFVPADFQL"
     misc_feature    419782..420123
                     /gene="terB"
                     /locus_tag="YPTB0354"
                     /note="tellurite resistance protein terB; Region: terB;
                     cd07176"
                     /db_xref="CDD:143580"
     misc_feature    order(419827..419829,419848..419850,420064..420066,
                     420085..420087)
                     /gene="terB"
                     /locus_tag="YPTB0354"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:143580"
     gene            420172..421209
                     /gene="terC"
                     /locus_tag="YPTB0355"
                     /db_xref="GeneID:2956678"
     CDS             420172..421209
                     /gene="terC"
                     /locus_tag="YPTB0355"
                     /note="similar to Yersinia pestis YPO0297 terC; tellurium
                     resistance protein (99.4% evalue=0); Escherichia coli
                     Z1613 terC_2; phage inhibition, colicin resistance and
                     tellurite resistance protein (83.9% evalue=1.E-164)"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein"
                     /protein_id="YP_068901.1"
                     /db_xref="GI:51594710"
                     /db_xref="GeneID:2956678"
                     /translation="MESTHIGFPIETVAVFILLSVGAICIDLFMHRHDKPISLKSAAL
                     WSLFWVAIAFVFAGFLYLHHGAEAASLFVTGYALEKVLSIDNLFVMMAIFSWFAVPDR
                     LRHRVLYWGIIGAIVFRGIFVAIGTGLLMLGPWVEVVFAIVVAWTAVMMLRKGDDDDA
                     IEDYSQHIAYRLVKRFFPIWPKLRGNAFILSQKEVDAELAKPENADVQVGRKGGVARY
                     ATPLMLCLAVVELSDVMFAFDSVPAVIAVSREPLIVYSAMMFAILGLRTLYFVLEALK
                     QYLVHLEKAVIVLLFFIAAKLGLNASDHFFNHGYDISANVSLFVVIGVLALGIVASFL
                     FPEKDSKEGQH"
     misc_feature    420196..421185
                     /gene="terC"
                     /locus_tag="YPTB0355"
                     /note="Integral membrane protein TerC family; Region:
                     TerC; cl10468"
                     /db_xref="CDD:263978"
     misc_feature    join(420199..420267,420301..420369,420412..420471,
                     420490..420558,420568..420627,420814..420882,
                     420925..420987,421006..421074,421117..421176)
                     /gene="terC"
                     /locus_tag="YPTB0355"
                     /note="9 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            421273..421851
                     /gene="terD"
                     /locus_tag="YPTB0356"
                     /db_xref="GeneID:2956679"
     CDS             421273..421851
                     /gene="terD"
                     /locus_tag="YPTB0356"
                     /note="similar to Yersinia pestis YPO0298 terD; tellurium
                     resistance protein (100% evalue=1.E-106); Escherichia coli
                     Z1614 terD_2; phage inhibition, colicin resistance and
                     tellurite resistance protein (86.4% evalue=5.E-94)"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein"
                     /protein_id="YP_068902.1"
                     /db_xref="GI:51594711"
                     /db_xref="GeneID:2956679"
                     /translation="MGVSLSKGGNVSLSKEAPTMTNVLIGLGWDARSTDGQDFDLDAS
                     AFLLTANGKVRNDADFIFYNNLKSSDGSVMHTGDNRTGEGEGDDESLKIKLPLIPADV
                     DKIVFVVTIHDAQARRQSFGQVANAFIRLVNDDNGVEIARYDLSEDASTETAMLFGEL
                     YRHNAEWKFRAVGQGYAGGLSSVCAQYGINAS"
     misc_feature    421330..421836
                     /gene="terD"
                     /locus_tag="YPTB0356"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(421390..421392,421396..421398,421537..421539)
                     /gene="terD"
                     /locus_tag="YPTB0356"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            422035..422610
                     /gene="terE"
                     /locus_tag="YPTB0357"
                     /db_xref="GeneID:2956680"
     CDS             422035..422610
                     /gene="terE"
                     /locus_tag="YPTB0357"
                     /note="similar to Yersinia pestis YPO0299 terE; tellurium
                     resistance protein (100% evalue=1.E-105); Escherichia coli
                     Z1615 terE_2; phage inhibition, colicin resistance and
                     tellurite resistance protein (85.3% evalue=4.E-91)"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein"
                     /protein_id="YP_068903.1"
                     /db_xref="GI:51594712"
                     /db_xref="GeneID:2956680"
                     /translation="MAVSLVKGGNVSLTKEAPTMNIAVVGLGWDARVTDGSEFDLDAS
                     VFMVGENGKVLSDQHFIFFNNKVSPCGSVVHQGDNRTGAGDGDDEQIKIDLKKVPADV
                     KKIIFSVTIYDAEARKQNFGMVSNSFMRVVNEDNSAEIARFDLSEDASTETAMIFGEL
                     YRNNDEWKFKAVGQGFAGGLSALASQHGVSV"
     misc_feature    422107..422598
                     /gene="terE"
                     /locus_tag="YPTB0357"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(422152..422154,422158..422160,422299..422301)
                     /gene="terE"
                     /locus_tag="YPTB0357"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            423323..423961
                     /locus_tag="YPTB0358"
                     /db_xref="GeneID:2953193"
     CDS             423323..423961
                     /locus_tag="YPTB0358"
                     /note="similar to Yersinia pestis YPO0301  exported
                     protein (100% evalue=1.E-115); Salmonella typhimurium
                     STM4574  outer membrane protein (23.8% evalue=8.E-09)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068904.1"
                     /db_xref="GI:51594713"
                     /db_xref="GeneID:2953193"
                     /translation="MKKPLTQIAILSSLVVSISAASAAVPTAELKVVGTMTVPSCTVV
                     SPDAGIYDIGKLSSSLVKPGTTVTVLAQINKTWTVNCDANTYLNFTPVDNRVGSSSDG
                     SAAAFGLGKINDTGKIGYYTVQMRNATVDGKKSGVFTASSASFSQADTSYLNRGQRTG
                     WAAGANTQNSGKVFVADLLVTPVLAGTNTMNGAITEDAKIDGSLTMNFAFGI"
     misc_feature    423323..423952
                     /locus_tag="YPTB0358"
                     /note="Protein of unknown function (DUF1120); Region:
                     DUF1120; cl05856"
                     /db_xref="CDD:262699"
     gene            424212..426590
                     /locus_tag="YPTB0359"
                     /db_xref="GeneID:2953194"
     CDS             424212..426590
                     /locus_tag="YPTB0359"
                     /note="similar to Yersinia pestis YPO0302  outer membrane
                     fimbrial usher protein (99.6% evalue=0); Escherichia coli
                     b3216 yhcD; hypothetical outer membrane usher protein in
                     gltF-nanT intergenic region precursor (27.2%
                     evalue=8.E-80)"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane fimbrial usher protein"
                     /protein_id="YP_068905.1"
                     /db_xref="GI:51594714"
                     /db_xref="GeneID:2953194"
                     /translation="MVARCINLQCIAFLFSFFPTLAFPVTEEGEVVFDIETLERLGYS
                     AELAKFFSGQDRFLPGQHDVTIIINASKTYRIAATFDSEGKLCMDKALLMALKLRNTE
                     SDGSCENMEARWPGMVVKLFPGQFRVEITLPQEAFDPEMEGSEYQQGGHALLLNYNIF
                     GQRVESNNSRFNLVQGQFEPGINFKNWVLRNRGSYSYNQGVSQYYNQETSALRAVESL
                     KSVVQLGEFGLVGNTFSGLPVTGIQLYSDDAQRDDTQLIVPIEGIANTNATIEIRQRG
                     RVIYRTIVAPGPFSLSNISNFSSGVNTDVSIIEEDGTQQNFTVTSALDINAEQQASIY
                     QLAVGRYRDMFTGEDRPSPLLLSGEMSFNPAATFYMTSAGLLSSGYQNIRVQNLYSGW
                     DQAWFSAAASYANTKDAGQGYQFSVQNQMTINGNFGVSWSSVYGSANYWSPDDALSSS
                     NNLNDLMFGKLKNATSVAVSWVHPRWGAFSYALSNNMYYQASGRTYHIFSISEQFGRA
                     TTILSSQLSSQGQNSLYVGINMPLGNGTLSGRVQRNNGNVALGSTYQGRWGDNKDYSV
                     GISGDNRQRRINGSMNIRTAYSQLTGGVSQATNNSRSAYLSSRGSVAYVNNTFATSSS
                     SVGDTFAVVNIPNQPGLRVSSPSSGIAITDYAGIALLPLVRPYTASKVQISTQTLPLN
                     IRLNNTSADLLMTRGSVATHHFETTETRQLLLTIRGSDGEMLPIGANVLDEKGNFLGT
                     IIGDGNFMLENKAIGVTLRVKANNRDECRVNYREPEKFDPDVLYEVADAVCQ"
     misc_feature    424215..426587
                     /locus_tag="YPTB0359"
                     /note="P pilus assembly protein, porin PapC [Cell motility
                     and secretion / Intracellular trafficking and secretion];
                     Region: FimD; COG3188"
                     /db_xref="CDD:225729"
     misc_feature    424308..424697
                     /locus_tag="YPTB0359"
                     /note="PapC N-terminal domain; Region: PapC_N; pfam13954"
                     /db_xref="CDD:258209"
     misc_feature    424734..426308
                     /locus_tag="YPTB0359"
                     /note="Outer membrane usher protein; Region: Usher;
                     pfam00577"
                     /db_xref="CDD:249973"
     misc_feature    426351..426548
                     /locus_tag="YPTB0359"
                     /note="PapC C-terminal domain; Region: PapC_C; pfam13953"
                     /db_xref="CDD:258208"
     gene            426662..427405
                     /locus_tag="YPTB0360"
                     /db_xref="GeneID:2953195"
     CDS             426662..427405
                     /locus_tag="YPTB0360"
                     /note="member of the periplasmic pilus chaperone family of
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic chaperone protein"
                     /protein_id="YP_068906.1"
                     /db_xref="GI:51594715"
                     /db_xref="GeneID:2953195"
                     /translation="MQNFPTHHRDIGATIIYVNSVNRFNIFFVFTLLILLSSWSAVSY
                     ASFKLESTTVILQESEARTSFTIDNISSNPILLVTKLTDLDGKSFSKQILISPPVTRI
                     NAGQSQQVNFVLKKGSVLNNEVLLKASFEGVEQVPGNAAVMPIRQEIGFLIQPSAVPQ
                     IRMPWQTLVFSISGNNLVIKNPGKHVVRLGPQIILVPSNEVVALGNPYIMPETSKLFP
                     ITSSPTAVKVTPLSRYGFVQTEVTLPVTR"
     misc_feature    426725..427402
                     /locus_tag="YPTB0360"
                     /note="putative fimbrial chaperone protein; Provisional;
                     Region: PRK09918"
                     /db_xref="CDD:236632"
     misc_feature    426797..427138
                     /locus_tag="YPTB0360"
                     /note="Pili and flagellar-assembly chaperone, PapD
                     N-terminal domain; Region: PapD_N; pfam00345"
                     /db_xref="CDD:249787"
     misc_feature    426722..426790
                     /locus_tag="YPTB0360"
                     /note="1 probable transmembrane helix predicted by
                     TMHMM2.0"
     misc_feature    427413..427668
                     /product="pseudogene"
                     /note="similar to Yersinia pestis YPO0304 with a
                     frameshift."
                     /pseudo
     gene            427416..427598
                     /locus_tag="YPTB0361"
                     /pseudo
                     /db_xref="GeneID:2953196"
     misc_feature    427416..427598
                     /locus_tag="YPTB0361"
                     /note="hypothetical"
                     /pseudo
                     /db_xref="PSEUDO:CAH19601.1"
     gene            428763..430181
                     /locus_tag="YPTB0362"
                     /db_xref="GeneID:2953197"
     CDS             428763..430181
                     /locus_tag="YPTB0362"
                     /note="similar to Yersinia pestis YPO0306 hypothetical
                     protein (99.7% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068907.1"
                     /db_xref="GI:51594716"
                     /db_xref="GeneID:2953197"
                     /translation="MSRNKFCQCLITLERPLIPRCYPPNDLIIMEDNMMHTENNSPPG
                     LIPLPDWYPVAFSHLDAMEYASVTRLWHHEPVLRDLVDELDKRNPGLITFTHCPHCHS
                     ADICPGTRPEEYRCRTCHRCSSPYTHTPFFDLHHARHSRLYAVLVTLWGTWQVEDAAW
                     LSDCKSKQIWKQYCHRLKPILALIGGRAVTHTPRYLRGFTPGQQGLHCPACASTQLVY
                     SETMPVGNPEVHCQVCQTDFVMYPDIPKGIDPFAVNTPQYDIPLPRWFSRLFSHASQA
                     QYQHLREVWQREPVLREAVDRLDAQNPEQGAVYACPYCQNKHISPRKTASSIEGYYCP
                     ACDNPFTATTGTVFTRMRQEHFWRLYAVLVMLWTQWRPTQIFELCQLRSVHPFLTYHK
                     RLAPLLAEFDGAPITPYPRNLLGFTPGQQGVCCVYCQSTKLITEGITVMPLDNPYICC
                     LDCGQRFMLRVWRKQVKSNEKK"
     gene            complement(430201..430476)
                     /locus_tag="YPTB0363"
                     /db_xref="GeneID:2953198"
     CDS             complement(430201..430476)
                     /locus_tag="YPTB0363"
                     /note="similar to Salmonella typhimurium STM4155  inner
                     membrane protein (32.5% evalue=2.E-07)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068908.1"
                     /db_xref="GI:51594717"
                     /db_xref="GeneID:2953198"
                     /translation="MGTLVIASFYFLVAYLLIKKEVRIYQIASSLLYAVSLQMIQWNI
                     TAFIVYLTIPISIAFFSMIKKSNNQITYFSIPCWLVILSIIINSFLK"
     misc_feature    complement(join(430207..430272,430318..430383,
                     430423..430464))
                     /locus_tag="YPTB0363"
                     /note="3 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            431190..433247
                     /locus_tag="YPTB0364"
                     /db_xref="GeneID:2953199"
     CDS             431190..433247
                     /locus_tag="YPTB0364"
                     /note="similar to Yersinia pestis YPO0308  oxidoreductase
                     (99.7% evalue=0); Ralstonia solanacearum RS01873 conserved
                     hypothetical protein (42.8% evalue=1.E-102)"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_068909.1"
                     /db_xref="GI:51594718"
                     /db_xref="GeneID:2953199"
                     /translation="MKIIDKNVSTYETLQKGFNLRWPPNVEQGAETIYICTTPDEVFA
                     AANTALAAGNRITVRSGGHCYEGFVSNKLSTERLSIIDLGEMSGLDYDEDKTITSLWD
                     ANKNTYRFKSLTGNQNWNGYVSLYKRSGRTIPGGSCYSVGVGGHISGGGYGLLSRLHG
                     LTVDWVTGVDILVPVGNAHRLAFRHVRADSVSEVDRELFMACCGAGGGNFGIIIAYYF
                     DDLPKAPQKAYWIPLTYPWSSLKATFPAFLKAYWQWFADNDVNATSTKEGVGNGGLFT
                     LLKLNHIDASDNVVLAIQYTGPNGQVGGANDIPLNDFIEKMNAAAGMTPTIYDDFILP
                     NIPPFKHLYPGRKIGRTVDESASMDWLHVTQMINGSGSNQRGKYKSDYQIKQFSDEMC
                     HALLTHLTTATADKRFNQSLVQIDSYGGAINSRGIGATAVSQRNSLLKAQYQTYWTNE
                     ADDQTHLTWIRNIYAAVHNGKPAPPEFEGCYINYPDIDMKYTDSGEEDPNWLNLYYGW
                     DTQLIKRLIALKARIDPNNIFHHELSIPLVTELPKAPVNLHSTGQTTTSISLMWGSSI
                     GALPVASYAIYRDGHEVKLLNGTQTSAEDAGLQPNTEYRYFVAAGDEHGNLSVPSNVL
                     TVSTQGTHPAWVLNGSYAVGDVVSNLGKLWRCIQSHVAYDPLWAPGTNGGITLWAGYT
                     AGR"
     misc_feature    431241..432803
                     /locus_tag="YPTB0364"
                     /note="FAD/FMN-containing dehydrogenases [Energy
                     production and conversion]; Region: GlcD; COG0277"
                     /db_xref="CDD:223354"
     misc_feature    432627..432797
                     /locus_tag="YPTB0364"
                     /note="Berberine and berberine like; Region: BBE;
                     pfam08031"
                     /db_xref="CDD:254594"
     misc_feature    432813..433244
                     /locus_tag="YPTB0364"
                     /note="Uncharacterized protein contain chitin-binding
                     domain type 3 [General function prediction only]; Region:
                     COG3979"
                     /db_xref="CDD:226487"
     misc_feature    432813..433073
                     /locus_tag="YPTB0364"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(432813..432815,432987..432989,433032..433034)
                     /locus_tag="YPTB0364"
                     /note="Interdomain contacts; other site"
                     /db_xref="CDD:238020"
     misc_feature    order(433035..433037,433041..433043,433047..433052)
                     /locus_tag="YPTB0364"
                     /note="Cytokine receptor motif; other site"
                     /db_xref="CDD:238020"
     misc_feature    433089..433223
                     /locus_tag="YPTB0364"
                     /note="chitin-binding domain of Chi A1-like proteins;
                     Region: ChiA1_BD; cd12214"
                     /db_xref="CDD:213177"
     gene            complement(433591..437385)
                     /locus_tag="YPTB0365"
                     /db_xref="GeneID:2953200"
     CDS             complement(433591..437385)
                     /locus_tag="YPTB0365"
                     /note="similar to Yersinia pestis YPO1672 conserved
                     hypothetical protein (79.7% evalue=0)"
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter protein"
                     /protein_id="YP_068910.1"
                     /db_xref="GI:51594719"
                     /db_xref="GeneID:2953200"
                     /translation="MHIQFREPISTSPAQPDAGRQHLFSRVPAAVMNPITLAIIVAFS
                     TLVLPQTAWAACNSSGVGTYVCEGENNTAISLFGTDIAVETRPGFGITEHEITDSALS
                     LTGSGTISYLDTNSSALDTDSRYSLYIKNDTLITEQSASINVQSNGSISSGVYIDNQS
                     SDDSTIRVDLSGILSSSLSGAPALSIFSSAGNDSTIILNTHAISGVTGIQSDNNSQNG
                     ATITHVDVTGDINVENSGVSIRNAANGGTSIINFNSKSINTEYDSFYIQNTNYVGGVI
                     TDINIDGDISSANSQAARIYNYTNGGLASLRFRANNVTGSTGLYIDNSSQNGAVTDII
                     LTGDLTATSGSALQANAYSDEGNIETAIKLNNVYSLYDALNISDYTRSGNILHDLDIS
                     GTITAENGTGIKVMGAAGEGSSTMLINVNNITSSSQSLDINNYNFLGSAFSAITATGH
                     LTAEWGQGAMLQTHSSLGDATTLIHFNDITAMSSGISLINEANQGTSTTDITVTGQIN
                     VSHGEGITLNALTTDGRTLVNVDVNNIASEYDAIRLYNYNYNDNYATGVDDGTGADNG
                     TSTIDLITRGALVSQQGYGINIETNTADTYVTVGGLVHGGNGTAIGIHRLDNIQTSAT
                     LELQSGYALEGVTQALVFNGSYAEINDAALDLANSHLVLGGTGDAAFDLTRIDNREEA
                     ILDGDPNRITGFGTLTKTNNSIWTLTGANMADGDANAFLSANIAGGILVLDNATLGLT
                     PATTILNRLSAADIAADPTLVATETGALTLAEGGALSSLGDSVLSGNLISAGGILLSN
                     TYTGGNGAATDDRLTVTGTYFGENNGSGEGAWLALDTVLGDDDSATDRLVINGDATGT
                     TSVRVNNAGGLGDKTLNGINLITVDGLAQDDTFLLAGDYVTTDGYQAVVAGAYAYTLQ
                     ADGEAATAGRNWYLSSELMLTEGVRYQVGVPLYEQYPQVLAALNTLPTLQQRVGNRYG
                     APGALADLNFDDNQWAWGRIEGSHQVTDPARSTSGSQREIDVWKLQTGIDVPLYQSQG
                     GSLLTGGVNFTYGKAKADIHSFFGDGRINSAGYGLGTSLTWYGNNGVYVDGQLQTMWF
                     DSDLSSRTAGHAVASGNNGRGYTSAIEAGKGYALGNGLSLTPQMQVTYSRVDFDTFRD
                     PFDSEVSLQEGDSLRGRLGVSLDKETTWSAKDGTTRRSHIYSHLDLHNEFLNGSKVQV
                     SGVEFATRDERQSVGLGAGGTYEWQNGRYAVYGNVNLLGATRNVSDNYAVGGTIGARV
                     SW"
     misc_feature    complement(434587..435135)
                     /locus_tag="YPTB0365"
                     /note="Pertactin-like passenger domains (virulence
                     factors), C-terminal, subgroup 2, of autotransporter
                     proteins of the type V secretion system of Gram-negative
                     bacteria. This subgroup includes the passenger domains of
                     the nonprotease autotransporters, Ag43; Region:
                     PL2_Passenger_AT; cd01344"
                     /db_xref="CDD:238654"
     misc_feature    complement(433594..434958)
                     /locus_tag="YPTB0365"
                     /note="outer membrane autotransporter barrel domain;
                     Region: autotrans_barl; TIGR01414"
                     /db_xref="CDD:233402"
     misc_feature    complement(433666..434418)
                     /locus_tag="YPTB0365"
                     /note="Autotransporter beta-domain; Region:
                     Autotransporter; smart00869"
                     /db_xref="CDD:214872"
     gene            438217..438741
                     /gene="ubiC"
                     /locus_tag="YPTB0366"
                     /db_xref="GeneID:2956851"
     CDS             438217..438741
                     /gene="ubiC"
                     /locus_tag="YPTB0366"
                     /note="catalyzes the formation of 4-hydroxybenzoate from
                     chorismate"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate pyruvate lyase"
                     /protein_id="YP_068911.1"
                     /db_xref="GI:51594720"
                     /db_xref="GeneID:2956851"
                     /translation="MFIGDASILKPIQWCATEHPELPADIADWLMELGSMTRRFEQHC
                     QRVHVEPQRECFITRDALGEEAEHLPVSQRYWLREIVLFGDNVPWLLGRTVIPEETLS
                     GPDRALVDLGTLPLGRYLFSGDALTRDYIHVGRQDNLWARRSLLRLSGNPLLLTEVFL
                     PASPLYTHCDSIPK"
     misc_feature    438217..438726
                     /gene="ubiC"
                     /locus_tag="YPTB0366"
                     /note="chorismate pyruvate lyase; Provisional; Region:
                     ubiC; PRK11655"
                     /db_xref="CDD:236949"
     gene            438907..439773
                     /gene="ubiA"
                     /locus_tag="YPTB0367"
                     /gene_synonym="cyr"
                     /db_xref="GeneID:2956850"
     CDS             438907..439773
                     /gene="ubiA"
                     /locus_tag="YPTB0367"
                     /gene_synonym="cyr"
                     /EC_number="2.5.1.-"
                     /note="catalyzes the conversion of 4-Hydroxybenzoate into
                     3-octaprenyl-4-hydroxybenzoate, as part of the ubiquinone
                     biosynthesis pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="YP_068912.1"
                     /db_xref="GI:51594721"
                     /db_xref="GeneID:2956850"
                     /translation="MKGSTVHTKWQAYCRLMRIDKPIGSLLLLWPTLWALWLAGRGIP
                     EAKILVVFVLGVFFMRAAGCVVNDYADRHIDGFVKRTASRPLPSGTISEKESKILFVV
                     LILLSFGLVLTLNSMTIWLSLAALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAA
                     VSESLPLVCWLLLLANICWTVAYDTQYAMVDRDDDLRIGVKSTAILFGQHDKLIIGLL
                     QLATLLLMVAIGWLMNLGGAFYWSILLAGALFTHQQKMIAQREREPCFRAFLNNNYVG
                     LVLFLGILISYW"
     misc_feature    438955..439764
                     /gene="ubiA"
                     /locus_tag="YPTB0367"
                     /gene_synonym="cyr"
                     /note="4-Hydroxybenzoate polyprenyltransferase; Region:
                     PT_UbiA_COQ2; cd13959"
                     /db_xref="CDD:260122"
     misc_feature    order(439117..439119,439129..439131,439477..439479,
                     439489..439491)
                     /gene="ubiA"
                     /locus_tag="YPTB0367"
                     /gene_synonym="cyr"
                     /note="putative active site [active]"
                     /db_xref="CDD:260122"
     misc_feature    join(438967..439020,439048..439116,439198..439266,
                     439324..439392,439405..439473,439585..439653,
                     439714..439767)
                     /gene="ubiA"
                     /locus_tag="YPTB0367"
                     /gene_synonym="cyr"
                     /note="7 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(439954..442458)
                     /gene="pslB"
                     /locus_tag="YPTB0368"
                     /db_xref="GeneID:2956340"
     CDS             complement(439954..442458)
                     /gene="pslB"
                     /locus_tag="YPTB0368"
                     /EC_number="2.3.1.15"
                     /note="PlsB; catalyzes the formation of 1-acyl-sn-glycerol
                     3-phosphate by transfering the acyl moiety from acyl-CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="YP_068913.1"
                     /db_xref="GI:51594722"
                     /db_xref="GeneID:2956340"
                     /translation="MSGWRKIYYKLLNLPLKLLVKSKVIPADPVSELGLDPSRPILYV
                     LPYNSKADLLTLRAQCLAQDLPDPLIPLEIDGVQLPSHVFIENGPRVFRYYVPKQESV
                     KLFHDYLDLHRNNPALDIQMLPVSVMFGRSPGREGHGTPHLRVLNGVQKFFAVLWLGR
                     DSFVRFSTTVSLRRMASEHGTDKTIAHKLARVARMHFSRQRLAAVGPSLPARQDLFKK
                     LLASKAIEKAVADEARSKKISHEKAQQNAITLMEEIAANFSYEAVRLSDRVLSWTWNR
                     LYQGINVHNAERVRQLAQDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINL
                     NFWPAGPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFTRGYSVEYFVEGGRSRTGR
                     LLEPKTGTLSMTIQAMLRGGTRPITLVPIYIGYEHVMEVGTYAKELRGAIKEKENLLQ
                     MLRGLRKLRNLGQGYVNFGEPLPLTTYLNTHVPQWRDAIDPIEAQRPSWLTPAVNDLA
                     NQIMVRINNAAAANAMNLCSTALLASRQRSLTREQLLEQLDCYLQLMRNAPYAKDTTV
                     PDKTPEELLNHALNMNKFEVEKDTIGDIIILPREQAVLMTYYRNNIQHLLILPSLIAS
                     MVMYHRRITRTELLHKISMIYPMLKAELFLHYSKEQLPETLDTLIDELARQQLICDKG
                     SELVLNPARIRPLQLLAAGVRETLQRYAITLSLLSATPSINRGALEKESRIMAQRLSV
                     LHGINAPEFFDKAVFSTLVATLREEGYISDSGDAIQEHTLEVYNMLSALMTPEVKLTI
                     ESVSMPAETSNQPEAPETPETPETPETPEPEGKTES"
     misc_feature    complement(440041..442458)
                     /gene="pslB"
                     /locus_tag="YPTB0368"
                     /note="Glycerol-3-phosphate O-acyltransferase [Lipid
                     metabolism]; Region: PlsB; COG2937"
                     /db_xref="CDD:225488"
     misc_feature    complement(441022..441627)
                     /gene="pslB"
                     /locus_tag="YPTB0368"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: GPAT-like; Region:
                     LPLAT_DHAPAT-like; cd07993"
                     /db_xref="CDD:153255"
     misc_feature    complement(order(441298..441306,441457..441468,
                     441529..441531,441535..441537,441544..441546))
                     /gene="pslB"
                     /locus_tag="YPTB0368"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153255"
     gene            442586..442957
                     /gene="dgkA"
                     /locus_tag="YPTB0369"
                     /db_xref="GeneID:2955456"
     CDS             442586..442957
                     /gene="dgkA"
                     /locus_tag="YPTB0369"
                     /EC_number="2.7.1.107"
                     /note="similar to Yersinia pestis YPO0313 dgkA;
                     diacylglycerol kinase (100% evalue=9.E-63); Escherichia
                     coli ECs5025 diacylglycerol kinase (68.3% evalue=1.E-42)"
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="YP_068914.1"
                     /db_xref="GI:51594723"
                     /db_xref="GeneID:2955456"
                     /translation="MANQSTGLTRIYKAAGYTVKGLTAAWNNEAAFRQESVAAVIAII
                     LAFWLDVGAIARILLICSVVLVLIVEVINSAIEAVVDRIGSEFHALSGRAKDMGSAAV
                     FLTILMALFVWITVLWQHVAR"
     misc_feature    442610..442936
                     /gene="dgkA"
                     /locus_tag="YPTB0369"
                     /note="Integral membrane diacylglycerol kinase; Region:
                     DAGK_IM; cd14264"
                     /db_xref="CDD:260133"
     misc_feature    order(442610..442612,442625..442627,442637..442639,
                     442646..442648,442673..442675,442682..442684,
                     442688..442690,442793..442795,442802..442807,
                     442814..442816,442826..442831,442865..442873,
                     442877..442882,442886..442888)
                     /gene="dgkA"
                     /locus_tag="YPTB0369"
                     /note="putative active site [active]"
                     /db_xref="CDD:260133"
     misc_feature    order(442631..442651,442655..442660,442742..442750,
                     442754..442759,442766..442768,442775..442777,
                     442787..442792,442796..442801,442805..442813,
                     442817..442825,442829..442834,442847..442849,
                     442853..442858,442865..442867,442874..442876,
                     442883..442888,442895..442900,442907..442909,
                     442919..442921,442928..442933)
                     /gene="dgkA"
                     /locus_tag="YPTB0369"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:260133"
     misc_feature    order(442643..442645,442670..442672,442793..442795,
                     442814..442816,442826..442828,442868..442873)
                     /gene="dgkA"
                     /locus_tag="YPTB0369"
                     /note="putative active site [active]"
                     /db_xref="CDD:260133"
     misc_feature    order(442670..442672,442814..442816)
                     /gene="dgkA"
                     /locus_tag="YPTB0369"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:260133"
     misc_feature    join(442694..442762,442883..442951)
                     /gene="dgkA"
                     /locus_tag="YPTB0369"
                     /note="2 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            443082..443690
                     /gene="lexA"
                     /locus_tag="YPTB0370"
                     /gene_synonym="exrA; spr; tsl; umuA"
                     /db_xref="GeneID:2955945"
     CDS             443082..443690
                     /gene="lexA"
                     /locus_tag="YPTB0370"
                     /gene_synonym="exrA; spr; tsl; umuA"
                     /EC_number="3.4.21.88"
                     /note="Represses a number of genes involved in the
                     response to DNA damage"
                     /codon_start=1
                     /transl_table=11
                     /product="LexA repressor"
                     /protein_id="YP_068915.1"
                     /db_xref="GI:51594724"
                     /db_xref="GeneID:2955945"
                     /translation="MKALTTRQQEVYDLVRDHLAQTGMPPTRAEIAQRLGFRSPNAAE
                     EHLKALARKGVIEIVSGASRGIRLLMEEEEGLPLIGRVAAGEPLLAQQHIEGHYKVDP
                     SLFKPGADFLLRVNGMSMRDIGILDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKK
                     QGNIVHLLPENSEFQPIVVDLREQSFTIEGLAVGVIRNGDWI"
     misc_feature    443088..443678
                     /gene="lexA"
                     /locus_tag="YPTB0370"
                     /gene_synonym="exrA; spr; tsl; umuA"
                     /note="LexA repressor; Validated; Region: PRK00215"
                     /db_xref="CDD:234688"
     misc_feature    443088..443276
                     /gene="lexA"
                     /locus_tag="YPTB0370"
                     /gene_synonym="exrA; spr; tsl; umuA"
                     /note="LexA DNA binding domain; Region: LexA_DNA_bind;
                     pfam01726"
                     /db_xref="CDD:201938"
     misc_feature    443412..443630
                     /gene="lexA"
                     /locus_tag="YPTB0370"
                     /gene_synonym="exrA; spr; tsl; umuA"
                     /note="Peptidase S24 LexA-like proteins are involved in
                     the SOS response leading to the repair of single-stranded
                     DNA within the bacterial cell. This family includes: the
                     lambda repressor CI/C2 family and related bacterial
                     prophage repressor proteins; LexA (EC...; Region:
                     S24_LexA-like; cd06529"
                     /db_xref="CDD:119397"
     misc_feature    order(443436..443438,443547..443549)
                     /gene="lexA"
                     /locus_tag="YPTB0370"
                     /gene_synonym="exrA; spr; tsl; umuA"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            complement(443899..444408)
                     /locus_tag="YPTB0371"
                     /db_xref="GeneID:2953201"
     CDS             complement(443899..444408)
                     /locus_tag="YPTB0371"
                     /note="Acts as a negative controlling element, employing
                     Zn(2+) as a cofactor to bind the operator of the repressed
                     genes znuACB"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc uptake transcriptional repressor"
                     /protein_id="YP_068916.1"
                     /db_xref="GI:51594725"
                     /db_xref="GeneID:2953201"
                     /translation="MNPINQEKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAISA
                     YDLLDLLRVAEPQAKPPTVYRALDFLLEQGFIHRVESANSYVLCHHFEEPTHTSALFI
                     CDRCKIVTERPTVGIEEALAQLAKQSGFTLRHSVVEAHGLCTECGVVEACESHDDCEH
                     DHSIVVKKK"
     misc_feature    complement(443980..444333)
                     /locus_tag="YPTB0371"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(444076..444078,444109..444111,
                     444121..444123,444142..444144,444286..444288))
                     /locus_tag="YPTB0371"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(444190..444234)
                     /locus_tag="YPTB0371"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(444004..444006,444055..444057,
                     444112..444114,444124..444126))
                     /locus_tag="YPTB0371"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(443983..444009,444013..444021,
                     444046..444051,444097..444105))
                     /locus_tag="YPTB0371"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(443980..443982,444091..444093,
                     444100..444102))
                     /locus_tag="YPTB0371"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            444663..445700
                     /locus_tag="YPTB0372"
                     /db_xref="GeneID:2953202"
     CDS             444663..445700
                     /locus_tag="YPTB0372"
                     /note="similar to Yersinia pestis YPO0316 conserved
                     hypothetical protein (99.7% evalue=0); Salmonella typhi
                     STY4439 yjbN; conserved hypothetical protein (77.7%
                     evalue=1.E-149)"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase A"
                     /protein_id="YP_068917.1"
                     /db_xref="GI:51594726"
                     /db_xref="GeneID:2953202"
                     /translation="MHEAQTFSSTPATKPQYPLQRFSVAPMLDWTDRHCRYFHRLLTK
                     QALLYTEMVTTGAIIHGKADYLAYSEQDHPVALQLGGSDPQALAHCAKLAEQRGYNEI
                     NLNVGCPSDRVQNGRFGACLMGEADLVADCIKAMRDAVAIPVTVKTRIGIDQLDSYEF
                     LCEFVQTVAERGECEIFTIHARKAWLSGLSPKENREVPPLDYERVYQLKRDFPALTIA
                     INGGVKTLAEAKEHLKHLDGVMMGREAYQNPGILTQVDRELFDPHAPVVDSVKAIEAL
                     YPYIEQELSQGAYLGHITRHILGIFQGIPGARQWRRHLSENAHKPGAGVSVVEEALAL
                     VSPSYYESVGG"
     misc_feature    444723..445442
                     /locus_tag="YPTB0372"
                     /note="Dihydrouridine synthase-like (DUS-like) FMN-binding
                     domain. Members of this family catalyze the reduction of
                     the 5,6-double bond of a uridine residue on tRNA.
                     Dihydrouridine modification of tRNA is widely observed in
                     prokaryotes and eukaryotes, and also...; Region:
                     DUS_like_FMN; cd02801"
                     /db_xref="CDD:239200"
     misc_feature    444729..445634
                     /locus_tag="YPTB0372"
                     /note="Dihydrouridine synthase (Dus); Region: Dus;
                     pfam01207"
                     /db_xref="CDD:250444"
     misc_feature    order(444735..444743,444816..444818,444894..444896,
                     444975..444977,445101..445103,445200..445202,
                     445320..445322,445326..445328,445386..445391)
                     /locus_tag="YPTB0372"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239200"
     misc_feature    order(444894..444896,444984..444989,445101..445103,
                     445107..445109,445197..445202,445206..445211,
                     445323..445328,445389..445391)
                     /locus_tag="YPTB0372"
                     /note="active site"
                     /db_xref="CDD:239200"
     misc_feature    order(444984..444986,445107..445109,445200..445202,
                     445206..445208)
                     /locus_tag="YPTB0372"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239200"
     misc_feature    order(444987..444989,445101..445103,445197..445199,
                     445209..445211,445323..445328)
                     /locus_tag="YPTB0372"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239200"
     gene            446216..446434
                     /gene="pspG"
                     /locus_tag="YPTB0373"
                     /db_xref="GeneID:2953203"
     CDS             446216..446434
                     /gene="pspG"
                     /locus_tag="YPTB0373"
                     /note="coordinately regulated along with pspA;
                     PspF-dependent induction in response to secretin
                     overexpression in Yersinia"
                     /codon_start=1
                     /transl_table=11
                     /product="phage shock protein G"
                     /protein_id="YP_068918.1"
                     /db_xref="GI:51594727"
                     /db_xref="GeneID:2953203"
                     /translation="MLEIFFVIGFFMVLMVTGISLLGILAALLVAAVFMMLGGLFVMM
                     IKLLPWLILAVVVAWIWRSMQKPVIRRY"
     misc_feature    446216..446431
                     /gene="pspG"
                     /locus_tag="YPTB0373"
                     /note="phage shock protein G; Reviewed; Region: pspG;
                     PRK09459"
                     /db_xref="CDD:181875"
     misc_feature    join(446234..446302,446330..446398)
                     /gene="pspG"
                     /locus_tag="YPTB0373"
                     /note="2 probable transmembrane helices predicted by
                     TMHMM2.0"
     gene            complement(446779..447762)
                     /gene="qor"
                     /locus_tag="YPTB0374"
                     /gene_synonym="hcx"
                     /db_xref="GeneID:2956395"
     CDS             complement(446779..447762)
                     /gene="qor"
                     /locus_tag="YPTB0374"
                     /gene_synonym="hcx"
                     /EC_number="1.6.5.5"
                     /note="similar to Yersinia pestis YPO0319 qor, hcz;
                     quinone oxidoreductase (99.6% evalue=0); Salmonella typhi
                     STY4441 qor; quinone oxidoreductase (73.7%
                     evalue=1.E-136)"
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="YP_068919.1"
                     /db_xref="GI:51594728"
                     /db_xref="GeneID:2956395"
                     /translation="MAKHIQFTTTGGPDVLQYLEFTPSDPAPHEVQVENKAIGINYID
                     TYVRSGLYPPAHLPSGLGTEAAGIVSKVGAAVSSVKVGDRVVYAQSALGAYSEVHNVP
                     ADKIALLPEQISFEQAAASFLKGLTAYYLLRQTHEIKPGEVFLFHAAAGGVGLIACQW
                     AKALGAKLIGTVGSDEKAQLAKAAGAWATINYRTENIAQRVAELTEGEKVGVVYDSVG
                     KSTWEASLDSLKRRGLLVSFGNASGPVTGVNLGILNQKGGIYVTRPSLNVYVANRQEL
                     ESASQQLFSMITSGAINVDVAQAQQFPLCDAQRAHETLEGRQTTGSSLLIP"
     misc_feature    complement(446782..447762)
                     /gene="qor"
                     /locus_tag="YPTB0374"
                     /gene_synonym="hcx"
                     /note="quinone oxidoreductase, NADPH-dependent;
                     Provisional; Region: PRK10754"
                     /db_xref="CDD:182701"
     misc_feature    complement(446782..447756)
                     /gene="qor"
                     /locus_tag="YPTB0374"
                     /gene_synonym="hcx"
                     /note="Quinone oxidoreductase (QOR); Region: QOR2;
                     cd05286"
                     /db_xref="CDD:176189"
     misc_feature    complement(order(446812..446814,446818..446820,
                     446965..446976,447037..447051,447112..447117,
                     447187..447189,447232..447234,447244..447249,
                     447304..447312,447319..447321,447373..447375,
                     447382..447384,447394..447396,447625..447627,
                     447637..447642))
                     /gene="qor"
                     /locus_tag="YPTB0374"
                     /gene_synonym="hcx"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:176189"
     misc_feature    complement(order(446956..446961,446968..446991,
                     447013..447030,447067..447072,447358..447360))
                     /gene="qor"
                     /locus_tag="YPTB0374"
                     /gene_synonym="hcx"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176189"
     gene            448094..449500
                     /gene="dnaB"
                     /locus_tag="YPTB0375"
                     /gene_synonym="groP; grpA"
                     /db_xref="GeneID:2955471"
     CDS             448094..449500
                     /gene="dnaB"
                     /locus_tag="YPTB0375"
                     /gene_synonym="groP; grpA"
                     /EC_number="3.6.1.-"
                     /note="unwinds double stranded DNA"
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="YP_068920.1"
                     /db_xref="GI:51594729"
                     /db_xref="GeneID:2955471"
                     /translation="MAAKKPTNKMTEPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNER
                     WDNVSERVASKDFFSRPHRRIFTEMQRLLENSKPIDLITLSESLEQKGDLDSVGGFAY
                     LAELSKNTPSAANIGAYADIVRERAVVREMISVANEIADAGYDPQGRSSEDLLDLAES
                     KVFQIAESRASKDEGPKSVDRILEDTVARIEQLYQRPHDGVTGVSTGFTDLDKKTAGL
                     QKSDLIIVAARPSMGKTTFAMNLCENAAMMQDKPVLIFSLEMPGDQIMMRMLASLSHV
                     DQTRIRTGQLDDEDWARISSTMGILMEKRNMYIDDSSGLTPTEVRSRARRIFREHGGL
                     SLIMIDYLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADK
                     RPVNSDLRESGSIEQDADLIMFIYRDEVYHENSDEKGIAQIILGKQRNGPIGSVRLKF
                     NGQWSRFDNYAGPQYDDE"
     misc_feature    448094..449497
                     /gene="dnaB"
                     /locus_tag="YPTB0375"
                     /gene_synonym="groP; grpA"
                     /note="replicative DNA helicase; Provisional; Region:
                     PRK08006"
                     /db_xref="CDD:181193"
     misc_feature    448163..448468
                     /gene="dnaB"
                     /locus_tag="YPTB0375"
                     /gene_synonym="groP; grpA"
                     /note="DnaB-like helicase N terminal domain; Region: DnaB;
                     pfam00772"
                     /db_xref="CDD:250122"
     misc_feature    448718..449449
                     /gene="dnaB"
                     /locus_tag="YPTB0375"
                     /gene_synonym="groP; grpA"
                     /note="DnaB helicase C terminal domain. The hexameric
                     helicase DnaB unwinds the DNA duplex at the  chromosome
                     replication fork. Although the mechanism by which DnaB
                     both couples ATP hydrolysis to translocation along DNA and
                     denatures the duplex is unknown, a...; Region: DnaB_C;
                     cd00984"
                     /db_xref="CDD:238484"
     misc_feature    448778..448798
                     /gene="dnaB"
                     /locus_tag="YPTB0375"
                     /gene_synonym="groP; grpA"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238484"
     misc_feature    order(448793..448798,449111..449113,449234..449236,
                     449342..449344,449408..449410,449441..449443)
                     /gene="dnaB"
                     /locus_tag="YPTB0375"
                     /gene_synonym="groP; grpA"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238484"
     misc_feature    449102..449113
                     /gene="dnaB"
                     /locus_tag="YPTB0375"
                     /gene_synonym="groP; grpA"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238484"
     misc_feature    order(449126..449131,449150..449158,449231..449257,
                     449339..449344,449378..449383)
                     /gene="dnaB"
                     /locus_tag="YPTB0375"
                     /gene_synonym="groP; grpA"
                     /note="DNA binding loops [nucleotide binding]"
                     /db_xref="CDD:238484"
     gene            449597..450676
                     /gene="alr"
                     /locus_tag="YPTB0376"
                     /db_xref="GeneID:2955187"
     CDS             449597..450676
                     /gene="alr"
                     /locus_tag="YPTB0376"
                     /EC_number="5.1.1.1"
                     /note="converts L-alanine to D-alanine which is used in
                     cell wall biosynthesis; binds one pyridoxal phosphate per
                     monomer; forms a homodimer"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="YP_068921.1"
                     /db_xref="GI:51594730"
                     /db_xref="GeneID:2955187"
                     /translation="MKAATAVIDRHALRHNLQQIRRLAPQSRLVAVVKANAYGHGLLA
                     AAHTLQDADCYGVARISEALMLRAGGIVKPILLLEGFFDAEDLPVLVANHIETAVHSL
                     EQLVALEAATLSAPINAWMKLDTGMHRLGVRPDQAEAFYQRLSACRNVIQPVNIMSHF
                     SRADEPEVAATQQQLACFDAFAAGKPGKQSIAASGGILRWPQAHRDWVRPGIVLYGVS
                     PFDTPYGRDFGLLPAMTLKSSLIAVREHKAGESVGYGGTWVSERDTRLGVIAIGYGDG
                     YPRSAPSGTPVWLNGREVSIVGRVSMDMISIDLGPESTDKVGDEALMWGAELPVERVA
                     ACTGISAYELITNLTSRVAMEYLGE"
     misc_feature    449597..450667
                     /gene="alr"
                     /locus_tag="YPTB0376"
                     /note="alanine racemase; Reviewed; Region: alr; PRK00053"
                     /db_xref="CDD:234600"
     misc_feature    449603..450664
                     /gene="alr"
                     /locus_tag="YPTB0376"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzymes, Proteobacterial Alanine Racemases; Region:
                     PLPDE_III_AR_proteobact; cd06827"
                     /db_xref="CDD:143500"
     misc_feature    order(449690..449692,449696..449698,449708..449710,
                     449828..449830,449960..449962,449981..449983,
                     450065..450067,450071..450073,450173..450181,
                     450221..450232,450620..450622)
                     /gene="alr"
                     /locus_tag="YPTB0376"
                     /note="active site"
                     /db_xref="CDD:143500"
     misc_feature    order(449690..449692,449696..449698,449708..449710,
                     449828..449830,450071..450073,450173..450178,
                     450221..450223,450227..450232,450620..450622)
                     /gene="alr"
                     /locus_tag="YPTB0376"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143500"
     misc_feature    order(449696..449698,449708..449710,449981..449983,
                     450071..450073,450620..450622)
                     /gene="alr"
                     /locus_tag="YPTB0376"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143500"
     misc_feature    order(449696..449698,450356..450358)
                     /gene="alr"
                     /locus_tag="YPTB0376"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143500"
     misc_feature    order(450317..450319,450326..450328,450344..450349,
                     450353..450361,450398..450400,450413..450415,
                     450431..450433,450497..450499,450503..450505,
                     450614..450616,450620..450625,450638..450640,
                     450647..450649)
                     /gene="alr"
                     /locus_tag="YPTB0376"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143500"
     gene            450862..452055
                     /gene="tyrB"
                     /locus_tag="YPTB0377"
                     /db_xref="GeneID:2956846"
     CDS             450862..452055
                     /gene="tyrB"
                     /locus_tag="YPTB0377"
                     /EC_number="2.6.1.57"
                     /note="catalyzes the formation of L-glutamate and an
                     aromatic oxo acid from an aromatic amino acid and
                     2-oxoglutarate"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid aminotransferase"
                     /protein_id="YP_068922.1"
                     /db_xref="GI:51594731"
                     /db_xref="GeneID:2956846"
                     /translation="MFQNVDAYAGDPILSLMESFKADNRAHKVNLSIGLYYNEQGEIP
                     QMQAVDAAEAQLSAQPHGTPVYLPMEGLQSYRTAIQQLLFGHDHPMLVQQRVATIQTV
                     GGSGALKVGADFLNHYFPDSQVWVSDPTWENHVAIFSGAGFKVNTYPYFDNDKLAVKF
                     DPMLATLQQLPARSIVLLHPCCHNPTGSDLTNAQWDRLIDVVKERELIPFLDIAYQGF
                     GAGLNEDAYAIRAMAAAGLPCLISNSFSKIFSLYNERVGGLSVVCESDEAAGRVLGQL
                     KATVRRNYSSPPNFGAQVVSKVLNDTVLRAQWQAEVEQMRLRILDMRHTLVEALKASL
                     PERNFDYLLQQRGMFSYTGFSEAQVDRLREEFGVYLIASGRMCMAGVNHQNVEQVAVA
                     FAAVQ"
     misc_feature    450937..452040
                     /gene="tyrB"
                     /locus_tag="YPTB0377"
                     /note="Aminotransferase class I and II; Region:
                     Aminotran_1_2; pfam00155"
                     /db_xref="CDD:249636"
     misc_feature    450946..452010
                     /gene="tyrB"
                     /locus_tag="YPTB0377"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(451168..451176,451252..451254,451411..451413,
                     451504..451506,451591..451593,451597..451602,
                     451624..451626)
                     /gene="tyrB"
                     /locus_tag="YPTB0377"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(451177..451179,451282..451284,451483..451485,
                     451618..451626,451732..451734,451741..451743)
                     /gene="tyrB"
                     /locus_tag="YPTB0377"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    451600..451602
                     /gene="tyrB"
                     /locus_tag="YPTB0377"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            452582..452941
                     /locus_tag="YPTB0378"
                     /db_xref="GeneID:2953204"
     CDS             452582..452941
                     /locus_tag="YPTB0378"
                     /note="similar to Yersinia pestis YPO0323 conserved
                     hypothetical protein (100% evalue=3.E-66); Escherichia
                     coli JW4018 yjbR; Hypothetical protein (57.5%
                     evalue=5.E-35)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068923.1"
                     /db_xref="GI:51594732"
                     /db_xref="GeneID:2953204"
                     /translation="MNHSALLEYCLSKPGAEQCEHEQWQTNQIKVADVMFAMVGNIGG
                     RPSISLKSSPKLAERLREQHPEIVPSEHLNKTHWNTVFLDGKLPNSQFYTLIDHSYQL
                     VLQGLPEQRRQDLSSHL"
     misc_feature    452582..452935
                     /locus_tag="YPTB0378"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: MmcQ; COG2315"
                     /db_xref="CDD:225197"
     gene            complement(453034..455877)
                     /gene="uvrA"
                     /locus_tag="YPTB0379"
                     /gene_synonym="dinE"
                     /db_xref="GeneID:2956881"
     CDS             complement(453034..455877)
                     /gene="uvrA"
                     /locus_tag="YPTB0379"
                     /gene_synonym="dinE"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. UvrA is an ATPase and a
                     DNA-binding protein. A damage recognition complex composed
                     of 2 uvrA and 2 uvrB subunits scans DNA for abnormalities.
                     When the presence of a lesion has been verified by uvrB,
                     the uvrA molecules dissociate"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="YP_068924.1"
                     /db_xref="GI:51594733"
                     /db_xref="GeneID:2956881"
                     /translation="MDNIEVRGARTHNLKNINLIIPRDKLIVVTGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIHDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVISQPEGRRLMLLAPVVKDRKG
                     EHTKILENLAAQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVVDRFKVREDLAQRLA
                     ESFETALALSGGTAVVADMDDPHVEELLFSANFACPICGYSMRELEPRLFSFNNPAGA
                     CPTCDGLGVQQFFDPDRVLQNPELSLAGGAIRGWDRRNFYYFQMLRSLAEHYKFDIEA
                     PFNSLDSAVQQAVLYGSGKDTIEFKYINDRGDTTVRRHPFEGVLHNMERRYKETESSA
                     VREELAKFISNRSCASCSGTRLRREARYVFVENTTLPEISELSIGHALSFFQNMKLSG
                     QRAQIAEKILKEIGDRLKFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGV
                     MYVLDEPSIGLHQRDNERLLETLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGV
                     HGGEVVAEGTVDDIMAAPASLTGQFLSGKRSIAIPEKRVSADPSKVLKLIGATGNNLK
                     DVTLTLPVGLFSCITGVSGSGKSTLINDTLYSIAQRQLNGATITEPAPYREIQGLEHF
                     DKVIDIDQSPIGRTPRSNPATYTGIFTPIRELFAGVPESRTRGYTPGRFSFNVKGGRC
                     EACQGDGVIKVEMHFLPDIYVPCDHCKGKRYNRETLEIKYKGKSIHEVLAMTIEEARE
                     FFDAVPALARKLQTLIDVGLSYICLGQSATTLSGGEAQRVKLSRELSKRGTGQTLYIL
                     DEPTTGLHFADIQQLLAVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGE
                     ILVSGTPETVAECAASHTARFLKPMLQRKPQTV"
     misc_feature    complement(453052..455877)
                     /gene="uvrA"
                     /locus_tag="YPTB0379"
                     /gene_synonym="dinE"
                     /note="excinuclease ABC subunit A; Reviewed; Region: uvrA;
                     PRK00349"
                     /db_xref="CDD:234734"
     misc_feature    complement(<455530..455868)
                     /gene="uvrA"
                     /locus_tag="YPTB0379"
                     /gene_synonym="dinE"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    complement(454153..>454491)
                     /gene="uvrA"
                     /locus_tag="YPTB0379"
                     /gene_synonym="dinE"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    complement(453115..454041)
                     /gene="uvrA"
                     /locus_tag="YPTB0379"
                     /gene_synonym="dinE"
                     /note="ATP-binding cassette domain II of the excision
                     repair protein UvrA; Region: ABC_UvrA_II; cd03271"
                     /db_xref="CDD:213238"
     gene            456318..456866
                     /gene="ssb"
                     /locus_tag="YPTB0380"
                     /gene_synonym="exrB; lexA"
                     /db_xref="GeneID:2956634"
     CDS             456318..456866
                     /gene="ssb"
                     /locus_tag="YPTB0380"
                     /gene_synonym="exrB; lexA"
                     /note="binds to single stranded DNA and PriA helcase
                     facilitate replication restart"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="YP_068925.1"
                     /db_xref="GI:51594734"
                     /db_xref="GeneID:2956634"
                     /translation="MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDK
                     QTGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGALQTRKWQDQSGQERYTTEV
                     VVNVGGTMQMLGGRQGGGAPAGGGAAPQDGGAQGGWGQPQQPQGGNQFSGGQASRPAQ
                     PAPAAPQGGNEPPMDFDDDIPF"
     misc_feature    456330..456863
                     /gene="ssb"
                     /locus_tag="YPTB0380"
                     /gene_synonym="exrB; lexA"
                     /note="Single-stranded DNA-binding protein [DNA
                     replication, recombination, and repair]; Region: Ssb;
                     COG0629"
                     /db_xref="CDD:223702"
     misc_feature    456342..456632
                     /gene="ssb"
                     /locus_tag="YPTB0380"
                     /gene_synonym="exrB; lexA"
                     /note="SSB_OBF: A subfamily of OB folds similar to the OB
                     fold of ssDNA-binding protein (SSB). SSBs bind with high
                     affinity to ssDNA. They bind to and protect ssDNA
                     intermediates during DNA metabolic pathways. All bacterial
                     and eukaryotic SSBs studied to date...; Region: SSB_OBF;
                     cd04496"
                     /db_xref="CDD:239942"
     misc_feature    order(456342..456353,456426..456434,456477..456479,
                     456483..456485,456546..456548,456573..456575,
                     456606..456608,456615..456617)
                     /gene="ssb"
                     /locus_tag="YPTB0380"
                     /gene_synonym="exrB; lexA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(456357..456365,456381..456383,456411..456413,
                     456432..456437,456471..456476,456480..456482,
                     456486..456488,456492..456494,456498..456500,
                     456537..456542,456564..456566,456570..456572,
                     456576..456581,456618..456620,456624..456626)
                     /gene="ssb"
                     /locus_tag="YPTB0380"
                     /gene_synonym="exrB; lexA"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    order(456546..456548,456552..456554,456558..456560)
                     /gene="ssb"
                     /locus_tag="YPTB0380"
                     /gene_synonym="exrB; lexA"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    <456825..456863
                     /gene="ssb"
                     /locus_tag="YPTB0380"
                     /gene_synonym="exrB; lexA"
                     /note="putative single-stranded DNA-binding protein;
                     Region: PHA01740"
                     /db_xref="CDD:133956"
     gene            complement(457114..457428)
                     /locus_tag="YPTB0381"
                     /db_xref="GeneID:2953205"
     CDS             complement(457114..457428)
                     /locus_tag="YPTB0381"
                     /note="similar to Yersinia pestis YPO0326 conserved
                     hypothetical protein (100% evalue=3.E-58); Salmonella
                     typhimurium STM4043 yiiL; cytoplasmic protein (77.8%
                     evalue=1.E-45)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068926.1"
                     /db_xref="GI:51594735"
                     /db_xref="GeneID:2953205"
                     /translation="MIRKAFVMAVNPDAHAEYQRRHTPIWPELESVLKAHGAHHYSIF
                     LDETRNLLFGVVEIESEERWNAVAQTAECQRWWQHMADVMPSHPDNSPVSQALREVFY
                     LE"
     misc_feature    complement(457117..457422)
                     /locus_tag="YPTB0381"
                     /note="L-rhamnose 1-epimerase; Reg