GenomeNet

Database: RefSeq
Entry: NC_006155
LinkDB: NC_006155
Original site: NC_006155 
LOCUS       NC_006155            4744671 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Yersinia pseudotuberculosis IP32953 genome, complete sequence.
ACCESSION   NC_006155
VERSION     NC_006155.1  GI:51594359
DBLINK      BioProject: PRJNA224116
            Assembly: GCF_000047365.1
KEYWORDS    RefSeq; complete genome.
SOURCE      Yersinia pseudotuberculosis IP 32953
  ORGANISM  Yersinia pseudotuberculosis IP 32953
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Yersinia.
REFERENCE   1  (bases 1 to 4744671)
  AUTHORS   Chain,P.S., Carniel,E., Larimer,F.W., Lamerdin,J., Stoutland,P.O.,
            Regala,W.M., Georgescu,A.M., Vergez,L.M., Land,M.L., Motin,V.L.,
            Brubaker,R.R., Fowler,J., Hinnebusch,J., Marceau,M., Medigue,C.,
            Simonet,M., Chenal-Francisque,V., Souza,B., Dacheux,D.,
            Elliott,J.M., Derbise,A., Hauser,L.J. and Garcia,E.
  TITLE     Insights into the evolution of Yersinia pestis through whole-genome
            comparison with Yersinia pseudotuberculosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (38), 13826-13831 (2004)
   PUBMED   15358858
REFERENCE   2  (bases 1 to 4744671)
  AUTHORS   Chain,P.S.G., Carniel,E., Garcia,E. and Larimer,F.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-FEB-2004) Biology and Biotechnology Research Program,
            Lawrence Livermore National Laboratory, Livermore, CA 94550 USA,
            Yersinia Research Unit, Institute Pasteur, 75724 Paris Cedex 15,
            France, and the Genome Analysis Group, Oak Ridge National
            Laboratory, Oak Ridge, TN 37831 USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 11/04/2014 01:53:08
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 450998)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,409
            CDS                          :: 4,238
            Pseudo Genes                 :: 52
            CRISPR Arrays                :: 2
            rRNAs                        :: 22 ( 5S, 16S, 23S )
            tRNAs                        :: 82
            ncRNA                        :: 15
            Frameshifted Genes           :: 42
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4744671
                     /organism="Yersinia pseudotuberculosis IP 32953"
                     /mol_type="genomic DNA"
                     /strain="IP 32953"
                     /db_xref="taxon:273123"
     gene            complement(270..710)
                     /locus_tag="YPTB_RS00075"
                     /old_locus_tag="YPTB0001"
     CDS             complement(270..710)
                     /locus_tag="YPTB_RS00075"
                     /old_locus_tag="YPTB0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004393050.1"
                     /note="An electron-transfer protein; flavodoxin binds one
                     FMN molecule, which serves as a redox-active prosthetic
                     group; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding protein MioC"
                     /protein_id="WP_002212258.1"
                     /db_xref="GI:488141050"
                     /translation="MADITLISGSTLGSAEYVAEHLADKLEEAGFSTEILHGPELDEL
                     TLNGLWLIVTSTHGAGDLPDNLQPLLEQIEQQKPDLSQVRFGAVGLGSSEYDTFCGAI
                     IKLDQQLIAQGAQRLGEILEIDVIQHEIPEDPAEIWVKDWINLL"
     gene            complement(803..1264)
                     /locus_tag="YPTB_RS00080"
                     /old_locus_tag="YPTB0002"
     CDS             complement(803..1264)
                     /locus_tag="YPTB_RS00080"
                     /old_locus_tag="YPTB0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002220765.1"
                     /note="transcriptional repressor of asnA which codes for
                     aspartate-ammonia ligase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002212257.1"
                     /db_xref="GI:488141049"
                     /translation="MSEIYQIDNLDRSILKALMENARTPYAELAKNLAVSPGTIHVRV
                     EKMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYT
                     TGHYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
     gene            1434..2426
                     /locus_tag="YPTB_RS00085"
                     /old_locus_tag="YPTB0003"
     CDS             1434..2426
                     /locus_tag="YPTB_RS00085"
                     /old_locus_tag="YPTB0003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004707340.1"
                     /note="catalyzes the formation of asparagine from
                     aspartate and ammonia; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate--ammonia ligase"
                     /protein_id="WP_002212256.1"
                     /db_xref="GI:488141048"
                     /translation="MKKQFIQKQQQISFVKSFFSRQLEQQLGLIEVQAPILSRVGDGT
                     QDNLSGSEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFDFGADQGVYTHMKALRPD
                     EDRLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFGVKPF
                     LPDHIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDY
                     DDWTSPSAEGFSGLNGDIIVWNPILEDAFEISSMGIRVDAEALKRQLALTGDEDRLEL
                     EWHQSLLRGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVDGLL"
     gene            complement(2525..3991)
                     /locus_tag="YPTB_RS00090"
                     /old_locus_tag="YPTB0004"
     CDS             complement(2525..3991)
                     /locus_tag="YPTB_RS00090"
                     /old_locus_tag="YPTB0004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004875728.1"
                     /note="contains a von Willibrand factor type A domain;
                     stimulates the ATPase activity of RavA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein ViaA"
                     /protein_id="WP_002212255.1"
                     /db_xref="GI:488141047"
                     /translation="MLSLATLDMLLSISEGELIEEMVVGLLAAPQLAIFFEKFPRIKR
                     ALMKDIPGWKQNLQQRIREASVPPGLANEFSLYQQSLLEDSPQFYAHLPDIVAQLQDL
                     HSPFATQAKTLVQTADLAKNPPGGDSLQTLFLQRWRVSLILQTITIHHQLLEQEREQL
                     LAELQRRLALSGALEPILTTNDNAAGRLWDMSQGHLQRGDYQLLLQYGDFLQQQPELI
                     RLAEQLGRSRSAKAQPAPDARYEPYTVMVRQPDSVPEEVSGIHQSNDILRLLPTELVM
                     LGMSELEFEFYRRLLERRLLTYRLQGDNWQEKTQQRPVSLKQNDEQPRGPFIVCVDTS
                     GSMGGFNEQCAKAFCLALLRIALADNRRCYIMLFATEIIHYELSADNGIEQAIRFLNQ
                     HFRGGTDLAACLANTLNKMEDREWYDADAVIISDFIAQRLPEELVRKIKIQQQAHQHR
                     FHAVAMSAYGKPGIMRIFDHIWRFDTSLKSRLIRRWKR"
     gene            complement(3995..5533)
                     /locus_tag="YPTB_RS00095"
                     /old_locus_tag="YPTB0005"
     CDS             complement(3995..5533)
                     /locus_tag="YPTB_RS00095"
                     /old_locus_tag="YPTB0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A9QYG5.1"
                     /note="interacts with LdcI, lysine decarboxylase; may be
                     active in late log/ early stationary phase; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase RavA"
                     /protein_id="WP_011191439.1"
                     /db_xref="GI:499504799"
                     /translation="MAQSSQLAERISRLSHALESGLYERQEAIRLCLLAALSGESVFL
                     LGPPGIAKSLIARRLKFAFRHARAFEYLMTRFSTPEEVFGPLSIQALKEEGRYQRMTG
                     GYLPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGDREDSIPMRLLVTASNELPDA
                     DSSLEALYDRMLIRLWLDRVQEKQNFRSLLISRQNENHNPVAENLSITDEEFHQWQPL
                     IDKITLPDHCFELIFQLRQRLSALEHAPYVSDRRWKKALRLLQASAFFSGRDEITPID
                     LILLKDCLWHDLNSFKLLQQQLEQLLTEQGYQQQSLLMKLQDINSKWLQHQQQQSDHQ
                     ALTVVKQSGMFSRKAQYALPDNLTDSTLTLLLQKPLNLHDIQVNHLQVDKEALAQWLN
                     KGGALRAKLNGVGYAQSIDAEIDDQLHIIILDVSRQPSTLSLPGATTTSVPPELLLAL
                     TKLESTLAEQRRLFSQHQPCLFTPSSWLAKIEASLLQVVEQLQFQQIQFQQRKFQQQK
                     HSGH"
     gene            5807..7675
                     /gene="trkD"
                     /locus_tag="YPTB_RS00100"
                     /old_locus_tag="YPTB0006"
     CDS             5807..7675
                     /gene="trkD"
                     /locus_tag="YPTB_RS00100"
                     /old_locus_tag="YPTB0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4TSH8.1"
                     /note="Responsible for the low-affinity transport of
                     potassium into the cell; involved in potassium ion uptake
                     under hyper-osmotic stress at a low pH; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low affinity potassium transport system protein
                     kup"
                     /protein_id="WP_011191440.1"
                     /db_xref="GI:499504800"
                     /translation="MSTEHKQSLSAVTLAAIGVVYGDIGTSPLYTLRECFSGHYGFDV
                     RPDVVFGFLSLIFWMLILVVSVKYLTYVMRADNAGEGGILTLMSLAGRNTSSRATSIL
                     VVLGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVLTLLFVIQKH
                     GTGSVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFVEYKSVSFFAL
                     GAVVLAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNP
                     FFLLAPDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIHTSEMES
                     GQIYIPVINWTLYLAVVLVIIGFERSSNLAAAYGIAVTGTMVITSILFCTVAWKNWHW
                     NRFLVAFLLMVLLIIDIPMFSANVLKLFSGGWLPLSLGLVMFIIMTTWKSERFSLLRR
                     MHEHSNSLEAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHERVVLL
                     TMRTDDVPYVHNVERVTIEQLSPTFWRVVARYGWRETPNVAEIFHRCGLEGLSCQMME
                     TSFFMSHESLILTKRPWHLFLRGKLFIALSRNALRAPDQFEIPPNRVIELGTQVEI"
     gene            7880..8299
                     /locus_tag="YPTB_RS00105"
                     /old_locus_tag="YPTB0007"
     CDS             7880..8299
                     /locus_tag="YPTB_RS00105"
                     /old_locus_tag="YPTB0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004393068.1"
                     /note="cytoplasmic mutarotase that catalyzes the
                     conversion between beta-pyran and beta-furan forms of
                     D-ribose; RbsD is required for efficient ribose
                     utilization in E. coli; rbsD-mutant E. coli strains are
                     unable to use ribose as a sole carbon source; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose pyranase"
                     /protein_id="WP_002212252.1"
                     /db_xref="GI:488141044"
                     /translation="MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLAL
                     TRGVPGFLQVVDVVTQEMQVENAYLAEEIVKNNPQLHEALLVLLTQLEQRQENQIALR
                     YISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF"
     gene            8350..9276
                     /locus_tag="YPTB_RS00110"
                     /old_locus_tag="YPTB0008"
     CDS             8350..9276
                     /locus_tag="YPTB_RS00110"
                     /old_locus_tag="YPTB0008"
                     /EC_number="2.7.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304785.1"
                     /note="catalyzes the formation of D-ribose 5-phosphate
                     from ribose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="WP_011191441.1"
                     /db_xref="GI:499504801"
                     /translation="METGKLVVLGSINADHILNIEQFPRPGETVIGQQYNVAFGGKGA
                     NQAVAAGRSGADIAFIACVGDDDIGERVRQQLTADKIDTQPIEAIKGATTGVALIFVN
                     SDGENVIGINAGANSAVTPEYLRRYQQQVIDADALLMQLESPLDTVIAAAKLAKQHQT
                     QVILNPAPARKLPDELLTLVDMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIAT
                     VIITLGSRGVWLSEQGKGKLVAGFKVNAVDTIAAGDTFNGALLTALLEGQSMDAAVRF
                     AHAAAAIAVTRPGAQPSIPWRAEIDSFLQERV"
     gene            9329..9499
                     /locus_tag="YPTB_RS00115"
                     /old_locus_tag="YPTB0009"
     CDS             9329..9499
                     /locus_tag="YPTB_RS00115"
                     /old_locus_tag="YPTB0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002215906.1"
                     /db_xref="GI:488144698"
                     /translation="MARAGLPIIAGYEVVSDFEFGGGLVALKQRLNNPEAEPQVLPLT
                     PELIERGSVSLR"
     gene            complement(9496..10920)
                     /locus_tag="YPTB_RS00120"
                     /old_locus_tag="YPTB0010"
     CDS             complement(9496..10920)
                     /locus_tag="YPTB_RS00120"
                     /old_locus_tag="YPTB0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011991004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002212250.1"
                     /db_xref="GI:488141042"
                     /translation="MIKSARSMAGLPWIAAMAFFMQALDATILNTALPSIAESLNRSP
                     LTMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFILAVSLFTFGSLLCALSGSLAFLV
                     ASRVIQGIGGAMMMPVARLALIRAYPRSELLPVLNFVTIPGLVGPVMGPLLGGLLVTY
                     TTWHWIFILNIPIGLLGIFYARKYMPNFTMPKRTFDFVGFLLFGISLVMISTSLEIMG
                     RPEIADYLPAATLLGGLLMLIFYIFHAKGHPNPLIGLPLFKTRTFSVGIAGNVASRLG
                     TGCVPFLMPLMLQVGFGYSALIAGCMMAPTAIGSIMAKSAVTQVLRSLGYRKVLVGIT
                     LIIGVLIASFALQSPGMSAWMMILPLFILGIAMSTQFTAMNTITLADLTDNNASSGNS
                     VLAVTQQLSISFGIAISATVLRFYDGLSLGGNVDHFHYTFITMGIVTLLSSLVFLLLK
                     PRDGDNLIQGRNVKKVAPQVKNNV"
     gene            complement(11000..11689)
                     /locus_tag="YPTB_RS00125"
                     /old_locus_tag="YPTB0011"
     CDS             complement(11000..11689)
                     /locus_tag="YPTB_RS00125"
                     /old_locus_tag="YPTB0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002215905.1"
                     /db_xref="GI:488144697"
                     /translation="MQLNTQQQAAQRNLSYLLAEKIGQRILAGEYEAGSILPGEIELG
                     EQFGVSRTAVREAVKMLAAKGMLLPRPRIGTRVMPQTNWNYLDQELLTWWMTKENFDQ
                     VMQHFLILRTSLEPQACYLAATHANEKQRELLASLVAEMRALHSNFNREQWIQVDTQF
                     HKLIYEASGNPFLISFANLFSSVYYSYFRAITGDEVIKLQHHQNIVDTILAGDNQGAL
                     FACQVLLKTVD"
     gene            complement(12058..12243)
                     /locus_tag="YPTB_RS00130"
     CDS             complement(12058..12243)
                     /locus_tag="YPTB_RS00130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002218887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032466595.1"
                     /db_xref="GI:694126000"
                     /translation="MFDLLTFTCVKAAVLKDYFLQIGILTEVTMFTALVTLQDLILFL
                     PAETGVDIVLRVPTQIV"
     gene            12246..13794
                     /locus_tag="YPTB_RS00135"
                     /old_locus_tag="YPTB_RNA_93"
     rRNA            12246..13794
                     /locus_tag="YPTB_RS00135"
                     /old_locus_tag="YPTB_RNA_93"
                     /product="16S ribosomal RNA"
     gene            13928..14003
                     /locus_tag="YPTB_RS00140"
                     /old_locus_tag="YPTB_RNA_1"
     tRNA            13928..14003
                     /locus_tag="YPTB_RS00140"
                     /old_locus_tag="YPTB_RNA_1"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:13962..13964,aa:Glu,seq:ttc)
     gene            14247..17180
                     /locus_tag="YPTB_RS00145"
                     /old_locus_tag="YPTB_RNA_94"
     rRNA            14247..17180
                     /locus_tag="YPTB_RS00145"
                     /old_locus_tag="YPTB_RNA_94"
                     /product="23S ribosomal RNA"
     gene            17273..17388
                     /locus_tag="YPTB_RS00150"
                     /old_locus_tag="YPTB_RNA_95"
     rRNA            17273..17388
                     /locus_tag="YPTB_RS00150"
                     /old_locus_tag="YPTB_RNA_95"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            17956..19143
                     /locus_tag="YPTB_RS00155"
                     /old_locus_tag="YPTB0012"
     CDS             17956..19143
                     /locus_tag="YPTB_RS00155"
                     /old_locus_tag="YPTB0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011191442.1"
                     /db_xref="GI:499504802"
                     /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELT
                     EHLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQ
                     MDSQILSLYAKSMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY
                     PIVYMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTEL
                     KNRGLQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSG
                     LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYT
                     TNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKMEYADPELAVSDEPFYY
                     RVR"
     gene            complement(19223..19753)
                     /locus_tag="YPTB_RS00160"
                     /old_locus_tag="YPTB0013"
     CDS             complement(19223..19753)
                     /locus_tag="YPTB_RS00160"
                     /old_locus_tag="YPTB0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002217538.1"
                     /note="in Escherichia coli the MobB protein is not
                     essential but has been found to interact with multiple
                     proteins involved in the molybdopterin guanine
                     dinucleotide cofactor biosynthesis pathway; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein B"
                     /protein_id="WP_002217538.1"
                     /db_xref="GI:488146330"
                     /translation="MNYKSPPLLGIAAYSGTGKTTLLKSLIPLLQQRQVRVGLIKHTH
                     HNMEIDTPGKDSYELRKAGALQTLVASDCRWALMTETPEQQPLNLHYLASRLDASTID
                     LILVEGFKHEPINKIALYRESIGKPFSGLIDKHVIALASDKPIETTVKQLDINQPEQI
                     TEFICTWLENISFEVR"
     gene            complement(19753..20341)
                     /gene="mobA"
                     /locus_tag="YPTB_RS00165"
                     /note="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobA; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            20495..20764
                     /locus_tag="YPTB_RS00170"
                     /old_locus_tag="YPTB0015"
     CDS             20495..20764
                     /locus_tag="YPTB_RS00170"
                     /old_locus_tag="YPTB0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005277758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002213170.1"
                     /db_xref="GI:488141962"
                     /translation="MKCHRVNELIELLHPAWQQEPDLNLVQFLQKLAAEAGFKGDFSD
                     LTDDVLIYHLKMRGAASTEVIPGLKKDYEEDFKTALLRARGIIKD"
     gene            20855..21841
                     /locus_tag="YPTB_RS00175"
                     /old_locus_tag="YPTB0016"
     CDS             20855..21841
                     /locus_tag="YPTB_RS00175"
                     /old_locus_tag="YPTB0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016582340.1"
                     /note="catalyzes the phosphorylation of protein substrates
                     at serine and threonine residues in vitro; specific
                     substrate in vivo has not been identified yet; plays a
                     role in long-term cell survival and expression of surface
                     appendages; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_002213169.1"
                     /db_xref="GI:488141961"
                     /translation="MNNSAFNFQTLSPDLIMDALEGAGLRVDSGLTALNSYENRVYQF
                     MDEESKRYVVKFYRPERWSSEQITEEHQFSLDLAESEIPVIAPLRLNGKTLHTHCGFF
                     FAVFPSVGGRQYEIDNLDQLEWVGRFLGRIHQAARNSLFVARPTMGIEEYLTEPRQLL
                     ANCDLVPVKQRDKFLAAADLLITTIKQYWHTEWQPLRLHGDCHPGNILWRDGPMFVDL
                     DDARNGPAIQDLWMLLHGDRRDQSMQLDILLEAYSEFADFDQRELALIEPLRAMRMVY
                     YLAWVARRWQDPAFPKSFPWMAESDFWLQQTASFTEQVKLLQEPPLQLMPMY"
     gene            21869..22492
                     /locus_tag="YPTB_RS00180"
                     /old_locus_tag="YPTB0017"
     CDS             21869..22492
                     /locus_tag="YPTB_RS00180"
                     /old_locus_tag="YPTB0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein DsbA"
                     /protein_id="WP_002213168.1"
                     /db_xref="GI:488141960"
                     /translation="MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEF
                     FSFYCPHCYQFEEVYQVPKAVKKALPEGTKMTRYHVEFLGPLGKQLTQAWAVAMALGV
                     EEKITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAA
                     EDLQLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK"
     gene            22983..25781
                     /locus_tag="YPTB_RS00185"
                     /old_locus_tag="YPTB0018"
     CDS             22983..25781
                     /locus_tag="YPTB_RS00185"
                     /old_locus_tag="YPTB0018"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005191199.1"
                     /note="has 3'-5' exonuclease, 5'-3' exonuclease and
                     5'-3'polymerase activities, primarily functions to fill
                     gaps during DNA replication and repair; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_011191443.1"
                     /db_xref="GI:499504803"
                     /translation="MAQIAENPLILVDGSSYLYRAYHAFPPLTNGSGEPTGAMYGVLN
                     MLRSLLLQYRPSHVAVVFDAKGKTFRDELFAEYKSHRPPMPDDLRVQIEPLHQMVKAM
                     GLPLLVVSGVEADDVIGTLAREAEKAGHSVLISTGDKDMAQLVTPNITLINTMNNTIL
                     GPQDVCDKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLFSNL
                     DKISTLTFRGAKTMSAKLEQNKDVAYLSYKLATIKTDVELDVTCDELTVSPPDDKQLH
                     QLFSRYEFKRWLADVEAGKWLDSKKDRPTGQTSSQSFVAADTAPTAEVTAVLSQENYQ
                     TILDEKALADWIERLKAAEVFAFDTETDGLDTLSCNLIGMSFAVAPGEAAYLPLAHDY
                     LDAPPQLDRDWVLATLKPLLEDDKALKVGQNLKFDKSMLARYGIDLKGIAFDTMLESY
                     VLDSVAGRHDMDSLAERYLNHKTITFEEIAGKGKNQLTFNQIALEQAGPYAAEDADVT
                     LQLHLVLWPKLQQSEGLKRVFQEIEMPLLPILSRIERTGVLIDQNILAAHSKELTIRL
                     DELEKQAHELAEEPFNLASPKQLQAILYEKQKLPILKKTPGGAASTNEEVLAELALDY
                     PLPKVILEYRGLAKLKSTYTDKLPLMINPVSGRVHTSYHQAVTATGRLSSRDPNLQNI
                     PVRNEEGRRIRQAFIAPKGYCIMAADYSQIELRIMAHLSQDNGLLAAFAAGQDIHRAT
                     AAEVFGSPLEKVTTEQRRSAKAINFGLIYGMSAFGLARQLGIPRGEAQRYMDLYFERY
                     PGVLEYMERTRKQAAEQGYVTTLDGRRLYLPDIHSRNANRRKAAEREAINAPMQGTAA
                     DIIKRAMIAVDGWLQQEPEPLVRVIMQVHDELVFEVHESVLQSAEQKIRELMEKSMQL
                     AVPLKVDVGVGANWDQAH"
     gene            25940..26047
                     /gene="spf"
                     /locus_tag="YPTB_RS00005"
     misc_RNA        25940..26047
                     /gene="spf"
                     /locus_tag="YPTB_RS00005"
                     /product="spf Spot 42 RNA"
     gene            complement(26189..26839)
                     /locus_tag="YPTB_RS00190"
                     /old_locus_tag="YPTB0019"
     CDS             complement(26189..26839)
                     /locus_tag="YPTB_RS00190"
                     /old_locus_tag="YPTB0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZJS0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_002213160.1"
                     /db_xref="GI:488141952"
                     /translation="MTIRNYNYHMTHFVISAPDIRHLPRDEGIEVAFAGRSNAGKSSA
                     LNTLTNQKGLARTSKTPGRTQLINLFEVVDGVRLVDLPGYGYAEVPEEMKLKWQRALG
                     EYLQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQ
                     LNLVREAIIPFMGDIQVEAFSSLKKIGVDKLREKLDTWFSEIPPEVMAEEFDGEGE"
     gene            27205..27459
                     /locus_tag="YPTB_RS00010"
     misc_RNA        27205..27459
                     /locus_tag="YPTB_RS00010"
                     /product="regulatory RNA CsrC"
     gene            27604..28170
                     /locus_tag="YPTB_RS00195"
                     /old_locus_tag="YPTB0020"
     CDS             27604..28170
                     /locus_tag="YPTB_RS00195"
                     /old_locus_tag="YPTB0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005191191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="der GTPase-activating protein YihI"
                     /protein_id="WP_002213158.1"
                     /db_xref="GI:488141950"
                     /translation="MKQPNKAPRANIAAPKGTATPKRRRKTRDELDAEARDRKRQKKH
                     SGNRSGARTNVEGSNKKGHSQTQEKDPRVGSKVPVPLVIESQVKAKSMPKPVEKNVVK
                     PRLTPEEELAKLENDERLDALLDRLDNDEVLNKEDQAYVDLTLDRIDALMEQLGIELG
                     DDEDDVEREEKQEDILQLLKRGNPKDTF"
     gene            28357..29730
                     /locus_tag="YPTB_RS00200"
                     /old_locus_tag="YPTB0021"
     CDS             28357..29730
                     /locus_tag="YPTB_RS00200"
                     /old_locus_tag="YPTB0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015683769.1"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_002213155.1"
                     /db_xref="GI:488141947"
                     /translation="MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQA
                     VKRYPQRPLSLYVHIPFCHKLCYFCGCNKLVTRQQHKADEYLVVLEKEIRQRAALFTG
                     RQVSQMHWGGGTPTYLNKTQISHLMTVLREHFDFLPDAEQSIEVDPREIELDVLDHLR
                     AEGFNRLSMGVQDFNKEVQRLVNREQDEDFIFALIARAKALGFNSTNIDLIYGLPKQT
                     PESFAFTLKRVAELNPDRLSVFNYAHLPSLFAAQRKIKDADLPTAEQRLDILQHTIRF
                     LTESGYQFIGMDHFARPDDELAIAQQEGTLHRNFQGYTTQGESDLLGLGVSAISMLGD
                     SYAQNEKDLETYYACVEQRGNALWRGLTMTEDDCLRRDVIKTLICHFQLSYQPIEQRY
                     GIRFADYFAEDFELLAPFEQDGLVERNETGLRVTPRGRLLIRNICMCFDIYLRKQARK
                     QQFSRVI"
     gene            complement(29784..31196)
                     /gene="glnG"
                     /locus_tag="YPTB_RS00205"
                     /old_locus_tag="YPTB0022"
     CDS             complement(29784..31196)
                     /gene="glnG"
                     /locus_tag="YPTB_RS00205"
                     /old_locus_tag="YPTB0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080344.1"
                     /note="response regulator of a two-component regulatory
                     system involved in the activation of nitrogen assimilation
                     genes; interacts with sigma-54; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(I)"
                     /protein_id="WP_011191444.1"
                     /db_xref="GI:499504804"
                     /translation="MQRGIVWIVDDDSSIRWVLERALTGAGLNCVAFDSGNQVLDALA
                     TRTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYL
                     PKPFDIDEAVALVERAISHYQEQQQPARSQPVSGPTADIIGEAPAMQDVFRIIGRLSR
                     SSISVLINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAF
                     TGANQVRQGRFEQADTGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVR
                     IIAATHQNLELRVQEGKFREDLFHRLNVIRVHLPPLRERSEDIPRLARYFLHVAAKEL
                     GVESKNLHPETEAALTRLPWPGNVRQLENTCRWLTVMAAGQEVLVQDLPSELFETHMP
                     DASGQRAPDSWSTLLAQWADRALRSGHQDLLSEAQPEMERTLLTTALRHTQGHKQEAA
                     RLLGWGRNTLTRKLKELGME"
     gene            complement(31204..32253)
                     /gene="glnL"
                     /locus_tag="YPTB_RS00210"
                     /old_locus_tag="YPTB0023"
     CDS             complement(31204..32253)
                     /gene="glnL"
                     /locus_tag="YPTB_RS00210"
                     /old_locus_tag="YPTB0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002213151.1"
                     /note="sensory histidine kinase in two-component
                     regulatory system with GlnG; acts as a signal transducer
                     which responds to the nitrogen level of cell and modulates
                     the activity of ntrC by phosphorylation/dephosphorylation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(II)"
                     /protein_id="WP_002213151.1"
                     /db_xref="GI:488141943"
                     /translation="MATGTLPDAGQILNTLINSILLLDDDLAIHYANPAAQQLLAQSS
                     RKLFGTPLPDLLGYFSLNIVLMRESLQAGQGFTDNEVTLVVDGRAHILSLTAQSLAEG
                     FILLELAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLAKALP
                     DPALLEYTQVIIEQADRLRNLVDRLLGPQRPGQHITQSIHQVAERVCQLVSLEKPDNV
                     TLIRDYDPSLPELAHDPDQIEQVLLNITRNALQALGETGGTITLRTRTAFQVTLHGMR
                     YRLAARIDIEDDGPGVPTQLQDTVFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFNS
                     WPGHTEFSVYLPIRQ"
     gene            complement(32506..33915)
                     /gene="glnA"
                     /locus_tag="YPTB_RS00215"
                     /old_locus_tag="YPTB0024"
     CDS             complement(32506..33915)
                     /gene="glnA"
                     /locus_tag="YPTB_RS00215"
                     /old_locus_tag="YPTB0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004956808.1"
                     /note="forms a homododecamer; forms glutamine from ammonia
                     and glutamate with the conversion of ATP to ADP and
                     phosphate; also functions in the assimilation of ammonia;
                     highly regulated protein controlled by the
                     addition/removal of adenylyl groups by adenylyltransferase
                     from specific tyrosine residues; addition of adenylyl
                     groups results in inactivation of the enzyme; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_002213150.1"
                     /db_xref="GI:488141942"
                     /translation="MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHITIPAHQVNADFF
                     EEGKMFDGSSIGGWKGINESDMVLMPDASTAVMDPFFADSTLIIRCDILEPGTMQGYD
                     RDPRSISKRAEDFLKSSGIADTVLFGPEPEFFLFDDIRFGSSINGSHVSIDDVEGAWN
                     SSTKYEGGNKGHRPAVKGGYFPVPPVDSAQDLRSAMCLTMEEMGLVVEAHHHEVATAG
                     QNEVATRFNTMTKKADEIQIYKYVVHNVAHAFGKTATFMPKPMFGDNGSGMHCHMSLS
                     KNGNNLFAGDKYGGLSEIALFYIGGIIKHAKAINALANPTTNSYKRLVPGYEAPVMLA
                     YSARNRSASIRIPVVASPKARRIEARFPDPAANPYLCFAALLMAGLDGIINKIHPGDA
                     MDKNLYDLPPEEEAEIPKVAGSLDEAMAALNEDREFLTRGGVFTDDAIDAYIELRREE
                     MDRVRMTPHPVEFELYYSV"
     gene            complement(34101..34232)
                     /locus_tag="YPTB_RS00220"
     CDS             complement(34101..34232)
                     /locus_tag="YPTB_RS00220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002422228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002422228.1"
                     /db_xref="GI:488352843"
                     /translation="MIWHKWGVWKVGIDFATYFIMNSFITNRFSMDRSLESLAWILR"
     gene            34478..36301
                     /locus_tag="YPTB_RS00225"
                     /old_locus_tag="YPTB0025"
     CDS             34478..36301
                     /locus_tag="YPTB_RS00225"
                     /old_locus_tag="YPTB0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002217380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_002217380.1"
                     /db_xref="GI:488146172"
                     /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERTEATERVMD
                     SNDLEKERGITILAKNTAINWKDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAM
                     DGPMPQTRFVTKKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDF
                     PIIYASALMGIAGEDHNDMAEDMTPLYQAIIDHVPAPDVDSSGPLQMQISQLDYNNYV
                     GVIGIGRIKRGIVKPNQQVTVIDSEGKTRNGKVGKVLGHMGLERIETTQAEAGDIVAI
                     TGLGELNISDTICDVNAVEALPPLSVDEPTVTMYFCVNTSPFCGKEGKYVTSRQILDR
                     LNKELIHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVINRII
                     DGRNQEPFESVTLDIEEQHQGAVMQAMGERKGDVKDMIPDGKGRIRLDYMIPSRGLIG
                     FRTEFMTMTSGTGLLYSTFSHYDDVRPGDIGQRQNGVLISNGQGKAVAFALYKLQDRG
                     KLFIGHGTEVYEGQIIGIHSRSNDLTVNCLTGKQLTNMRASGTDEATTLVPFLKKTLE
                     QALEFIDDDELVEVTPQSIRIRKRHLTENDRKRAGRGPREG"
     gene            36623..37213
                     /locus_tag="YPTB_RS00230"
                     /old_locus_tag="YPTB0026"
     CDS             36623..37213
                     /locus_tag="YPTB_RS00230"
                     /old_locus_tag="YPTB0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="WP_002209011.1"
                     /db_xref="GI:488137803"
                     /translation="MLYIFDLGNVIVDIDFKRVLGVWSKLSSVPLATLNERFTMGEVF
                     QQHERGEISDEDFAHQLSDEMGISLSFEQFAEGWQAIFVALRPEVIDIMNKLRREGNR
                     VVVLSNTNRLHCYYWPEHYPEVAAAADHMYLSQDLGMRKPEARIYQHVLNAENVPAEQ
                     AVFFDDVEANVLAAKAVGINAIHVTDRQIIPTYFSL"
     gene            37310..38194
                     /locus_tag="YPTB_RS00235"
                     /old_locus_tag="YPTB0027"
     CDS             37310..38194
                     /locus_tag="YPTB_RS00235"
                     /old_locus_tag="YPTB0027"
                     /EC_number="3.1.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66GF5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191445.1"
                     /db_xref="GI:499504805"
                     /translation="MASFRRFRLLSPLKPCVTFGRMLYTRIDKDGLTMLAGHLAYVSL
                     LSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFMPATGDIIQNYLEQFVANSNRMT
                     VVGTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFSFAVYWMVLTLGPILVGASMVI
                     SSYLLSLHWLAHARVDSMIDEILRVFPLLISWVSFWLLYSVVPTVRVPARDALIGALV
                     AALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGE
                     YRAERHHAKSVITQSPEM"
     gene            38201..38638
                     /locus_tag="YPTB_RS00240"
                     /old_locus_tag="YPTB0028"
     CDS             38201..38638
                     /locus_tag="YPTB_RS00240"
                     /old_locus_tag="YPTB0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JHU4.1"
                     /note="hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and
                     free tRNA(Tyr); possible defense mechanism against a
                     harmful effect of D-tyrosine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-aminoacyl-tRNA deacylase"
                     /protein_id="WP_002209009.1"
                     /db_xref="GI:488137801"
                     /translation="MIALIQRALSASVVVEGNIVGEIGPGLLVLLGVEQGDTEQKAQR
                     LCERVLGYRIFSDENDKMNLNVQQAGGSVLVVSQFTLVADTQKGMRPSFSRGAIPQEA
                     DRLYQYFVAQCRERGVKTETGLFAADMKVSLVNDGPVTFWLQV"
     gene            38824..39747
                     /locus_tag="YPTB_RS00245"
                     /old_locus_tag="YPTB0029"
     CDS             38824..39747
                     /locus_tag="YPTB_RS00245"
                     /old_locus_tag="YPTB0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209008.1"
                     /db_xref="GI:488137800"
                     /translation="MYHLRVPITEQELKDYYQFRWEMLRKPLHQPIGSEKDAYDAMAH
                     HQMVVDEQGKAVAIGRLYINADNEAAIRFLAVAPSVRNKGLGTLVAMTLESVARQEGV
                     KRVVCSAREDAVDFFAKLGFVCQGEITAPQTTPVRHFLMIKPVATMDDILHRPDWCGQ
                     LQQAWYDHIPLSEKMGVRISQYTGQRFVTTMPEAGNQNPHHTLFAGSLFSLATLTGWG
                     LIWLLLRERHLGGTIILADAHIRYSAPVTGRPRAVAELSSLSGDLDRLARGRRARVQL
                     NVNLFGDENQGAVFEGTYMVLPVAAGDDMAN"
     gene            complement(39882..41591)
                     /locus_tag="YPTB_RS00250"
                     /old_locus_tag="YPTB0030"
     CDS             complement(39882..41591)
                     /locus_tag="YPTB_RS00250"
                     /old_locus_tag="YPTB0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209007.1"
                     /db_xref="GI:488137799"
                     /translation="MKFLGKTLLTLLLLFALSIVLCYAVLQTSWAAGWLSRWVSNNSG
                     YHLSLRGIDHRWSQPGQISFSDVTLARADQPPFLTAQQVIFGLSWRQLTDPKHFLSLQ
                     LQNGSLTLNNSTPSLPLQADTLQLTDMTLNTTVESKNATSQWKIAGQHVNGGLVPWQP
                     IPGNSFGENTQFHFSAGFLTINDISAQQIYLQGSIQKDILTLTNFGANIAQGELTGNA
                     RQSADGSWLVDRLRLSNIRLQTTASLEDVWNNVLQLPPITLKRFDLIDARVEGKGWAV
                     NDVDLTLKNITFKQGDWQSDDGELVFNASDIIKGNIHLIDPIATFTLSPEGVAINQFT
                     TRWQDGLLRTLGSWSRATHRLQLGELTVVALVYTLPNDWKQLWQQTLPDWLSEVYVGK
                     LSANRNLLIDISPDFPFQITSLDAAGSNLLLAKNHQWGVWSGSLVLNAGNATFNKNDI
                     RRPSLALNANEQQITFSDLSAFTKEGLLEATASIDQTPDRALSLALTGRSVDLNFLHN
                     WGWPALPLQGLGNLKLQIKGNLTADAPLKPTLNGSLQAIDSNGQQINQTVLHGVVQGT
                     AEQ"
     gene            complement(41738..43123)
                     /locus_tag="YPTB_RS00255"
                     /old_locus_tag="YPTB0031"
     CDS             complement(41738..43123)
                     /locus_tag="YPTB_RS00255"
                     /old_locus_tag="YPTB0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011171741.1"
                     /note="high-affinity transporter for xanthine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine permease"
                     /protein_id="WP_011191446.1"
                     /db_xref="GI:499504806"
                     /translation="MSTQSAELDTAQPSPARPSELIYHLEDRPPLPQTLFAACQHLLA
                     MFVAVITPGLLICQALGLPAEDTQRIISMSLFASGLASLLQIKTWGPVGSGLLSIQGT
                     SFNFVSPLIMGGLALKNGGADIPTMMAALFGTLMVASCTEILLSRVLHLARRIITPLV
                     SGIVVMIIGLSLIQVGLTSIGGGYGAMSDNTFGAPKNLLLAGAVLGVIILLNRQRNPY
                     LRVASLVIAMAVGYLLAWALGMLPESRPVVDTALITIPTPLYYGLSFDWNLLIPLMLI
                     FMVTSLETIGDITATSDVSEQPVRGPLYMKRLKGGVLANGLNSMLSAIFNTFPNSCFG
                     QNNGVIQLTGVASRYVGFVVAIMLIILGLFPAVAGFVQHIPEPVLGGATLVMFGTIAA
                     SGVRIVSRETLNRRAIMIMALSLAVGMGVAQQPLILQFAPDWIKTLFSSGIAAGGITA
                     IVLNLLFPQEK"
     gene            43361..44575
                     /locus_tag="YPTB_RS00260"
                     /old_locus_tag="YPTB0032"
     CDS             43361..44575
                     /locus_tag="YPTB_RS00260"
                     /old_locus_tag="YPTB0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304777.1"
                     /note="is involved with the sodium-dependent uptake of
                     glutamate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/glutamate symport carrier protein GltS"
                     /protein_id="WP_002209005.1"
                     /db_xref="GI:488137797"
                     /translation="MFHLDTYGTLVAACLVLLLGRKLVQTVPFLKKYTIPEPVAGGLL
                     VAFMMLLVQKTLGWEVSFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFVFIVV
                     GLLLVQNTIGIVLAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFSERYGFENATEV
                     AMACATFGLVLGGLIGGPVARYLVKHSSTPEGTPDDSAVPSAFEKPSAGRMITSLVLI
                     ETIAMISICLMAGNLIAGWLQGTMFELPIFVCVLFVGVILSNTLSASGFYRVFDRAVS
                     VLGNVSLSLFLAMALMSLKLWELASLALPMLVILSVQALAMALYAIFVTYRIMGKNYD
                     AAVLAAGHCGFGLGATPTAIANMQAITDRFGPSHLAFLVVPMVGAFFIDIVNAIVIKL
                     YLLLPIFPAVTG"
     gene            complement(44941..47022)
                     /locus_tag="YPTB_RS00265"
                     /old_locus_tag="YPTB0033"
     CDS             complement(44941..47022)
                     /locus_tag="YPTB_RS00265"
                     /old_locus_tag="YPTB0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209004.1"
                     /note="catalyzes branch migration in Holliday junction
                     intermediates; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_002209004.1"
                     /db_xref="GI:488137796"
                     /translation="MKGRLLDAVPLSTLSGVGASQAGKLAKIGLETIQDLLLHLPLRY
                     EDRTRLYRIGDLLPGLSVTVEGEVLRSDISFGRRRMMTCQISDGSGVLTLRFFNFNAA
                     MKNSLSVGKHVIAYGEAKRGNNGPEIIHPEYRVHGENIGVELQESLTPVYPTTEGIRQ
                     ATLRKLIDQALAMLDTCVIAELLPIELSRSLISLPEAIHTLHRPPADIQLADLEQGKH
                     PAQRRLIMEELLAHNLSMLAVRAGAQSYRALPLMAEEQLKQRFLAALPFTPTQAQQRV
                     VAEIERDMTQSFPMMRLIQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHA
                     TTFRQWLEPLGFSVGWLAGKQKGKARLAQQEAVASGQVSMVIGTHAMFQEQVQFSGLA
                     LVIIDEQHRFGVHQRLTLWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDE
                     LPPGRTPVTTVAIPDTRRSDVIQRVKNACLEEGRQAYWVCTLIEESELLEAQAAEVTC
                     EELKIALPEIKVGLVHGRMKGPEKQAIMLAFKQGELQLLVATTVIEVGVDVPNASLMI
                     IDNPERLGLAQLHQLRGRVGRGAVASHCVLLYKTPLSKTAQMRLQVLRDSNDGFVIAQ
                     RDLEIRGPGELLGTRQTGSAEFKVADLLRDQAMIPEVQRVARHLHQQYPEHAKALIER
                     WLPERVRYTNA"
     gene            complement(47023..47682)
                     /locus_tag="YPTB_RS00270"
                     /old_locus_tag="YPTB0034"
     CDS             complement(47023..47682)
                     /locus_tag="YPTB_RS00270"
                     /old_locus_tag="YPTB0034"
                     /EC_number="2.1.1.34"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002361605.1"
                     /note="specifically modifies tRNA at position G18; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA methyltransferase"
                     /protein_id="WP_002361605.1"
                     /db_xref="GI:488290397"
                     /translation="MLATRQPDLTVCLEQVHKPHNVSAIIRTADAVGIHQVHAIWPTT
                     QMYTRLSAAAGSNSWVQVKTHPHIADAIAYLKSQDMQILATHLSDKAVDFREIDYTRP
                     TCILMGQEKTGISPEALALADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQNAGMY
                     KRTHSVLAESEQQRLLFEGGYPVLAHVAKRKGLPQPHIDEQGQIIADAQWWSAMQATE
                     S"
     gene            complement(47721..49829)
                     /locus_tag="YPTB_RS00275"
                     /old_locus_tag="YPTB0035"
     CDS             complement(47721..49829)
                     /locus_tag="YPTB_RS00275"
                     /old_locus_tag="YPTB0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016603963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional (p)ppGpp synthetase II/
                     guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase"
                     /protein_id="WP_002209002.1"
                     /db_xref="GI:488137794"
                     /translation="MYLFESLNLLIQRYLPEEQIKRLKQAYLVARDAHEGQTRSSGEP
                     YITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSK
                     LDKLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIAR
                     ETLEIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILA
                     EIEGRLTEAGIPCRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVKEVDTCYRV
                     LGQAHSLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMG
                     VAAHWAYKEQGESGTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFT
                     PEGRIVELPAGATPVDFAYVVHTDIGHACVGARVDRQPYPLSQPLSSGQTVEIITAPG
                     ARPNAAWLNFVVSSKARAKIRQLLKNLKRDESVSLGRRLLNHALGNGRKLSDISEENI
                     KHELDRMKLATVDDLLAEIGLGNAMSVVVAKNLLGDPSTLGTSASGTRKLPIKGADGV
                     LITFAKCCRPIPGDPIIAHISPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDQETEQE
                     FIAEIKVDMFNQQGALANLTAAINAAESNIQSLNTEEKDGRVYSAFIRLTTRNRVHLA
                     NIMRKIRIMPDVVKVSRNRN"
     gene            complement(49849..50124)
                     /gene="rpoZ"
                     /locus_tag="YPTB_RS00280"
                     /old_locus_tag="YPTB0036"
     CDS             complement(49849..50124)
                     /gene="rpoZ"
                     /locus_tag="YPTB_RS00280"
                     /old_locus_tag="YPTB0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013511051.1"
                     /note="Promotes RNA polymerase assembly; latches the N-
                     and C-terminal regions of the beta' subunit thereby
                     facilitating its interaction with the beta and alpha
                     subunits; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="WP_004392061.1"
                     /db_xref="GI:490526778"
                     /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQIQSGGKDALVPEEND
                     KVTVIALREIEEGLITNQILDVRERQEQQEQEAAEIQAVTAIAEGRR"
     gene            complement(50179..50802)
                     /locus_tag="YPTB_RS00285"
                     /old_locus_tag="YPTB0037"
     CDS             complement(50179..50802)
                     /locus_tag="YPTB_RS00285"
                     /old_locus_tag="YPTB0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004931218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_002209000.1"
                     /db_xref="GI:488137792"
                     /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAK
                     RPGENHGEHYFFVSEKEFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLD
                     IDWQGAQQIRAKMPTARSIFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVAEMAHY
                     AEYDYLIVNDDFNLALSDLKTIIRAERLRLGRQKQRHDALISKLLAD"
     gene            51203..52906
                     /gene="ligB"
                     /locus_tag="YPTB_RS00290"
                     /old_locus_tag="YPTB0038"
                     /gene_synonym="yicF"
     CDS             51203..52906
                     /gene="ligB"
                     /locus_tag="YPTB_RS00290"
                     /old_locus_tag="YPTB0038"
                     /gene_synonym="yicF"
                     /EC_number="6.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1C259.1"
                     /note="this ligase is similar to LigA but it lacks the
                     C-terminal BRCT domain; catalyzes strand joining of nicked
                     DNA in the presence of a divalent cation and NAD+; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase B"
                     /protein_id="WP_011191447.1"
                     /db_xref="GI:499504807"
                     /translation="MNILNLKIIMFLLISNIIVVGGAWATSTCPDWPATRIAVEINAL
                     EQQLNKWSAAYHQQGHSPVTDDIYDQLQDKLRVWQSCRGLPDKTESQPIPGKGQFLHP
                     VAHTGLKKLKDETALTRWMAGRKNLWVQPKVDGVAVTLVYHGGKLVQLLSRGNGVKGQ
                     NWTEKAPFISAIPQYIANAPALLTLQGELFLLMDGHQQAKSGGVNARSTVAGALMRKS
                     PSPLLAQVGVFIWAWPDGPTTMKEKVALLQVMGFPFTAKYSEPVMSHLDVVQWRQFWF
                     QAPLPFVTDGVVVRQEEEPAGRYWQATPGQWSMAWKYPPLQHIAEVKDIHFTLGRTGK
                     GTVVLEVLPIKIDDKWIRRVNIGSVTRWKQWDIAPGDHITLALAGHGIPRLDNVVWRV
                     HQRNTITAPNWDKFHQLSCFQRLPHGCEPQFLSRLIWLSGPGGLDIGGIGGGFWQKLI
                     HHELINDLVGWLLLTPEQIASIPGIGNARAEKIYQQFQRAKQQPFSRWLLALGFPQVV
                     SVDAQWQVVLRRSLSEWATMAGIGQMRAKQIKHFLDHPDVQALADFLSTQKVVGFELT
                     E"
     gene            complement(52926..53543)
                     /locus_tag="YPTB_RS00295"
                     /old_locus_tag="YPTB0039"
     CDS             complement(52926..53543)
                     /locus_tag="YPTB_RS00295"
                     /old_locus_tag="YPTB0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191448.1"
                     /db_xref="GI:499504808"
                     /translation="MLLSVLYIIGITAEAMTGALAAGRRQMDMFGVIIIASATAIGGG
                     SVRDMLLGHYPLGWVKHPEYIVIVAIAAIVTTWMAPLMKQLRHLFLVLDAIGLIVFSI
                     IGAQIALDMGHSTIIAAIAAVITGVFGGVLRDMLCNCIPLVFQKEIYAGISFAAAWIY
                     IALQYTPLSHNWVIIITLITGLSARLLALRFRLGLPVFKYEHSDH"
     gene            complement(54064..54927)
                     /locus_tag="YPTB_RS00300"
                     /old_locus_tag="YPTB0040"
     CDS             complement(54064..54927)
                     /locus_tag="YPTB_RS00300"
                     /old_locus_tag="YPTB0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005122606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002208998.1"
                     /db_xref="GI:488137790"
                     /translation="MIRSMTAYARRDIKGEWGNAAWELRSVNQRYLETYIRLPEQFRS
                     LEPVIRERIRSRLTRGKIECHLRFELDANAQSSLILNEKLAKQLVEAGNWVKMQSDEG
                     EINPVDILRWPGVMSAEEQDLDAISTELMQALDTALDDFIVSRETEGAALKTLIEQRL
                     EGVSAEVVKVRAHMPNILQWQRERLLNKLEEAQVQLENTRLEQELVLMAQRIDVAEEL
                     DRLEAHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLI
                     EQMREQIQNIE"
     gene            55054..55770
                     /gene="rph"
                     /locus_tag="YPTB_RS00305"
                     /old_locus_tag="YPTB0041"
     CDS             55054..55770
                     /gene="rph"
                     /locus_tag="YPTB_RS00305"
                     /old_locus_tag="YPTB0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZJP8.1"
                     /note="RNase PH; tRNA nucleotidyltransferase; forms
                     hexamers in Bacillus subtilis; phosphoroltic 3'-5'
                     exoribonuclease; involved in maturation of tRNA precursors
                     and removes terminal nucleotides near CCA acceptor arms of
                     mature tRNAs; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="WP_002208997.1"
                     /db_xref="GI:488137789"
                     /translation="MRPADRAAQQVRPLTLTRNYTKHAEGSVLVEFGDTKVLCTATVE
                     EGVPRFLKGQGQGWITAEYGMLPRSTHSRNAREAAKGKQGGRTLEIQRLIARSLRAAV
                     DLKKLGEFTITLDCDVLQADGGTRTASISGACVALADALNKLVASGKLKANPMKGLVA
                     AVSVGIVKGEALCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLALL
                     DLARGGIETIFQAQKAALES"
     gene            55937..56584
                     /gene="pyrE"
                     /locus_tag="YPTB_RS00310"
                     /old_locus_tag="YPTB0042"
     CDS             55937..56584
                     /gene="pyrE"
                     /locus_tag="YPTB_RS00310"
                     /old_locus_tag="YPTB0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZJP7.1"
                     /note="involved in fifth step of pyrimidine biosynthesis;
                     converts orotidine 5'-phosphate and diphosphate to orotate
                     and 5-phospho-alpha-D-ribose 1-diphosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="WP_002208996.1"
                     /db_xref="GI:488137788"
                     /translation="MKAYQREFIEFALNKQVLKFGEFTLKSGRISPYFFNAGLFNTGL
                     DLAKLGRFYAAALMDCGVEFDLLFGPAYKGIPIATTTAVALAEHHERDVPYCFNRKEA
                     KTHGEGGNLVGSPLQGRVMLVDDVITAGTAIRESMEIINAQGATLAGVMISLDRQERG
                     RGEISAIQEVERDYHCKVIAIVTLNDVIRYLEDKPEMAEHLVAVRQYREQYGVTL"
     gene            complement(56719..57315)
                     /gene="slmA"
                     /locus_tag="YPTB_RS00315"
                     /old_locus_tag="YPTB0043"
                     /gene_synonym="ttk"
     CDS             complement(56719..57315)
                     /gene="slmA"
                     /locus_tag="YPTB_RS00315"
                     /old_locus_tag="YPTB0043"
                     /gene_synonym="ttk"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005175956.1"
                     /note="FtsZ binding protein; synthetically lethal with a
                     defect in the Min system; this protein is the first
                     identified nucleoid occlusion factor which works along
                     with the Min system to properly position the FtsZ ring
                     assembly; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid occlusion factor SlmA"
                     /protein_id="WP_002208995.1"
                     /db_xref="GI:488137787"
                     /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVS
                     EAALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAERN
                     PGLTRIMTGHALMFEQDRLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLAT
                     QLLAFCEGMLSRFVRSEFRYCPTQEFDSRWPLIVAQLQ"
     gene            complement(57437..57895)
                     /locus_tag="YPTB_RS00320"
                     /old_locus_tag="YPTB0044"
     CDS             complement(57437..57895)
                     /locus_tag="YPTB_RS00320"
                     /old_locus_tag="YPTB0044"
                     /EC_number="3.6.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MAX3.1"
                     /note="catalyzes the formation of dUMP from dUTP; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="WP_011566231.1"
                     /db_xref="GI:499885497"
                     /translation="MMKKIDIKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQ
                     PGQTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVW
                     NRGQQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTGGFGHSGRQ"
     gene            complement(57873..59090)
                     /locus_tag="YPTB_RS00325"
                     /old_locus_tag="YPTB0045"
     CDS             complement(57873..59090)
                     /locus_tag="YPTB_RS00325"
                     /old_locus_tag="YPTB0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104266.1"
                     /note="catalyzes the conjugation of cysteine to
                     4'-phosphopantothenate to form
                     4-phosphopantothenoylcysteine, which is then
                     decarboxylated to form 4'-phosphopantotheine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenoylcysteine decarboxylase"
                     /protein_id="WP_002208993.1"
                     /db_xref="GI:488137785"
                     /translation="MMTGLSGKHIVLGISGGIAAYKSPELVRRLRDKGADVRVVMTHA
                     AKAFIAPLTLQAVSGYPVSDDLLDPAAEAAMGHIELGKWADLVIIAPATADLLARMAA
                     GMANDLLTTVCLATAAPIAAVPAMNQQMYRAPATQENLQTLSKWGVLLWGPDSGSQAC
                     GDIGPGRMLDPQEIVALAYNHFSAKQDLQHLSVMITAGPTREPLDPVRFISNQSSGKM
                     GFAIAQALAARGSNVTLIAGPVNLSTPEGVKRIDVITALEMQQAVQKIAQQQNIFISC
                     AAVADYRAEHVSDEKIKKQGDEITLKLVKNPDIVAGVASMAKNRPFVVGFAAETQNVE
                     EYARQKLARKNLDLICANDVSLAEHGFNSDTNALHLFWSTGEKRLPLSDKYLLSQRLI
                     DEIVSRYDEKNRH"
     gene            59284..59952
                     /locus_tag="YPTB_RS00330"
                     /old_locus_tag="YPTB0046"
     CDS             59284..59952
                     /locus_tag="YPTB_RS00330"
                     /old_locus_tag="YPTB0046"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZJP3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="WP_002208992.1"
                     /db_xref="GI:488137784"
                     /translation="MDEWYGQVAPREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKM
                     AEYLIETFGSLHGLISADYQTLCAHKGIGASKYSQIQAIGELACRCFSSHLMRESVLL
                     NPGITQKFLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREAL
                     KVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLVVGRGECVSFAE
                     RGWL"
     gene            60215..60451
                     /gene="rpmB"
                     /locus_tag="YPTB_RS00335"
                     /old_locus_tag="YPTB0047"
     CDS             60215..60451
                     /gene="rpmB"
                     /locus_tag="YPTB_RS00335"
                     /old_locus_tag="YPTB0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2VF68.1"
                     /note="required for 70S ribosome assembly; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_002208991.1"
                     /db_xref="GI:488137783"
                     /translation="MSRVCQVTGKRPMSGNNRSHAMNATKRRFLPNLHSHRFWVEGEK
                     RFVTLRVSAKGMRVIDKKGIETVLAEIRARGEKY"
     gene            60463..60630
                     /gene="rpmG"
                     /locus_tag="YPTB_RS00340"
                     /old_locus_tag="YPTB0048"
     CDS             60463..60630
                     /gene="rpmG"
                     /locus_tag="YPTB_RS00340"
                     /old_locus_tag="YPTB0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MY30.1"
                     /note="in Escherichia coli BM108, a mutation that results
                     in lack of L33 synthesis had no effect on ribosome
                     synthesis or function; there are paralogous genes in
                     several bacterial genomes, and a CXXC motif for zinc
                     binding and an upstream regulation region of the paralog
                     lacking this motif that are regulated by zinc similar to
                     other ribosomal proteins like L31; the proteins in this
                     group lack the CXXC motif; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_002208990.1"
                     /db_xref="GI:488137782"
                     /translation="MAKGVREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVR
                     QHVLYKEAKIK"
     gene            60713..61522
                     /locus_tag="YPTB_RS00345"
                     /old_locus_tag="YPTB0049"
     CDS             60713..61522
                     /locus_tag="YPTB_RS00345"
                     /old_locus_tag="YPTB0049"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4TSD4.1"
                     /note="Involved in base excision repair of DNA damaged by
                     oxidation or by mutagenic agents. Acts as DNA glycosylase
                     that recognizes and removes damaged bases; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formamidopyrimidine-DNA glycosylase"
                     /protein_id="WP_002208989.1"
                     /db_xref="GI:488137781"
                     /translation="MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWPVSDEILTL
                     SDQPVLSVQRRAKYLLLELPKGWIIIHLGMSGSLRVLSEETAAEKHDHVDLVVSNGKI
                     LRYTDPRRFGAWLWAKDLETSNVLAHLGPEPLSDEFTAQYLFDKSRNKRTLIKPWLMD
                     NKVVVGVGNIYASESLFAAGILPDRAAGSLTDAESVLLVATIKAVLLHSIEQGGTTLR
                     DFLQSDGKPGYFAQELQVYGRAGEPCRQCGHPIEIAKHGQRSTFFCRHCQH"
     gene            complement(61528..62007)
                     /locus_tag="YPTB_RS00350"
                     /old_locus_tag="YPTB0050"
     CDS             complement(61528..62007)
                     /locus_tag="YPTB_RS00350"
                     /old_locus_tag="YPTB0050"
                     /EC_number="2.7.7.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7FCT8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="WP_011191449.1"
                     /db_xref="GI:499504809"
                     /translation="MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKP
                     MFTLDERVALAKKVTALLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQL
                     ANMNRHLMPKLESVFLMPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA"
     gene            complement(62004..62786)
                     /locus_tag="YPTB_RS00355"
                     /old_locus_tag="YPTB0051"
     CDS             complement(62004..62786)
                     /locus_tag="YPTB_RS00355"
                     /old_locus_tag="YPTB0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS biosynthesis protein"
                     /protein_id="WP_002208987.1"
                     /db_xref="GI:488137779"
                     /translation="MGTKKRLSVVMITKNEASLLTDCLASVAWADEIIVLDSGSEDET
                     RALAQQFGAKVYSNINWPGYGKQRQLAQQYASGDYILMLDADERVTPELKIAIESVLL
                     APEEGAVYSCSRRNLFLGRFMRHSGWYPDRVTRLYPHHQYRYNDNLVHESLDSGSAKV
                     IPLAGDLLHLTCRDFFAFQRKQLSYAEAWAIQRHQQGKSCSYFAILSHTLGAFSKTWL
                     LRAGFLDGKQGLLLAVVNAQYTFNKYAALWALSHQYQKSEKS"
     gene            complement(62787..64064)
                     /locus_tag="YPTB_RS00360"
                     /old_locus_tag="YPTB0052"
     CDS             complement(62787..64064)
                     /locus_tag="YPTB_RS00360"
                     /old_locus_tag="YPTB0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013648993.1"
                     /note="catalyzes the transfer of
                     2-keto-3-deoxy-D-manno-octulosonic acid to lipid A;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid transferase"
                     /protein_id="WP_002208986.1"
                     /db_xref="GI:488137778"
                     /translation="MLLRLYQVLLYLIQPLIWLRLLLRSRKAPAYRKRWGERYGFCAG
                     KVVAGGIMLHSVSVGETLAAIPLVRALRHRYPSLPITVTTMTPTGSERVQSAFGKDVH
                     HVYLPYDLPGSVNRFLDQVNPKLVIIMETELWPNLINTLHRRKIPLVIANARLSARSA
                     AGYKKIGSFIRTILQRITLIAAQNQEDGDRFIELGLKRSQLTVTGSLKFDISVTPELA
                     ARAVTLRRQWAPHRPVWIATSTHDGEETILLEAHRQLLQQFPTLLLILVPRHPERFGK
                     AVELTQKIGLSYTLRSKGEVPSSSTQVVIGDTMGELMLLYGIADLAFVGGSLVERGGH
                     NPLEAAAHAIPVLMGPHTFNFKDICAKLEQAEGLITVTDTLSLVKEITVLLTDEDCRL
                     YYGRHAVDVLHENQGALQRLLHLLEPYLPQRSH"
     gene            complement(64484..65449)
                     /locus_tag="YPTB_RS00365"
                     /old_locus_tag="YPTB0053"
     CDS             complement(64484..65449)
                     /locus_tag="YPTB_RS00365"
                     /old_locus_tag="YPTB0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose:LPS heptosyl transferase"
                     /protein_id="WP_002208985.1"
                     /db_xref="GI:488137777"
                     /translation="MHVLIVKTSSMGDVLHTLPALTDAMNAIPGIRFDWVVEEGFSQI
                     PSWHPAVDKVIPVAIRRWRKNWFGSDTRQERCDFKRVVQQRSYDRVIDAQGLIKSAAL
                     ITRIAKGTKHGPDCKSAREPFASWFYNCRHEIDTKQHAVERIRQLFAKSLGYDKPESY
                     GDYAIAQRFLNQLPADAGQYLVFLHATTRDNKHWPESHWVQLIELVQPTGLKIKLPWG
                     AEHEHQRALRLAEHFPHVEVLPKLSLQQVAEVLAGAKAVVSVDTGLSHLTAALDRPNI
                     TLFGPTDPGLIGGYGKNQIAVISEQKKMDSLSAPTIMARLETLIS"
     gene            complement(65449..66513)
                     /locus_tag="YPTB_RS00370"
                     /old_locus_tag="YPTB0054"
     CDS             complement(65449..66513)
                     /locus_tag="YPTB_RS00370"
                     /old_locus_tag="YPTB0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208984.1"
                     /note="catalyzes the transfer of the second heptose to the
                     heptosyl-KDO2 moiety of the lipopolysaccharide inner core;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose:LPS heptosyl transferase"
                     /protein_id="WP_011191450.1"
                     /db_xref="GI:499504810"
                     /translation="MKILVIGPSWVGDMMMSQSLYRTLKAEYPAADIDVMAPAWCRPL
                     LARMPEVRHAIPMPLGHGAFAFEERRRLGLALRETEYDRAYVLPNSFKSALIPYFSGI
                     KRRIGWRGEMRYFLLNDLRILDKQAFPMMVQRYVALAYDKERIRSAADLPQPLLWPQL
                     QVRDEEIAETTASFNLTDNRPIIGFCPGAEFGPAKRWPHYHYATLAQKLIDDGYQVVL
                     FGSAKDNEAGEDIRQALSDTDREYCLNLAGQTSLEQAVVLIAACSAVVSNDSGLMHVA
                     AALNKPLVALYGPSSPDFTPPLSEKATVIRLITGYHKVRKGDSAQGYHQSLIDIQPEH
                     VMAALEKQLATQECSVKGGD"
     gene            complement(66544..67476)
                     /gene="rfaD"
                     /locus_tag="YPTB_RS00375"
                     /old_locus_tag="YPTB0055"
     CDS             complement(66544..67476)
                     /gene="rfaD"
                     /locus_tag="YPTB_RS00375"
                     /old_locus_tag="YPTB0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080305.1"
                     /note="catalyzes the interconversion between
                     ADP-D-glycero-beta-D-manno-heptose and
                     ADP-L-glycero-beta-D-manno-heptose; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
                     /protein_id="WP_002208983.1"
                     /db_xref="GI:488137775"
                     /translation="MIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNLVD
                     LDIADYMDKEDFVASIVAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILH
                     FCLDRSIPFLYASSAATYGGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADS
                     QICGFRYFNVYGPREGHKGSMASVAFHLNNQINAGERPKLFAGSENFKRDFIYVGDVA
                     DVNLWFWQNGVSGIFNCGTGRAESFQAVADAVVDYHQSGPVEYIEFPEKLKGRYQAYT
                     QADLTKLRAAGYGKPFKTVAEGVKEYLAWLNRSV"
     gene            67722..68933
                     /locus_tag="YPTB_RS00380"
                     /old_locus_tag="YPTB0056"
     CDS             67722..68933
                     /locus_tag="YPTB_RS00380"
                     /old_locus_tag="YPTB0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104268.1"
                     /note="catalyzes the formation of 2-amino-3-oxobutanoate
                     from acetyl-CoA and glycine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-3-ketobutyrate CoA ligase"
                     /protein_id="WP_002208982.1"
                     /db_xref="GI:488137774"
                     /translation="MSLPCNKHPFYQQLEQQLDTTRTEGLYKNERVITSAQQANIAVA
                     DGSRVINFCANNYLGLANHPKLIAAAKAGMDSHGFGMASVRFICGTQDIHKELEHKLA
                     SFLGMEDAILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKAKRYRYAN
                     NDMTELEAQLKQAKAEGARHIMIATDGVFSMDGVIANLKRVCDLADEYQALVMVDDSH
                     AVGVIGANGRGTHEYCEVMDRVDIITGTLGKALGGASGGYTAGRKELVEWLRQRSRPY
                     LFSNSLAPAIVAASIEVLSLLEEGGALRDRLWANARLFREKMSAAGFTLAGADHAIIP
                     VMLGEAKLAQDFANALLKEGIYVTGFFFPVVPKGQARIRTQMSAGHTTEQVERAIEAF
                     VRIGKQLNVIA"
     gene            68943..69968
                     /gene="tdh"
                     /locus_tag="YPTB_RS00385"
                     /old_locus_tag="YPTB0057"
     CDS             68943..69968
                     /gene="tdh"
                     /locus_tag="YPTB_RS00385"
                     /old_locus_tag="YPTB0057"
                     /EC_number="1.1.1.103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005164731.1"
                     /note="converts threonine and NAD to
                     1,2-amino-3-oxobutanoate and NADH; functions in threonine
                     catabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="l-threonine 3-dehydrogenase"
                     /protein_id="WP_011191451.1"
                     /db_xref="GI:499504811"
                     /translation="MKALSKLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHI
                     YNWDEWSQKTIPVPMVVGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGG
                     RTHLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSF
                     DLVGEDVLVSGAGPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVNVSKE
                     NLNDVMTELGMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRIAMLGIPPSDMSIDWNQV
                     IFKGLFIKGIYGREMFETWYKMAALIQSGLDLTPIITHRFPIDEFQQGFDAMRSGKSG
                     KVVLSWD"
     gene            complement(70106..71116)
                     /locus_tag="YPTB_RS00390"
                     /old_locus_tag="YPTB0058"
     CDS             complement(70106..71116)
                     /locus_tag="YPTB_RS00390"
                     /old_locus_tag="YPTB0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar deacetylase"
                     /protein_id="WP_011191452.1"
                     /db_xref="GI:499504812"
                     /translation="MRYFNTRQFIIVSTLFIASTAQAGKLSIVIDDFGYRPQNENKIL
                     QMPLPISVAILPNAPYAREMATKAHNQGREILIHLPMAPQSKQPLERDTLQPSMSSEE
                     IQRIIRQAANNVPYAKGMNNHMGSAMTASLPGMQKVMQALGSYQLYFLDSVTIGNSQA
                     SKAAEGTGVKVIKRKIFLDDSQNEAAIRQQFNRAVALARRNGSAIAIGHPHPATIKVL
                     QQMLPQLPADIVLVRPSALLNEPVQSLSPDKTKPREPVKGQRLPAIKQCKAKASYVPE
                     KIYADKLFILLGESLMQNPAVIFIQQHWQQYFTPAPPATPIDEQKAIENTEKLPPKKA
                     AQ"
     gene            complement(71140..72510)
                     /locus_tag="YPTB_RS00395"
                     /old_locus_tag="YPTB0059"
     CDS             complement(71140..72510)
                     /locus_tag="YPTB_RS00395"
                     /old_locus_tag="YPTB0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M37"
                     /protein_id="WP_002208980.1"
                     /db_xref="GI:488137772"
                     /translation="MKDRELLAKSITTKDAVSDGRESPSLLSDKLSRLPWSTLYASVF
                     CAGVLLLPFSGQAVEPPVAAKASENKNQLKTLQQDIAEKEKSVQQQKKQRSSLLDQLK
                     QQENTISQTSRSLRETQATLAELSKDIASLTTSIEKLQNQQSQQQSILSKQLAAAFKQ
                     GKHSSLQLILSGEESQRSERILAYFSYLNEARQKAIEELKQTRTTLSAEKKMLEQKQN
                     QHKALLDEQKAQQQKLEQARIARQKTLTSLEASLEKDQQSLAELKLNESRLRDQIAKA
                     EREAKARAEREAKEAARVREQVKVKEQQAKKTGSSYKPSESERSLMARTGGLGRPGGQ
                     ALWPVRGNVSHRFGEPLQGELRWKGMVITAPEGSEVKAIADGRVLLADWLQGYGLVVV
                     IEHGKGDMSLYGYNQSALVNVGAQVKAGQPIALVGTSGGQGEPSLYFEIRRQGQAVNP
                     QPWLGR"
     gene            complement(72520..74067)
                     /locus_tag="YPTB_RS00400"
                     /old_locus_tag="YPTB0060"
     CDS             complement(72520..74067)
                     /locus_tag="YPTB_RS00400"
                     /old_locus_tag="YPTB0060"
                     /EC_number="5.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7FCU8.1"
                     /note="catalyzes the interconversion of 2-phosphoglycerate
                     and 3-phosphoglycerate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase"
                     /protein_id="WP_011191453.1"
                     /db_xref="GI:499504813"
                     /translation="MSSTKKPLVLTILDGYGHREEQQDNAILNAKTPVMDVLWQQQPH
                     TLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEGDFFTNPTLTAA
                     VDNAVKTGKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPR
                     SAESSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTADN
                     AVAGLQAAYARGENDEFVKPTVIQATGEADAAMNEGDTLIFMNFRADRARQITRTFVN
                     ADFDGFKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISE
                     TEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGK
                     YDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAE
                     QMRDPATGQAHTAHTSLPVPLIYVGNKAVKAVEGGKLSDIAPTMLSLMEMEIPQEMTG
                     KPLFIVE"
     gene            74465..74899
                     /locus_tag="YPTB_RS00405"
                     /old_locus_tag="YPTB0061"
     CDS             74465..74899
                     /locus_tag="YPTB_RS00405"
                     /old_locus_tag="YPTB0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002353237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002208978.1"
                     /db_xref="GI:488137770"
                     /translation="MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRG
                     EATRLINKEDAVVVDIRTREDYRKGHIANSINLIPSDIKNGNLGELEKHKTQPIIVVC
                     AMGTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK"
     gene            75018..75266
                     /locus_tag="YPTB_RS00410"
                     /old_locus_tag="YPTB0062"
     CDS             75018..75266
                     /locus_tag="YPTB_RS00410"
                     /old_locus_tag="YPTB0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016266853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_002208977.1"
                     /db_xref="GI:488137769"
                     /translation="MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEM
                     IARSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDPLL"
     gene            75354..75830
                     /locus_tag="YPTB_RS00415"
                     /old_locus_tag="YPTB0063"
     CDS             75354..75830
                     /locus_tag="YPTB_RS00415"
                     /old_locus_tag="YPTB0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZJM7.1"
                     /note="molecular chaperone that is required for the normal
                     export of envelope proteins out of the cell cytoplasm; in
                     Escherichia coli this proteins forms a homotetramer in the
                     cytoplasm and delivers proteins to be exported to SecA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-export protein SecB"
                     /protein_id="WP_002208976.1"
                     /db_xref="GI:488137768"
                     /translation="MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDL
                     DTASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYC
                     PNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA"
     gene            75830..76849
                     /locus_tag="YPTB_RS00420"
                     /old_locus_tag="YPTB0064"
     CDS             75830..76849
                     /locus_tag="YPTB_RS00420"
                     /old_locus_tag="YPTB0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002361564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]"
                     /protein_id="WP_002208975.1"
                     /db_xref="GI:488137767"
                     /translation="MNTNPASMAVIGAGSYGTALAITLARNGHQVVLWGHDPKHIQQL
                     QQDRCNRAFLPDAAFPDTLRLETDLACALAASRDVLVVVPSHVFGAVLHQLKPHLRKD
                     ARIVWATKGLEAETGRLLQDVAREVLGEAIPLAVISGPTFAKELAAGLPTAIALASTD
                     VQFSEDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTAL
                     ITRGLAEMTRLGTALGADPSTFMGMAGLGDLVLTCTDNQSRNRRFGIMLGQGLGVKEA
                     QDNIGQVVEGYRNTKEVLALAQRHGVEMPITEQIYQVLYCHKNAREAALTLLGRTKKD
                     EKIGI"
     gene            76909..77049
                     /locus_tag="YPTB_RS00425"
                     /old_locus_tag="YPTB0065"
     CDS             76909..77049
                     /locus_tag="YPTB_RS00425"
                     /old_locus_tag="YPTB0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191454.1"
                     /db_xref="GI:499504814"
                     /translation="MELQQGSKRAYPDELIHVSDSGGREPLTLIITKSIVTIINRNSA
                     TA"
     gene            77115..77936
                     /gene="cysE"
                     /locus_tag="YPTB_RS00430"
                     /old_locus_tag="YPTB0066"
     CDS             77115..77936
                     /gene="cysE"
                     /locus_tag="YPTB_RS00430"
                     /old_locus_tag="YPTB0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002218861.1"
                     /note="catalyzes the O-acetylation of serine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine acetyltransferase"
                     /protein_id="WP_002208974.1"
                     /db_xref="GI:488137766"
                     /translation="MSSEELEQVWSNIKSEARALAECEPMLASFFHATLLKHENLGSA
                     LSYILANKLANPIMPAIAIREVVEEAYRSDAHMIVSAARDILAVRLRDPAVDKYSTPL
                     LYLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHAT
                     GIVIGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGA
                     KIGAGSVVLQSVPAHTTAAGVPARIVGKPESDKPSLDMDQHFNGSIQGFEYGDGI"
     gene            complement(78059..78547)
                     /locus_tag="YPTB_RS00435"
                     /old_locus_tag="YPTB0067"
     CDS             complement(78059..78547)
                     /locus_tag="YPTB_RS00435"
                     /old_locus_tag="YPTB0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004705053.1"
                     /note="member of the SPOUT superfamily of RNA
                     methyltransferases; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA methyltransferase"
                     /protein_id="WP_011191455.1"
                     /db_xref="GI:499504815"
                     /translation="MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRL
                     RRAGLDYHEFADIKHHHDYQAFLDSEKLDSTQLARLFALTTKGTPAHSAVSYQANDYL
                     LFGPETRGLPAYILDALPAQQKIRIPMQADSRSMNLSNAVSVVVYEAWRQLGYPGALL
                     KE"
     gene            78736..79800
                     /locus_tag="YPTB_RS00440"
                     /old_locus_tag="YPTB0068"
     CDS             78736..79800
                     /locus_tag="YPTB_RS00440"
                     /old_locus_tag="YPTB0068"
                     /EC_number="2.1.1.63"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016604261.1"
                     /note="regulates genes involved in the repair of alkylated
                     DNA; repairs DNA containing 6-O-methylguanine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O6-methylguanine-DNA methyltransferase"
                     /protein_id="WP_011191456.1"
                     /db_xref="GI:499504816"
                     /translation="MNNVKDPRWAAIINRDKTADGQFVYAVKTTSIYCRPSCPSRRAK
                     AEHIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQVEKISQACRLIELAETPPKLNEL
                     AAQLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSS
                     RFYAQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVQ
                     LVQQLQDKFPQANLVGGDAEFEQWVAQVVGCVEAPKLGLGLPLDIRGTAFQQRVWQAL
                     REIPIGETASYADIASRIGSPTAVRAVAGACAANILAVAIPCHRVIRQDGALSGYRWG
                     VERKRLLLERESVEKEAEDH"
     gene            complement(79868..81244)
                     /gene="cpxA"
                     /locus_tag="YPTB_RS00445"
                     /old_locus_tag="YPTB0069"
     CDS             complement(79868..81244)
                     /gene="cpxA"
                     /locus_tag="YPTB_RS00445"
                     /old_locus_tag="YPTB0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208971.1"
                     /note="part of two-component CpxA/CpxR system; senses
                     envelope stress; upregulates a number of periplasmic
                     folding and trafficking factors; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_002208971.1"
                     /db_xref="GI:488137763"
                     /translation="MINSLTTRIFAIFWFTLALVLMLVLMVPKLDSRQLTVLLDSEQR
                     QGTMLEQHIEAELANDPANDLMWWRRLHRAIEKWAPPGQHLILVTSEGRIIGVQRQEV
                     QMVRNFIGQSDNADQPKKKKYGRVEMVGPFSIRDGEDNYQLYLIRPANSPQSDFINLM
                     FDRPLLLLIATMLISAPLLLWLAWSLAKPARKLKNAADDVARGNLKQHPELESGPQEF
                     LATGASFNQMISSLDRMVVAQQRLISDISHELRTPLTRLQLATALMRRRHGEGKELER
                     IEMEAQRLDSMINDLLVLSRSQHKNELHREPIKADELWSDVLENAQFEAEQMGKTLVV
                     TAPPGPWPLFCNPAALDSALENIVRNALRYSHHHIAVAFSIDNQGVTIIVDDDGPGVS
                     PEDREQIFRPFYRTDEARDRASGGTGLGLAIVETAVSQHRGWVKAEDSPLGGLRLIVW
                     LPLHPLKS"
     gene            complement(81241..81939)
                     /locus_tag="YPTB_RS00450"
                     /old_locus_tag="YPTB0070"
     CDS             complement(81241..81939)
                     /locus_tag="YPTB_RS00450"
                     /old_locus_tag="YPTB0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208970.1"
                     /note="response regulator in two-component regulatory
                     system with CpxA; part of the envelope stress response
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002208970.1"
                     /db_xref="GI:488137762"
                     /translation="MHKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQALSQLDSS
                     IDLLLLDIMMPRKNGIETLKELRQHHQTPVIMLTARGSELDRVLGLELGADDYLAKPF
                     NDRELVARIRAILRRSNWSEQQQNAEQGAPTLEVDCLQLNPGRQEASFEGQPLELTGT
                     EFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGLPWF
                     KTLRGRGYLMVSET"
     gene            82113..82601
                     /gene="cpxP"
                     /locus_tag="YPTB_RS00455"
                     /old_locus_tag="YPTB0071"
     CDS             82113..82601
                     /gene="cpxP"
                     /locus_tag="YPTB_RS00455"
                     /old_locus_tag="YPTB0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191457.1"
                     /note="repressor of the Cpx envelope stress response
                     pathway which occurs via periplasmic interactions with
                     CpxA; CpxP is degraded by DegP protease especially in the
                     presence of misfolded substrates; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_011191457.1"
                     /db_xref="GI:499504817"
                     /translation="MRKVTTLVMASMFVLGSSAAFAADNTKVTEGYHGDGKMMMNKKG
                     DRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRLDLEDHEAMHKLITADKFDEAAVR
                     AQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSSA
                     QK"
     gene            83279..84238
                     /locus_tag="YPTB_RS00460"
                     /old_locus_tag="YPTB0072"
     CDS             83279..84238
                     /locus_tag="YPTB_RS00460"
                     /old_locus_tag="YPTB0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002208968.1"
                     /db_xref="GI:488137760"
                     /translation="MIAQEDAHDYHRPMKTTPTPHDALFKNFMTQPATACDLLEFHLP
                     PELRQLCDLSTLRLESGSFIENNLRACYSDVLYSLKTTVGDGYVYALIEHQSSPDKHM
                     AFRLMRYAIAAMQSHLEAGYDKLPLVIPILFYHGMVTPYPYPMSWLHAFNQPELAGQL
                     YCGNFPLVDVTVIPDHEIMTHRRIALLELLQKHIRQRDLSELLDQLVILIASGYTTED
                     QLKSAINYIIQVGETAEPEVFIRSLAHRLPEHEESLMTIAQKLEQKGEARGIVKGRVE
                     GRVEGAQETALKIARTMLANGLDRATVMKMTGLSEEELTQIHH"
     gene            84800..85702
                     /gene="fieF"
                     /locus_tag="YPTB_RS00465"
                     /old_locus_tag="YPTB0073"
                     /gene_synonym="yiiP"
     CDS             84800..85702
                     /gene="fieF"
                     /locus_tag="YPTB_RS00465"
                     /old_locus_tag="YPTB0073"
                     /gene_synonym="yiiP"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66GA9.1"
                     /note="member of cation diffusion facilitator family; CDF;
                     membrane-bound; induced by both zinc and iron, but does
                     not induce resistance to zinc; can transport zinc(II) in a
                     proton-dependent manner; instead this protein induces iron
                     resistance; forms dimers; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation-efflux pump FieF"
                     /protein_id="WP_002208967.1"
                     /db_xref="GI:488137759"
                     /translation="MDPQYARWVKAAALSATALASILLIIKIFAWWHTGSVSLLAALV
                     DSLVDLAASLTNLFVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGF
                     RHLASPEPLQDPSIGIGVTLVALFSTLILVTFQRWVVRKTHSQAIRADMLHYQSDVLM
                     NGAILIALALSWYGFRRADALFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQQI
                     IDIVTSWPGVIGAHDLRTRRSGQTRFIQLHLEMEDMMPLMEAHVLAEQVEHALLYRFP
                     GADVLIHQDPCSVVPKERHAHWEL"
     gene            85920..86903
                     /locus_tag="YPTB_RS00470"
                     /old_locus_tag="YPTB0074"
     CDS             85920..86903
                     /locus_tag="YPTB_RS00470"
                     /old_locus_tag="YPTB0074"
                     /EC_number="2.7.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004392226.1"
                     /note="catalyzes the formation of D-fructose
                     1,6-bisphosphate from D-fructose 6-phosphate in
                     glycolysis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent 6-phosphofructokinase"
                     /protein_id="WP_011191458.1"
                     /db_xref="GI:499504818"
                     /translation="MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLG
                     LYENRMKKLDRYSVSDMINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIG
                     GDGSYAGADLLTKEGGIHCVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSS
                     SHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHA
                     IVAITEKLDDIDSLAKYIEKETGRETRGTVLGHIQRGGAPVAYDRILASRMGSYAVDL
                     LLQDHDYKKGGFCVGVQNEKMVHELISVCIAPENKKSKFKEDWYDTAKKLF"
     gene            87124..88113
                     /locus_tag="YPTB_RS00475"
                     /old_locus_tag="YPTB0075"
     CDS             87124..88113
                     /locus_tag="YPTB_RS00475"
                     /old_locus_tag="YPTB0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter subunit"
                     /protein_id="WP_011191459.1"
                     /db_xref="GI:499504819"
                     /translation="MRKWGVGLSLLLLASGAIAKDIQLLNVSYDPTREFYQEYNQAFS
                     KYWQQQTGDKVTVRQSHGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKNWI
                     KRLPDNSAPYTSTIVFLVRKGNPKQIHDWSDLVKPGTSVITPNPKTSGGARWNYLAAW
                     GYALEHNNNDQAKAQEFVNALYKNVEVLDSGARGATNTFVERGIGDVLIAWENEALLA
                     VNEVGNGQFDIVTPSVSILAEPTVSVVDKVVDKRGTCDVADAYLKYLYSPEGQTIAAK
                     NYYRPRDPAVAAKFAKEFPQLKLFTIDEVFGGWTQAQKTHFATGGVFDEISKR"
     gene            complement(88363..89022)
                     /locus_tag="YPTB_RS00480"
                     /old_locus_tag="YPTB0076"
     CDS             complement(88363..89022)
                     /locus_tag="YPTB_RS00480"
                     /old_locus_tag="YPTB0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016257829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_032466594.1"
                     /db_xref="GI:694125999"
                     /translation="MATRQFLTEVIAQFAQQSKYQVELESVGGVDATKRVEAGEAFDV
                     VILSANAIDKLIDSGKILPNSRIDLVKSGVAIAVKEGAQIMDVSSEETVKQAVLAANT
                     IAYSTGPSGVYLTEVFERWGIAEQIKDRIVKVPPGVPVGSLVAKGEVELGFQQLSELL
                     HLKGIIILGPLPTDIQIMTHFSAGVPLKTNQQKAIKVLLDFLASPAATEAKIKNGMEP
                     I"
     gene            complement(89257..90684)
                     /locus_tag="YPTB_RS00485"
                     /old_locus_tag="YPTB0077"
     CDS             complement(89257..90684)
                     /locus_tag="YPTB_RS00485"
                     /old_locus_tag="YPTB0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002208963.1"
                     /db_xref="GI:488137755"
                     /translation="MKNKIWKLCILVMIPLVIWFIPPPEGLTELSWRLSGFYLAAICG
                     LILKPFSEAVVLLGVVGFAGFFLNNTSQILVGYATSTVWLVFAAFGISISFVKTGLGR
                     RIAFHMIRFCGSTTLRLGYVTAFLEFVISPVTPSNTARSGGIVFPIILSVVKALGSEP
                     GDTAKKAGSYLMSNIYFVMKVSSFMFITAMAPNLLAADFAAKILGIHLDWGVWALAMV
                     VPGLLLLLIVPAVGYYLDKPELKKVDNKKIADEGLAELGPITRNEKLLVGIFISALLG
                     WALPSLLGQLFGITLKIDATAVAIMAMALCILLGVIKWDDVLQNKGAWNTLLWFGGII
                     GLASALSKEKVFDWLANLIQNNVDFGHNPFIALTIIGFLSIIIRYFFASASSYAIAML
                     PVFLTVGKVAGADPMALALVLAATNSYGGALTHYGGGSAPIIFGAGYNNVKQWWASGA
                     VIATVCFIVTMTVGYVWWQFLGFVK"
     gene            complement(90750..91463)
                     /locus_tag="YPTB_RS00490"
                     /old_locus_tag="YPTB0078"
     CDS             complement(90750..91463)
                     /locus_tag="YPTB_RS00490"
                     /old_locus_tag="YPTB0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002208962.1"
                     /db_xref="GI:488137754"
                     /translation="MSLVNMKGVVVTNIERAELALLQRFAEYGVATVHEAQLRQGLLD
                     ERIKPIQQGRCIAGNAVTVLVTPGDNWMFHVAVEQCQPGDVLLVAPTSECHDGFFGDL
                     LATSLLARGVVALVGDIGIRDSQTLREMNFPVWSRAVWAQGTVKASLGSVNVPVICAG
                     QLVNPGDIVVADDDGVVIVPREQATAIADAAQTRVDLETSKRQRLANGELGLDIYQMR
                     APLAKKGLRYVNSLNALKS"
     gene            complement(91460..92197)
                     /locus_tag="YPTB_RS00495"
                     /old_locus_tag="YPTB0079"
     CDS             complement(91460..92197)
                     /locus_tag="YPTB_RS00495"
                     /old_locus_tag="YPTB0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002356630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GlcNAc-PI de-N-acetylase"
                     /protein_id="WP_002208961.1"
                     /db_xref="GI:488137753"
                     /translation="MAMIPQKTALVVSAHSADFVWRAGGAIALHVEQGYQVHIVCLSY
                     GERGESAKLWRKGDMTEERVKASRHTEAQAAANVLGASIEFFDMGDYPLRADKESLFR
                     LADVFRRIQPHFVLTHSLADPYNYDHPLAANLAQEARIIAQAEGYRPGEAIIGAPPVY
                     CFEPHQPEQCGWKPDVLLDITSVWEKKYAAIQCMAGQEHLWEYYTRVALQRGVQAKRN
                     IGIASTKTIIHGEGYQSLFPRVTEDLS"
     gene            92334..93569
                     /locus_tag="YPTB_RS00500"
                     /old_locus_tag="YPTB0080"
     CDS             92334..93569
                     /locus_tag="YPTB_RS00500"
                     /old_locus_tag="YPTB0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011191461.1"
                     /db_xref="GI:499504821"
                     /translation="MRKKNDRNSIKIMQIRAFCMTAEQGAASLAALNLFRTQSAITRS
                     IRDLEHTLAISLFERHAKGMLLTDLGNVILPRARSAMEELTRIPALLRRLQQRDDEGI
                     EDLEPIWLFNERRLQIFLSLYRQQHALHVAQALDITQSAVSAALKVLEKGAGMYLFHR
                     TPKGMLPTPAGHEIAPCISRALNALHHIPEEITAHRGALTGSVRVGALPLSRARLLPL
                     AMIKLISRHPGIKIVTNESGFTALIAELRAGDIDFIIGALRNEKMLLDIHSEILFEEE
                     LILLARPNHPLSDRRVKNQELKDIQWVLPRNHAPSRHLLEVAFCKMGLASPQPVVESG
                     DPAVVRALLLGSDMVAAVSSHQLDFEVSEGILIPLQVNLTGTRREIGLMTRQKALNSP
                     ATDALINCVREVIQSSNDK"
     gene            complement(93800..94567)
                     /locus_tag="YPTB_RS00505"
                     /old_locus_tag="YPTB0081"
     CDS             complement(93800..94567)
                     /locus_tag="YPTB_RS00505"
                     /old_locus_tag="YPTB0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JHZ7.1"
                     /note="Reversibly isomerizes the ketone sugar
                     dihydroxyacetone phosphate to the aldehyde sugar
                     glyceraldehyde-3-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="WP_002208959.1"
                     /db_xref="GI:488137751"
                     /translation="MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPA
                     IYLNQAKHELAGSRIALGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYH
                     QESDELIAKKFGVLKEIGLIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFE
                     GAVIAYEPIWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNA
                     AELFTQPDIDGALVGGASLKADAFAVIVKAAAKAKKA"
     gene            complement(94696..95331)
                     /locus_tag="YPTB_RS00510"
                     /old_locus_tag="YPTB0082"
     CDS             complement(94696..95331)
                     /locus_tag="YPTB_RS00510"
                     /old_locus_tag="YPTB0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191462.1"
                     /db_xref="GI:499504822"
                     /translation="MRKKIVSMRIILLLAALLLITFMLITTINHAHADPTNDSSPPKE
                     GAPPIAPYLLFNAPTFDLTLVKFRESYNRANPTLPINEFHAITVKEDSPPLTRAASKI
                     NENLYASTALEKGTGKIKTLQITYLPIKGNEEKTAKLLAINYMAALMRQFEPTLSVAQ
                     SLANVQKLLTEGKGSPFYAHTIGAIRYVVADNGEKGLTFAVEPIKLSLSEA"
     gene            95479..95913
                     /locus_tag="YPTB_RS00515"
                     /old_locus_tag="YPTB0083"
     CDS             95479..95913
                     /locus_tag="YPTB_RS00515"
                     /old_locus_tag="YPTB0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005190549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002208957.1"
                     /db_xref="GI:488137749"
                     /translation="MTIQQWCFSFKGRIGRREFWIWMGLWLLAMLVIFTLAGKEWLPI
                     QSASFALVFLLWPTAAVVVKRLHDRNKAGWWALLAVLAWMLMAGNWQMLTPIWQWGVG
                     RFIPTLIFVMMFIDCGAFLGTEGDNRFGPEAVPVKFFADKAK"
     gene            complement(96254..97000)
                     /locus_tag="YPTB_RS00520"
                     /old_locus_tag="YPTB0084"
     CDS             complement(96254..97000)
                     /locus_tag="YPTB_RS00520"
                     /old_locus_tag="YPTB0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-NADP reductase"
                     /protein_id="WP_002208956.1"
                     /db_xref="GI:488137748"
                     /translation="MAEWVSGKITHIEHWTDALFSLQVNAPVDPFTAGQFAKLALDIN
                     GERVQRAYSYVNAPSDHNLEFYLVTVPEGKLSPRLDQLSVGGEVMITKQAAGFFVLEE
                     IPDCDTLWMLATGTAIGPYLSILQEGQDLERFKHLVLVHAARFAHDLSYLPLMQQLEQ
                     RYNGKLRIQTVVSREESPGSLTGRVPALIENGALEAAVGLKIDAKDSHVMLCGNPQMV
                     RDTQQLLKEQREMRKHLRRKPGHMTSEQYW"
     gene            complement(97155..98165)
                     /locus_tag="YPTB_RS00525"
                     /old_locus_tag="YPTB0085"
     CDS             complement(97155..98165)
                     /locus_tag="YPTB_RS00525"
                     /old_locus_tag="YPTB0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose 1,6-bisphosphatase"
                     /protein_id="WP_002223912.1"
                     /db_xref="GI:488152704"
                     /translation="MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADGAAVQAMRIML
                     NQVNIDGRIVIGEGEIDEAPMLFIGEHVGTGQGDAVDIAVDPIEGTRMTAMGQANALA
                     VLAVGDQGTFLHAPDMYMEKLVVGPAAKGAIDLNLPLEQNLCNIATALNKPLADLTVI
                     TLAKPRHDGIIAAMQQLGVKVFAIPDGDVAASILTCMPESEVDVMYCIGGAPEGVISA
                     AVIRALDGDMQGRLLPRHQVKGDSEDNRRIGEQELLRCKSMGIEAGNVLQLGDMARND
                     NVIFSATGITKGDLLEGIYRKGNMATTETLLIRGKSRTIRRIRSTHFLDRKDPALHEF
                     LL"
     gene            complement(98418..99941)
                     /gene="glpK"
                     /locus_tag="YPTB_RS00530"
                     /old_locus_tag="YPTB0086"
     CDS             complement(98418..99941)
                     /gene="glpK"
                     /locus_tag="YPTB_RS00530"
                     /old_locus_tag="YPTB0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228890.1"
                     /note="Converts glycerol and ADP to glycerol-3-phosphate
                     and ADP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="WP_002218876.1"
                     /db_xref="GI:488147668"
                     /translation="MTTENTTQKKYIVALDQGTTSSRAVVLDHNANIVSVSQREFTQI
                     YPKAGWVEHDPMEIWATQSSTLIEVLAKAGINSDEIAGIGITNQRETTIVWDKVTGKP
                     VYNAIVWQCRRTADICEKLKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARER
                     AERGELLFGTVDTWLVWNMTQGRVHVTDYTNASRTMMFNIRTKEWDDRMLKALNIPRA
                     MLPEVRPSSEIYGKTNIGGKGGTRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCF
                     LLMNTGEEAVQSTHGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDELKLIGDATD
                     SEYFATKVKNSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNSNHIIRATLESIAY
                     QTRDVLDAMQADSGARLKSLRVDGGAVANNFLMQFQADILGTRVERPAIRESTALGAA
                     FLAGLATGFWDDLDEVKSKASIEREFRPGIETTERDIRYKGWKKAVARARDWEEHDE"
     gene            complement(100118..100966)
                     /locus_tag="YPTB_RS00535"
                     /old_locus_tag="YPTB0087"
     CDS             complement(100118..100966)
                     /locus_tag="YPTB_RS00535"
                     /old_locus_tag="YPTB0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004719538.1"
                     /note="involved in the transport of glycerol into the
                     cell; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake facilitator protein"
                     /protein_id="WP_002208954.1"
                     /db_xref="GI:488137746"
                     /translation="MSQTASSTLKGQCIAEFLGTGLLIFFGAGCVAALKLAGASFGQW
                     EISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFERRKVLPYIVAQVAGAFCA
                     AALVYGLYYSLFVDFEQTHQMVRGSTESLQLAGIFSTYPNPHISVVQAFLVETVITAI
                     LMCLILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFALNPARDLGPKAFSYL
                     AGWGDIAFTGGRDIPYFLVPIFGPIVGALLGAFGYRALIGRHLPCDVCTLEDEESTTI
                     TTERKA"
     gene            complement(100976..101215)
                     /locus_tag="YPTB_RS00540"
                     /old_locus_tag="YPTB0088"
     CDS             complement(100976..101215)
                     /locus_tag="YPTB_RS00540"
                     /old_locus_tag="YPTB0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002215868.1"
                     /db_xref="GI:488144660"
                     /translation="MTAPLMRYTPLTFSQKITGPITLLKSLNALKLRENAHFMTNNTY
                     FDFATSRFRSLTINLHYPLHCSKGKNKKYPINLCL"
     gene            101610..101849
                     /locus_tag="YPTB_RS00545"
                     /old_locus_tag="YPTB0089"
     CDS             101610..101849
                     /locus_tag="YPTB_RS00545"
                     /old_locus_tag="YPTB0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114846.1"
                     /note="interacts with FisZ and is necessary for Z-ring
                     formation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapB"
                     /protein_id="WP_002208953.1"
                     /db_xref="GI:488137745"
                     /translation="MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLTQEVQDA
                     AGSREALVRENEQLKQEQHVWQDRLRALLGKMEEV"
     gene            complement(102190..104304)
                     /locus_tag="YPTB_RS00550"
                     /old_locus_tag="YPTB0090"
     CDS             complement(102190..104304)
                     /locus_tag="YPTB_RS00550"
                     /old_locus_tag="YPTB0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002230357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011191463.1"
                     /db_xref="GI:499504823"
                     /translation="MNDTHFNEIKNRLNFSFRRKVPQVLQTEAAECGLACLVMACRYH
                     GMDIDLFNLRQRFGISSHGATLALLINISAQLKFKTRALSLDLDELRQLKTPCILHWD
                     MSHFVVLVAVKGTRFIIHDPAFGRRTVSLSEMSQHFTGVALELWPDSEFTRQKSRTRL
                     SLLSLMRNISGLPGFLTKIFCLSLMVEAINLLLPVGTQLVMDHVIIAEDHDLLALICI
                     GLLFFILFRTFLSMLRSWTSLVMGSLVDVQWKAGLFDHLLKLPLAYFEKRKLGDIQSR
                     FGSLDIIRSTLTNNVVNGIIDGLMSIGVFIMMFLYGGWLVWVVLGFTAMYMILRLATY
                     NQYRQASEEQIVKNAKASSHFMETLYGISTLKALGLAATRSQFWLNLNIDTTNANIRL
                     TKLDMFFGGVNTLIGTIDQVVILWLGASMVIDGQMTLGMFVAFNAYRGQFSDRATNLI
                     NMVLQLRMLALHSERIADIVFTETEKEQTPRQLLSPNQPAVFEARNIAFQYDNLSKPI
                     FSDLNIHVEAGESVAITGPSGIGKTTLMKVIAGLLTPSQGHILIDGLDITTVGLNNYR
                     DCIACVLQDDKLFAGSIADNIASFDVNKDEQRILSCANHCNIHKEIMHMPMGYETLIS
                     ELGGSLSGGQKQRLLIARALYRQPSLLFLDEATSHLDLANEAHINNAIASLKITRIFI
                     AHRPSTIASAQRIINLEKQNVS"
     gene            complement(104297..105589)
                     /locus_tag="YPTB_RS00555"
                     /old_locus_tag="YPTB0091"
     CDS             complement(104297..105589)
                     /locus_tag="YPTB_RS00555"
                     /old_locus_tag="YPTB0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin V secretion protein CvaA"
                     /protein_id="WP_002208949.1"
                     /db_xref="GI:488137741"
                     /translation="MSSNQIFRRDAVEYIRTKWLGKALLTSGYSTTFIAALCAIFLVL
                     LITLIIYGTYTRRINVNGEVISQPHPINIFSPQQGFITKKWVEVGDIVRKGQHLYQID
                     VSRTTFSGNVSLNSLEAINNQLSQIDSIINNTQKNKELTLLNLRQQLAQYQKAHKKSQ
                     ELVDNAGKGMDDMRRTMASYGTYQRQGLITKDQLTNQRSLFYQQQNAFQSLNTQLIQE
                     SLQIAKLESEISTRASDFDNDISQYLFQKGDLKRQLAEVDASGMLLINSPSDGKIENM
                     SVTQGQMVNVNDSLVQLTPSDNPYYCLVLWVPNNSVPYINTGDKVNIRYDAFPFEKFG
                     QFPGRIISISNVPVSQQEIASYNIAPRLPNGGLIEPYYKVIVALDDIHFRYQSKPLML
                     SNGLKANVTLFLEKRPLYQWMLSPFYDIKKSVTGPVNE"
     gene            105802..106041
                     /locus_tag="YPTB_RS00560"
                     /old_locus_tag="YPTB0092"
     CDS             105802..106041
                     /locus_tag="YPTB_RS00560"
                     /old_locus_tag="YPTB0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002215873.1"
                     /db_xref="GI:488144665"
                     /translation="MKELTQTEVMEVSGAGIVSDAGKVLGSGFGALIDAGASIFGIKP
                     NASATIGKIGESIGSAFDAGISGVKQFFGLSAPQQ"
     gene            106216..106365
                     /locus_tag="YPTB_RS00565"
                     /old_locus_tag="YPTB0093"
     CDS             106216..106365
                     /locus_tag="YPTB_RS00565"
                     /old_locus_tag="YPTB0093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002208947.1"
                     /db_xref="GI:488137739"
                     /translation="MKIAYRTIRFINLWIYAVFYSEFFGFELSHYLSTADMIFFGDYE
                     FILYH"
     gene            106671..107255
                     /locus_tag="YPTB_RS00570"
                     /old_locus_tag="YPTB0094"
     CDS             106671..107255
                     /locus_tag="YPTB_RS00570"
                     /old_locus_tag="YPTB0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002228141.1"
                     /db_xref="GI:488156933"
                     /translation="MQRGCCFLRSTTTAGVALIVAMTLSVSAWAISEQAKSEQATTVP
                     NNDIVCHVAHLNARFDDKEGLFEGASQSGTLLILRNISARACQVNAMPVISFEGAVGQ
                     QLAVFRKVPRGMRQEPVLSPVTVAAGAEVAVQLRWVASDAFDGNNCVTPEKVVVTLLG
                     GTLRLPFGRQMCAASGDTEFFSQAPVGPATNEVQ"
     gene            complement(107372..107857)
                     /locus_tag="YPTB_RS00575"
                     /old_locus_tag="YPTB0095"
     CDS             complement(107372..107857)
                     /locus_tag="YPTB_RS00575"
                     /old_locus_tag="YPTB0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004704795.1"
                     /note="regulator of RNase E; increases half-life and
                     abundance of RNAs; interacts with RNase E possibly
                     inhibiting catalytic activity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of ribonuclease activity A"
                     /protein_id="WP_002208945.1"
                     /db_xref="GI:488137737"
                     /translation="MKYDTSDLCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFED
                     NGLLFDLLEENGLGRVLVVDGGGSVRRALINAELAELALKNEWEGIVVYGAVRQVDDL
                     AELDIGIQAMAAIPVGAADEGVGESDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDI
                     E"
     gene            complement(107999..108916)
                     /locus_tag="YPTB_RS00580"
                     /old_locus_tag="YPTB0096"
     CDS             complement(107999..108916)
                     /locus_tag="YPTB_RS00580"
                     /old_locus_tag="YPTB0096"
                     /EC_number="2.5.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208944.1"
                     /note="catalyzes the formation of dimethylmenaquinone from
                     1,4-dihydroxy-2-naphthoate and octaprenyl diphosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="WP_011191464.1"
                     /db_xref="GI:499504824"
                     /translation="MSLSINTSQTQAWLESLRPRTLPLAFASIVTGSALAVWLDSFKP
                     AVALLALLTAGLLQILSNLANDYGDAVKGSDTEERIGPLRGMQKGIISHQQMKVALII
                     TVILTIISGIALIAVACEKPSDILGFLLLGLMAIVAAITYTVGRKPYGYMGLGDISVL
                     VFFGWLSVAGTYYLQAGHFDSIVMLPATACGLLATAVLNINNLRDIENDKANGKNTLA
                     VRLGPVVARYYHALLISAAIFCLALFSILHLHSWHGWIFLLAIPLLGKHALFVLRDPT
                     AAGMRPMLEQMVKAALLTNILFAVGLVFS"
     gene            complement(109151..110482)
                     /gene="hslU"
                     /locus_tag="YPTB_RS00585"
                     /old_locus_tag="YPTB0097"
     CDS             complement(109151..110482)
                     /gene="hslU"
                     /locus_tag="YPTB_RS00585"
                     /old_locus_tag="YPTB0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004719530.1"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease ATPase subunit HslU"
                     /protein_id="WP_002208943.1"
                     /db_xref="GI:488137735"
                     /translation="MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEEL
                     RHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRD
                     LTDAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGVPDESQEPSATRQTFR
                     KKLREGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKI
                     KEALKLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREG
                     VQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQA
                     LTTDDFERILTEPSASLTEQYKALMATEGVTIEFTREGIRKIAEAAWQVNERTENIGA
                     RRLHTVLERLMEDISYDASESSGQSITIDAEYVGKHLDELVADEDLSRFIL"
     gene            complement(110553..111077)
                     /locus_tag="YPTB_RS00590"
                     /old_locus_tag="YPTB0098"
     CDS             complement(110553..111077)
                     /locus_tag="YPTB_RS00590"
                     /old_locus_tag="YPTB0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005279166.1"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease subunit HslV"
                     /protein_id="WP_002208942.1"
                     /db_xref="GI:488137734"
                     /translation="MTTIVSVRRDGHVVIGGDGQVTLGNTVMKGNAKKVRRLYNNKVI
                     AGFAGGTADAFTLFELFERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADET
                     ASLIITGNGDVVQPEDDLIAIGSGGPYAQSAARALLENTELGARDIVEKSLSIAGDIC
                     IYTNRFQTIEELTY"
     gene            complement(111177..112022)
                     /locus_tag="YPTB_RS00595"
                     /old_locus_tag="YPTB0099"
     CDS             complement(111177..112022)
                     /locus_tag="YPTB_RS00595"
                     /old_locus_tag="YPTB0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsN"
                     /protein_id="WP_002208941.1"
                     /db_xref="GI:488137733"
                     /translation="MAQRDYVSRGRSGARRKSTSRKKRSAPIVSKTVMALAVALLVVF
                     VGGLYFITHNKPGELPLLPNHDPRTGNGLPPKPEERWRYIKELENRQIGVPMPTEPSA
                     GGEVNAKTELTNEQRQLLEQMQADMRQQPTQLSEVPYNQGMQQVPRSAVTIKPPATSV
                     QPQPVTPPRQTTIPVQPQAPAPVRTPPAAPVTQAVTPPKVEKEKEKTQRWMVQCGSFK
                     AVDQAESIRAQLAFAGIESRITSGGGWNRVVLGPYNSKAAADKALQRLQGAGQSGCIP
                     LSVGG"
     gene            complement(112088..113116)
                     /locus_tag="YPTB_RS00600"
                     /old_locus_tag="YPTB0100"
     CDS             complement(112088..113116)
                     /locus_tag="YPTB_RS00600"
                     /old_locus_tag="YPTB0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002216730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002216730.1"
                     /db_xref="GI:488145522"
                     /translation="MENKKEFTMTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKV
                     EQAVLAVGYSPHALSRNIKRNESRTILVIVPDISDPFFADVIQGIEHAAAQQGYLILI
                     GDCAQQTQQERTFVNLIITKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELE
                     LPTVHIDNLTAAYEAVNYLHELGHKRIACIAGPESLPLSHYRLQGYIQALRRNGITVD
                     NDYIIRGDFSYEAGAQSFAALMELPHPPTAIFSHNDVMAVGAIWQAKQLGLRIPQDVS
                     LVGFDDLKLSQFCDPPLTTVAQPRYQIGQQAMLLLLEQLQGHSVQSGSRLLDTELIIR
                     ESTAAPKH"
     gene            complement(113239..113382)
                     /locus_tag="YPTB_RS00605"
     CDS             complement(113239..113382)
                     /locus_tag="YPTB_RS00605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002216732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosome assembly protein PriA"
                     /protein_id="WP_002216732.1"
                     /db_xref="GI:488145524"
                     /translation="MANPLQRQEKGVRPIFYCLIVTTKQSFTLLSASQFEKTYLRHIF
                     YAN"
     gene            complement(113469..115667)
                     /locus_tag="YPTB_RS00610"
                     /old_locus_tag="YPTB0101"
     CDS             complement(113469..115667)
                     /locus_tag="YPTB_RS00610"
                     /old_locus_tag="YPTB0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002356663.1"
                     /note="binding of PriA to forked DNA starts the assembly
                     of the primosome, also possesses 3'-5' helicase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosome assembly protein PriA"
                     /protein_id="WP_011191465.1"
                     /db_xref="GI:499504825"
                     /translation="MSVVQVALPVPLARTFDYRLDSAMACPVVGARVSVPFGKRKAIG
                     IVVGLSDTSTFPLEQLKTIDAILDNHSLFPPSLWRILCWATEYYHYPIGEVLFHALPI
                     LLRQGRPAQSAPLWQWFVTEQGRATPPESLKRAPKQQQALAALLQKPVYRHQVNEMAL
                     TESALQALRSKGLIDLRAQEATTTDWRHSFSVLGERLRLNTEQATAVGAIRSEDNQFA
                     AWLLAGVTGSGKTEVYLSVLENILAQGRQALILVPEIGLTPQTIARFRERFNAPVEVL
                     HSGLNDSERLSVWLRARSGEAAIVIGTRSALFTPFSRLGVIIIDEEHDSSYKQQEGWR
                     YHARDLAVFRAREEGIPIVMGTATPALETLHNVQMGKYRQLTLTKRAGSAKPAAQHLL
                     DLKGLPLKVGLSQPLLKRMKTHLQAGNQVILFLNRRGYAPALLCHECGWIAECQRCDH
                     YYTLHQNHRQLRCHHCDSQRPVPQQCPKCGSTHLVSVGVGTEQLENELAPLFPETPIT
                     RIDRDTTSRKGSLEQHLADVHQGGARILIGTQMLAKGHHFPDVTLVALLDVDGALFSA
                     DFRSAERFAQLYTQVSGRAGRAGKQGEVILQTHHPEHPLLQILLQQGYDAFAKQALEE
                     RKSVFLPPYTSHIIVRSEDHDNQQSALFLQQLRNLLEASPLKDEALWIMGPVPALQAK
                     RGGRFRWQLLLQHPSRQLLQRLIKTSQPLISTLPQARKVKWTIDVDPIDS"
     gene            115920..116135
                     /gene="rpmE"
                     /locus_tag="YPTB_RS00615"
                     /old_locus_tag="YPTB0102"
     CDS             115920..116135
                     /gene="rpmE"
                     /locus_tag="YPTB_RS00615"
                     /old_locus_tag="YPTB0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004704783.1"
                     /note="RpmE; there appears to be two types of ribosomal
                     proteins L31 in bacterial genomes; some contain a CxxC
                     motif while others do not; Bacillus subtilis has both
                     types; the proteins in this cluster have the CXXC motif;
                     RpmE is found in exponentially growing Bacilli while YtiA
                     was found after exponential growth; expression of ytiA is
                     controlled by a zinc-specific transcriptional repressor;
                     RpmE contains one zinc ion and a CxxC motif is responsible
                     for this binding; forms an RNP particle along with
                     proteins L5, L18, and L25 and 5S rRNA; found crosslinked
                     to L2 and L25 and EF-G; may be near the
                     peptidyltransferase site of the 50S ribosome; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="WP_002216737.1"
                     /db_xref="GI:488145529"
                     /translation="MKQGIHPKYEQVTASCSCGNVIKINSTVGHDLNLDVCGECHPFY
                     TGKQRDVASGGRVDRFNKRFSVPGAKK"
     gene            complement(116677..117132)
                     /locus_tag="YPTB_RS00620"
                     /old_locus_tag="YPTB0103"
     CDS             complement(116677..117132)
                     /locus_tag="YPTB_RS00620"
                     /old_locus_tag="YPTB0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002208936.1"
                     /db_xref="GI:488137728"
                     /translation="MNPNYAKPSAAFTAASWSALLGGFVIFLIGLWNADMQLNERGYY
                     FAVLILGLFSAVSLQKTVRDKLEGLAITSIYYGLCWVAFIVAVLLLCIGLWNATLALS
                     EKGFYGVTFFMTLFGAIAVQKNTRDSAMSSDTESASLFKKVRDQLKAED"
     gene            117183..117344
                     /locus_tag="YPTB_RS00625"
     CDS             117183..117344
                     /locus_tag="YPTB_RS00625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002216739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002216739.1"
                     /db_xref="GI:488145531"
                     /translation="MISNHLKTGYIPIIRSSKIIIDNMLFYRDIHGGMVCENILIQYV
                     DIAKTILEL"
     gene            complement(117481..117798)
                     /locus_tag="YPTB_RS00630"
                     /old_locus_tag="YPTB0104"
     CDS             complement(117481..117798)
                     /locus_tag="YPTB_RS00630"
                     /old_locus_tag="YPTB0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006708712.1"
                     /note="when combined with S-adenosylmethionine represses
                     the expression of the methionine regulon and of proteins
                     involved in S-adenosylmethionine synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="met repressor"
                     /protein_id="WP_004392248.1"
                     /db_xref="GI:490526974"
                     /translation="MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRR
                     QVNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDT
                     WEY"
     gene            118176..119336
                     /locus_tag="YPTB_RS00635"
                     /old_locus_tag="YPTB0105"
     CDS             118176..119336
                     /locus_tag="YPTB_RS00635"
                     /old_locus_tag="YPTB0105"
                     /EC_number="2.5.1.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191466.1"
                     /note="catalyzes the formation of cystathionine from
                     L-cysteine and O-succinyl-L-homoserine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="WP_011191466.1"
                     /db_xref="GI:499504826"
                     /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTH
                     DYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAIHLVCTTFLQPGDLLVAPHDCYG
                     GSYRLFDSLSKRGAYRVLFVDQGDEAALNRALAEKPKLVLIETPSNPLLRVVDIAAIC
                     QAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPEL
                     VVELAWWANNIGVTGAAFDSYLLLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLY
                     HPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALELFTLAESLGGVESLI
                     SHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQLAVTR"
     gene            119339..121774
                     /gene="metL"
                     /locus_tag="YPTB_RS00640"
                     /old_locus_tag="YPTB0106"
                     /gene_synonym="metM"
     CDS             119339..121774
                     /gene="metL"
                     /locus_tag="YPTB_RS00640"
                     /old_locus_tag="YPTB0106"
                     /gene_synonym="metM"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013649013.1"
                     /note="multifunctional homodimeric enzyme that catalyzes
                     the phosphorylation of aspartate to form
                     aspartyl-4-phosphate as well as conversion of aspartate
                     semialdehyde to homoserine; functions in a number of amino
                     acid biosynthetic pathways; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aspartate kinase II/homoserine
                     dehydrogenase II"
                     /protein_id="WP_002208934.1"
                     /db_xref="GI:488137726"
                     /translation="MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGD
                     LMVVSAAGSTTNQLISWLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISE
                     FIHDLERLAGLLDNKIDDVIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRA
                     ERAAQPQIDESRSYPLLQQLMAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQV
                     GALAGAERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQP
                     VSGSDIDLQLRCSYQPEQGSTRIERVLASGLGAKIVTSHDDVCLIELQIASHHDFSLA
                     QKEIDLLLKRAQIKPLATGIHPDRNLLQLCYTSEVVNSALRVLEDAALPGKLSLREGL
                     ALVALVGAGVSKNPLHSHRFYQQLKDQPVEFVWQAEDGISMVAVLRLGPTEHLIQGLH
                     QSLFRAEKRIGLMLFGKGNIGARWLELFAREQKSLSARSGFEFVLAGVVDSRRSLLSY
                     DGLDASRTLAFYNDEAKEQDEESLFLWMRAHPFDDLVVLDVTASPSLAEQYLDFASYG
                     FHVISANKLAGASSSNNYRQIRDAFAKTGRHWLYNATVGAGLPVNHTVRDLRDSGDSI
                     LAISGIFSGTLSWLFLQFDGSVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILA
                     REAGYDIEPNQVRVESLVPAGAESGSVDQFFENGEALNQQMIQRLEAAKEMGLVLRYV
                     ARFDANGKARVGVEAVRTDHPLASLLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAG
                     AIQSDLNRLSQLL"
     gene            122007..122891
                     /gene="metF"
                     /locus_tag="YPTB_RS00645"
                     /old_locus_tag="YPTB0107"
     CDS             122007..122891
                     /gene="metF"
                     /locus_tag="YPTB_RS00645"
                     /old_locus_tag="YPTB0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002208933.1"
                     /note="MTHFR; catalyzes NADH-linked reduction of
                     5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate
                     using FAD as a cofactor; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="WP_002208933.1"
                     /db_xref="GI:488137725"
                     /translation="MSFFHANQREALNQSLSELQGQINVSFEFFPPRTSEMEDTLWSS
                     IDRLSTLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASPTQLRDI
                     AIDYWNSGIRHIVALRGDLPPNSGKPEMYACDLVGLLKDVGDFDISVAAYPEIHPEAK
                     SAQADLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFK
                     QLQRFATMTNVRVPNWMTSIFDGLDNDPETRKMVGASVAMDMVKILSREGVKDFHFYT
                     LNRAELSYAICHTLGVRP"
     gene            122933..123115
                     /locus_tag="YPTB_RS00650"
     CDS             122933..123115
                     /locus_tag="YPTB_RS00650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011566322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041175434.1"
                     /db_xref="GI:752489414"
                     /translation="MVWWFGGLVLVIGFGCYGFTAHLASDEPTANGAISVAPLEPRAF
                     ALSLAHCVGSLDSSFR"
     gene            complement(123720..126356)
                     /locus_tag="YPTB_RS00655"
                     /old_locus_tag="YPTB0108"
     CDS             complement(123720..126356)
                     /locus_tag="YPTB_RS00655"
                     /old_locus_tag="YPTB0108"
                     /EC_number="4.1.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002231867.1"
                     /note="catalyzes the formation of oxaloacetate from
                     phosphoenolpyruvate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxylase"
                     /protein_id="WP_011191467.1"
                     /db_xref="GI:499504827"
                     /translation="MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILDRVETIRKLSKS
                     SRAGNEASRQELLTTLQNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPE
                     ALAQLFTRLKDKKLSDQDMRSAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQL
                     DHNDLADYERNKIMRRLRQLVAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPA
                     FLREFNEQLENSLDYRLPVEAVPIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATD
                     LFLRDIQVLVSELSMSECTPELRELAGGEEVLEPYRQLMKNVRTQLTNTQAYLEARLK
                     GERVLPPHDLLVSNDQLWEPLYACYQSLKACGMEIIANGQLLDTLRRVRCFGVPLVRI
                     DVRQESTRHTDAIAELTRYLGLGDYESWSESDKQAFLVRELNSKRPLVPLKWEPSAET
                     QEVLETCRVIAEAPQGSIAAYVISMAKVPSDVLAVHLLLKEAGCPFTLPVAPLFETLD
                     DLNNADDVMTQLLGIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYRAQDALIKT
                     CEKAGITLTLFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKFGLPE
                     VTISSLALYAGAILEANLLPPPEPKKEWIEVMDLLSDASCDMYRSYVRENPEFVRYFR
                     AATPELELGKLPLGSRPAKRRPDGGVESLRAIPWIFAWTQNRLMLPAWLGAGAGLQRA
                     IDAGKRDVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEYYDQRLVDKSLWPLGQQLR
                     DQLAADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNVLQAELLHRSRQQEHPD
                     ACVEQALMVTIAGVAAGMRNTG"
     gene            complement(126730..127893)
                     /locus_tag="YPTB_RS00660"
                     /old_locus_tag="YPTB0109"
     CDS             complement(126730..127893)
                     /locus_tag="YPTB_RS00660"
                     /old_locus_tag="YPTB0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002223919.1"
                     /note="catalyzes the formation of L-ornithine from
                     N(2)-acetyl-L-ornithine in arginine biosynthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine deacetylase"
                     /protein_id="WP_002223919.1"
                     /db_xref="GI:488152711"
                     /translation="MKLPPFIELYRALIATPSISAADSALDQSNEALINLLAGWFADL
                     GFRVEIQPVPDTRHKFNLLASIGENENGEGHGGLLLAGHTDTVPYDEGRWTRDPFTLT
                     EHDHKLYGLGTADMKGFFAFILDAVRDIDASKLTKPLYILATADEETTMAGARYFAAN
                     TQLRPDFAIIGEPTSLQPVRAHKGHISNAIRITGQSGHSSDPARGVNAIDLMHESITQ
                     LMALRTTLQERYHNPAFTIPYPTMNFGHINGGDAANRICACCELHMDIRPLPGLTLSD
                     LNELMTEALEPVSQRWPGRLSIDELHPPIPGYECPTDHHMVGVIEKLLGERTAVVNYC
                     TEAPFIQQVCPTLVLGPGSINQAHQPDEFIDMAFIEPTRELIGQLVDHFCQQK"
     gene            128144..129148
                     /locus_tag="YPTB_RS00665"
                     /old_locus_tag="YPTB0110"
     CDS             128144..129148
                     /locus_tag="YPTB_RS00665"
                     /old_locus_tag="YPTB0110"
                     /EC_number="1.2.1.38"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002231140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="n-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="WP_011191468.1"
                     /db_xref="GI:499504828"
                     /translation="MLNTLIVGASGYAGAELTAYLNRHPHMNITGLAVSAQSADAGKL
                     LSELHPQLKGILDLPLQPLVDVAQAAKGIDVVFLATAHEVSHDLAPQFLAAGCVVFDL
                     SGAFRVRDAAFYSQYYGFEHQHPDWLDKAVYGLAEWQSEDIKQAQLIAVPGCYPTASQ
                     LALKPLVDGQLLNDAQWPVINAVSGVSGAGRKASMGNSFCEVSLQPYGLFTHRHQPEI
                     VAHLGTPVIFTPHLGNFARGILATITCRLKAGVTAQNIADAYHHAYQNKPLVRLYQQG
                     VPALKAVVGLPFCDIGFSVQGEHLIIVATEDNLLKGAAAQAVQCMNIRFGFPETQSLL
                     "
     gene            129331..130104
                     /locus_tag="YPTB_RS00670"
                     /old_locus_tag="YPTB0111"
     CDS             129331..130104
                     /locus_tag="YPTB_RS00670"
                     /old_locus_tag="YPTB0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="WP_002209488.1"
                     /db_xref="GI:488138280"
                     /translation="MNPLVIKLGGVLLDSEEALERLFTALVTYREKHERPLVIMHGGG
                     CLVDELMKRLALPVVKKNGLRVTPADQIDIITGALAGTANKTLLAWAVKHQINAVGLC
                     LADGNTVTVTLLDAELGHVGKAQPGSAALVQTLLAAGYMPIISSIGITVEGQLMNVNA
                     DQAATALAATLGADLILLSDVSGILDGKGQRIAEMTAQKAEQLIAQGIITDGMVVKVN
                     AALDAARSLGRPVDIASWRHSEQLPALFNGVPIGTRISV"
     gene            130271..131644
                     /locus_tag="YPTB_RS00675"
                     /old_locus_tag="YPTB0112"
     CDS             130271..131644
                     /locus_tag="YPTB_RS00675"
                     /old_locus_tag="YPTB0112"
                     /EC_number="4.3.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005163844.1"
                     /note="catalyzes the formation of arginine from
                     (N-L-arginino)succinate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="WP_011191469.1"
                     /db_xref="GI:499504829"
                     /translation="MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKAL
                     VTVGVLNADEQQQLEQALSVLLEEVQANPHAILASDAEDIHSWVETKLIDKVGDLGKK
                     LHTGRSRNDQVATDLKLWCKFQITELQTAVQQLQQALVMTAEANQDAVMPGYTHLQRA
                     QPVTFAHWCLAYVEMLSRDESRLQDTLKRLDVSPLGCGALAGTAYAIDREQLAGWLGF
                     ASATRNSLDSVSDRDHVLELLSDASIGMVHLSRFAEDLIFFNSGEAAFVDLSDRVTSG
                     SSLMPQKKNPDALELIRGKCGRVQGALTGMTMTLKGLPLAYNKDMQEDKEGLFDALNT
                     WLDCLHMAALVLDGIQVKRPRCKEAAEQGYANATELADYLVAKGVPFREAHHIVGEAV
                     VEAIRQGKALEALALSDLQQFSSVIGDDVYPILALQSCLDKRVAKGGVSPQQVASAIA
                     EAKARLF"
     gene            complement(131807..131917)
                     /locus_tag="YPTB_RS00680"
     CDS             complement(131807..131917)
                     /locus_tag="YPTB_RS00680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032465932.1"
                     /db_xref="GI:694125337"
                     /translation="MIIIITEEYKLNSLLSLKDHKIENIEILRKIKAKKA"
     gene            132243..134735
                     /locus_tag="YPTB_RS00685"
                     /old_locus_tag="YPTB0113"
     CDS             132243..134735
                     /locus_tag="YPTB_RS00685"
                     /old_locus_tag="YPTB0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_011191470.1"
                     /db_xref="GI:499504830"
                     /translation="MDNIIRDKKTIISVNKITTCILFALVTQSYSGQLAANTATIPTN
                     NNDMALDKLNVEGKGNAHDSDWIYDEPRSVSEITREQLDNRPARHAADILEQTPGVYS
                     SVSQQDPGLSINIRGIQDYGRVNMNIDGMRQNFMKSGHGQRNGSMYIDPEILSNVVIE
                     RGIFNGIGGAGAIGGIATFNTINASDFLAPEKELGGHIRAMTGDNGTRFIGSGALALG
                     NPNGDILLAVSERNLKDYWPGNKGVLAGLRLYSPTRNVGDDLKNTKTLFTGYKMRSQL
                     AKVGWNFEAGQRLEFSYLQTQIASPNASMLSEVLALSPSGKEITKIGWRNTSFTNVEN
                     RNIALDYRLNPEHISWLDATAKIYYVDTNDETDNANSLFKEYFWTQTRLKTRGLQLQN
                     TNTFTPSDAHQIRLKYGLEWFSDKSEGYSTRKLIERTTPPGKRAITSTFAQLNYEYDD
                     WLRLEGGLRYDQFRLKGNTWLHTRSFLQPYTFENPCDRRIHEQSEKPGSRCSSRRPAT
                     MRWDVDRREQQLSPTLAMGVKPGLEWLEFFGSYGKSWRPPAMTEVLATGTAHGYSWVL
                     PNPFVAAERARTWEAGFNIQQSNLFIEDDHFAAKVAYFDTRIANYINLELGKAKPKFG
                     GDSFTDVAYVNNLLKTRFRGLEYQLSYDAGTFYTNINYTRMIGVNNVCSPYAWLGGLQ
                     SVKYKYVGKVEQIYAVENEVANNYVTCMNANVLFGSSAYLPGDRGSLTLGSRIFDRRL
                     DFGTVIRYNKGYQDRSAQDENGNPLTAYVADWPKYIVYDLYASYKVTNNLILRSSIEN
                     ITNRAYLVNYGDTLSFAPSRGRTIQGGFEYKF"
     gene            134963..135580
                     /locus_tag="YPTB_RS00690"
                     /old_locus_tag="YPTB0114"
     CDS             134963..135580
                     /locus_tag="YPTB_RS00690"
                     /old_locus_tag="YPTB0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme acquisition hemophore HasA"
                     /protein_id="WP_011191471.1"
                     /db_xref="GI:499504831"
                     /translation="MSTTIQYNSNYADYSISSYLREWANNFGDIDQAPAETKDRGSFS
                     GSSTLFSGTQYAIGSSHSNPEGMIAEGDLKYSFMPQHTFHGQIDTLQFGKDLATNAGG
                     PSAGKHLEKIDITFNELDLSGEFDSGKSMTENHQGDMHKSVRGLMKGNPDPMLEVMKA
                     KGINVDTAFKDLSIASQYPDSGYMSDAPMVDTVGVMDSNDMLLAA"
     gene            135746..137554
                     /locus_tag="YPTB_RS00695"
                     /old_locus_tag="YPTB0115"
     CDS             135746..137554
                     /locus_tag="YPTB_RS00695"
                     /old_locus_tag="YPTB0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012230143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_011191472.1"
                     /db_xref="GI:499504832"
                     /translation="MESCKTPGASSVPPTILSVLAGNKKILWGIGLFTAVINLLMLAP
                     AIYMLQVYDRVLASANTMTLLMLTVLVLGVFVFIGLLEWVRSAVVIRLGTQIDMQLNQ
                     PVFNAAFAANLKGHNTPAAQALNDLTVLRQFATGNALFAFFDAPWFPLYLLVIFLLHP
                     WLGMLAAAGAGILVVLAWLNQWICKKPLHDASIITSHATQQANANLRNADVIEAMGML
                     KALRERWLMQHANFLYQQNLASDKSSRVTAVAKSSRQALQSMMLGLGALLVIYNEITA
                     GVMIAGSILIGRVLGPIDQLIAVWKQWSHARLAYQRLSQLLAQHPSSPTGMVLPAPQG
                     KLNVTQLMACKPGTHIPVLHSINFELQPGDVLGILGPSGSGKSTLAKLLVASQPAFSG
                     TVRLDSADLSRWDKTQLGEFIGYLPQNIQLFRGTVAENIARFGAIDTAKVVAAAQLAD
                     VHDLILHLPQGYDTPLGDDGEGLSGGQRQRIALARAMYGIPRLIVLDEPNASLDKEGE
                     QALLASIIQLKQQGCTIVMITHKPELLSGSDYLLFLKNGQMDLFDRTQAVLQNIQGKD
                     KPAVQPEAKIRNSRSGWSNGVSYGIGPARTTSSPKP"
     gene            137630..138958
                     /locus_tag="YPTB_RS00700"
                     /old_locus_tag="YPTB0116"
     CDS             137630..138958
                     /locus_tag="YPTB_RS00700"
                     /old_locus_tag="YPTB0116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="WP_011191473.1"
                     /db_xref="GI:499504833"
                     /translation="MLPESACYSVANANRQPPLQINSGRYLNIGGGLVVIGFIGFLLW
                     AGLAPLDKGVAVTGLLVVAENRKVIQPLQGGRIQQLHVTEGDEIVSGQLLVTLDDTAI
                     RNQRDNLQHQYLSALAQEARLTAEQNDLDVITFPQALLEHATQPAVERNIILQQQLLH
                     HRRQAHLSEIARLSTQLTRHQARLDGLQAMRSNHQRQSNLFQQQLDSVQLLAKDGYIA
                     KNKLLEMESQLTSLQARVEQGTSDIAEAHKLIDETEQHVLQRREQYQSENSEQLAKAQ
                     QNTQELVQRLNIAEYELSHTRIFAPVSGSVIALAQHTVGGVVSSGQALMEIVPIGQPL
                     FVEAQLPVELIDKVAVGLPVDLNFSAFNQSNTPRLQGSVWRIGADRIQPPPTSPPYYP
                     LTVAIDLDPTELAIRPGMAVDVFIRTGERSLLSYLFKPFTDRLHLALAEE"
     gene            139023..139826
                     /locus_tag="YPTB_RS00705"
                     /old_locus_tag="YPTB0117"
     CDS             139023..139826
                     /locus_tag="YPTB_RS00705"
                     /old_locus_tag="YPTB0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter TonB"
                     /protein_id="WP_011191474.1"
                     /db_xref="GI:499504834"
                     /translation="MNRLQQSSEKLIFWLVGALLACGIHIYALWWLSTASIPAIPTSY
                     PAAIMMELSAEPEFMQNLPQNSVVGITQNIIEPAVEQRINQPDDIVDLPTLPEQPEGQ
                     REITRKEPIKVKRPAENRATSRKPVNKETQESDSKQSSPAAAASAMLSGTSQQVAAAV
                     NSDSSHRQQAQVSWKSRLQGHLMGFKRYPSSARKQQQQGTAMIRFVVDKNGYVSSVQL
                     SNSSGTSALDREALAIIKRAQPLPKPPAELLSQGQITLSLPVDFNLKRK"
     gene            complement(139942..141405)
                     /locus_tag="YPTB_RS00710"
                     /old_locus_tag="YPTB0118"
     CDS             complement(139942..141405)
                     /locus_tag="YPTB_RS00710"
                     /old_locus_tag="YPTB0118"
                     /EC_number="1.8.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209480.1"
                     /note="Catalyzes the oxidation of dihydrolipoamide to
                     lipoamide; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="WP_011191475.1"
                     /db_xref="GI:499504835"
                     /translation="MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCA
                     RVGCMPSKLLIAAAEAVHQIEKAPGFGIHPQGKPLINGREVMDRVKRERDRFVGFVLK
                     GVETIPAADKIQGYARFIDDNTLQVDDHTQLTSQKIIAQRIVIATGSHPSWPASWNEL
                     GDRLIINDDVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDS
                     IVRDYAAKTLGDEFYLDPDVKVELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRR
                     PNVDKLGLENTSLILDERGVPQADRLTMQTNVPHIFIAGDASNQLPLLHEASDQARIA
                     GVNAGGFPEVVPGLRRSPISVVFSDPQIAMVGATFRELAQKFSACGCFEIGEVSFENQ
                     GRSRVMLKNKGILRIYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTIDQMLDMP
                     FYHPVIEEGLRTALRDLQSKLKLGADEAERCLRCPGE"
     gene            complement(141499..142230)
                     /locus_tag="YPTB_RS00715"
                     /old_locus_tag="YPTB0119"
     CDS             complement(141499..142230)
                     /locus_tag="YPTB_RS00715"
                     /old_locus_tag="YPTB0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione amide-dependent peroxidase"
                     /protein_id="WP_002209479.1"
                     /db_xref="GI:488138271"
                     /translation="MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPG
                     AFTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVNDTFVMNAWKSDQHAENITFVPDG
                     NGEFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
                     KYLAPDFKVQESVAVFTKPGCPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGR
                     STVPQIFIGGRHIGGSDDLEKYLPA"
     gene            142377..143294
                     /locus_tag="YPTB_RS00720"
                     /old_locus_tag="YPTB0120"
     CDS             142377..143294
                     /locus_tag="YPTB_RS00720"
                     /old_locus_tag="YPTB0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191476.1"
                     /note="Activates the expression of a regulon of hydrogen
                     peroxide-inducible genes such as katG, gor, ahpC, ahpF,
                     oxyS, dps, fur and grxA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011191476.1"
                     /db_xref="GI:499504836"
                     /translation="MNIRDLEYLVALAEFRHFRRAADSCHVSQPTLSGQIRKLEDELG
                     IMLLERTSRKVLFTQAGLLLVEQAKTVLREVKVLKEMASLQGESMSGPLHIGLIPTVG
                     PYLLPQIIPMLHKTFPKLEMYLHEAQTQNLLAQLDSGKLDCAILALVKETEAFIEIPL
                     FDEPMNLAIYADHPWANRERVEMHELAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTH
                     FRATSLETLRNMVAAGSGITLLPALAVPNERQRDGVCYLECYKPVPKRTIALVYRPGS
                     PLRGRYEQLAEAIRDHMQERMASSLEQAI"
     gene            complement(143277..144677)
                     /locus_tag="YPTB_RS00725"
                     /old_locus_tag="YPTB0121"
     CDS             complement(143277..144677)
                     /locus_tag="YPTB_RS00725"
                     /old_locus_tag="YPTB0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017491068.1"
                     /note="catalyzes the conversion of NADPH to NADH; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="soluble pyridine nucleotide transhydrogenase"
                     /protein_id="WP_002209477.1"
                     /db_xref="GI:488138269"
                     /translation="MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGG
                     CTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARTIKSSFADILNHADRVINQQTRMRQ
                     GFYDRNHCHMFSGDASFIDANTVNVRYADGTSDTLQADNIVIATGSRPYRPVNVDFNH
                     ERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQE
                     MSDALSYHFWNNGVVIRHNEEFEQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTS
                     GLGLENIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLASAAYDQGRIAAQAMI
                     KGEANVHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMD
                     TGSLKILFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTLEYFVNTTFNYPTM
                     AEAYRVAALNGLNRLF"
     gene            144895..145530
                     /locus_tag="YPTB_RS00730"
                     /old_locus_tag="YPTB0122"
     CDS             144895..145530
                     /locus_tag="YPTB_RS00730"
                     /old_locus_tag="YPTB0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1CBU4.1"
                     /note="negatively controls the expression of fabA and
                     fabB, genes involved in the unsaturated fatty acid
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002209476.1"
                     /db_xref="GI:488138268"
                     /translation="MGVRAQQKERTRRSLIEAAFSQLSAERSFASLSLREVSREAGIA
                     PTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGNN
                     PNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLELENHMPRSFTEAQAEAMVTI
                     VFSAGAEVLDVDIEQRRQLEERLVLQLRMISKGAYYWYRREQEKLAASRVE"
     gene            145543..145950
                     /locus_tag="YPTB_RS00735"
                     /old_locus_tag="YPTB0123"
     CDS             145543..145950
                     /locus_tag="YPTB_RS00735"
                     /old_locus_tag="YPTB0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002209475.1"
                     /db_xref="GI:488138267"
                     /translation="MEQSSRRETGTLLLALITGLAINGVCAALFSALVPFSVFPLLTL
                     ILAVYCLHQRYLNFAMPQGIPVLASACFLLGILLYSAIVRVEYPAIGSNFVPAVLSVV
                     LVFWILFKLRTRKSVQTHTDADIDINNSDQPQQ"
     gene            complement(146084..147187)
                     /locus_tag="YPTB_RS00740"
                     /old_locus_tag="YPTB0124"
     CDS             complement(146084..147187)
                     /locus_tag="YPTB_RS00740"
                     /old_locus_tag="YPTB0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAA0.1"
                     /note="catalyzes the formation of 5-methyl-uridine at
                     position 54 in all tRNAs; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA/tmRNA (uracil-C(5))-methyltransferase"
                     /protein_id="WP_002209474.1"
                     /db_xref="GI:488138266"
                     /translation="MTPNILPIESYDHQLAEKSARLKAMMLPFQAPEPEIFRSPADHY
                     RMRAEFRVWHDEDDLYHIMFDQQTKQRIRVEQFPVASRLINRLMDALMTAIRAEPLLR
                     RKLFQIDYLSTLSGKLIASLLYHRQLDEEWQQKALELRDQLRAQGFDLQLIGRAAKTK
                     IMLDHDYIDEVLPVAGREMIYRQVENSFTQPNAAVNIHMLEWALDVTQGATGDLLELY
                     CGNGNFSLALARNFERVLATEIAKPSVAAAQYNIAANNIDNVQIIRMSAEEFTQAMQG
                     VREFNRLKGIDLGSYNCETIFVDPPRSGLDHETVKLVQAYPRILYISCNPETLCANLE
                     QLQHTHKISRLALFDQFPYTHHMECGVLLEKRH"
     gene            147186..147431
                     /locus_tag="YPTB_RS00745"
     CDS             147186..147431
                     /locus_tag="YPTB_RS00745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032465927.1"
                     /db_xref="GI:694125332"
                     /translation="MFFSLGQYKRGMILADCRESCPDVQFCRVYSGVDQWKSRHLFYL
                     IVALWSGLMLLFKHLRVKRESGVNPELTRSGKGKSRR"
     misc_binding    147318..147580
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            147319..147579
                     /locus_tag="YPTB_RS00015"
     misc_RNA        147319..147579
                     /locus_tag="YPTB_RS00015"
                     /product="Cobalamin riboswitch"
     gene            147667..149541
                     /gene="btuB"
                     /locus_tag="YPTB_RS00750"
                     /old_locus_tag="YPTB0125"
     CDS             147667..149541
                     /gene="btuB"
                     /locus_tag="YPTB_RS00750"
                     /old_locus_tag="YPTB0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66G57.1"
                     /note="involved in the active translocation of vitamin B12
                     (cyanocobalamin) across the outer membrane to the
                     periplasmic space; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="vitamin B12 transporter BtuB"
                     /protein_id="WP_024063655.1"
                     /db_xref="GI:568135543"
                     /translation="MTIKKYTLLTALSVTAFSGWAQGNNTTDNNNEMVVTANRFPQPK
                     SSVLAPVDVVTRADIDRWQSTNINDVLRRLPGINIAQYGGPRQLSSLFIRGTNSSHVL
                     VLVDGVRLNQAGISGSSDLSQIPISLVQRIEYIRGPRSAVYGSDAIGGVVNIITERET
                     LGSTLTAGLGSNGYQNYNGSTQQKLGDDTTITLAGNYDYSKGYDVVAKGNTGMASQPD
                     RDGYLGKMLWLGANHKFNEQFSGFVRGYGFDNRSDYDSYYYPGSPLVDTRSLSSRTYD
                     TGINFSNGGYASQLIGSYSRTQDYNYDPSYGRYDQSATLDDISQYNLQWTNTYQLGLG
                     NVGGGLDWQKQTTEPGTNYLSNGYEQRNTGVYGTVQQFVGPVTLEGAIRGDDNSQFGW
                     HTTWQSSAGWEFVDGYRLIGSYGTAFKAPNLGQIYSSTYGNRDLKPEESTQWEAAITG
                     ITGPLDWRLSAYRNDIDQMIATRGVYPNSRYYNVEKATIKGVEWTGSFETGPLSHQVT
                     LEYLDPRNADTHEILARRAKQQVKYQLDWQMADLDWSVTYQYIGQRYDSVFDPITYAA
                     SPVKLAGISLWDLAVSYPVTSHLTVRGRIANLFDKDYEMVYGYQTPGREYYFTGSYNF
                     "
     gene            149486..150349
                     /locus_tag="YPTB_RS00755"
                     /old_locus_tag="YPTB0126"
     CDS             149486..150349
                     /locus_tag="YPTB_RS00755"
                     /old_locus_tag="YPTB0126"
                     /EC_number="5.1.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002430140.1"
                     /note="converts L-glutamate to D-glutamate, a component of
                     peptidoglycan; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="WP_011191478.1"
                     /db_xref="GI:499504838"
                     /translation="MATKPQDANTTSREAITSKADSPPRPTALIFDSGVGGLSVYQEI
                     RQLLPNLHYIYAFDNVAFPYGEKSGEFIVERVLEIVTAVQQSHPLAIVVIACNTASTV
                     SLPALRERFAFPVVGVVPAIKPAVRLTRNGVVGLLATRATVHASYTLDLIARFATDCK
                     IELLGSSELVEVAETKLHGGVVPLEVLKKILHPWLSMREPPDTIVLGCTHFPLLTEEL
                     AQVLPEGTRMVDSGAAIARRTAWLISSQENVISSQDENIAYCMALDEDTDALLPVLQS
                     YGFPKLQKLPI"
     gene            complement(150615..150800)
                     /locus_tag="YPTB_RS00760"
     CDS             complement(150615..150800)
                     /locus_tag="YPTB_RS00760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002218887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002228331.1"
                     /db_xref="GI:488157123"
                     /translation="MFDLLTFTCVKAAVLKDYFLQICILTEVKMFTALVTLQDLILFL
                     PAETGVDIVLRVPTQIV"
     gene            150803..152351
                     /locus_tag="YPTB_RS00765"
                     /old_locus_tag="YPTB_RNA_96"
     rRNA            150803..152351
                     /locus_tag="YPTB_RS00765"
                     /old_locus_tag="YPTB_RNA_96"
                     /product="16S ribosomal RNA"
     gene            152485..152560
                     /locus_tag="YPTB_RS00770"
                     /old_locus_tag="YPTB_RNA_2"
     tRNA            152485..152560
                     /locus_tag="YPTB_RS00770"
                     /old_locus_tag="YPTB_RNA_2"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:152519..152521,aa:Glu,seq:ttc)
     gene            152804..155737
                     /locus_tag="YPTB_RS00775"
                     /old_locus_tag="YPTB_RNA_97"
     rRNA            152804..155737
                     /locus_tag="YPTB_RS00775"
                     /old_locus_tag="YPTB_RNA_97"
                     /product="23S ribosomal RNA"
     gene            155830..155945
                     /locus_tag="YPTB_RS00780"
                     /old_locus_tag="YPTB_RNA_98"
     rRNA            155830..155945
                     /locus_tag="YPTB_RS00780"
                     /old_locus_tag="YPTB_RNA_98"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            156071..156147
                     /locus_tag="YPTB_RS00785"
                     /old_locus_tag="YPTB_RNA_3"
     tRNA            156071..156147
                     /locus_tag="YPTB_RS00785"
                     /old_locus_tag="YPTB_RNA_3"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:156105..156107,aa:Asp,seq:gtc)
     gene            156156..156231
                     /locus_tag="YPTB_RS00790"
                     /old_locus_tag="YPTB_RNA_4"
     tRNA            156156..156231
                     /locus_tag="YPTB_RS00790"
                     /old_locus_tag="YPTB_RNA_4"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:156189..156191,aa:Trp,seq:cca)
     gene            157214..158170
                     /locus_tag="YPTB_RS00795"
                     /old_locus_tag="YPTB0127"
     CDS             157214..158170
                     /locus_tag="YPTB_RS00795"
                     /old_locus_tag="YPTB0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_011191479.1"
                     /db_xref="GI:499504839"
                     /translation="MYRRLLLAAAVTAAMCSAVQAAPLVVGFSQIGSESGWRSAETKV
                     AKQEAEKRGITLKIADAQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWTPVLQEAKE
                     AKIPVFLLDRMIEVNDPSLYTAAVASDSVYEGKVAGEWLLQDVVGKPCNVVELQGTVG
                     SSVAINRKKGFADGIASAPGVKIIRSQSGDFTRSKGKEVMESFIKAEQNGKNICAVYA
                     HNDDMAIGAIQAIKEAGLKPGSDIKIVSIDGVPDIFKAMSSGEANATVELTPNMAGPA
                     LDALIVLKKDGTQPPKFIQTESRLLQPDTAKQEYELKKSLGY"
     gene            158256..159746
                     /locus_tag="YPTB_RS00800"
                     /old_locus_tag="YPTB0128"
     CDS             158256..159746
                     /locus_tag="YPTB_RS00800"
                     /old_locus_tag="YPTB0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_011191480.1"
                     /db_xref="GI:499504840"
                     /translation="MEILLEVRGLSVEFPGVKALDSVDFSLQRGEVVALLGENGAGKS
                     TLIKALTGVYKRSAGEVLLDGKAVCPIDTADAQLMGIGTVYQEVNLLPNISVAANLFI
                     GREPLRWGLIDHNKMNQQAAKLLTGYGLTLDVQQPLANFSIAIQQIVAIARAVDLSAK
                     VLILDEPTASLDAKEVSMLLDILCQLRDQGIGMVFVTHFLDQVYRISDRITVLRNGKL
                     VGTKTVAELPRIELVQMMLGHSFDEQLLKRGEHSITNKNPLVEFKNYGRRGVVENFDL
                     SVSPGEIVGLAGLLGSGRTETAQLIFGITTPDTGEAKIQGKPVKIRTPRKASKFGFGY
                     CPEDRKTEGIVGAATVRENIILALQAQRGWLRPLSMREQTQIADDFIQQLGIRTPSPE
                     QQIQYLSGGNQQKVLLARWLATKPRFLILDEPTRGIDVGAHAEIIRLIEKLCDEGLAL
                     LIISSELEELAGYADRVIVLRDRRHVAQLDHDEISVPAIMQAIAVQ"
     gene            159779..160777
                     /locus_tag="YPTB_RS00805"
                     /old_locus_tag="YPTB0129"
     CDS             159779..160777
                     /locus_tag="YPTB_RS00805"
                     /old_locus_tag="YPTB0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002401546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_002220992.1"
                     /db_xref="GI:488149784"
                     /translation="MTQRPRKVKWVLPKGATQFGALAVILLIDSLVAPHFFSIHIQDG
                     RLFGSIIDILNRGAPVALLALGMTLVIATGGIDLSVGAVMAIAGATAATLTSAGYPFM
                     TVLALSLAVGALCGLWNGFLVAVLQIQPIVATLMLMVAGRGIAQLITEGQIVTFDSGG
                     LATLGSSTLMYLPMSVVIACSMLILVWLLTRKTALGLFIESVGINLRSARNAGVSTRL
                     VLIAVYVICGVCAAVAGIIVTADIRGADANNAGLWLELDAILAVVIGGASLMGGRFNL
                     LLSVIGALIIQGMNTGILLSGYQPEFNLVLKAIVVLAVLVVQSPMISLSHLFQRRK"
     gene            160777..161769
                     /locus_tag="YPTB_RS00810"
                     /old_locus_tag="YPTB0130"
     CDS             160777..161769
                     /locus_tag="YPTB_RS00810"
                     /old_locus_tag="YPTB0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212021.1"
                     /note="membrane component of a putative sugar ABC
                     transporter system; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002212021.1"
                     /db_xref="GI:488140813"
                     /translation="MLKRNVPLLITIAVFILGYAFCLSQFPSFSSSRVWCDLLTDNAF
                     LGIVAVGMTFVILSGGIDLSVGSVIAFTGVLLAKLIGTYGIHPVYAFAIVLVMGAMFG
                     ALMGWIIDSLKLPAFIITLAGMFFIRGMSFIVSEESLPINHPIYETLANYAWRVPGGG
                     RFTLLAFIMLMVVAFGILLAHHTRFGHNVYAIGGNSVSAGLMGVPVRRTTIKIYMLSS
                     TLAALSGIVFSLYTSAGYALAASGVELDAIAAVVIGGTLLAGGIGTVFGTLFGVLIQG
                     LIQSYITFDGTLSSWWTKIVIGILLFSFIVIQKAMSAFYLNRRSRPQSSPLTPV"
     gene            complement(161756..162637)
                     /locus_tag="YPTB_RS00815"
                     /old_locus_tag="YPTB0131"
     CDS             complement(161756..162637)
                     /locus_tag="YPTB_RS00815"
                     /old_locus_tag="YPTB0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAA7.1"
                     /note="Negatively regulates the transcription of the
                     flagellar master operon flhDC by binding to the upstream
                     region of the operon; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002212020.1"
                     /db_xref="GI:488140812"
                     /translation="MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLG
                     ANLFTRHRNNIRLTPAGERLVPYAEMLLNTWRLAKKEVIHSLQHTELSIGATASLWEA
                     YLTPWLQQLYEQQEELRLEARIALRNSLVKQLHERQLDLLITTEPPKMDELACLLLGH
                     FSLRLYSSFSLDLPKEDDTPNEHKNASEVPYIKLEWGADFHQQENRLLDSEQAPILTT
                     TSAHLTRQLLETTGGCAFLPEHWQKEYPQLVIHPDIPPIVRPLYAVWLQNSDQQALIR
                     QLLKTPMNNATQSVTRE"
     gene            162756..163094
                     /locus_tag="YPTB_RS00820"
                     /old_locus_tag="YPTB0132"
     CDS             162756..163094
                     /locus_tag="YPTB_RS00820"
                     /old_locus_tag="YPTB0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004714216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002212019.1"
                     /db_xref="GI:488140811"
                     /translation="MADSFITTNRFFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNE
                     LDSGKREPVTEEEQRFVAVCRGEREPVSAEEKVWSKYVIRTRQPKRFHTLSGGKPQMD
                     AVEDYTDSDD"
     gene            complement(163475..164998)
                     /locus_tag="YPTB_RS00825"
                     /old_locus_tag="YPTB0133"
     CDS             complement(163475..164998)
                     /locus_tag="YPTB_RS00825"
                     /old_locus_tag="YPTB0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212018.1"
                     /note="among the AAA+ ATPases, the YifB protease family
                     belongs to the Helix 2 insert clade; unknown function;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011191481.1"
                     /db_xref="GI:499504841"
                     /translation="MSLATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKE
                     ARDRVRSALINSGFNFPAKRITVSLAPADLPKEGGRYDLPIALAILAASEQIPADKLA
                     HYEFLGELALSGALRRVSGAIPAALACSEANRQLILPTANGLEIGLIPQGNSWVADHL
                     LAVCGFLQGENPLAQGQPFEPAPSPDNHLDLHDIIGQSQAKRALEIAAAGGHNLLLLG
                     PPGTGKTMLATRLTGLLPPLTDQEALEAAAITGLLHSNALPTQWRCRAFRAPHHSASM
                     AALIGGGSIPRPGEISLAHNGVLFLDELPEFERRVLDSLREPLESGEIIISRAAAKIC
                     FPAKVQLIAAMNPSPSGHYQGVHNRTPPQQILRYLAKLSGPFLDRFDLSIEVPLLPAG
                     MLGAQKNQGESSATVKQRVLQARQRQMDRAGKINTQLTSQEVAEFCYLAPEDAAFLEQ
                     VLLTLGLSVRAWHHILKVARTIADLAQEKTIQKSHLSEALSYRCMDRLLLQLHKSLM"
     gene            165622..167268
                     /locus_tag="YPTB_RS00830"
                     /old_locus_tag="YPTB0134"
     CDS             165622..167268
                     /locus_tag="YPTB_RS00830"
                     /old_locus_tag="YPTB0134"
                     /EC_number="2.2.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212017.1"
                     /note="catalyzes the formation of 2-acetolactate from
                     pyruvate; also known as acetolactate synthase large
                     subunit; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase"
                     /protein_id="WP_011191482.1"
                     /db_xref="GI:499504842"
                     /translation="MNGAQWVVQALRAQGVDTVFGYPGGAIMPVYDALYDGGVEHLLC
                     RHEQGAAIAAIGYARATGKVGVCIATSGPGATNLITGLADALLDSVPVIAITGQVGSA
                     LIGTDAFQEIDVLGLSLACTKHSFLVESLDALPEIMAEAFAIATSGRPGPVLIDIPKD
                     IQLAVGELTPHLKPVEEHSVDSAAELQHAWDMLANAQKPMLYVGGGVGMAQAVPALRD
                     FIAMTGIPAVATLKGLGAPDIAHPCYLGMLGMHGTKAANFAVQDCDLLVAVGARFDDR
                     VTGKLNTFASKAKVIHMDIDPAELGKLRQVHVALQGNLNVLLPALQQPLNIQPWRDEV
                     MALKQQHHWRYDHPGQAIYAPLLLKQISERKAPETVVTTDVGQHQMWTAQHMNFTRPE
                     NFITSSGLGTMGFGVPAAVGAQMARPDDMVICVSGDGSFMMNVQELGTIKRKQLPLKI
                     VLLDNQRLGMVRQWQQLFFDGRYSETNLSDNPDFITLASAFDIPGQRITRKDQVDAAL
                     DALFNSEGPYLLQVSIDELENVWPLVPPGAGNETMLEKIS"
     gene            167265..167522
                     /gene="ilvM"
                     /locus_tag="YPTB_RS00835"
                     /old_locus_tag="YPTB0135"
     CDS             167265..167522
                     /gene="ilvM"
                     /locus_tag="YPTB_RS00835"
                     /old_locus_tag="YPTB0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase"
                     /protein_id="WP_002212016.1"
                     /db_xref="GI:488140808"
                     /translation="MIQHQLSIQARFRPEMLERVLRVVRHRGFQVCAMNMSPMIDAGN
                     VNIELTVASQRPVDLLSSQLSKLMDVACVEILQPNTLQIRA"
     gene            167545..168471
                     /locus_tag="YPTB_RS00840"
                     /old_locus_tag="YPTB0136"
     CDS             167545..168471
                     /locus_tag="YPTB_RS00840"
                     /old_locus_tag="YPTB0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="WP_002212015.1"
                     /db_xref="GI:488140807"
                     /translation="MTKKADYIWFNGEMVPWAEAKVHVMSHALHYGTSVFEGVRCYES
                     HKGPVVFRHREHMQRLHDSAKIYRMPVSQSVDELMEACRATLRKNNLTSAYIRPLVFI
                     GDVGMGVNPPEGYNTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRVAPNTIPTAAKA
                     GGNYLSSLLVGSEARRHGYQEGIALDVHGYLSEGAGENLFEVKDGILFTPPFTSSALP
                     GITRDAIIKLAKDMGLEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGIGK
                     RGPVTAKIQQAFFGLFTGETEDKWGWLDQVNP"
     gene            168782..170632
                     /locus_tag="YPTB_RS00845"
                     /old_locus_tag="YPTB0137"
     CDS             168782..170632
                     /locus_tag="YPTB_RS00845"
                     /old_locus_tag="YPTB0137"
                     /EC_number="4.2.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004877656.1"
                     /note="catalyzes the dehydration of
                     2,3-dihydroxy-3-methylbutanoate to 3-methyl-2-oxobutanoate
                     in valine and isoleucine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="WP_011191483.1"
                     /db_xref="GI:499504843"
                     /translation="MPKYRSHTTTHGRNMAGARALWRATGMTDDDFGKPIIAVVNSFT
                     QFVPGHVHLRDLGKLVAEQIVASGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIAD
                     SVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDKII
                     KLDLIDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTANSMNCLNEALGLALPGN
                     GSLLATHADRKQLFLDAGKYIVALTKRYYEQDDVSALPRNIANKAAFENAMILDIAMG
                     GSTNTVLHLLAAAQEGEIDFSMTDIDRLSRKVPHLCKVAPSTQKYHMEDVHRAGGVIG
                     ILGELDRAGLLNRDVSNVLGLNLTQTLEAYDVMLTQDEGVKQMYAAGPAGIRTTKAFS
                     QDCRYPSLDTDREEGCIRTREHAYSQDGGLAVLYGNIAADGCIVKTAGVDKDSLTFRG
                     PAKVFESQDEAVEAILGGKVVAGDVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSC
                     ALLTDGRFSGGTSGLSIGHVSPEAASGGLIGLVQDGDFINIDIPNRGIVLDVSEAELA
                     ARRETEEAHGDAAWSPKGRERQVSYALRAYAMLATSADKGAVRDKSKLGG"
     gene            170638..172182
                     /locus_tag="YPTB_RS00850"
                     /old_locus_tag="YPTB0138"
     CDS             170638..172182
                     /locus_tag="YPTB_RS00850"
                     /old_locus_tag="YPTB0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019084367.1"
                     /note="threonine deaminase; threonine dehydratase; in
                     Escherichia coli, IlvA is part of the isoleucine
                     biosynthetic pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase"
                     /protein_id="WP_002212013.1"
                     /db_xref="GI:488140805"
                     /translation="MAVSQPLSAAPCGAEYLRAILRAPVYEVAQVTPLQVMEKISSRV
                     GNTVLVKREDRQPVHSFKLRGAYAMISSLTEEQKACGVVTASAGNHAQGVALSAHKMG
                     IKALIVMPVATADIKVDAVRAFGGEVLLFGANFDEAKTKAIALAQEQGYTFVPPFDHP
                     AVIAGQGTLAMELLQQDAHLDRVFVPVGGGGLVAGVAVLIKQLMPQIKVIGVEAEDSA
                     CLRAALDAGQPVDLARVGLFAEGVAVKRIGDEPFRLCQEYLDDVITVDSDAICAAVKD
                     LFEDVRAIAEPSGALALAGLKKYVQQHNIQGERLAHVLSGANVNFHGLRYVSERCELG
                     EQREALLAVTIPEQKGSFLRFCELLGGRSVTEFNYRYADAENACIFVGVRLTRGYAER
                     VEILAELQDKGYQVVDLSDDEMAKLHVRYMVGGRPSKPLRERLFSFEFPESPGALLKF
                     LHTLGTHWNISLFHYRSHGTDFGRVLAAFELSATEPQFEERLAALGYYCHDETDNPAF
                     KFFLAG"
     gene            complement(172313..172777)
                     /locus_tag="YPTB_RS00855"
                     /old_locus_tag="YPTB0139"
     CDS             complement(172313..172777)
                     /locus_tag="YPTB_RS00855"
                     /old_locus_tag="YPTB0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191484.1"
                     /db_xref="GI:499504844"
                     /translation="MKVKNKKNLCALLLIGSVLLGYFFWLSRHPVEIISVHQRNNYSD
                     ILVRNFPFTEKGKINWWLENRDMLKAKYSIPKPASDGFYTIIFWDFGDGYKEEGKYDR
                     LCFSDMNTTKNCIEKEKYMTIYKIKNDEPLFSFDGNRYFLNENNKIVKMKRE"
     gene            complement(172795..173259)
                     /locus_tag="YPTB_RS00860"
                     /old_locus_tag="YPTB0140"
     CDS             complement(172795..173259)
                     /locus_tag="YPTB_RS00860"
                     /old_locus_tag="YPTB0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191485.1"
                     /db_xref="GI:499504845"
                     /translation="MKAKSKKIICALLLLGSILLGYFFWLSLRPVEIVAIHKDGNFSA
                     VLVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITFWDFGEGYKEEGKYDR
                     RCFEDMKTDKNCIDKKSVFSVRRINNDRILFITYEGRYSLNDNGEIIKIKRK"
     gene            complement(173339..173800)
                     /locus_tag="YPTB_RS00865"
                     /old_locus_tag="YPTB0141"
     CDS             complement(173339..173800)
                     /locus_tag="YPTB_RS00865"
                     /old_locus_tag="YPTB0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002230571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002212010.1"
                     /db_xref="GI:488140802"
                     /translation="MKAKSKKTLYALLLIGSVLLGYFFWLSLRPVEIVAVHKDRNFSA
                     VLVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEEGKYDR
                     RCFEDMKTSKNCIDKNSLMIIRNSQYNVMSFTLDSGIYQLKNGEIVKMKHE"
     gene            complement(173784..174662)
                     /locus_tag="YPTB_RS00870"
                     /old_locus_tag="YPTB0142"
     CDS             complement(173784..174662)
                     /locus_tag="YPTB_RS00870"
                     /old_locus_tag="YPTB0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012229054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002228241.1"
                     /db_xref="GI:488157033"
                     /translation="MLETTKSTVQALYFPCTVFKTQKRMDDYGADDMRCGDLSATQLK
                     TDFNLHNISSKVNPYTLTLFQQLKPMPYGYAYDKNPESKKITRQECVRILFNEFRHES
                     RSFAFYGPYKHLIEKMIDHMQNGNGTPFRDLSLDAALKEQILSDYTEKNSTRLLLRKV
                     LNENIDWRNKLYPAEKKDDIRKFILDGRLPKFDRFQDNFNGMGITVHDTWATDITIKS
                     LQIDNDRYRAMVHYKIQDHFGLDNNDIKNTKFNRFHFFRIWFVLQRFNQFGFKPFMTN
                     MEATIEITGGRNESKK"
     gene            175310..175519
                     /locus_tag="YPTB_RS00875"
                     /old_locus_tag="YPTB0143"
     CDS             175310..175519
                     /locus_tag="YPTB_RS00875"
                     /old_locus_tag="YPTB0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002212009.1"
                     /db_xref="GI:488140801"
                     /translation="MEDNGAVAKETIEGTVGYIGDDISLLTSAMNNFSSQVSEQVSML
                     GAIQSNVTGSIAMISCYSIGRVIAA"
     gene            complement(175574..176455)
                     /locus_tag="YPTB_RS00880"
                     /old_locus_tag="YPTB0144"
     CDS             complement(175574..176455)
                     /locus_tag="YPTB_RS00880"
                     /old_locus_tag="YPTB0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011055242.1"
                     /note="participates in controlling several genes involved
                     in isoleucine and valine biosynthesis; activates the
                     transcription of the ilvC gene in the presence of
                     acetolactate or acetohydroxybutyrate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002212008.1"
                     /db_xref="GI:488140800"
                     /translation="MDLRDLKVFLHLAESRHFGRSAKAMHVSPSTLSRQIQRLEETIG
                     QPLFLRDNRTVQLTDAGNQLKAFAQQTLLQYQQLLHALGQHGPSLSGELRLFCSVTAA
                     YSHLPPILDRFRARHPLVEIKLTTGDAADAVNKVQSNEADLGIAGRPEVLPTSVAFTQ
                     IGEIPLVLIAPALPCAVRSQVAVEKPDWAMIPFILPEHGPSRKRIDLWFRRQRITNPL
                     IYATVSGHEAIVSMVALGCGVALIPSVVVDNSPEPVRNRISLLDDVSLVEPFELGVCV
                     PKKRLQEPLIDAFWGLL"
     gene            176746..178224
                     /locus_tag="YPTB_RS00885"
                     /old_locus_tag="YPTB0145"
     CDS             176746..178224
                     /locus_tag="YPTB_RS00885"
                     /old_locus_tag="YPTB0145"
                     /EC_number="1.1.1.86"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009111017.1"
                     /note="catalyzes the formation of
                     (R)-2,3-dihydroxy-3-methylbutanoate from
                     (S)-2-hydroxy-2-methyl-3-oxobutanoate in valine and
                     isoleucine biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="WP_011191486.1"
                     /db_xref="GI:499504846"
                     /translation="MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVG
                     CGAQGLNQGLNMRDSGLDVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLV
                     VNLTPDKQHSAVVKAVQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTE
                     VREEYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDL
                     MGEQTILCGMLQAGSLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDR
                     LSNPAKLRAYALSEQLKEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREET
                     GRTAFENAPQFEGKISEQEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLH
                     ELPLIANTIARKRLYEMNVVISDTAEYGNYLFANAAVPLLKEKFMDSLQAGDLGKSIP
                     GSAVDNAQLRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG"
     gene            178405..178605
                     /locus_tag="YPTB_RS00890"
     CDS             178405..178605
                     /locus_tag="YPTB_RS00890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002212006.1"
                     /db_xref="GI:488140798"
                     /translation="MLYYEPEFLGSLRQEAYNTYEIAKTEREVAERNRVQKKPFGLFI
                     EEMTLQKTLTDSQVAETAAHII"
     gene            178813..180249
                     /locus_tag="YPTB_RS00895"
     CDS             178813..180249
                     /locus_tag="YPTB_RS00895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin"
                     /protein_id="WP_041175435.1"
                     /db_xref="GI:752489415"
                     /translation="MQQQRVNADLETAKITEPQRVENARLTAEAAEKAARDRRISEEI
                     AATEAKRQRMENERLAEQERQRVEGTKQQVSEASCAQQASAWQNRFTLPALQPSGSAQ
                     YSFAASGMSAVGEAAELHNSFLAAQEQLSAIATISASGSVAAMIALGIYQTKVGESSE
                     RPPGWNVNPKFVGSISLSAMGLPATESLASQGEMALPVRMRIIDAKDWIGCTEIYAVK
                     TGVAGVLPKVKVGAAQYDESTGVYTFTTDSTPPRTLIFTPAQPPGAETRPILAPPGST
                     PATLQHTGEMIIKPVITPTILPLPQLYARDFHDYIIWFPADSGLEPVYVYLNSPYGKT
                     TAKGKYSGRDFNPDKAGGPIKNLDWKEIKIRGEGVDEVKLHTRRFGELEDNKLMIERL
                     EKILTNKLTATATDIDKRFYTHEIRELERYRMLGIPDDVNDKSVWNDAHTATLEDFKI
                     NEKTQPLYTSEAEDAYIKAELKNSLGSK"
     gene            180249..180512
                     /locus_tag="YPTB_RS00900"
                     /old_locus_tag="YPTB0147"
     CDS             180249..180512
                     /locus_tag="YPTB_RS00900"
                     /old_locus_tag="YPTB0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002212004.1"
                     /db_xref="GI:488140796"
                     /translation="MSIMEKIIQNETVEDVLLAFTPNTAYQGIERMYVRYRFNIVSNR
                     ELLFTYQRLIKEAKLAEDEKGHTLKGPNWKEPKFVTDKKYGIE"
     gene            180774..181019
                     /locus_tag="YPTB_RS00905"
     CDS             180774..181019
                     /locus_tag="YPTB_RS00905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH nuclease"
                     /protein_id="WP_032465988.1"
                     /db_xref="GI:694125393"
                     /translation="MATFWREVANDPELVGQFLPLNQNIMKRGYAPYPIPTQQVGRKV
                     KFELHHVKFIRDDGAVYYIENIRVMTPKRHIDINSKN"
     gene            181028..181282
                     /locus_tag="YPTB_RS00910"
                     /old_locus_tag="YPTB0149"
     CDS             181028..181282
                     /locus_tag="YPTB_RS00910"
                     /old_locus_tag="YPTB0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin transporter"
                     /protein_id="WP_011191487.1"
                     /db_xref="GI:499504847"
                     /translation="MKLKNSISEYAEGEFLDFLNKIWSVDVSESEHDALIRHFVMITE
                     HPQGNGVLFYPPEGVENSPEGVLDFIKKWRSENGKPSFKE"
     gene            181435..181854
                     /locus_tag="YPTB_RS00915"
                     /old_locus_tag="YPTB0150"
     CDS             181435..181854
                     /locus_tag="YPTB_RS00915"
                     /old_locus_tag="YPTB0150"
                     /EC_number="3.1.21.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH nuclease"
                     /protein_id="WP_011191488.1"
                     /db_xref="GI:499504848"
                     /translation="MYVYLKSPRDEPGVVTGRGERITGIWLAGAGKDMGAPIPAQIAD
                     KLRGRRFSHFGRFRAAFWKVVGEDPNLVKYFKSGNLGNIKNGKVPSPKEREQVGRRVK
                     YELHHLKPISKNGAVYHIENIRVLTPKRHIDIHKGAE"
     gene            181856..182110
                     /locus_tag="YPTB_RS00920"
                     /old_locus_tag="YPTB0151"
     CDS             181856..182110
                     /locus_tag="YPTB_RS00920"
                     /old_locus_tag="YPTB0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin immunity protein E2"
                     /protein_id="WP_011191489.1"
                     /db_xref="GI:499504849"
                     /translation="MEDKSICDYTESEFLELVKELFNVEKTTEEEDINNLIEFKRLCE
                     HPAGSDLIFYPDNNREDSPEGVVKEVKKWRAENGKPGFKK"
     gene            182263..182691
                     /locus_tag="YPTB_RS00925"
                     /old_locus_tag="YPTB0152"
     CDS             182263..182691
                     /locus_tag="YPTB_RS00925"
                     /old_locus_tag="YPTB0152"
                     /EC_number="3.1.21.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH nuclease"
                     /protein_id="WP_011191490.1"
                     /db_xref="GI:499504850"
                     /translation="MYVYLKSLRDEPGVVTGRGERITGIWLAGAGKDMGVPIPSQIAD
                     KLRGRWFSHFGRFRAAFWREVANDPELVGQFIISNRERMSVGKAPKAKKIDSGGKRIP
                     FEIHHVKFIKDNGEVYNIDNLRILTPKLHIELHSKNKGKQ"
     gene            182688..182951
                     /locus_tag="YPTB_RS00930"
                     /old_locus_tag="YPTB0153"
     CDS             182688..182951
                     /locus_tag="YPTB_RS00930"
                     /old_locus_tag="YPTB0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin immunity protein E2"
                     /protein_id="WP_011191491.1"
                     /db_xref="GI:499504851"
                     /translation="MKLKNSISEYTEEEFIDFLKEIFKENIADTDARLNELLEHFECV
                     TEHPEGTDLIYYPLSDYECTPRKILEKVKKWRAENGKPGFKNK"
     gene            complement(183374..183559)
                     /locus_tag="YPTB_RS00935"
     CDS             complement(183374..183559)
                     /locus_tag="YPTB_RS00935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032466601.1"
                     /db_xref="GI:694126006"
                     /translation="MSGPNTPACQYGLNITHSFSPCYIPVTLQDAGTLAALAHPSHLV
                     LLTLKINKRLEINEPHP"
     gene            183509..183880
                     /locus_tag="YPTB_RS00940"
                     /old_locus_tag="YPTB0154"
     CDS             183509..183880
                     /locus_tag="YPTB_RS00940"
                     /old_locus_tag="YPTB0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitermination protein"
                     /protein_id="WP_011191492.1"
                     /db_xref="GI:499504852"
                     /translation="MSYIQTVLARWGVWARDNSCLDYPHISSGFKGLVTRNKPAESCC
                     DHDGLVIDNTVGNLQRAAREKELELILRHYVYGQSKSSIARLKKCNEREIRRQLQIAE
                     SFIEGCITQSDILLEMHKELF"
     gene            184491..184826
                     /locus_tag="YPTB_RS00945"
                     /old_locus_tag="YPTB0155"
     CDS             184491..184826
                     /locus_tag="YPTB_RS00945"
                     /old_locus_tag="YPTB0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191493.1"
                     /db_xref="GI:499504853"
                     /translation="MSYKILGGIITALVASFLLLLVQWSNLSKQIENKEKELVTVREA
                     NVVLKNILDIYHVNDMSNRVATARQLENERVLRNEYEENIRQFKAATIDDFCAAQHMP
                     DRIINLLQE"
     gene            complement(185085..185903)
                     /locus_tag="YPTB_RS00950"
                     /old_locus_tag="YPTB0156"
     CDS             complement(185085..185903)
                     /locus_tag="YPTB_RS00950"
                     /old_locus_tag="YPTB0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_002215825.1"
                     /db_xref="GI:488144617"
                     /translation="MHMRKWLSVSNNIMLSRINRRLRGLLLLMTTCRVLTLPALTIGV
                     LIMSALATSAVASVIAERTRIVFSEGSTEESLQLVNSNSYPVAVQVWVDDGNLMATPD
                     KAVSPILVLPPVFRLQPQAQRSLRLILSGGSKLPADRESAFWLNIYEIPPKATPKSGD
                     ESFVTLALRMQYKVFYRPKNLPAPGDILGKALTFSLERNGDSALIKVNNPTPYYASFA
                     ALTIGSAEGPPEMVAPFSQLDFPLNRAPISDNKTVNFDLIDDLGNRNSFSHELK"
     gene            complement(185869..187146)
                     /locus_tag="YPTB_RS00955"
                     /old_locus_tag="YPTB0157"
     CDS             complement(185869..187146)
                     /locus_tag="YPTB_RS00955"
                     /old_locus_tag="YPTB0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002355452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_002355452.1"
                     /db_xref="GI:488284244"
                     /translation="MTLLIGLFSTSAWSNCTRITAQNQISSSDGTAASWLGSRDDNNG
                     SLNLPSIVDLSTNANFQPDGTLLASATSDFTTFAVNTGYALDQVLFRCDAADVDQLYE
                     MYATNGDSTYGGRYEDGTIAGNVSYGYATTVMNVVIRFTNLATGEYYARIWKGRRLTG
                     LDTDSSGRILVKAKNFSNVYTELFRIDYARSGANNTPSYLYGRSQPNAYIAFKGPGIT
                     GPIEGTDSYSNWPGWYSTWPASLGLYKYVTFRRTTICAVSNFTPTVVLPRISVAELNN
                     GNTSSADFNVDFQCQTGINSGVTAGTVAMGFLVPAANAAKAQALGLMNGNGGVSHLVS
                     DNYGAAGTAGGVGIRIYRNNSPMYLLSKNVTQTGNNGGWYGILQGAQETTGSVDGGNS
                     YTETFRAELSKISGQTVTAGAVNAHAQVVIRVQ"
     gene            complement(187253..189904)
                     /locus_tag="YPTB_RS00960"
                     /old_locus_tag="YPTB0158"
     CDS             complement(187253..189904)
                     /locus_tag="YPTB_RS00960"
                     /old_locus_tag="YPTB0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial usher protein"
                     /protein_id="WP_011191494.1"
                     /db_xref="GI:499504854"
                     /translation="MVQARVILKKNFSGRRKALTLCITLILHIDTAFGQEEPQNFEFD
                     ESLFLGTKYASGLTQLNKKNSITAGNYDAVDVLVNNKLFKRMSVQFIKDANSSEVYPC
                     LSDELLTAAGVELGRENSTPPKEPHVTEANTPITETHAPTNQCLPLSTRVKGASFRFD
                     QAKLRLELSIPQALLQKRPRGYIERAEWQEGEKLAFINYSANAYRSDTRGQQKRTSDF
                     GFIGLKSGINLGLWQVRQQSNVRYASNDSGSDTQWNSIRTYVQRPIPQLDSQLTLGET
                     FTDSTLFGSMSFLGAKMATDQRMWPVSMRGFSPEVRGVASTNARVIIRQNGREIYETN
                     VAPGPFVINDLFSTSSQGDLNVEVIEANGSRSTFTVPFSAVPDSMRPGVSRYNAVIGE
                     SRDFTNIDNYFTDFTYERGLTNQLTANSGVRLAKDYTALLAGGVLGTPVGALGLNATY
                     SHAKVENDKTQDGWRMQATYSQTFNQTGTTFSLAGYRYSTKGYRDLNDVFGVRSMQKN
                     GGTWDSSTYKQRSQFTTTINQDLGNWGQLYASASTSDYYNDTARDTQLQLGYSNSYQQ
                     ISYNLAVSRQRSVYTSTLYNWDSPDTDETATTTRYGNTENIATFTVSIPLNIGSNNQY
                     LSMSASRNPKSGNNYQTSLSGTAGERNSFNYALNAGYDDSNIGSSSNNWGANVQKQFP
                     NATVNGSYSRGNNYTQYGAGARGAAVIHRQGVTLGPYLGETFGLIEANGAQGATVRNA
                     QGARIDSNGFALVPALTPYNYNTIGLDTKGINRNTELKENQGRVVPYAGAAVKVKFET
                     LTGYAVLIQAEGERLPLGADVYNSKDELVGMVGQGNQIYARIADNKGTLDVRWGESSG
                     DQCQLPYAFNRQDTEQDIIHITASCRR"
     gene            complement(189932..190663)
                     /locus_tag="YPTB_RS00965"
                     /old_locus_tag="YPTB0159"
     CDS             complement(189932..190663)
                     /locus_tag="YPTB_RS00965"
                     /old_locus_tag="YPTB0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial chaperone"
                     /protein_id="WP_011191495.1"
                     /db_xref="GI:499504855"
                     /translation="MLSIYARHYHYLFVTLLVAMSLSFANASVVMTGSRIIYPAAASE
                     HSIQLTNNDNFPNAVQVWLDSGDEKSTPETGKAPFIVTPPFFRIEANSGQTLRLKYTG
                     SGLPTDRESVFYLNFLQIPPVNKVEKDNKMLVLLRNRIKVFYRPESIIGRVDQVSTAL
                     TFSLRKQGTNLVLTGKNPTGFYATIASGEIVSGSIKLKVKSNMIAPMSQVEWVIPNAS
                     VPSSATINFLIMNDFGGQDAGSYRI"
     gene            complement(190727..191257)
                     /locus_tag="YPTB_RS00970"
                     /old_locus_tag="YPTB0160"
     CDS             complement(190727..191257)
                     /locus_tag="YPTB_RS00970"
                     /old_locus_tag="YPTB0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_002211997.1"
                     /db_xref="GI:488140789"
                     /translation="MKKITLAIALFSASTTVAMSASNNTITFQGEVTAQTCSVTVNGL
                     EANPVVLLPTVSSSDLDASGQTKGKTTFTLGVSGCTSGSDDLDIKTVFIGSLVTATGN
                     LQNTGTAGNVELQLLKDATTTTGIDLNSGLAQDGIVLLAGDTSAEHDFAVQYYATGQS
                     TPGSVIASVQYAVSYL"
     gene            191568..191744
                     /locus_tag="YPTB_RS00975"
     CDS             191568..191744
                     /locus_tag="YPTB_RS00975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002231894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002231894.1"
                     /db_xref="GI:488160686"
                     /translation="MLNKGFIVIFITNHTLGYYFSIYLKVYFLNVAIYIPLNKTKKNQ
                     CLIQEYDNAYRVLH"
     gene            complement(192049..192840)
                     /locus_tag="YPTB_RS00980"
                     /old_locus_tag="YPTB0161"
     CDS             complement(192049..192840)
                     /locus_tag="YPTB_RS00980"
                     /old_locus_tag="YPTB0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine cyclotransferase"
                     /protein_id="WP_011191496.1"
                     /db_xref="GI:499504856"
                     /translation="MEILNIPRRCFTFLLIIITYSFPLSFADSKPLKYTFEVIRKIPH
                     DETSFTQGLVIDDGKLYETTGLYKNSKIRELDLTNGKVIRSVDLPDNIFGEGITKLGD
                     SFYVLTWKEKKAFVINPNDLKIIKTFNYEGEGWGLTTDGINLIMGDGSDTLYFRNPAD
                     FSIIKKISVTFDGRRIEKINELEWIDGMIYANVWYSDAILVIEPENGRVVKWIELSGL
                     QFMLDSVNRNTNTLNGIAYDKSKNKIYLTGKNWSNIFEVKFLTSK"
     gene            complement(193079..193360)
                     /locus_tag="YPTB_RS00985"
                     /old_locus_tag="YPTB0162"
     CDS             complement(193079..193360)
                     /locus_tag="YPTB_RS00985"
                     /old_locus_tag="YPTB0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004704164.1"
                     /note="rotamase C; accelerates isomerization of the
                     peptidyl prolyl bond; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_002211995.1"
                     /db_xref="GI:488140787"
                     /translation="MANKASALHILVDDEKQANDILAQLNNGANFQELAKKFSNCPSK
                     RNGGDLGEFNKGDMVPAFDKAVFSCELLQPYGPVKTQFGYHIIKVLYRS"
     gene            complement(193380..193565)
                     /locus_tag="YPTB_RS00990"
     CDS             complement(193380..193565)
                     /locus_tag="YPTB_RS00990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002215828.1"
                     /db_xref="GI:488144620"
                     /translation="MTLGCSMGLRGSELYQKATDEKKLPAFLIGNTHAAATKIRYTDA
                     LREPIEETLRKITLSLK"
     gene            193564..195585
                     /locus_tag="YPTB_RS00995"
                     /old_locus_tag="YPTB0163"
     CDS             193564..195585
                     /locus_tag="YPTB_RS00995"
                     /old_locus_tag="YPTB0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104296.1"
                     /note="single-stranded DNA-dependent ATPase; initiates
                     unwinding at a nick in the DNA; involved in DNA
                     replication; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase Rep"
                     /protein_id="WP_002211993.1"
                     /db_xref="GI:488140785"
                     /translation="MRLNPSQQEAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRQCG
                     YQPKHIAAVTFTNKAAREMKERVAQTLGRKEARGLMIATFHTLGLEIIKKEYVALGMK
                     SNFSLFDAQDQMGLLKDLTHKWLEDDKTLLQQLVSAISNWKNDLLDPAAAAATARSER
                     DKLFVHCYGLYDAHLKACNVLDFDDLISLPTLLLQKNLEVRERWQNRLRYLLVDEYQD
                     TNTSQYQMVKLLVGNRARFTVVGDDDQSIYSWRGARPQNLVLLNEDFPALRVIKLEQN
                     YRSSGRILKAANILIANNPHVFEKKLFSELSYGDELKVITANNEDHEAERVVGELIAH
                     HFVKKTQYSDYAILYRGNHQSRLFEKLLMQNRIPYRISGGDSFFSRPEIKDLLAYLRV
                     LTNQDDDSAFLRIVNTPKREIGAATVQKLGEWANLRNKSLFRASFDLGLGEHLKGRGL
                     ESLQRFTHWMDGIIRLVEREPVAAVRDLIHGIDYESWLFETAPSPKAAEMRMKNVNLL
                     FSWMTEMLEGSELDEPMTLTQVVTRFTLRDMMERGESDEELDQVQLMTLHASKGLEFP
                     YVFLVGMEEGLLPHQSSIDEDNVDEERRLAYVGITRAQRELFFTLCKERRQYGELIRP
                     EPSRFLMELPQDDLNWENERKAVSPEERMQKGQSHLANLRAQLANAKKP"
     gene            complement(195753..197246)
                     /locus_tag="YPTB_RS01000"
                     /old_locus_tag="YPTB0164"
     CDS             complement(195753..197246)
                     /locus_tag="YPTB_RS01000"
                     /old_locus_tag="YPTB0164"
                     /EC_number="3.6.1.40"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q74R94.1"
                     /note="catalyzes the conversion of guanosine
                     5'-triphosphate,3'-diphosphate (pppGpp) to guanosine
                     5'-diphosphate,3'-diphosphate (ppGpp); pppGpp and ppGpp
                     control the stringent response during amino acid
                     starvation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine polyphosphate pyrophosphohydrolase"
                     /protein_id="WP_032466602.1"
                     /db_xref="GI:694126007"
                     /translation="MLSSTSLYAAIDLGSNSFHMLVVREVAGSIQTLARIKRKVRLAA
                     GLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRVVATATLRLASNADEFLRTATE
                     ILGCPIQVISGEEEARLIYHGVAHTTGGPEQRLVVDIGGGSTELVTGNGAQANILVSL
                     SMGCVTWLERYFGDRHLAKENFERAELAAHEMIKPVAQRFREHGWQVCVGASGTVQAL
                     QEIMVAQGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIF
                     QELSIESMTLAGGALREGLVYGMLHLPVEQDIRRRTLRNLQRRYLLDTEQAKRVSCLA
                     DNFFLQVEKEWHLDGRCREFLQNACLIHEIGLSVDFKHAPQHAAYLIRNLDLPGFTPA
                     QKLLLSALLQNQSDTIDLSLLNQQNALPADMAQHLCRLLRLAIIFSSRRRDDTLPAVR
                     LRADNNALYVLVPQGWLEQHPYRAEALEQESHWQSYVQWPLLLEELS"
     gene            complement(197253..198539)
                     /locus_tag="YPTB_RS01005"
                     /old_locus_tag="YPTB0165"
     CDS             complement(197253..198539)
                     /locus_tag="YPTB_RS01005"
                     /old_locus_tag="YPTB0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAD8.1"
                     /note="enables ATP-dependent unwinding of double stranded
                     RNA as a component of the RNA degradosome, a multi-enzyme
                     complex important in RNA processing and messenger RNA
                     degradation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase RhlB"
                     /protein_id="WP_002228177.1"
                     /db_xref="GI:488156969"
                     /translation="MSKTHLTEQKFSDFALHPLVVEALENKGFQYCTPIQALALPLTL
                     SGRDVAGQAQTGTGKTLAFLASTFHYLLSHPAEEGRQTNQPRALIMAPTRELAVQIHS
                     DAESLSQVTGLKLGLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNYINLGAIQ
                     VVVLDEADRMYDLGFIKDIRWLFRRMPSVDKRLNMLFSATLSYRVRELAFEQMNNAEY
                     VEVEPLQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWPDRCIIFANTKHRCEEIWGHL
                     AADGHRVGLLTGDVAQKKRLRILEDFTKGDLDILVATDVAARGLHIPLVTHVFNYDLP
                     DDCEDYVHRIGRTGRAGESGHSISLACEEYALNLPAIETYTGHSIPVSKYNSDALLTD
                     LPAPKRLARTRTGNGPRRNSAPRRSGAPRNNRKRPG"
     gene            198658..198984
                     /gene="trxA"
                     /locus_tag="YPTB_RS01010"
                     /old_locus_tag="YPTB0166"
     CDS             198658..198984
                     /gene="trxA"
                     /locus_tag="YPTB_RS01010"
                     /old_locus_tag="YPTB0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011906449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_002211990.1"
                     /db_xref="GI:488140782"
                     /translation="MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILD
                     EIAEEYEGRLTIAKLNIDDNQGTAPKYGIRGIPTLLLFRDGEVVATKVGALSKGQLKA
                     FLDANL"
     gene            199464..200723
                     /gene="rho"
                     /locus_tag="YPTB_RS01015"
                     /old_locus_tag="YPTB0167"
     CDS             199464..200723
                     /gene="rho"
                     /locus_tag="YPTB_RS01015"
                     /old_locus_tag="YPTB0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004721644.1"
                     /note="An RNA-DNA helicase that actively releases nascent
                     mRNAs from paused transcription complexes; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_002211989.1"
                     /db_xref="GI:488140781"
                     /translation="MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFSILKQHAK
                     SGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIR
                     PPKEGERYFALLKVNEVNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTAR
                     VLDLASPIGRGQRGLIVAPPKAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTE
                     MQRLVKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNT
                     VVPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEE
                     FKGTGNMELHLSRKIAEKRVFPAIDFNRSGTRKEELLTTTDELQKMWILRRILHPMGE
                     IDAMEFLISKLATAKTNDQFFDNMRRS"
     gene            201272..202354
                     /locus_tag="YPTB_RS01020"
                     /old_locus_tag="YPTB0168"
     CDS             201272..202354
                     /locus_tag="YPTB_RS01020"
                     /old_locus_tag="YPTB0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004877079.1"
                     /note="catalyzes the formation of
                     alpha-N-acetylglucosaminyl-pyrophosphoryl-undecaprenyl
                     from alpha-N-acetylglucosaminyl 1-phosphate and the lipid
                     carrier undecaprenyl phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-phosphate alpha-N-acetylglucosaminyl
                     1-phosphate transferase"
                     /protein_id="WP_002216793.1"
                     /db_xref="GI:488145585"
                     /translation="MSTELIYIFLFSMAFLFVARKVAIKIGLVDKPNYRKRHQGLIPL
                     VGGISVFAGVCFAFLITNQQIPHFRLYLACAGLLVFVGALDDRFDISVKIRAFVQALV
                     GIAMMAVAGLYLRSLGHAFGPWEMVLGPFGYVVTLFAVWAAINAFNMVDGIDGLLGGL
                     SCVSFGAMGILLYQSGQMSLALWCFAMIATIIPYILLNLGLLGRRYKVFMGDAGSTLI
                     GFTAIWILLQATQGNAHPINPVTALWIIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIH
                     HLIMRAGFTSRQAFVLITLAAALLAMIGVIGERLTFIPEWVMLALFLLAFLLYGYCIK
                     RAWRVARFIKRFKRRMRRASKNKHES"
     gene            202375..203451
                     /locus_tag="YPTB_RS01025"
                     /old_locus_tag="YPTB0169"
     CDS             202375..203451
                     /locus_tag="YPTB_RS01025"
                     /old_locus_tag="YPTB0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304740.1"
                     /note="Enterobacterial Common Antigen (ECA) polysaccharide
                     chain length modulation protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS biosynthesis protein"
                     /protein_id="WP_012304740.1"
                     /db_xref="GI:501261722"
                     /translation="MKPESMSTDKTGSTNNEPSVDNELDIRGLCRTLWRGKVWIIGMA
                     IIFAAIALGVSYLVKQQWSATAITDKPTVNNLGGYYSQQQFLRNLDIRLNSGLVSEQP
                     GISDEAYGEFITQLAAYDTRRDFWLQSDYYKQRLEGDAKADAALLDELVNNIVFTARD
                     DKKIPNDSIKLTAETASDANKLLRGYIDFASQRASSHLNDEIQGAWAARTQSMKAQVK
                     RQEAVAQAVFDREVAAVKQALKVAGQQGITRSQTDTPAEQLADSKMFMLGKPMLEARL
                     ETLLATGPSFDIDYDQNRAMLATLNVGPTLDDKFQTYRYLRTPEDPVTRDSPRRVFLL
                     IMWGAIGALVGAGVVLVRRSNKAL"
     gene            203800..204930
                     /locus_tag="YPTB_RS01030"
                     /old_locus_tag="YPTB0170"
     CDS             203800..204930
                     /locus_tag="YPTB_RS01030"
                     /old_locus_tag="YPTB0170"
                     /EC_number="5.1.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAE3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="WP_011191498.1"
                     /db_xref="GI:499504858"
                     /translation="MKVLTVFGTRPEAIKMAPLVHALAQDDAFESRVCVTAQHREMLD
                     QVLRLFEIQPDYDLDIMRPGQGLTEITCRILEGLKPVLEEFKPDVILVHGDTTTTLSA
                     SLAGFYHRIPVGHVEAGLRTGDLYSPWPEEANRQLTGHLAMYHFAPTENSRQNLLREL
                     VPENRIFVTGNTVIDALFWVRDRVMNTPDLRANLAQRYAFLDTNKKMILVTGHRRESF
                     GGGFERICSALAEIARKHPEVQVVYPVHLNPNVSEPVNRILKGIDNIILIDPQDYLPF
                     VYLMNHAYLILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDSGTVLLVGTNINKIVD
                     AVTRLLTDETAYHQMTRAHNPYGDGYACQRILKALKNHQVTL"
     gene            204927..206189
                     /gene="wecC"
                     /locus_tag="YPTB_RS01035"
                     /old_locus_tag="YPTB0171"
     CDS             204927..206189
                     /gene="wecC"
                     /locus_tag="YPTB_RS01035"
                     /old_locus_tag="YPTB0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005190238.1"
                     /note="catalyzes the oxidation of
                     UDP-N-acetyl-D-mannosamine to UDP-N-acetylmannosaminuronic
                     acid; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetyl-D-mannosamine dehydrogenase"
                     /protein_id="WP_011191499.1"
                     /db_xref="GI:499504859"
                     /translation="MSFETISVIGLGYIGLPTAAAFASRKKKVIGVDVNAHAVETINR
                     GAIHIVEPDLDKVVKIAVEGGYLQAATKPQAADAFLIAVPTPFKGDHEPDMIFVESAA
                     KSIAPVLKKGDLVILESTSPVGATEQMAQWLAEARPDLSFPQQAGEAADINIAYCPER
                     VLPGQVMVELIQNDRVIGGMTPKCSARASALYKIFLEGECVVTNSRTAEMCKLTENSF
                     RDVNIAFANELSLICDEQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVS
                     QNPQLARLIHTARLVNDGKPLWVVDRVKAAVADCLAASDKRASEVKIACFGLAFKPDI
                     DDLRESPAVGVARLIAEWHVGETLVVEPNVEQLPKSLMGLVTLKDTATALQQADVLVM
                     LVDHKQFKAIKPEDIKQQWIVDTKGVWR"
     gene            206186..207253
                     /locus_tag="YPTB_RS01040"
                     /old_locus_tag="YPTB0172"
     CDS             206186..207253
                     /locus_tag="YPTB_RS01040"
                     /old_locus_tag="YPTB0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="WP_011191500.1"
                     /db_xref="GI:499504860"
                     /translation="MRRILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLESL
                     SVVAGSERYAFEQVDICDRSELDRVFAQYQPNVVMHLAAESHVDRSIDGPAAFIETNV
                     VGTYTLLEAARHYWQQLSVEAKQAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPY
                     SASKASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYG
                     NGAQVRDWLYVEDHARALYQVVTEGVVGETYNIGGHNERKNIEVVETICALLDELVPA
                     KPAGIAHYRDLITYVKDRPGHDMRYAIDAGKIERELGWRPQETFESGIRKTVLWYLNN
                     ESWWRRVQDGSYAGERLGLSD"
     gene            207548..208429
                     /locus_tag="YPTB_RS01045"
                     /old_locus_tag="YPTB0173"
     CDS             207548..208429
                     /locus_tag="YPTB_RS01045"
                     /old_locus_tag="YPTB0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011566130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="WP_002211983.1"
                     /db_xref="GI:488140775"
                     /translation="MKGIILAGGSGSRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLA
                     GIRDVLIISTPEDLPSFQRLLGNGDEFGINLSYAAQPSPDGLAQAFIIGEAFIDNEPC
                     CLVLGDNIYFGQGFSPKLKAVAARQQGATVFGYQVMDPERFGVVEFDDNFRALSIEEK
                     PSQPKSNWAVTGLYFYDNQVVDFAKQVKPSARGELEITSINQMYLDRGELTVELLGRG
                     FAWLDTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLDDDGVKRAATALAKT
                     GYGKYLLDLLHARPRQY"
     gene            208407..209144
                     /locus_tag="YPTB_RS01050"
                     /old_locus_tag="YPTB0174"
     CDS             208407..209144
                     /locus_tag="YPTB_RS01050"
                     /old_locus_tag="YPTB0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TDP-fucosamine acetyltransferase"
                     /protein_id="WP_012304738.1"
                     /db_xref="GI:501261720"
                     /translation="MPVHASIEPLGWESEFFQRQSAKLIFSDSAPPLNPAELAAFTLV
                     QAKVPTHRLDLIDALSQLDFHLVEGEIDLSLAVGEKEGIGTENATSEPNMGPYSQRVA
                     TEADIPQLRRVAASTFALSRFRAPWYDAQDSGRFYALWVEKAVLGTFDHQCLLVLDST
                     DQPVGFVTLRDLQDGSARIGLLAVFPGAQSKGIGLRLMSAAKQWCQHHGLHRLRVATQ
                     MSNIAALRLYIRSGASIESTAYWLCRG"
     gene            209146..210276
                     /locus_tag="YPTB_RS01055"
                     /old_locus_tag="YPTB0175"
     CDS             209146..210276
                     /locus_tag="YPTB_RS01055"
                     /old_locus_tag="YPTB0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304737.1"
                     /note="catalyzes the formation of dTDP-D-fucosamine from
                     dTDP-4-oxo-6-deoxy-D-glucose in enterobacterial common
                     antigen biosynthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TDP-4-oxo-6-deoxy-D-glucose aminotransferase"
                     /protein_id="WP_002211981.1"
                     /db_xref="GI:488140773"
                     /translation="MIPFNTPPIVGTELGYMQAAMSSGKLCGDGGFTRRCQQWMEKRF
                     NCPKVLLTPSCTASLEMAALLLDIKPGDEVIMPSFTFVSTANAFVLRGAKMVFVDIRP
                     DTMNIDETKIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMST
                     YKGKALGTIGHIGCFSFHETKNYTAGGEGGATLINDPSLIDRAEIIREKGTNRSQFFR
                     GQVDKYTWRDIGSSYLMSDLQAAYLWGQLEAAEQINERRLALWHGYYNAFKPLADAGR
                     IDLPVIPGNVVQNAHMFYIKLRDIEERSAFISYLKEADIMAVFHYIPLHACPAGEAFG
                     RMAGEDRFTSKESERLVRLPIFYNLTDVNQSTVINTVLSFFV"
     gene            210278..211534
                     /locus_tag="YPTB_RS01060"
                     /old_locus_tag="YPTB0176"
     CDS             210278..211534
                     /locus_tag="YPTB_RS01060"
                     /old_locus_tag="YPTB0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304736.1"
                     /note="involved in the movement of lipid III across the
                     membrane; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translocase"
                     /protein_id="WP_011191502.1"
                     /db_xref="GI:499504862"
                     /translation="MSLAKASIWTACSTLIKIGVGLLVVKLLAVTFGPSGVGQAGNFR
                     QLIIVLGVLSGAGIFNGITKYVAEYHQQPERLRAMLGTSSTIVLGFSTLLALVFLLAA
                     KPVSIALFGHADYQNVVRAIAFIQMGIAYGNLFLAILKGYRDAMGNALAIIGGSLIGV
                     VAYYICFQIGGYSGALVGLGLVPALVVLPAAAMLYRRRTIPLRYLKPHWDKALASHLG
                     KFTLMALITSVTLPVAYVMMRHLLANNYGWDAVGIWQGVSSISDAYLQFITASFTVYL
                     LPTLSRLKDKGAISREILRSLKFVLPAVAAASLTVWLLRDFAIWLLFSHQFTAMRDLF
                     AWQLVGDVLKVGSYVFGYLVIAKASLRFYILAEVSQFLLLTGFAYWLIPMNGSLGAAQ
                     AYMATYIVYFALCSCAFLVYRRHSAP"
     gene            211557..212642
                     /locus_tag="YPTB_RS01065"
                     /old_locus_tag="YPTB0177"
     CDS             211557..212642
                     /locus_tag="YPTB_RS01065"
                     /old_locus_tag="YPTB0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4TRB6.1"
                     /note="catalyzes the synthesis of a lipid-linked
                     intermediate involved in ECA synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TDP-N-acetylfucosamine:lipid II
                     N-acetylfucosaminyltransferase"
                     /protein_id="WP_011191503.1"
                     /db_xref="GI:499504863"
                     /translation="MITLTHVLGSDIPHHNLTVLRFFNDVLAKCLPVEQVRHFMVAAK
                     ETAPFSSFPQLDINTYSDKKALAEAVIARAQADRSARFFWHGQFNATLWLALLSGKIK
                     PGQVYWHVWGADLYEDAKSLKFRLFYLLRRIAQGRVGHVFATRGDLIHYQQRHPRVPA
                     SLLYFPTRMDPALTAINIDKPLAGPMTILVGNSGDTTNRHIEALKAIHQQFGPDVRVI
                     IPMGYPANNEAYIEQVRQAGLALFSQDNLRILTEQIPFDDYLNILRECDLGYFIFNRQ
                     QGIGTLCLLTQFGVPFVLSRKNPFWQDLAEQHIPVFFYGDTLDEPLIREAQRQLAGLD
                     KQAIAFFNPNYIEGWKQALALAAGEHP"
     gene            212639..214003
                     /locus_tag="YPTB_RS01070"
                     /old_locus_tag="YPTB0178"
     CDS             212639..214003
                     /locus_tag="YPTB_RS01070"
                     /old_locus_tag="YPTB0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAF1.1"
                     /note="enterobacterial common antigen polymerase; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polymerase"
                     /protein_id="WP_002211978.1"
                     /db_xref="GI:488140770"
                     /translation="MTLGQFGGLFCIYLIAVIFILTLTYQEFRRVKFNFNVLFSMLYL
                     LTFYFGFPLTCMLVFQFGVAVVPVEYLLYAMLSATAFYGIYYVTYKTRLRQPRSQPRT
                     PIFTMNRVETNLTWVLLALVAVGTVGIFFMQNGFLLFKLDSYSKIFSSDVSGVALKRF
                     FYFFIPAMLVVYFLKQDRRAWFFFLASTVAFGILTYVIVGGTRANIIIAFSLFLFIGI
                     VRGWITLWMLAAAGVFGIVGMFWLALKRYGLDVNGAEAFYTFLYLTRDTFSPWENLGL
                     LLQNYDKIDFQGLAPIVRDFYVFIPSALWPERPDLVLNTANYFTWDVLDNHSGLAISP
                     TLIGSLVVMGGVLFIPLGAIVVGLIIKWFDWLYEQGKAESNRYKAAILQSFCFGAVFN
                     IIVLAREGLDSFVSRVVFFCVIFGACLVLAKLLYWLFDTAGLIKRQGIKSNRLSTPNA
                     GNQL"
     gene            214012..214752
                     /locus_tag="YPTB_RS01075"
                     /old_locus_tag="YPTB0179"
     CDS             214012..214752
                     /locus_tag="YPTB_RS01075"
                     /old_locus_tag="YPTB0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAF2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetyl-D-mannosaminuronic acid
                     transferase"
                     /protein_id="WP_011191504.1"
                     /db_xref="GI:499504864"
                     /translation="MEPNTVIPKYNVRGFEIWGFRDMAQVLDHLLGSGPVKTGTLVAM
                     NAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQAELSRVAGADLWEALMQ
                     RAGQQGTPVFLVGGKPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFARIAASG
                     AAIVTVAMGSPKQEIFMRDCRKFYPDALYMGVGGTYDVFTGHVKRAPKIWQNMGLEWL
                     YRLLAQPSRIRRQLKLLKFVGYYYSGRL"
     gene            215316..216707
                     /locus_tag="YPTB_RS01080"
                     /old_locus_tag="YPTB0180"
     CDS             215316..216707
                     /locus_tag="YPTB_RS01080"
                     /old_locus_tag="YPTB0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104302.1"
                     /note="involved in the transport across the cytoplasmic
                     membrane of D-alanine, D-serine and glycine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine glycine permease"
                     /protein_id="WP_002220976.1"
                     /db_xref="GI:488149768"
                     /translation="MADNAEKKGLHRGLEARHIELIALGGTIGVGLFMGSASTLKWAG
                     PSVLLAYIIAGLFVFFIMRAMGEMLYLEPVAGSFAVYAHKYLSPYFGYLTAWGYWFMW
                     IAVGISEITAIGVYVQFWFPEIPQWLPAIAGVAIVALANLAAVKLYGELEFWFAMIKV
                     TTIIVMILVGLGVIFFGFGNHGQPIGFDNLTAHGGFFAGGWKGFLFALCIVVASYQGV
                     ELVGITAGEARNPQVTLRRAINNILWRILIFYVGAIFVIVTIFPWNGIGTEGSPFVLT
                     FAKIGIVAAAGIINFVILTAALSGCNSGMYSGGRMLYALAKNRQLPAGLTKLSASGVP
                     VYCIAITILCLLVGSSLNYIIPNPQQVFVYVYSASVLPGMVPWFVVLVCQLRFRQVHK
                     AALQQHPFKSILFPYVNYLTIAFLICVLVGMGINPDTRLSLLVGAIFLALVTGCYFVL
                     GMHKPKAMEAERL"
     gene            216856..216932
                     /locus_tag="YPTB_RS01085"
                     /old_locus_tag="YPTB_RNA_5"
     tRNA            216856..216932
                     /locus_tag="YPTB_RS01085"
                     /old_locus_tag="YPTB_RNA_5"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:216890..216892,aa:Arg,seq:ccg)
     gene            217016..217091
                     /locus_tag="YPTB_RS01090"
                     /old_locus_tag="YPTB_RNA_6"
     tRNA            217016..217091
                     /locus_tag="YPTB_RS01090"
                     /old_locus_tag="YPTB_RNA_6"
                     /product="tRNA-His"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:217049..217051,aa:His,seq:gtg)
     gene            217108..217194
                     /locus_tag="YPTB_RS01095"
                     /old_locus_tag="YPTB_RNA_7"
     tRNA            217108..217194
                     /locus_tag="YPTB_RS01095"
                     /old_locus_tag="YPTB_RNA_7"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:217142..217144,aa:Leu,seq:cag)
     gene            217270..217346
                     /locus_tag="YPTB_RS01100"
                     /old_locus_tag="YPTB_RNA_8"
     tRNA            217270..217346
                     /locus_tag="YPTB_RS01100"
                     /old_locus_tag="YPTB_RNA_8"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:217304..217306,aa:Pro,seq:tgg)
     gene            complement(218227..219447)
                     /locus_tag="YPTB_RS01105"
                     /old_locus_tag="YPTB0181"
     CDS             complement(218227..219447)
                     /locus_tag="YPTB_RS01105"
                     /old_locus_tag="YPTB0181"
                     /EC_number="1.3.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX biogenesis protein"
                     /protein_id="WP_011191505.1"
                     /db_xref="GI:499504865"
                     /translation="MLRVLLLFLVLTVGIVLGPMLAGHQGYVLIQTDNYNVTTSVTGL
                     AIMLVLLLVAFFIVEWVLRRIFRTGARTRGWFLGRKRTRARNQMKAALIKLAEGDFLQ
                     VEKLLTRNADHAEQPMVNYLLAAEAAQQRGDEFRTNQYLERAAEVADGDQLPVNITRV
                     RIQLAQGHIHAARHGVDRLLDQAPRHPEVLRLAEQAYLRSGAYRSLLDILPAMSKTQI
                     HTPEEVAALEQQAYIGIMNQCMADEGSEGLKRWWKDQSRKVRNEIPLQVALAEHLIEC
                     DDHDVAQKIILDSLKHQYDERLVLLIPRLKAGNPEPLEKSLRQQIKQHGATPLLNSTL
                     GQLMLKHGEWEKASEAFKAALAQRPDGYDYAWLADALDKLHRPEDAAQARREGLLLTL
                     RQNGESSALTKLIH"
     gene            complement(219450..220574)
                     /locus_tag="YPTB_RS01110"
                     /old_locus_tag="YPTB0182"
     CDS             complement(219450..220574)
                     /locus_tag="YPTB_RS01110"
                     /old_locus_tag="YPTB0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen III methyltransferase"
                     /protein_id="WP_011191506.1"
                     /db_xref="GI:499504866"
                     /translation="MTEQNTPSAPVEEPTTAVERPQQPEPKGHREKRTGPILGVIAIA
                     LVIALGAGLYYHGQQQAQLQSAENIALQEQLVALKQTLLQEKQQLESLLQQQGKALES
                     AENQQASLTRQLNELQEKVATISGSDAKTWLLAQADFLVKMAGRKLWSDQDVTTAVTL
                     LKSADASLADMNDPSLIDVRRAITEDISALSAVSQVDFDGIILKLNQLSNQVDNLRLA
                     DNNIDDSPMDANSDELSSSLSEWRQNLSKSWRSFMSDFISIRRRDSSAEPLLAPNQDV
                     YLRENIRSRLLVAAQAVPRHQDEVYKQSLETISTWVRAYFDVNDPSTKAFLDELENLS
                     QQPISMDVPDQLKSQPILEKLMQTRVRNLLAQTPVDAQGE"
     gene            complement(220605..221354)
                     /gene="hemD"
                     /locus_tag="YPTB_RS01115"
                     /old_locus_tag="YPTB0183"
     CDS             complement(220605..221354)
                     /gene="hemD"
                     /locus_tag="YPTB_RS01115"
                     /old_locus_tag="YPTB0183"
                     /EC_number="4.2.1.75"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211464.1"
                     /note="catalyzes the formation of uroporphyrinogen-III
                     from hydroxymethylbilane; functions in tetrapyrrole and
                     heme biosynthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen III methyltransferase"
                     /protein_id="WP_011191507.1"
                     /db_xref="GI:499504867"
                     /translation="MTILVTRPSPAGEQLVTRLRALGRVAYHAPLIDFSPGRDLPKLP
                     ELLQDMRAGDLVFALSQNAVRYANPLLKRNKLSWPVQLSYYAIGRTTALALHTASRLH
                     VTFPPMGETSEMLLSLPLLQNLAGKKALLLRGNGGRELLGASLAERGAAVTFCECYQR
                     SPIYYDGSEQSAHWQRAGVDILVVTSGEMLQQIYTLVPDYYRSSWLLRCRLIVVSDRL
                     AALATQMGWTEVRVAENADNDALIRALQDLQ"
     gene            complement(221351..222292)
                     /gene="hemC"
                     /locus_tag="YPTB_RS01120"
                     /old_locus_tag="YPTB0184"
     CDS             complement(221351..222292)
                     /gene="hemC"
                     /locus_tag="YPTB_RS01120"
                     /old_locus_tag="YPTB0184"
                     /EC_number="2.5.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P46355.2"
                     /note="transformation of porphobilinogen to
                     hydroxymethylbilane in porphyrin biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase"
                     /protein_id="WP_011191508.1"
                     /db_xref="GI:499504868"
                     /translation="MLDKIIRIATRQSPLALWQAHYVQHLLQANHPGLQIELVPMVTR
                     GDIILDTPLAKVGGKGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVAICERE
                     DPRDAFVSSHYAHLDDLPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLD
                     NGDYQAIILAVAGLKRLGLETRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAP
                     LNHRHTELRVCAERAMNIRLEGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGER
                     RGPAAEAEQMGIELADELLSRGAREILAAVYLDNPAR"
     gene            222786..225338
                     /gene="cyaA"
                     /locus_tag="YPTB_RS01125"
                     /old_locus_tag="YPTB0185"
     CDS             222786..225338
                     /gene="cyaA"
                     /locus_tag="YPTB_RS01125"
                     /old_locus_tag="YPTB0185"
                     /EC_number="4.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015683523.1"
                     /note="catalyzes transfer of adenylyl group of ATP from
                     pyrophosphate to the 3'-hydroxyl group to form cyclic AMP;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate cyclase"
                     /protein_id="WP_011191509.1"
                     /db_xref="GI:499504869"
                     /translation="MYLYIETLKQRLDAINQLRVDRALAAMGPAFQKVYSLLPILLHC
                     HHPQMPGYLDGNVPHGVCLFTPNEIQQDYLADVEARWGEPLAPSAGGELPITGVYSMG
                     STSSIGQCHTSDLDIWVCHQAWLDTEERNQLQQKCSLLEKWAASMGVEVSFFLVDENR
                     FRHNASGSLGGEDCGSTQHILLLDEFYRSAVRLAGKRILWNMVPVKEEEHYDDYVLSL
                     YAQGVLTPNEWLDLGGLSTLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYP
                     NSQLLAMEIKQHLHAGEIVSFGLDAYCMMLDRVTRYLIQINDTTRLNLVRRCFYLKVC
                     EKLSRTPASTGWRREVLSQLVSEWGWSNEKLAVLDNRANWKIERVREAHNELLDAMMQ
                     SYRNLIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEEHLT
                     FIHVPAGRANRPGWYLYNQAPSMDAIVSHQPLEYNRYLNKLVSWAYFNGLLTSKTHLH
                     IKSANLCDTVKLQELVTDISHHFPLRLAAPTPKALYSPCEIRHLAIIVNLEHDPTTTF
                     RNQVVHFDFRKLDVFSFGEQQQCLVGSIDLLYRNSWNEVRTLHFSGEQAVLEALKTIL
                     GKMHQDAAPPESVDVFCYSQHLRGLIRTRIQQLVSECIDLRLSSTRQEPGRFKAVRVS
                     GQTWGLFFERLSVSVQKLENAVEFYGAISNNKLHGLSVQVATNQIHLPPVVDGFASEG
                     IIQFFFEGTADEKGFNIYILDEANRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGS
                     SFINFNLPQFYQIVQLDGRTQVIPFRSNTLSQLCANIAEKEASLPTKQCQLH"
     gene            complement(225374..225697)
                     /locus_tag="YPTB_RS01130"
     CDS             complement(225374..225697)
                     /locus_tag="YPTB_RS01130"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012413417.1"
                     /db_xref="GI:501381851"
                     /translation="MSHYLYLNEPVDKRHLLFMQNNFDEVFTAIEKRELTVNIYRKTR
                     PENQEELLIMSKDEPVIKLDVDILAASLEHNKKMMSSKHSKTNINNSHCYQRQSSLFL
                     IRDSQ"
     gene            complement(225858..227066)
                     /locus_tag="YPTB_RS01135"
                     /old_locus_tag="YPTB0186"
     CDS             complement(225858..227066)
                     /locus_tag="YPTB_RS01135"
                     /old_locus_tag="YPTB0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015899171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002209743.1"
                     /db_xref="GI:488138535"
                     /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELT
                     EHLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQ
                     MDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY
                     PIVYMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTEL
                     KNRGLQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSG
                     LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYT
                     TNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFII
                     EFGDRLSDHL"
     gene            complement(<227132..228253)
                     /locus_tag="YPTB_RS01140"
     CDS             complement(<227132..228253)
                     /locus_tag="YPTB_RS01140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413418.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041175484.1"
                     /db_xref="GI:752489464"
                     /translation="MGPLSSPSNVYSIPNSEPGKNTFLDDEEKGFAILMKKISKDVSQ
                     ADQHDLQRLKRAVLENICEDNTASTTLMFSGMDFRGVDLSNLNLSGAELDFTDLSDTN
                     MTNTNLKKAFICNAKLNNIHWENTDITDISIELDDIHLLPLTAPEQYKMLEKNVEIIE
                     NYNDGYKEIDKIEKFKEVLDVKNKIQQRFHNLDNKQLQILLPCLYVEAAHRLNPVMAY
                     REKDKGYSATEENDNVLMIEGYTSLLSTLNNALTPNENQCHAERVKNIALGIEKLIEI
                     LLGSNTLCIENLTSYFRVHNSQIYKFKTLHKEIEKGKLTLNALKYDIGLTIDTNGEVT
                     FNGVIDNTIENKNKILYEFSNKLVSAHAKNDIVEIFKLET"
     gene            complement(228439..228762)
                     /gene="cyaY"
                     /locus_tag="YPTB_RS01145"
                     /old_locus_tag="YPTB0188"
     CDS             complement(228439..228762)
                     /gene="cyaY"
                     /locus_tag="YPTB_RS01145"
                     /old_locus_tag="YPTB0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66FZ7.1"
                     /note="iron-dependent inhibitor of iron-sulfur cluster
                     formation; iron-binding and oxidizing protein; defects in
                     the mitochondrial frataxin protein cause Friedreich ataxis
                     which is an autosomal recessive neurodegenerative disease;
                     based on phylogenomic distribution this protein may have a
                     role in iron-sulfur cluster protein assembly; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein CyaY"
                     /protein_id="WP_011191510.1"
                     /db_xref="GI:499504870"
                     /translation="MNDSEFHQLADQLMLYIEETLDGFTGDSDIDYETNGGVMTLTFE
                     NGSKIVINRQEPLHQVWLATKAGGYHFNYRDGHWYCSRSGEEFFAKLSEAATTQAGEE
                     VSFSE"
     gene            228914..229114
                     /locus_tag="YPTB_RS01150"
                     /old_locus_tag="YPTB0189"
     CDS             228914..229114
                     /locus_tag="YPTB_RS01150"
                     /old_locus_tag="YPTB0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191511.1"
                     /db_xref="GI:499504871"
                     /translation="MKKELRWPMAAMMVLALAGCGLKGPLYFPPADKPPVDAAPPESG
                     QVEKTQQDLSATPQTPSTAESQ"
     gene            229282..230106
                     /gene="dapF"
                     /locus_tag="YPTB_RS01155"
                     /old_locus_tag="YPTB0190"
     CDS             229282..230106
                     /gene="dapF"
                     /locus_tag="YPTB_RS01155"
                     /old_locus_tag="YPTB0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002427127.1"
                     /note="involved in lysine biosynthesis; DAP epimerase;
                     produces DL-diaminopimelate from LL-diaminopimelate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="WP_002211471.1"
                     /db_xref="GI:488140263"
                     /translation="MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQ
                     MLVVEPPYDPELDFHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKREISVSTQTG
                     RMILSVTEDEQVCVNMGEPDFEPQTVPFRAAKAEKTYILRAAEHTVLCGVVSMGNPHC
                     VMQVDDVSVANVALLGPVLENHERFPERANIGFMQVVSRDHIRLRVYERGAGETQACG
                     SGACAAVAVGVVQDLLNENVHVELPGGSLHIRWQGPGHPLYMTGPATHVYDGFIHL"
     gene            230171..230875
                     /locus_tag="YPTB_RS01160"
                     /old_locus_tag="YPTB0191"
     CDS             230171..230875
                     /locus_tag="YPTB_RS01160"
                     /old_locus_tag="YPTB0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002211472.1"
                     /db_xref="GI:488140264"
                     /translation="MKNYEEQALAGIELDDDAVMQYLLQNPDFFIRNARLVEQMHIPH
                     PVRGSVSLVEWQLGRQRNQIGQLEEEITLLMEQAGLNEVLFSRLLQLQANLAAADSLQ
                     DMLNRLQRWARDFGLAGANIRLFSDRWQIGAPSDFTHLALSRHAFEPLRIQRLGNRHH
                     YLGSLNGPELLLLLPQAKLVGSVALSLLGADGDLGVVIFSSRDAQHYQQGMGTVMLNQ
                     LSTLLPGLLARWIEPV"
     gene            230872..231783
                     /gene="xerC"
                     /locus_tag="YPTB_RS01165"
                     /old_locus_tag="YPTB0192"
     CDS             230872..231783
                     /gene="xerC"
                     /locus_tag="YPTB_RS01165"
                     /old_locus_tag="YPTB0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191512.1"
                     /note="site-specific tyrosine recombinase which cuts and
                     rejoins DNA molecules; binds cooperatively to specific DNA
                     consensus sites; forms a heterotetrameric complex with
                     XerC; XerCD exhibit similar sequences; essential to
                     convert chromosome dimers to monomers during cell division
                     and functions during plasmid segregation; cell division
                     protein FtsK may regulate the XerCD complex; enzyme from
                     Streptococcus group has unusual active site motifs;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerC"
                     /protein_id="WP_011191512.1"
                     /db_xref="GI:499504872"
                     /translation="MTEFSASLAPQVEAFLRYLSIERQLSPLTVTSYRRQLSALMEIG
                     EQMGLAHWQTLDAAQVRSLVSRSKRTGLHASSLALRLSALRSFLNWLVSQGVLPANPA
                     KGVSTPRSGRHLPKNIDVDEINKLLSIDLNDPLAVRDRAMLEVMYGAGLRLSELVGMN
                     CKHVDLASGDVWVMGKGSKERKVPLGKTAVTWLQHWLALRELFEPQDDAIFLANTGKR
                     ISARNVQKRFAEWGVKQGVSSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLTTT
                     QIYTHLDFQHLATVYDAAHPRAKRGKS"
     gene            231783..232499
                     /locus_tag="YPTB_RS01170"
                     /old_locus_tag="YPTB0193"
     CDS             231783..232499
                     /locus_tag="YPTB_RS01170"
                     /old_locus_tag="YPTB0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011815342.1"
                     /note="YigB; member of the haloacid dehalogenase
                     (HAD)-like hydrolases superfamily of protein; unknown
                     function; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavin mononucleotide phosphatase"
                     /protein_id="WP_011191513.1"
                     /db_xref="GI:499504873"
                     /translation="MHFYRPLERISAITFDLDDTLYDNRPVIARTEQQSVAFLQQYHP
                     NLALLQPVDFQRLRAELLAQDPGIYHDVTQWRWQAIELGLMRHGLSKAEAQAGADAAM
                     ANFALWRSRIDVPQATHDTLSALAEHYPLVAITNGNADPKACGLDRYFQFVLRSGPHG
                     RAKPFRDMYHKAANHLDIPLKHILHVGDDLTTDVAGSLRCGMQACWINDRQQNLMTAR
                     DSRLLPHIEISQLASLTALL"
     gene            232598..234760
                     /gene="uvrD"
                     /locus_tag="YPTB_RS01175"
                     /old_locus_tag="YPTB0194"
     CDS             232598..234760
                     /gene="uvrD"
                     /locus_tag="YPTB_RS01175"
                     /old_locus_tag="YPTB0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012229070.1"
                     /note="unwinds DNA duplexes with 3' to 5' polarity with
                     respect to the bound strand and initiates unwinding most
                     effectively when a single-stranded region is present;
                     involved in the post-incision events of nucleotide
                     excision repair and methyl-directed mismatch repair;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-dependent helicase"
                     /protein_id="WP_002211475.1"
                     /db_xref="GI:488140267"
                     /translation="MDVSDLLDSLNEKQRDAVAAPRGNLLVLAGAGSGKTRVLVHRIA
                     WLLSVENASPYSIISVTFTNKAAAEMRHRIEHLIGTSQGGMWIGTFHGLAHRLLRAHH
                     LDANLPQDFQILDSDDQLRLLKRLVKALNLDEKQWPPRQAMWYINGKKDEGLRPQHIE
                     SYGNPVEATWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNIL
                     VDEFQDTNNIQYAWIRLLAGERSNVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAET
                     IRLEQNYRSTSIILAAANALIANNDGRMGKNLWTDGAEGEPISLYCAFNELDEARFVV
                     NRIKAWQDNGGALNDCAILYRSNAQSRVLEEALLQTATPYRIYGGQRFFDRQEIKDSL
                     AYLRLISNRNDDAAFERVVNTPTRGIGDRTLDVVRQTARDRQLTLWQSTRAMLQEKVL
                     AGRAASALQRFVELIDSLARETADMPLHVQTDRVIRDSGLWSMYEQEKGEKGQARIEN
                     LEELVTATRQYSYQDEDQDLMPLQAFLSHAALEAGDGQADAYQDAVQLMTLHSAKGLE
                     FPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAYVGLTRAMQKLTLCYAESRRLYGKE
                     VNHRPSRFIGELPQECVEEVRLRASVSRPVNHRRMGTPMHENDSGFSLGQRVRHPKFG
                     EGTIVNLEGSGEHNRLQVAFPGEGIKWLVAAYARLEPV"
     gene            complement(234874..235539)
                     /locus_tag="YPTB_RS01180"
                     /old_locus_tag="YPTB0195"
     CDS             complement(234874..235539)
                     /locus_tag="YPTB_RS01180"
                     /old_locus_tag="YPTB0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_011191514.1"
                     /db_xref="GI:499504874"
                     /translation="MNTQNKQEGFSPSLTTIRARTRRLLIDTAMSMYERGAFPSITEV
                     ASAAQLSRATAYRYFPTQSALVSAMVDESLGPILAWQPTQPDARQRIAELLSFAYPRM
                     LQHEGVLRAALHLSLQQWADARSSDSNNSSNEEKLIRGNRKRLLKLAVEPLEETLAPE
                     ALQRVIHAFSLIYGSEVFMVLKDIWHLDEAGIQDVTQWMGKAILLQAETDSQLAAQDK
                     THS"
     gene            235967..237199
                     /locus_tag="YPTB_RS01185"
                     /old_locus_tag="YPTB0196"
     CDS             235967..237199
                     /locus_tag="YPTB_RS01185"
                     /old_locus_tag="YPTB0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191515.1"
                     /db_xref="GI:499504875"
                     /translation="MPRHIYIATTTDTKGQELAYVSELIQATGLTTVTVDLSTKESQR
                     DSGADICAETVAGYHPDGRQAVFCGDRGQAINAMAIAFERFMVSRVDVAALLGMGGSG
                     GTALITPAMQRLPIGIPKLMVSTMASGDVSGYIGASDIAMMYSVTDIAGLNRISRRVL
                     SNAAHQVAGAVYFAQEASPVDDKPALGLTMFGVTTPCIQAVSAELSDEYDCLVFHATG
                     SGGKAMEKLAESGLLAGVLDLTTTEVCDLLFDGVLACGPERFDAIAHTHIPYVGSCGA
                     LDMVNFGSPATIPAKYADRLFYKHNAQVTLMRTTEQENIEMARWIGEKLNRCQGEVRF
                     LIPEGGFSALDAPGQPFWDEKALTAFIRTLEETVIQTDKRRVVHYPFNINDPLFAQAA
                     IENFKEIVNKEIVNRPSH"
     gene            237225..238055
                     /locus_tag="YPTB_RS01190"
                     /old_locus_tag="YPTB0197"
     CDS             237225..238055
                     /locus_tag="YPTB_RS01190"
                     /old_locus_tag="YPTB0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002211478.1"
                     /db_xref="GI:488140270"
                     /translation="MPKFQRQAILAKFREMIARREPIIGGGAGTGLSAKCEEAGGIDL
                     IVIYNSGRYRMAGRGSLAGLLAYGNANDIVVDMAKEVLPVVKNTPVLAGVNGTDPFCQ
                     FDHFLDHLKALGFSGVQNFPTVGLIDGNFRANLEETGMGYGLEVEMIRLAHQKDLLTT
                     PYVFSAEDAIAMTQAGADIIVPHMGLTTGGNIGADTALKLADCVPLINDWAAAAKSVR
                     EEVIVLCHGGPISTPEDAQYIMDHCPQCDGFYGASSMERLPTEIALTDTTQKFKNITR
                     "
     gene            238705..239655
                     /locus_tag="YPTB_RS01195"
                     /old_locus_tag="YPTB0198"
     CDS             238705..239655
                     /locus_tag="YPTB_RS01195"
                     /old_locus_tag="YPTB0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004957399.1"
                     /note="responsible for the influx of magnesium ions;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter CorA"
                     /protein_id="WP_002211480.1"
                     /db_xref="GI:488140272"
                     /translation="MLSAFKLHNNRLSRLELDESDDLASSLWVDLVEPEEGERERVQT
                     ELGQSLATRPELDDIEASARFFEDEDGLHIHSFFYYEDADDHAGNSTVAFTIRDGRLY
                     TLRERELPAFRLYRMRARNQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLEALSR
                     VIMEGQQGDEYDAALSTLAEQEDIGWKVRLCLMDTQRALNFLVRKARLPSSQLEQARE
                     VLRDIESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSY
                     GMNFEFMPELRWSFGYPGAIALMIIAGLAPYLYFKRKNWL"
     gene            complement(239753..240643)
                     /locus_tag="YPTB_RS01200"
                     /old_locus_tag="YPTB0199"
     CDS             complement(239753..240643)
                     /locus_tag="YPTB_RS01200"
                     /old_locus_tag="YPTB0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chloramphenicol resistance permease RarD"
                     /protein_id="WP_002211481.1"
                     /db_xref="GI:488140273"
                     /translation="MDKQQTRQGIFFALAAYFIWGLAPAYFKLIQQVPADEILTHRVI
                     WSFFFMLILLTVSRHWPQVRDACKNRKRLLLLAVTAVLIASNWLLFIWAVNHNHMLEA
                     SLGYFINPLVNVLFGMLFLGERFRRMQWVAVALAFAGVLIQLWQFGSLPVIGLGLAIT
                     FALYGLLRKKLGVDAQTGMLIETMWLLPVAAVYLFFIADSPTSHLSANAWSLNLLLAA
                     AGVITTIPLLFFTAAATRLRLSTLGFFQYLGPTLMFILAVTFYGETIGNDKMVTFIFI
                     WAALLLFTLDALYTQRKLRR"
     gene            complement(240730..241200)
                     /locus_tag="YPTB_RS01205"
                     /old_locus_tag="YPTB0200"
     CDS             complement(240730..241200)
                     /locus_tag="YPTB_RS01205"
                     /old_locus_tag="YPTB0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002211482.1"
                     /db_xref="GI:488140274"
                     /translation="MSVTPLTLEDARRMIGETFVYHMPFNRELGLKLVRFEQDYAEIT
                     FDNDDKLVGNIAQKILHGGVIAAVLDVAAGLVCVGNSLIRHEPLIQEQLQIKLAKMGT
                     IDLRVDYLRPGRGEHFIARSSILRSGNKVAVARVELHNEKQIHIASATATYLVG"
     gene            241422..242300
                     /locus_tag="YPTB_RS01210"
                     /old_locus_tag="YPTB0201"
     CDS             241422..242300
                     /locus_tag="YPTB_RS01210"
                     /old_locus_tag="YPTB0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012229073.1"
                     /note="catalyzes the hydrolysis of phosphatidylcholine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase A"
                     /protein_id="WP_002211483.1"
                     /db_xref="GI:488140275"
                     /translation="MARFWQILIALLLVPTLAQAEEATIEKIHDAPAVRGSIIAAMLQ
                     DHDNPFLLYPYETNYLLYTYTNEINKQAISSYDWAEQANKDEVKFQLSLAFPIWRGIA
                     GDNSLLGASYTQRSWWQASNSEESSPFRETNYEPQLFLAWSTDYELAGWTFREVEFGF
                     NHQSNGKADPTSRSWNRVYTRVMAQRGNLEIDLKPWYRIPESDSKDDNPDITKYMGYY
                     RLKVGYALGDSVFSLDGRYNWNTGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYN
                     FRQTRVGVGIMLNDVL"
     gene            242377..244209
                     /locus_tag="YPTB_RS01215"
                     /old_locus_tag="YPTB0202"
     CDS             242377..244209
                     /locus_tag="YPTB_RS01215"
                     /old_locus_tag="YPTB0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080187.1"
                     /note="functions in blocking illegitimate recombination,
                     enhancing topoisomerase activity, initiating SOS signaling
                     and clearing blocked replication forks; component of the
                     RecF recombinational pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="WP_002211484.1"
                     /db_xref="GI:488140276"
                     /translation="MSTAAVINRELLAVQVLRDTFGYQQFRPGQQEIINATLSGQDCL
                     VVMPTGGGKSLCYQIPALVTDGLTLVVSPLISLMKDQVDQLLAYGVGAGCLNSSQTRE
                     QQLAVMDGCRSGQIKLLYIAPERLVMESFLDQLYQWRPALLAVDEAHCISQWGHDFRP
                     EYRALGQLKQRFPDLPVIALTATADEATRGDIVRLLNLDQPLIQISSFDRPNIRYTLV
                     EKFKPLDQLWRFVQDQRGKSGIIYCNSRAKVEDTTARLQSRGLSVAAYHAGLDNERRA
                     QVQEAFQRDDLQVVVATVAFGMGINKPNVRFVVHFDIPRTIESYYQETGRAGRDGLPA
                     EAVLLYDPADMAWLRRCLEEKPAGAQQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEG
                     KQQPCGNCDICLDPPKRYDGLADAQKALSCVYRVGQRFGLGYIVEVLRGANNQRIREM
                     GHDKLSVYGIGREQTHEHWVSVLRQLIHLGLLSQNIAQFSALQLTEAARPVLRAELPL
                     QLAVPRIQSLKVRSSANQKSYGGNYDRKLFAKLRKLRKSIADEGNIPPYVVFNDATLL
                     EMAEQMPITASELLSVNGVGQRKLERFGAPFMALIRDHVDNNDD"
     gene            244316..244936
                     /locus_tag="YPTB_RS01220"
                     /old_locus_tag="YPTB0203"
     CDS             244316..244936
                     /locus_tag="YPTB_RS01220"
                     /old_locus_tag="YPTB0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004714274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine transporter RhtB"
                     /protein_id="WP_002211485.1"
                     /db_xref="GI:488140277"
                     /translation="MLMLFLTVAFIHLVALISPGPDFFFVSQTAASRSRGEAMMGVLG
                     ISLGIVIWAGVALMGLNLILQKMAWLHQIIMVGGGMYLCWMGWQLLKSARAKHDVAEE
                     EVQVVLPARGRTFIRGLLTNLSNPKAVIYFGSVFSWFVGDDVGAGARWGLFILIVGET
                     FLWFTVVACVFALPTMRRGYQRLSKWIDGLAGVLFAGFGIQLILSR"
     gene            complement(244987..245607)
                     /gene="rhtB"
                     /locus_tag="YPTB_RS01225"
                     /old_locus_tag="YPTB0204"
     CDS             complement(244987..245607)
                     /gene="rhtB"
                     /locus_tag="YPTB_RS01225"
                     /old_locus_tag="YPTB0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine transporter RhtB"
                     /protein_id="WP_002211486.1"
                     /db_xref="GI:488140278"
                     /translation="MTLDWWLTYLLTTLILSLSPGSGAINTMSTAISHGTRGVVASIG
                     GLQLGLAVHIVLVGVGLGALVSQSLLAFEILKWLGAAYLIWLGIQQWRAAGSLDLHAL
                     ANSMPRRKLFKRAVFVNLTNPKSIVFLAALFPQFVLPQQPQVAQYLILGSTSVIVDII
                     VMIGYATLATRIARWIKSPQQMKLLNRIFGGLFMLIGALLATARKV"
     gene            245803..246816
                     /locus_tag="YPTB_RS01230"
                     /old_locus_tag="YPTB0205"
     CDS             245803..246816
                     /locus_tag="YPTB_RS01230"
                     /old_locus_tag="YPTB0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211487.1"
                     /note="lecithinase B; catalyzes the conversion of
                     1-lysophosphatidylcholine to glycerophosphocholine; can
                     also hydrolyze 2-acyl glycerophosphoethanolamine and other
                     substrates; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase L2"
                     /protein_id="WP_002211487.1"
                     /db_xref="GI:488140279"
                     /translation="MLLGHHMNNWLTREEQFAAFINGPLLDFWQQRDEQTFMGVDNIP
                     IRYVRFRAPHHTQVVVVVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRMLD
                     DHNRGHVIKFDDYIEDFAQLVQIEITGSHYQQRFALAHSMGGAILTRFLAREPDVFNA
                     VALCAPMFGIHLPLPGWLARRIVNWAEGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRE
                     RYRRYLRQYSDTPEIRVGGPTYHWLRESLLVGEQIIAEAEKITTPVLLLQASEDRVVH
                     NPAHDAFSQAMTLAGHPCEGGRPQVIQGARHEILFERDTLRAEALSAILRFFAQHQSS
                     VGH"
     gene            246851..247660
                     /locus_tag="YPTB_RS01235"
                     /old_locus_tag="YPTB0206"
     CDS             246851..247660
                     /locus_tag="YPTB_RS01235"
                     /old_locus_tag="YPTB0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_002211488.1"
                     /db_xref="GI:488140280"
                     /translation="MYHVVASDLDGTLLSPNHTLTPYTKETLKLLTQRDVHFVFATGR
                     HHIDVAQIRDNLEISAFMITSNGARVHNTEGELIFSHNLDADIARDLYNLEHHNPDIL
                     TNVYLGDEWFMNRECPEQEEFFRESVFNYQVFEPALLPTDGVCKVYFTCEDHDKLLIL
                     EEAINARWGDRVNVSFSFPTCLEVMGGGVSKGHALEQVAKIIGYSLKDCIAFGDGMND
                     VEMLSMSGKGCIMRDAHQRLKDVLPNLEVIGSNADDAVPHYLRKMFLGKEE"
     gene            247936..249135
                     /locus_tag="YPTB_RS01240"
                     /old_locus_tag="YPTB0207"
     CDS             247936..249135
                     /locus_tag="YPTB_RS01240"
                     /old_locus_tag="YPTB0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="viral enhancin family protein"
                     /protein_id="WP_002366764.1"
                     /db_xref="GI:488295556"
                     /translation="MSDINVTSPHFIPMKSPITARLDNSDLIDERPQKINFLGNKLNS
                     IADVNIDSKNKKITINIAEKKFSSDYIPEEYIYIAVWDAKGKMVFQKKLSDAEIKEEK
                     IELPFEVGYQLEMYHPIPSRLVSSPDLYSIIDSNSPFTLLVMTPLGVTNPKMESYPTD
                     IIEADFIHPNSVSVGVNADVIEPASTAEPTTSTPIAPDIPSASTDPIVSTSTRTGIDS
                     TTKLMVSFQFKLLGVCDYDIATVTIDEESKLAGIKIVTDTPHCHFGDELYASIKVTDK
                     QGHITFEEKLYGTNANISNTIIPFEKGYKLDIFHAEPSRLRVSSGDSDTLIPESKQNS
                     FIMTSIGIENTRQGSAEAIISDQFDTEKLVQDMSSFGDSSIAPVDNVYGYMGEKNHYQ
                     NVVSHVE"
     gene            complement(249209..250324)
                     /gene="glpQ"
                     /locus_tag="YPTB_RS01245"
                     /old_locus_tag="YPTB0208"
     CDS             complement(249209..250324)
                     /gene="glpQ"
                     /locus_tag="YPTB_RS01245"
                     /old_locus_tag="YPTB0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016674700.1"
                     /note="hydrolyzes deacylated phospholipids to glycerol
                     3-phosphate and the corresponding alcohols; periplasmic;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="WP_002211490.1"
                     /db_xref="GI:488140282"
                     /translation="MQTHVKTLLASLILAASMAAPAYAAKPASADKSASAIDKVVIAH
                     RGASGYLPEHSLPAKAMAYAQGADYLEQDLVMTKDNELVVLHDHYLDRVTDVAERFPD
                     RARKDGRYYAIDFTLPEIKSLKFTEGFDIDKNGKKVQSYPNRFPMGKSDFRVHTFQEE
                     IEFIQGLNHSTGKNTGIYPEIKAPWFHHQEGKDISTKVLEVLKEYGYTNKDDKVYLQS
                     FDVNELKRIKNELEPKMGMDLKLIQLIAYTDWNETYEQLPDGKWVNYNYDWMFKPGAM
                     KEVAHYADGIGPDYHMLVVKTSTAKDIKLTDLVKEAHASNMMVHPFTIRADRLPKYAT
                     DINQLFDIIYNQAQVDGVFTDFPDQGIQFLQKQQQHK"
     gene            250677..250775
                     /locus_tag="YPTB_RS01250"
     CDS             250677..250775
                     /locus_tag="YPTB_RS01250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002216569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate dehydrogenase subunit A"
                     /protein_id="WP_002216569.1"
                     /db_xref="GI:488145361"
                     /translation="MLDNMGCFIWGDGEIVTYFMKSAAILGDYSTF"
     gene            250949..252604
                     /locus_tag="YPTB_RS01255"
                     /old_locus_tag="YPTB0209"
     CDS             250949..252604
                     /locus_tag="YPTB_RS01255"
                     /old_locus_tag="YPTB0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate dehydrogenase subunit A"
                     /protein_id="WP_002211491.1"
                     /db_xref="GI:488140283"
                     /translation="MTNSSPYLETDVIIIGGGATGAGIARDCARRGLACTLLERHDIA
                     TGATGRNHGLLHSGARYAVTDGESARECIEENRILKRIARHCIEQTDGLFITLPEDSL
                     AYQLQFIARCRDAGIEAEAIDPAQALRLEPAVNPALIAAVRVPDGTVDPFRLTAANML
                     DAREHGANILTYHEVIGLLRQGSRINGVCVFDHKNQRKYDIHAQIVVNAAGIWGQHIA
                     EYADLRIRMFPAKGALLILGHRINNMVINRCRKPADADILVPGDTISLIGTTSTHINY
                     DQIDNMVVTAQEVDTLIREGAKLSPQLAQTRILRAYAGVRPLVASDDDPSGRNVSRGI
                     VLLDHASRDGVEGFITITGGKLMTYRLMAEWATDKVCEKLGISAACTTAQVPLPGSRQ
                     SAEQTLSKVISLPASIRGSAVYRHGDRATQLLVGNRLDNSLVCECEAVTAGEVRYAVE
                     SLSVNNLLDLRRRTRVGMGTCQGELCACRAAGLLSRFKVTTPQQSREQLTQFLNERWK
                     GVRPIAWGDALRESEFTQWVYQGLCGLDEIPATVNAREKHDEI"
     gene            252594..253868
                     /locus_tag="YPTB_RS01260"
                     /old_locus_tag="YPTB0210"
     CDS             252594..253868
                     /locus_tag="YPTB_RS01260"
                     /old_locus_tag="YPTB0210"
                     /EC_number="1.1.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAH6.1"
                     /note="sn-glycerol-3-phosphate dehydrogenase (anaerobic);
                     catalyzes the formation of dihydroxyacetone from glycerol
                     3-phosphate; part of GlpABC complex; presumably this
                     subunit is responsible for membrane interactions and
                     contains iron-sulfur clusters; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic glycerol-3-phosphate dehydrogenase
                     subunit B"
                     /protein_id="WP_011191516.1"
                     /db_xref="GI:499504876"
                     /translation="MKFDVIIIGGGLAGLACGIRLAEQGKYCAIVSAGQNALHFSSGS
                     LDLLAKLPDGRAVSQPLSALSALAELAPEHPYSKMRNITQLDELVQEAEALLRRCGLD
                     IVGSSAENHLRLTPLGSCRPTWLSLADIPVAPLNGPLPWQRVAVIGIEGFLDFQPQMV
                     ASALQDQGIDATADYLHLPALDRLRDNPSEFRAVNIARILDLPENRQPLADELSRLSS
                     TAEMILLPACIGLDKSAPLDALRAVVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGG
                     LVMPGDAVLRAELVDNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFDKVYEP
                     ILDLDILSLPHRADWSHSNLFAPQPYLQFGVNTDNHLRPLRGGVALENLHAIGAVLGG
                     YDPLQQGCGAGVSLTSAVFVAEQIISEMAVTL"
     gene            253865..255160
                     /gene="glpC"
                     /locus_tag="YPTB_RS01265"
                     /old_locus_tag="YPTB0211"
     CDS             253865..255160
                     /gene="glpC"
                     /locus_tag="YPTB_RS01265"
                     /old_locus_tag="YPTB0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191517.1"
                     /note="anaerobic; with GlpAB catalyzes the conversion of
                     glycerol-3-phosphate to dihydroxyacetone phosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate dehydrogenase subunit C"
                     /protein_id="WP_011191517.1"
                     /db_xref="GI:499504877"
                     /translation="MTGLPKHDASPEQDGTMVGDSRLTRDNSFESCIKCTVCTTYCPV
                     AKVNPLYPGPKQAGPDGERLRLKDPALYDDALKYCTNCKRCEVACPSDVKIGDIIQRA
                     KASHSTNKPKLRDAILSHTDIMGTLSTPFAPVINAVTGLKPVRVLLDKALKIDHRREL
                     PKYSFGTFRRWYRKQAEKQQQYTEQVAFFHGCFVNYNHPQLGKDLVSVFNAMNIGVQL
                     LKREKCCGVPLIVNGFIEQAKKQARVNLESLTDTVIGRDIPVVATSSSCTFTLRDEYP
                     HLLDVDTTPVRDKVELATRYLYRLLDQGRELPLKPLFSLNPLLASQEAPLRIAYHTPC
                     HMEKMGWTAYTLALLQRIPGVELVVLDSQCCGIAGTYGFKSENYATSQGIGASLFQQI
                     EDSGVDLVITDCETCKWQIEMSTSKKCEHPITLLARVLA"
     gene            complement(255304..255831)
                     /locus_tag="YPTB_RS01270"
                     /old_locus_tag="YPTB0212"
     CDS             complement(255304..255831)
                     /locus_tag="YPTB_RS01270"
                     /old_locus_tag="YPTB0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_002211494.1"
                     /db_xref="GI:488140286"
                     /translation="MYKKIVRFLAVGLLVAGLSACDNSSDNNVGQTVSLLDGKVTFNL
                     PADLSDQSGKMGNQANNMHVYANNTGDKAVIVILGEGTNEKLEVLTNRLAEQQRARDA
                     NLQVVTNKTININGQPFQQLDSIITSSGQKAYSSIVMGTVGNQLMTLQITLPAENQQQ
                     AQTEAESIISTLKLK"
     gene            complement(255961..256629)
                     /locus_tag="YPTB_RS01275"
                     /old_locus_tag="YPTB0213"
     CDS             complement(255961..256629)
                     /locus_tag="YPTB_RS01275"
                     /old_locus_tag="YPTB0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191518.1"
                     /db_xref="GI:499504878"
                     /translation="MFSFTAQQRMTALVWLSLFHIVIITSSNYLVQLPIAIFGFHTTW
                     GAFTFPFIFLATDLTVRIFGAPLARRIILSVMVPALLISYLISALFYQGSWQGFPALT
                     SFNLVVARIAVASFMAYVLGQILDVQVFNRLRQRNAWWVAPTAAMFFGNISDTMAFFF
                     IAFYRSSDPFMAAHWVEIALVDYSFKLLICMLFFLPAYGVMLNVLLKYFARQTGQPVL
                     ATER"
     gene            256913..257167
                     /locus_tag="YPTB_RS01280"
                     /old_locus_tag="YPTB0214"
     CDS             256913..257167
                     /locus_tag="YPTB_RS01280"
                     /old_locus_tag="YPTB0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAI0.1"
                     /note="TusA; transfers sulfur to TusBCD complex; involved
                     in thiouridation of U34 position of some tRNAs; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase TusA"
                     /protein_id="WP_002215973.1"
                     /db_xref="GI:488144765"
                     /translation="MTDIFANPDKTLDALGLRCPEPVMMVRKTVRHMEEGQTLLIIAD
                     DPATTRDIPGFCRFMDHQLLAQDTEQTPYRYLVRKGITAG"
     gene            complement(257232..259598)
                     /gene="zntA"
                     /locus_tag="YPTB_RS01285"
                     /old_locus_tag="YPTB0215"
     CDS             complement(257232..259598)
                     /gene="zntA"
                     /locus_tag="YPTB_RS01285"
                     /old_locus_tag="YPTB0215"
                     /EC_number="3.6.3.3"
                     /EC_number="3.6.3.5"
                     /function="pumps out Pb++/Cd++/Zn++/Hg++"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002231925.1"
                     /note="P-type ATPase involved in the export of lead,
                     cadmium, zinc and mercury; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc/cadmium/mercury/lead-transporting ATPase"
                     /protein_id="WP_011191519.1"
                     /db_xref="GI:499504879"
                     /translation="MHSHSEHQKSVETNSNCGCGHTHDKHQTGCSNLATAANSDAISH
                     DSVSEHSHHDGESCSHTHADEADEESDRLDTTIVSGTQRFSWQVKGMDCPSCARKIEN
                     AISGLDGVEKVKVLFTTEKLVVDARADVRSLVQKAVIATGFSLVNTQTTAGQKNVATE
                     SRLREYLPLALLSTLMLISWGLSFFNTELSQTAFTITTIVGLIPFVIKSWKLIRSGTP
                     FAIETLMSVAAIGAVFIGATAEAAMVLLLFMVGELLESYAVNRARRGVTALMALVPEE
                     ALLLKDGKRTLVPVADLRPGDIIEIPPGGRLPADAELQASFASFDESALTGESIPVER
                     QQGEKVAAGCLSVDRAVEMCVVSEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIY
                     TPIIILFSILVILVPPLVFAAPWEPWIYRGLTLLLIGCPCALVISTPAAITSALAAAT
                     RRGALIKGGAALEQLGRSQIIAFDKTGTLTEGKPKVTDVLPISGISETRLLTLAAAVE
                     AGSHHPLAIAIIQCAQQNQRAQQNQRAQQNTPMLPLAEERRALAGVGIEGVVNGLMVR
                     VSAPSKLSPALLTDEWLAQIDQLESSGKTAVVVLEDEKFIGLLALRDTLRTDAKQAID
                     ALKKLGIQGVMLTGDNPRAAAAIAGELGIDYRAGLLPADKVQAVMALNALQPTVMVGD
                     GINDAPAMKASSIGVAMGSGTDVALETADAALTHNRLTGLAEIILLSRAANANIRQNI
                     TIALGLKAIFLVTTLLGLTGLWLAVLADSGATALVTANALRLLRKRDV"
     gene            complement(260012..260638)
                     /locus_tag="YPTB_RS01290"
                     /old_locus_tag="YPTB0216"
     CDS             complement(260012..260638)
                     /locus_tag="YPTB_RS01290"
                     /old_locus_tag="YPTB0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002211498.1"
                     /db_xref="GI:488140290"
                     /translation="MSWPFLAVFFSGWLFVDATYRGPRWQRWVFKPVTLLLLLLLAWQ
                     APALGPAGYLIVLGLLATLLADALLLLPSERLLYALGAFFLSHLLYTISFASQMTLTL
                     FWPLPLVLIVVGALLLAALWTQLQDMRWPVVAFIGMTLLMVWMAGEQYFARSTDLGFS
                     LLAGSVLLLLSHAVWLLNRYRFSFRASDAIAAGCYFIGHFLIVRSLYL"
     gene            260928..261248
                     /locus_tag="YPTB_RS01295"
                     /old_locus_tag="YPTB0217"
     CDS             260928..261248
                     /locus_tag="YPTB_RS01295"
                     /old_locus_tag="YPTB0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005163956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002211499.1"
                     /db_xref="GI:488140291"
                     /translation="MANEQLLYRIQFINNGKNYQLYVREIGSSSLFGFIEIADFVFDS
                     QSTLLVDPSTEKLKTEFSGVNRSYIPLHAVIRIDSVTEKGSARISELGNNVMNFPYLP
                     GNKP"
     gene            261460..261879
                     /locus_tag="YPTB_RS01300"
                     /old_locus_tag="YPTB0218"
     CDS             261460..261879
                     /locus_tag="YPTB_RS01300"
                     /old_locus_tag="YPTB0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002211500.1"
                     /db_xref="GI:488140292"
                     /translation="MSKLPLLFIAVVVLIVVLATRQYWQKKQQDAENDRAPVRSVQVE
                     VVDKREVLAPNRRSRQREEIVAEEKRYEVYFRPLSSGIEIKNSLGLSGGNEIKSGSEI
                     KMVLPQQEYNRIEQGAQGILRLQGTRYIGFIPDAPHP"
     gene            complement(262056..262328)
                     /locus_tag="YPTB_RS01305"
                     /old_locus_tag="YPTB0219"
     CDS             complement(262056..262328)
                     /locus_tag="YPTB_RS01305"
                     /old_locus_tag="YPTB0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005163952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002211501.1"
                     /db_xref="GI:488140293"
                     /translation="MWINLGRLLMLGVWFFILLNLFQPYPKPLRYFIHVAMIFMVLMH
                     GLQLVLLKSTQPKDQPISGLQQFKIFVFGVFELLAWQKKQPQLPKK"
     gene            complement(262318..262980)
                     /gene="rsmD"
                     /locus_tag="YPTB_RS01310"
                     /old_locus_tag="YPTB0220"
     CDS             complement(262318..262980)
                     /gene="rsmD"
                     /locus_tag="YPTB_RS01310"
                     /old_locus_tag="YPTB0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012229076.1"
                     /note="catalyzes the methylation of 16S rRNA at position
                     G966; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011191520.1"
                     /db_xref="GI:499504880"
                     /translation="MAKQPIAKRSIVKKASPQSAGQIRIIGGKWRGRKLPVPDSPGLR
                     PTTDRVRETLFNWLAPMIQGARCLDCFAGSGALGLEALSRYASETTLLEADRQVAKQL
                     SDNLTLLKAENGQVVNTNSLQWLAQPGQPFNLVFLDPPFRKGLLAETINLLEQFNWLA
                     ADAWIYVEAEAESAVADVPANWLLHREKIAGQVAYRLFIRQQTDLPACTSVAEQEQHH
                     VD"
     gene            complement(263090..263233)
                     /locus_tag="YPTB_RS01315"
     CDS             complement(263090..263233)
                     /locus_tag="YPTB_RS01315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002215975.1"
                     /db_xref="GI:488144767"
                     /translation="MAYTFGYNNSLGYNNNVQVYHFLLDSNTRTMMLSTVNSIVIANI
                     SAT"
     gene            263262..264986
                     /locus_tag="YPTB_RS01320"
                     /old_locus_tag="YPTB0221"
     CDS             263262..264986
                     /locus_tag="YPTB_RS01320"
                     /old_locus_tag="YPTB0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsY"
                     /protein_id="WP_011191521.1"
                     /db_xref="GI:499504881"
                     /translation="MAKEKKRGFFSWLGLGRQSEEPAAEPLATEKEGVTEQEDVIEQT
                     GVIEPTDVIEQTVEHVISEKTTEAPAENAFIEVELREQVAAVIPTEPNNAIMSEGVPD
                     TLPERAVAESVVAELVETGDNAAIVHDEIIEPITQVTEAGGELSLVKPGIEGDTTEQG
                     GPTDNLPKRSLTEDNLIIDVPTPQAVVEESRVDAVEQPTETSEVEEVEEVEEVEEVEE
                     VEEVEEVEEVEEVEEVEEVEEVEEVEEVEEVEEVEEKIIPVAAQEQERPTKEGFFARL
                     KRSLIKTKQNLGSGFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTEHAS
                     RKQLKDADALYGKLKEEMSEILSKVDKPLDVSGKSPYVILMVGVNGVGKTTTIGKLAR
                     QFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVVAQHTGADSASVIFDAIQAAKA
                     RGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQA
                     KLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADEFI
                     EALFARED"
     gene            264992..265660
                     /locus_tag="YPTB_RS01325"
                     /old_locus_tag="YPTB0222"
     CDS             264992..265660
                     /locus_tag="YPTB_RS01325"
                     /old_locus_tag="YPTB0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080173.1"
                     /note="ATP-binding protein of an ATP-binding cassette
                     transporter; when bound to FtsX, FtsEX localizes to the
                     cell division site and plays a role in the assembly or
                     stability of the septal ring under low-salt growth
                     conditions; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsE"
                     /protein_id="WP_004391337.1"
                     /db_xref="GI:490526023"
                     /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTL
                     LKLICGIERPSAGHIWFGGHDISRLKNREVPFLRRQIGMIFQDHHLLLDRTVYDNVAM
                     PLIIAGASTEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLL
                     ADEPTGNLDDALSEGILRLFEEFNRVGVTVLMATHDTSLIARRRYPILTLSQGRMSGA
                     HHGE"
     gene            265650..266603
                     /gene="ftsX"
                     /locus_tag="YPTB_RS01330"
                     /old_locus_tag="YPTB0223"
     CDS             265650..266603
                     /gene="ftsX"
                     /locus_tag="YPTB_RS01330"
                     /old_locus_tag="YPTB0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211505.1"
                     /note="ABC transporter, membrane protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsX"
                     /protein_id="WP_002211505.1"
                     /db_xref="GI:488140297"
                     /translation="MANNARKAKTKALKGGWREQWRYSWVNAIADMMRQPMATLLTVM
                     VISISLTLPSVCYIVWKNVSQAAEQWYPTPQLTVYLDKALDDNAAENVVVTLKAEAGV
                     EKVNYLSREEAMGEFRNWSGFGGALDMLEENPLPAVAIITPKLNFQSAETLNTLRDRI
                     SQVEGVAEVRMDDSWFARLAALTGLVGQVAAMVGVLMVVAVFLVIGNSVRLSIFSRRD
                     TINVMKLLGATDGFILRPFLNGGAMLGFGGAVLSLILSEALVWQLGSVVKQVATVFGT
                     QFTLHGLSWDESLLLVLISAMIGWIAAWLATVQHLRRFTPQ"
     gene            266914..267771
                     /locus_tag="YPTB_RS01335"
                     /old_locus_tag="YPTB0224"
     CDS             266914..267771
                     /locus_tag="YPTB_RS01335"
                     /old_locus_tag="YPTB0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006708562.1"
                     /note="binds with the catalytic core of RNA polymerase to
                     produce the holoenzyme; this sigma factor is responsible
                     for the expression of heat shock promoters; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-32"
                     /protein_id="WP_002211506.1"
                     /db_xref="GI:488140298"
                     /translation="MTKEMQTLALVPQGSLEAYIRAANAYPMLTAEEERELAERLHYQ
                     GDLGAAKQLILSHLRFVAHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLV
                     SFAVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVELVAKE
                     LGVTSKDVREMESRMSAQDMTFDPSPDDEARDGQFMAPVLYLQDKTSDFADGIEEDNW
                     DSHAADKLSYALEGLDERSQHIIRARWLDDENKSTLQELADQYGVSAERVRQLEKNAM
                     KKLRMAIEA"
     gene            complement(267978..268370)
                     /locus_tag="YPTB_RS01340"
                     /old_locus_tag="YPTB0225"
     CDS             complement(267978..268370)
                     /locus_tag="YPTB_RS01340"
                     /old_locus_tag="YPTB0225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_011191522.1"
                     /db_xref="GI:499504882"
                     /translation="MKLTIERLITLTHQDVIDLAKIWPNQQPAAWQQWITEGRPLFAA
                     RFNERLLGAVKVAVYDQQAELQDLCVREVTRRRGVGLYLIEETLRQLPEIKHWYLNGG
                     DLTAAERPQINSFMLACGFSHEAQGWRR"
     gene            268792..269907
                     /locus_tag="YPTB_RS01345"
                     /old_locus_tag="YPTB0226"
     CDS             268792..269907
                     /locus_tag="YPTB_RS01345"
                     /old_locus_tag="YPTB0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191523.1"
                     /note="with LivFGHM is involved in the high affinity
                     leucine transport; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_011191523.1"
                     /db_xref="GI:499504883"
                     /translation="MKLTKGKALLAGCMAMAMSHSVLAQDIKVAIVGAMSGPVAQYGD
                     MQFTGARQAIADINASGGIKGDKLVGVEYDDACDPKQAVAVANKVINDGIRYVIGHLC
                     SSSTQPASDIYEDEGVIMITPAATNADLTTRGYKMIMRTTGLDSDQGPTAAKYIVETI
                     KPKRIAVVHDKQQYGEGLARSVRDSLKEQGAEVVLFEGVTAGDKDFSTLVARLKKENV
                     DFVYFGGYYPEMGQILRQAKQAGLTARFMGPEGVGNSSLSNIAGEASEGMLVTLPKRY
                     DQVPANQPIVDALKAKKLDPTGPFVWTTYAALQSLTTAMERTGSKEPADLANDLKTGK
                     PVETVMGPLSWDDKGDLKGFEFGIFEWHAAGSSTAVK"
     gene            270088..271014
                     /locus_tag="YPTB_RS01350"
                     /old_locus_tag="YPTB0227"
     CDS             270088..271014
                     /locus_tag="YPTB_RS01350"
                     /old_locus_tag="YPTB0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003852206.1"
                     /note="LivHMGF is the membrane component of the LIV-I/LS
                     branched-chain amino acid transporter; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transporter permease
                     subunit LivH"
                     /protein_id="WP_002211509.1"
                     /db_xref="GI:488140301"
                     /translation="MSEQFLYFLQQMFNGITLGSTYALIAIGYTMVYGIIGMINFAHG
                     EVYMISSYVSFIVIAALMMVGIDASWLLIGCAFLVSIVIASTYGWSIERVAYKPVRRS
                     KRLIALISAIGMSIFLQNYVSLTQGSRDLALPSLVTGQWTLGESNGFAATISTMQLTI
                     WIVTFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGINTDRVISLTFVIGALMAAV
                     AGVLLGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLVLGVAEALTSAYLS
                     TEYKDAVSFALLIVVLLVMPTGILGRPEVEKV"
     gene            271011..272297
                     /gene="livM"
                     /locus_tag="YPTB_RS01355"
                     /old_locus_tag="YPTB0228"
     CDS             271011..272297
                     /gene="livM"
                     /locus_tag="YPTB_RS01355"
                     /old_locus_tag="YPTB0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104327.1"
                     /note="Part of the ABC transporter complex LivFGHMJ and
                     LivFGHMK involved in the high-affinity transport of
                     branched-chain amino acids; LivFGHMK is specific for the
                     transport of leucine, while LivFGHMJ is a transporter for
                     leucine, isoleucine, and valine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine transporter permease
                     subunit"
                     /protein_id="WP_002211510.1"
                     /db_xref="GI:488140302"
                     /translation="MKQLNFVNAIISSFVLLVLASFVMGLQLQLDGTRLVVQGASEVR
                     WLWIGAGCLVVFCFQLVRPLIQQGIKKVSGPAWVLPSFDGTTPRQKLLAAVVIIAAVA
                     WPFLVSRGSVDIATLTLIYVMLGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLNHYY
                     GLGFWESLPLAGITAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGG
                     PNGISQIPKPTLFGLEFSRTAKDGGWDTFHNFFGLTYDPSHRIIFLYLVALLLVILTL
                     FVINRLLRMPLGRAWEALREDEIACRSLGLSPTKIKLTAFTISAAFAGFAGTLFAARQ
                     GFVSPESFTFVESAFVLAIVVLGGMGSQFAVILAAVLLVVSRELMRDLNAYSMLLLGA
                     LMVLMMIWRPQGLLPMKRPQLKLKVADVKAKQGEQA"
     gene            272294..273061
                     /gene="livG"
                     /locus_tag="YPTB_RS01360"
                     /old_locus_tag="YPTB0229"
     CDS             272294..273061
                     /gene="livG"
                     /locus_tag="YPTB_RS01360"
                     /old_locus_tag="YPTB0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191524.1"
                     /note="Part of the ABC transporter complexes LivFGHMJ and
                     LivFGHMK involved in the high-affinity transport of
                     branched-chain amino acids; LivFGHMK is specific for the
                     transport of leucine, while LivFGHMJ is a transporter for
                     leucine, isoleucine, and valine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_011191524.1"
                     /db_xref="GI:499504884"
                     /translation="MNGQPLLTVEGLSMRFGGLLAVNNVGLTLNQGEIVSLIGPNGAG
                     KTTIFNCLTGFYRPTGGTIKLRERHLEGLPGQMIARMGVIRTFQHVRLFREMTVIENL
                     LVAQHQHLKSGIFAGLLKTPGFRRAEADALARAATWLERVGLLALANRQAGNLAYGQQ
                     RRLEIARCMVTRPELLMLDEPAAGLNPKETDELNQLIMELRDQHQVSVLLIEHDMKLV
                     MGISDRIYVVNQGTPLAQGIPAEIRNNPDVIRAYLGE"
     gene            273106..273807
                     /gene="livF"
                     /locus_tag="YPTB_RS01365"
                     /old_locus_tag="YPTB0230"
     CDS             273106..273807
                     /gene="livF"
                     /locus_tag="YPTB_RS01365"
                     /old_locus_tag="YPTB0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011906446.1"
                     /note="with LivGHMJ and LivGHMK is part of the
                     high-affinity branched-chain amino acid transport system;
                     LivFGHMK is specific for the transport of leucine, while
                     LivFGHMJ is a transporter for leucine, isoleucine, and
                     valine; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_002211512.1"
                     /db_xref="GI:488140304"
                     /translation="MLSFNQVSAHYGKIQALHQVSLHIQQGEIVTLIGANGAGKTTLL
                     GTLCGEPRATEGNIVFGEQDITHWQTARIMREAIAIVPEGRRVFSRMTVEENLAMGGF
                     FADRQQYQQRIERVYDLFPRLFERRIQRAGTMSGGEQQMLAIGRALMSQPKLLLLDEP
                     SLGLAPIIILQIFDTIQQLREEGMTIFLVEQNANQALKLADRGYVLENGRIVLEDTGA
                     ALLANEAVRSAYLGG"
     gene            274035..274496
                     /locus_tag="YPTB_RS01370"
                     /old_locus_tag="YPTB0231"
     CDS             274035..274496
                     /locus_tag="YPTB_RS01370"
                     /old_locus_tag="YPTB0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191525.1"
                     /db_xref="GI:499504885"
                     /translation="MIGGTSNTMDLHGLSAVCSFAFLTADLMLNITNKNGDNHEYKVT
                     SSHVNNDKLQGPKGILKATKNHAELNNKNIASGEKNAIKFDQLHVREIPNREQASYID
                     NLSLNRNIYLDTRADRECRIPTQVISPVQKVDSGTKEPSWFSKYLCITTLY"
     gene            complement(274611..275717)
                     /locus_tag="YPTB_RS01375"
                     /old_locus_tag="YPTB0232"
     CDS             complement(274611..275717)
                     /locus_tag="YPTB_RS01375"
                     /old_locus_tag="YPTB0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191526.1"
                     /db_xref="GI:499504886"
                     /translation="MNIKNKSLFIGLLLLFLQPTTAVANKWAGIYFYPLASKYSNCKM
                     TLSEDNHLTVSFDVTLADHLFDISNSDHLQRWQELTRSQQHIMLAQNKALLYLYFYRA
                     DGSIDFSLQSGEVQDMSLNGVPAQHISNYIREAIFVSTPAFSNQSYHVSFSLAVSTLK
                     HIRMGATIGGVLHSEGQQYSVRSPNGVAFNQSGNQCEFFDPTTEIAPAHALYIEPKFR
                     LGSAIWQLKSLDLDHLLDSTADNHGLHAPLVNAPANRFCIHYSSVGIQNRRYMISASN
                     LNGLAESSRYFQLKDNQGEHIINYKVTLKNHEDSEADFSLPKEKKFVQLKSDTSSGGE
                     AQMCWSPRIRVYSTDTTDKGHYTDTLNFTITPLA"
     gene            complement(275942..276460)
                     /locus_tag="YPTB_RS01380"
                     /old_locus_tag="YPTB0233"
     CDS             complement(275942..276460)
                     /locus_tag="YPTB_RS01380"
                     /old_locus_tag="YPTB0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191527.1"
                     /db_xref="GI:499504887"
                     /translation="MNTIKMAITLLLLSWHTCWAATPLGDIDVKLEVTAQPRIEIEKP
                     HGGWYDNIKLHNSPENHAVYEVEVPVAVKLRRQEGYQISIKNPLILTRQSDAFSAIEQ
                     TFSPAEVRWGNNRTNLRLLSAVPESFSVPPQATRHTTTDYVLHISAKAPAGDNTAGKY
                     HGQLTLVFEVNS"
     gene            complement(276522..277169)
                     /locus_tag="YPTB_RS01385"
                     /old_locus_tag="YPTB0234"
     CDS             complement(276522..277169)
                     /locus_tag="YPTB_RS01385"
                     /old_locus_tag="YPTB0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191528.1"
                     /db_xref="GI:499504888"
                     /translation="MKNLVFAAISLLPLSAAGVIDIQPQVVELQQENTVVTVINHGMT
                     AEYITVQLYRLNNPGVAPELESLTPVGYQQQPLLFATPLKLTLGPRQSGKIFLHALGA
                     PEQEQVYRLAVVPGNHLKISGNNTAVVGVQISYMGLIRHLPASIQHQWTHRCIAGKPE
                     LHNTGNTRLYWHQLQAQGQMIDDFTLYPGQHRQLAFNELQGKVEDQAVSLQCPSG"
     gene            complement(277141..277827)
                     /locus_tag="YPTB_RS01390"
                     /old_locus_tag="YPTB0235"
     CDS             complement(277141..277827)
                     /locus_tag="YPTB_RS01390"
                     /old_locus_tag="YPTB0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="WP_011191529.1"
                     /db_xref="GI:499504889"
                     /translation="MKYLYSILSIALLLAPGTATYGQLLATPTRIAVEAQEQKRTVQV
                     YNSGDTPLYLDITLQRVDNPGVNPERKTPISEISQPEMIFNPNRITLGPRQKRDITLI
                     PLKSPVQETLYRLYINPVLNIKAVGDGEDKSKVHAPMTISIGYGVLIHHLPPAAAQTR
                     HWQHQCSATGELALTATGTVHSKFKQLESGGNPALADSLNLYPGTALTLPVKQLNGEV
                     DGEKFSLRCH"
     gene            complement(277845..280178)
                     /locus_tag="YPTB_RS01395"
                     /old_locus_tag="YPTB0236"
     CDS             complement(277845..280178)
                     /locus_tag="YPTB_RS01395"
                     /old_locus_tag="YPTB0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191530.1"
                     /db_xref="GI:499504890"
                     /translation="MAYYSKINHSLLFTLALFTLKLAHAEAVKIEYLVPMGFSAAEEN
                     NSLQLLGVLDSKTLPSPITFSEEKQQLQFNQQNDRHNNISEESIILLGKILSQIPYLQ
                     CKTGCDYTLSGHRVALDKVNNTLTITNNNNRYLMPTTTWGLVSNQSLDLRMTAAHYRA
                     MSVRGQSYIGLPWQSYGFASWFYNAIQSQNTLQSQNTMPSQSTYQPVNRPQYQRLTQK
                     GIGSWYLQKNFSALYLRTGRQNNLDNNAGSVHTLINPALDQFVTLGSQSYLAIDKPST
                     GSIVLYAAQDGDYEIYRDNQLIRRIPAQLGRNEIDYSQLPGGYYNVEIRLVDRLGRIV
                     SQENQTISNIGNQTNNGWFLTMGKGPAKGKKTPRLVQFGRSRVIESVQTNITLLKDDA
                     HHWAVEANVSRPLSLNKVNITPTGGLMSGEKRSGGYVRLNGGNNTLGYFSLARYQSPY
                     VSRYAPDSGSTSGSYTRRIGPTQLSYQFNQYRNNRQHRIQSGWDWQLPQFNLALSLGL
                     QNGGQWNSHNNYGVFLNTTLSFGQSNASINTAYTQQQLNTSASYQKEFIDNYGASTLG
                     VSGSASGKLNSVGGFAKRSGSRGDISGRVGIDNQITNGGISYNGMLALSSQGVALGRS
                     SYSGAALLIKAPALGGTPYSFHVEDSPITGGGIYAIPVPRYQDRFFVRTHTDRSDMDM
                     NIQLPVNIVRAHPGQVFSGKADITLNLLYSGFLKNAQGLPVSGVIEETGDTAYPNGLF
                     SINAQNRLQAITVQGPSGRYRCDMHSQPTHIYLCHAD"
     gene            complement(280445..280936)
                     /locus_tag="YPTB_RS01400"
                     /old_locus_tag="YPTB0237"
     CDS             complement(280445..280936)
                     /locus_tag="YPTB_RS01400"
                     /old_locus_tag="YPTB0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002228181.1"
                     /db_xref="GI:488156973"
                     /translation="MMKKTVIAIITMATLTSTAAYANTIEKDIRVEAEIISLMDVKRA
                     DDSNINKIKLTYDTVTNDGTYSHSEAIKVKARKQLGDKLKVSLAAPVILSEPNNNKEF
                     THVEVLLDGKKLLETADTRDLIAFHGSELNAELKVSAKEPNNAVGGEKYSGVIQLRLE
                     PSA"
     gene            281491..282810
                     /locus_tag="YPTB_RS01405"
                     /old_locus_tag="YPTB0238"
     CDS             281491..282810
                     /locus_tag="YPTB_RS01405"
                     /old_locus_tag="YPTB0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004710220.1"
                     /note="with UgpACE is involved in the uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate-binding periplasmic
                     protein UgpB"
                     /protein_id="WP_011191531.1"
                     /db_xref="GI:499504891"
                     /translation="MFNNSIHKVSICIALTLTFSANAMAVTEIPFWHSMEGELGKEVD
                     SIADRFNQSQPDYKIVPVYKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKA
                     IKPVYQVFKDANIDFDESVFVPTVAGYYTDSKTGRLLSQPFNSSTPVLYYNKEAFKKA
                     GLDPEQPPKTWQELAADTAKLRAAGSSCGYASGWQGWIQIENFSAWHGQPIASRNNGF
                     DGTDAVLEFNKPLQIKHIQLLSDMNKKGDFTYFGRKDESTSKFYNGDCAITTASSGSL
                     ASIRHYAKFNFGVGMMPYDADAKNAPQNAIIGGASLWVMDGKDKETYKGVAEFLQYLV
                     KPEIAAEWHQKTGYLPITTAAYELTKQQGFYEQNPGADVATRQMLNKPPLPYTKGLRL
                     GNMPQIRTVVDEELEAVWTGKKTPQAALDNSVKRGDVLLRRFEQANK"
     gene            283108..283992
                     /locus_tag="YPTB_RS01410"
                     /old_locus_tag="YPTB0239"
     CDS             283108..283992
                     /locus_tag="YPTB_RS01410"
                     /old_locus_tag="YPTB0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66FU6.1"
                     /note="with UgpEC is involved in the uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol 3-phosphate ABC transporter
                     permease"
                     /protein_id="WP_011191532.1"
                     /db_xref="GI:499504892"
                     /translation="MSPSRPGFSCSWLPYLLVLPQLAITAIFFLWPAGEALWYSVQTL
                     DPFGLSSEFVGLSNFIQLFQDEYYLASFYTTLIFSALVAGIGLNVSLFLAAMVDYVLR
                     GSRLYQTLLILPYAVAPAVAAVLWIFLFDPGLGLITHALAKLGYSWNHAQNSGQAMFL
                     VVLASVWKQISYNFLFFLAALQSIPKSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFL
                     LVVNLVYAFFDTFPVIDAATGGGPVQATTTLIYKIYREGFAGLDLSSSAAQSVILMLL
                     VIGLTVIQFRFVERKVRY"
     gene            283992..284837
                     /locus_tag="YPTB_RS01415"
                     /old_locus_tag="YPTB0240"
     CDS             283992..284837
                     /locus_tag="YPTB_RS01415"
                     /old_locus_tag="YPTB0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66FU5.1"
                     /note="with UgpABC is involved in uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol 3-phosphate ABC transporter
                     permease"
                     /protein_id="WP_002211522.1"
                     /db_xref="GI:488140314"
                     /translation="MIENRRGLDIFCHIMLIIGVLLILFPLYVAFVAASLDDSQVFQA
                     PMTLIPGPHLWQNISHIWHAGVGNNSTPFGLMLLNSFVMAFAITVGKITVSILSAYAI
                     VYFRFPLRNLFFWLIFLTLMLPVEVRIFPTIEVIANLNLLDSYTGLTLPLMASATATF
                     LFRQFFMTLPDELLEAARIDGAGAMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWP
                     ILITSDASMGTAVAGIRSMISTSGAPTQWNQVMAAMILTLIPPVVVVLLMQRWFVRGL
                     VDSEK"
     gene            284844..285917
                     /gene="ugpC"
                     /locus_tag="YPTB_RS01420"
                     /old_locus_tag="YPTB0241"
     CDS             284844..285917
                     /gene="ugpC"
                     /locus_tag="YPTB_RS01420"
                     /old_locus_tag="YPTB0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1CNC6.1"
                     /note="part of the UgpABCE glycerol-3-phosphate uptake
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate import ATP-binding
                     protein UgpC"
                     /protein_id="WP_011191533.1"
                     /db_xref="GI:499504893"
                     /translation="MACLKLQAVTKSYDGVTPVIKQIDLDVADGEFIVMVGPSGCGKS
                     TLLRMVAGLERTTTGDIYIGDQRVTDLEPKDRGIAMVFQNYALYPHMNVFDNMAYGLK
                     IRGFGKEQIRQRVDEAARILELQPLLKRKPRELSGGQRQRVAMGRAIVREPAVFLFDE
                     PLSNLDAKLRVQMRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVIVMNKGVAEQIGT
                     PSEVYKRPASLFVASFIGSPAMNLLDGTVSPDGRTFILSDGLTLPLEIPQPQWGGRRL
                     TLGIRPEHIQQTTSAQGVPMNLLTLELLGADNLAHGLWGGQSIIARLSHEEMPVAGST
                     LHLYLPPAALHFFDTDSGLRIEP"
     gene            285914..286663
                     /gene="ugpQ"
                     /locus_tag="YPTB_RS01425"
                     /old_locus_tag="YPTB0242"
     CDS             285914..286663
                     /gene="ugpQ"
                     /locus_tag="YPTB_RS01425"
                     /old_locus_tag="YPTB0242"
                     /EC_number="3.1.4.46"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211524.1"
                     /note="hydrolyzes diesters during transport at the inner
                     face of the cytoplasmic membrane to glycerol-3-phosphate
                     and alcohol; induced when cells are starved for inorganic
                     phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="WP_011191534.1"
                     /db_xref="GI:499504894"
                     /translation="MNRDWPYPPIVAHRGGGSLAPENTLAAIDVGARYGHKMIEFDAK
                     LSQDGQIFLLHDDTLERTSNGWGVAGELAWEKLIQLDAGDWFSKAFRGERLPLLSEVA
                     ARCAQHGMAANIEIKPTTGTDAPTGRAIALAARALWQGQPIPPLLSSFSVDALAAAQL
                     AAPELPRGLLLDKWDDNWAALTTQLDCVSLHINHKQLTAERVALLKAAGLRILVYTVN
                     QPERARELLNWGVDCICTDRIDLLGSDFTGC"
     gene            286764..287720
                     /locus_tag="YPTB_RS01430"
                     /old_locus_tag="YPTB0243"
     CDS             286764..287720
                     /locus_tag="YPTB_RS01430"
                     /old_locus_tag="YPTB0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002224020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002224020.1"
                     /db_xref="GI:488152812"
                     /translation="MPAFVVSLWHQIVLSSPLFVLLALGYALVRFGKWPSTITDGLTR
                     FVFSLALPAMLFRMMCDFSERPAVDARLLIAFFGSCLVVFIIGRVIAKRVFHLDGVSG
                     SVFALGGIFSNNVMLGLPIATIMLGEKSIPAVALVLVFNGLILWTLVTISVEWARNGS
                     PTMAGFVKTTRSVLTNPLIIGIISGTLFSLTGLHLPVFIDQPVSMLGQVAPPLSLIVL
                     GMGLAEYRVTEGWQISTAICFLKLIVQPMVIWALAWAMDLPALETQVVVLLGSMATGV
                     NVYLMSRQFNVLTGPAAASLVMSTVLAAVTTPLILTIIGVGI"
     gene            287857..288525
                     /locus_tag="YPTB_RS01435"
                     /old_locus_tag="YPTB0244"
     CDS             287857..288525
                     /locus_tag="YPTB_RS01435"
                     /old_locus_tag="YPTB0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191535.1"
                     /db_xref="GI:499504895"
                     /translation="MNQVDVQKDISDLIVNAFPRALWLNIQDVFHAKYEAAQQVTMGS
                     ALKLDGPGQLRLRPQIRHYTLNAAFKEAALSCGVIHNSVETSPKGEHFVVLSSAGVKM
                     SRIGLNYDEPNIKGAKHRTLLAELNESLEGYTPDLFSERTIDHGPTGTLGVLILNINP
                     PYHEPQSRMLDLRVVVPFSNLKGFHFNWSLTQLLERYTGEQKIIIPDNVLPTLKRHLK
                     DQEN"
     gene            288538..289740
                     /locus_tag="YPTB_RS01440"
                     /old_locus_tag="YPTB0245"
     CDS             288538..289740
                     /locus_tag="YPTB_RS01440"
                     /old_locus_tag="YPTB0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191536.1"
                     /db_xref="GI:499504896"
                     /translation="MRVGISGFQPERLTQMREARGLSKINLGRLVERSPSTITKWENG
                     SHSPDAEGLASLGKVLNCPVSWFTKVAYERENNPVFFRTLSATAKDLCKSSEVYMGWL
                     QEISASLQEYLDYPNVNIPYLDVDDYRSIDDEAIERVASDCRKRWGLGIAPIQDLLLV
                     MENAGVVCSRFEQGSVMMDGYSQWNEKENRPYVVLASDKNNYFRSRFDAAHELGHLVL
                     HRYVKRLDSINFKPIEEQAHKFAACFMLPEEAFSAELPSFPSLENFVSLKSRWGMSAQ
                     SMILRARDLELISSIEYQRLYKSLSSRGWRKGEPLDDQRKPESVRLLPRCINLLLEST
                     IFSKHGFLEFVNLARGDVEDLCSLPKGFLAESAVLSFESKIQLKNSVKTLPEIDHRTN
                     VVDMFDRR"
     gene            289947..290846
                     /locus_tag="YPTB_RS01445"
                     /old_locus_tag="YPTB0246"
     CDS             289947..290846
                     /locus_tag="YPTB_RS01445"
                     /old_locus_tag="YPTB0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002215597.1"
                     /db_xref="GI:488144389"
                     /translation="MLLLVITTILWAFSFSLIGEYLAGQVDSWFSVLMRVGLAALVFL
                     PFLRWRNIPWRVILLYMAVGSIQLGIMYLFSFRAYLYLTVPEFLLFTVMTPLYVTLIY
                     DLLRRQRLRWGYALSALLAVLGAAIIRYDQLSEHFWWGLALVQAANICFAIGQVGYKR
                     LMEVHPIPQHVAFSWFYLGAFVVAVVAWFAFGNPQRLPTTGLQWGILVWLGVGASALG
                     YFMWNYGATQVDAGTLGIMNNVHVPAGLLVNLAIWQEKPHWPSFIIGAAVIMASLWVH
                     RRWIAPHPLQTANDRKRADEQNE"
     gene            complement(290734..291687)
                     /locus_tag="YPTB_RS01450"
                     /old_locus_tag="YPTB0247"
     CDS             complement(290734..291687)
                     /locus_tag="YPTB_RS01450"
                     /old_locus_tag="YPTB0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191537.1"
                     /note="homocysteine-binding ; positive regulator of metA,
                     metE and metH; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011191537.1"
                     /db_xref="GI:499504897"
                     /translation="MIELKHLRTLQALRNTGSLAAAATQLHQTQSALSHQFSDLEQRL
                     GFRLFVRKSQPLRFTTQGEILLQLAEQVLPQIKQALQTCNEPHQTALRIAIECHSCIQ
                     WLTPALDNFHKHWPQVTMDFKSGVTFDPQPALQQGELDLVLTSDILPRSGLHYSPMFD
                     FEVRLVLAPDHPLANKDRIEPEDLAPEVLMIYPVQRQRLDVWRHFLQPAGVSPSLKNV
                     DNTLLLIQMVSARMGIAALPHWVVESFERQGLVVTKTLGEGLWSRLYAAVRDGEQRQP
                     VTEAFIRSARQHACDHLPFVKDAVRSNAGVPTAKPLSPQLQ"
     gene            291778..294069
                     /locus_tag="YPTB_RS01455"
                     /old_locus_tag="YPTB0248"
     CDS             291778..294069
                     /locus_tag="YPTB_RS01455"
                     /old_locus_tag="YPTB0248"
                     /EC_number="2.1.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7FDD3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="WP_012304714.1"
                     /db_xref="GI:501261696"
                     /translation="MGNKTMTILNHTLGFPRVGLKRELKKAQESYWAGNSTQEELLNV
                     GRELRARHWQQQQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGSIDIDTLF
                     RIGRGRAPTGKPAAAAEMTKWFNTNYHYMVPEFQQGQQFKLGWTQLLDEVDEALALGH
                     KIKPVLLGPITYLWLGKVKGEQFDRLSLLNDILPVYQQVLAELAKRGIEWVQIDEPAL
                     VLELPQEWLDAYQPAYQALQGQVKLLLTTYFDSIGHNIDTIRALPVQGLHVDVVAGHD
                     DLAVLNKNLPKEWLLSLGVINGRNVWRADLSSWFERLQPLVNSRPLWLGSSCSLLHSP
                     IDLNEETRLDAEVKSWFAFALQKCAELALLTQALNAPNDAKLAELAAYSAPIRARRSS
                     SRVHNAQVEQRLAAITSQDIERQLPYEARAETQRKRFNLPAWPTTTIGSFPQTTEIRG
                     LRLDFKQGRLDGKNYRTGISEHIKQAIAEQERLGLDVLVHGEAERNDMVEYFGEHLDG
                     FVFTQNGWVQSYGSRCVKPPVIIGDISRPEAITVEWAKYAQSLTEKPVKGMLTGPVTI
                     LCWSFPREDVSRETIAKQIALALRDEVEDLEKAGIGIIQIDEPALREGLPLRRADWQA
                     YLQWAVDAFKLNAAVAQNDTQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELL
                     ESFEDFAYPNEIGPGVYDIHSPNVPSVEWIEALLRKAAQRIPAERLWVNPDCGLKTRG
                     WPETRQALANMVLAAQRLREEQI"
     gene            complement(294124..294996)
                     /locus_tag="YPTB_RS01460"
                     /old_locus_tag="YPTB0249"
     CDS             complement(294124..294996)
                     /locus_tag="YPTB_RS01460"
                     /old_locus_tag="YPTB0249"
                     /EC_number="3.1.1.45"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxymethylenebutenolidase"
                     /protein_id="WP_012413425.1"
                     /db_xref="GI:501381859"
                     /translation="MKTDQLVRLRQAAGGFTPAGTPLMATAHHTDQLHSLQTHGIHCG
                     ETTIPSQGDELPAYIAKPDQHTGPYPVVIVVQEIFGVHEHIQDICRRLAKQGYLAIAP
                     ELYFRQGDAKDYSNINDLVNNLVKKVPDRQVLVDLDHTAHWASRHGGDTKKLAITGFC
                     WGGRIAWLYAAHNPQLKAAVAWYGKLVGEKTLFLPKYPVDVAIDLCAPVLGLYGGKDT
                     SIPAEHIETMRQALRAANADAEIIVYPEAGHAFNADYRPSYHAESAQDGWQRMLDWFT
                     QHGVSAIPIPEETQ"
     gene            295424..296185
                     /locus_tag="YPTB_RS01465"
                     /old_locus_tag="YPTB0250"
     CDS             295424..296185
                     /locus_tag="YPTB_RS01465"
                     /old_locus_tag="YPTB0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211528.1"
                     /note="catalyzes the reversible phosphorylytic cleavage of
                     uridine and deoxyuridine to uracil and ribose- or
                     deoxyribose-1-phosphate; involved in the pyrimidine
                     salvage pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uridine phosphorylase"
                     /protein_id="WP_002211528.1"
                     /db_xref="GI:488140320"
                     /translation="MAKSDVFHLGLTKNDLQGATLAIVPGDPQRVEKIAKLMDNPVHL
                     ASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHI
                     NVGDVLVTTAAVRLDGASLHFAPMEFPAVADFSCTTALVNAAKSVGATTHIGITASSD
                     TFYPGQERYDTFSGRVVRHFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAG
                     VIVNRTQQEIPNEETMKATESHAVKIVVEAARHLL"
     gene            296306..297166
                     /locus_tag="YPTB_RS01470"
                     /old_locus_tag="YPTB0251"
     CDS             296306..297166
                     /locus_tag="YPTB_RS01470"
                     /old_locus_tag="YPTB0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_011191540.1"
                     /db_xref="GI:499504900"
                     /translation="MTMTTFSHPSLIPLDGGINFRDLGGNLAADGRRIKPGLLFRSGS
                     LDRLSTNDCDFLSHSNVTQIIDYRDADEVQAKPDVLWPGAHYHNIPANPLSSEVNANL
                     EKLTNETLATFDVRAFMFELYHRLPFNSLAYQQLVNLLQNCASTDPVASSVVHSGDVV
                     HGDVVHSDVVHRGIVQHCAVGKDRTGVGAALVLFALGADESTVLEDYLLTETTLKPFR
                     EHMLAELALKLNDQALAQFTFVLSAREEFIQTTLRSIHERYGSRERWLKHEFGLGSIE
                     REKLQSYFLE"
     gene            297513..299324
                     /locus_tag="YPTB_RS01475"
                     /old_locus_tag="YPTB0252"
     CDS             297513..299324
                     /locus_tag="YPTB_RS01475"
                     /old_locus_tag="YPTB0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon starvation protein CstA"
                     /protein_id="WP_002211530.1"
                     /db_xref="GI:488140322"
                     /translation="MQHAITFVIASACILTICYRLYGIFFVRKVLRVDDSEVTPSHTF
                     EDGKDYVPTKKWVNFGSHFAAIAAAGPLVGPVLAAQYGYLPGFLWLLIGCVIGGAVHD
                     TVVLFASMKHQGKSLSEVAKSELGPVAGWCTGLAMLFIITITMAGLSMVVVHALERNP
                     WGTFAVFMTIPIAICVGLWERMTGSMKGASYVGIAAIMVCVFVGPYIEGTWLGEWLML
                     KADTVSIILPMYAFFATALPVWMLLTPRGYLSSFMKIGVFGALIVGVVFINPEIQFPA
                     VTQFIHGGGPVLAGPVWPFISITIACGAISGFHAFIGSGTTPKQIDKWSDILPVGFGA
                     MLAECMVGVMALIAATSLHPADYFAINSSAEAWSALGMEVVNLPKLSEEIGLDLYGRT
                     GGAVTLAVGMTDIFIRVPWFNSLAAYFFQFVVMFEAVFILTAVDSGTRVARYLLQDFL
                     GDIWAPLKRTDWLPGTLVCSVIACALWGYLLNSGDINSVWALFGVSNQLMASVGLIIG
                     ATIILRLATKRVYMLTCVIPLAYLFVTVNYAGYWMITHVYFNSAAKGYNLFNGIISII
                     MMTLGVIILISALRKWRELWIRRSAEMAGNKVVTANA"
     gene            299861..300391
                     /locus_tag="YPTB_RS01480"
                     /old_locus_tag="YPTB0253"
     CDS             299861..300391
                     /locus_tag="YPTB_RS01480"
                     /old_locus_tag="YPTB0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome O ubiquinol oxidase"
                     /protein_id="WP_011191541.1"
                     /db_xref="GI:499504901"
                     /translation="MTFNDAITTTIDFVRVHEAWAIPIVFILAFGESLAFLSLLLPAT
                     VILLGLGALIGESGIPFWPIWAAAATGAFFGDWASYWVGIHYKDRVATLWPLSRNPQL
                     LVRGHAFFERWGFFGAFFGRFFGPLRAIVPLVAGICAMPQRYFQLANIASALIWAFGI
                     LAPGAFGIQWLSNWIG"
     gene            300599..302104
                     /locus_tag="YPTB_RS01485"
                     /old_locus_tag="YPTB0254"
     CDS             300599..302104
                     /locus_tag="YPTB_RS01485"
                     /old_locus_tag="YPTB0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012104343.1"
                     /note="YigN; nuclease that may cleave DNA structures
                     arising during the recombination of short-inverted repeats
                     and thereby prevents the inversion of the internal
                     sequence; transcription is induced by DNA-damaging agents
                     such as nalidixic acid or mitomycin C in a LexA-dependent
                     manner; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RmuC"
                     /protein_id="WP_002211532.1"
                     /db_xref="GI:488140324"
                     /translation="MDISLFYGLGGCLVGGLIGWLIASLSQQRTKAQQDIERRLLEQA
                     LQQAQQSIATLQMTQQRNEQQLRQSELEQRNLHSQLAANSEKLQQLAHWRNECEQLNQ
                     ELRAQREINSAQEAELREVTIRLEETRLATEEKQRLLLNSEQRLTTQFENLANRIFEQ
                     TGRRADEQNKQSLDRLLLPLREQLDGFRRQVQDSFGQEARERHTLTHEIRNLQQLNAQ
                     MAREALNLTKALKGDNKTQGNWGEVVLAKVLEASGLREGHEYQTQVSVKIDQTSRMQP
                     DVIVRLPQGKDVVIDAKMSLVAYERYFNSEDDAEREVALNEHLSSLRGHIRMLGRKDY
                     QQLPGLRSLDYVLMFIPVEPAFLVAIDRQPELINEALQHNIMLVSPTTLLVALRTITN
                     LWRYEHQSQNAQRIAERAARLYDKVRLFVDDMASLGQSLDKAQLSYHQAMNKLSQGRG
                     NLVGQVESFRTLGVEVKRPISPLLAEKACAEHQPEGDLALSDDAESGAFPE"
     gene            302196..302951
                     /gene="ubiE"
                     /locus_tag="YPTB_RS01490"
                     /old_locus_tag="YPTB0255"
     CDS             302196..302951
                     /gene="ubiE"
                     /locus_tag="YPTB_RS01490"
                     /old_locus_tag="YPTB0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080147.1"
                     /note="Catalyzes the carbon methylation reaction in the
                     biosynthesis of ubiquinone and menaquinone; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone/menaquinone biosynthesis
                     C-methyltransferase UbiE"
                     /protein_id="WP_002224024.1"
                     /db_xref="GI:488152816"
                     /translation="MVDQEKETTHFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMS
                     FGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVGEQGEVILADINESMLR
                     MGREKLRDKGIVGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMFRVL
                     KPGGRLLVLEFSKPLLEPLSKAYDAYSFHILPKIGELVAQDAESYRYLAESIRMHPDQ
                     ETLKGMMADAGFENVTYSNLTGGIVALHRGFKF"
     gene            302965..303615
                     /locus_tag="YPTB_RS01495"
                     /old_locus_tag="YPTB0256"
     CDS             302965..303615
                     /locus_tag="YPTB_RS01495"
                     /old_locus_tag="YPTB0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sterol-binding protein"
                     /protein_id="WP_002215928.1"
                     /db_xref="GI:488144720"
                     /translation="MSLRTLMLKPFLLKPRLLTPLITAALETVLNGVLFNDKSLKAAR
                     SRLVGKVLRIELREINFPLLFVFSERQVDVLSQWDDAADCLVKTDVAVLARLRDRQQL
                     SPLMRTGELVVEGDIQVVQQLVALLDLAEWDLAEWLAPYVGDVAAESLGQAIHKSSGF
                     LSRQLRQQQHYLAEAITEEWRMAPNLLEVMWFHEEVDATARATEALSSRLATMETK"
     gene            303615..305246
                     /gene="ubiB"
                     /locus_tag="YPTB_RS01500"
                     /old_locus_tag="YPTB0257"
                     /gene_synonym="aarF; yigQ; yigR"
     CDS             303615..305246
                     /gene="ubiB"
                     /locus_tag="YPTB_RS01500"
                     /old_locus_tag="YPTB0257"
                     /gene_synonym="aarF; yigQ; yigR"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAM1.1"
                     /note="an Escherichia coli mutant results in accumulation
                     of octaprenylphenol and no ubiquinone; functions in the
                     formation of 2-octaprenyl-6-hydroxy-phenol from
                     2-octaprenylphenol in ubiquinone (coenzyme Q)
                     biosynthesis; similar to eukaryotic proteins that exhibit
                     kinase functions; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002211535.1"
                     /db_xref="GI:488140327"
                     /translation="MTPGELRRLYLIIRVFLSYGLDELIPNIRLTLPLRVGRHLFFWL
                     SNRHKDKSLGERLRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDG
                     ALARKHIEIAMGGALETWFDDFDSQALASASIAQVHTARLKENGKEVVLKVIRPDILP
                     IIKADVRLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRN
                     FEDSPMLYIPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFT
                     QVFRDSFFHADMHPGNIFVSYEHPHDPLYIGIDCGIVGSLNKADKRYLAENFIAFFNR
                     DYRRVAELHVDSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARR
                     FNMEVQPQLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALK
                     EKAPFWAEKFPELPELVYDSLQQHKLLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATL
                     LVSGTILFLADATEVSTGFIVAGALAWFIGWRRTC"
     gene            305426..305692
                     /locus_tag="YPTB_RS01505"
                     /old_locus_tag="YPTB0258"
     CDS             305426..305692
                     /locus_tag="YPTB_RS01505"
                     /old_locus_tag="YPTB0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAM2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase TatA"
                     /protein_id="WP_002211536.1"
                     /db_xref="GI:488140328"
                     /translation="MGSIGWAQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAMG
                     DDSQTPPTNVDKTSNDADFAKSITEKQQPVAKAEESKSHEKEQG"
     gene            305696..306358
                     /locus_tag="YPTB_RS01510"
                     /old_locus_tag="YPTB0259"
     CDS             305696..306358
                     /locus_tag="YPTB_RS01510"
                     /old_locus_tag="YPTB0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAM3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase TatB"
                     /protein_id="WP_011191542.1"
                     /db_xref="GI:499504902"
                     /translation="MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRTLRSLAA
                     TVQNELAQELKLQELQDSLKKVEQAGLQNLTPELKASMDELKEAAEALKRSYHVDAGS
                     EAPHTIHNPLVTEPEAIHDGVTPAEPATQVSALAQAPNILEAGTASVADSVVEAAPVT
                     TVKSVVQGEVLVKSTPVQEVGLADVMDKPVTKQQIDTIDSHGTDLSSAGPSRIHQPGG
                     DQ"
     gene            306361..307137
                     /locus_tag="YPTB_RS01515"
                     /old_locus_tag="YPTB0260"
     CDS             306361..307137
                     /locus_tag="YPTB_RS01515"
                     /old_locus_tag="YPTB0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002211538.1"
                     /note="with TatABE forms the twin-arginine translocation
                     complex which is involved in the transport of proteins
                     across the cytoplasmic membrane; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit TatC"
                     /protein_id="WP_011191543.1"
                     /db_xref="GI:499504903"
                     /translation="MAVDDTQPLISHLIELRKRLLNCIITILVVFLVLVFFANDIYNL
                     VSAPLIKQLPAGASMIATDVASPFFTPIKLTMMVSVFVSAPMILYQVWAFIAPALYKH
                     ERRLMVPLLISSSLLFYLGMAFAYFVVFPLAFGFFAKTAPESVLIATDITKYLDFVMA
                     LFMAFGISFEVPIAIILLCWAGVTTPEALKKKRPYVFVGAFVVGMLLTPPDVLSQTLL
                     AIPMYLLFEVGVFFARFYTGKQRRAATEEDEGIDSHPKAP"
     gene            307193..307975
                     /locus_tag="YPTB_RS01520"
                     /old_locus_tag="YPTB0261"
     CDS             307193..307975
                     /locus_tag="YPTB_RS01520"
                     /old_locus_tag="YPTB0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005187843.1"
                     /note="magnesium dependent; involved in quality control of
                     mutated Tat exported substrates; not involved in the
                     Sec-independent protein export system; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNase TatD"
                     /protein_id="WP_011191544.1"
                     /db_xref="GI:499504904"
                     /translation="MFDIGVNLTSVQFAKDYHQVVNRAKEAGVLGILITGTDADESLA
                     AQTLAAEYPGYCWSTTGVHPHHASSWQDSVEQKIRTLAATASVVAIGECGLDFNRNFS
                     TPAQQEVAFTAQLALAAELSLPVFLHCRDAHERFIDLLVPWLDKIPAAVVHCFTGNSG
                     ELDACLALGLSIGITGWVCDERRGLDLRALLPRIPVQQLLLETDAPYLLPRDLNPKPA
                     SRRNEPCFLPHIVQQVAAWRQEDPNWLGQKTDENARRVFRLV"
     gene            307990..309012
                     /locus_tag="YPTB_RS01525"
                     /old_locus_tag="YPTB0262"
     CDS             307990..309012
                     /locus_tag="YPTB_RS01525"
                     /old_locus_tag="YPTB0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002421699.1"
                     /note="catalyzes the formation of porphobilinogen from
                     5-aminolevulinate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="WP_002211541.1"
                     /db_xref="GI:488140333"
                     /translation="MSYAFPGTFPGRRMRRVRCHDFSRRLVAENHLTVNDLIYPVFVM
                     EGTHQQQAVSSMPGVSRMTIDLLLKEAEAIAKLGVPVISLFPVIEAGKKSLYAEEAYN
                     PDGLVQRTVRALKDAVPELGILTDVALDPYTTHGQDGVIDSDGYVINDVTKEILVRQA
                     LSHAEAGAEIIAPSDMMDGRIGAIRDQLERQGLVNTQIMAYSAKYASCYYGPFRDAIG
                     SSSNLKGGDKKTYQMDPANSDEALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFG
                     VPTFAYQVSGEYAMHMAAIQNGWLQEKPTVMESLLCFKRAGADGVLTYFAKQVAQWLH
                     DDQMQR"
     gene            complement(309122..309610)
                     /gene="rfaH"
                     /locus_tag="YPTB_RS01530"
                     /old_locus_tag="YPTB0263"
     CDS             complement(309122..309610)
                     /gene="rfaH"
                     /locus_tag="YPTB_RS01530"
                     /old_locus_tag="YPTB0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011191545.1"
                     /db_xref="GI:499504905"
                     /translation="MKSWYLLYCKRGQILRAKEHLERQTVNCWTPIVAIEKIVRGKRI
                     EVIEALFPNYLFAEFDPENIHTTTVSATRGVSHFVRFGTQPAVIPATVIADMQAHAVD
                     KIIAPEVPKPGDIVKIIDGVFAGLQAIYTEPDGEARSMLLLNMLNSQIKHSLDNRQFE
                     KQ"
     gene            309858..311354
                     /locus_tag="YPTB_RS01535"
                     /old_locus_tag="YPTB0264"
     CDS             309858..311354
                     /locus_tag="YPTB_RS01535"
                     /old_locus_tag="YPTB0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1C2C1.2"
                     /note="catalyzes the decarboxylation of
                     3-octaprenyl-4-hydroxy benzoate to 2-octaprenylphenol;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="WP_011191546.1"
                     /db_xref="GI:499504906"
                     /translation="MISMKYRDLRDFLSLLEQRGELKRISQPIDPYLEMTEIADRTLR
                     AGGPALLFENPKGYSMPVLCNLFGTAKRVAMGMGQEDVSALRDVGKLLAFLKEPDPPK
                     GFRDLFDKLPKFKQVLNMPTKRLNSAPCQEQVWQGEDVDLSRIPVMHCWPEDAAPLVS
                     WGLTITRGPHKERQNLGIYRQQVLGKNKLIMRWLSHRGGALDYQEWCEAHPGERFPVA
                     VALGADPATILAAVTPVPDTLSEYAFAGLLRGHKTEVVKCLSNDLEVPASAEIVLEGY
                     IEQGDMAPEGPYGDHTGYYNEIDNFPVFTVTHITQRQDAIYHSTYTGRPPDEPAVMGV
                     ALNEVFVPILQKQFPEIVDFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQF
                     MYTKFVIVCDDDINARDWNDVIWAITTRMDPSRDTVLIENTPIDYLDFASPVSGLGSK
                     MGLDATNKWPAETPREWGRPIKMDEDVRARIDALWDELAIFSDKDAKR"
     gene            311409..312110
                     /gene="fre"
                     /locus_tag="YPTB_RS01540"
                     /old_locus_tag="YPTB0265"
                     /gene_synonym="fadI"
     CDS             311409..312110
                     /gene="fre"
                     /locus_tag="YPTB_RS01540"
                     /old_locus_tag="YPTB0265"
                     /gene_synonym="fadI"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215918.1"
                     /note="NAD(P)H-flavin reductase; catalyzes the reversible
                     oxidation/reduction of NAD(P) and flavine mononucleotide;
                     in Salmonella and E. coli this protein also reduces
                     aquacob(III)alamin to cob(II)alamin; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="WP_002215918.1"
                     /db_xref="GI:488144710"
                     /translation="MTTLSCKVTSVEAITDTVYRVQLVPESSFSFRAGQYLMVVMDER
                     DKRPFSMASTPFQQDFIELHIGASELNLYAMAVMDRILKEKKLDVDIPHGDAWFREGS
                     KRPLVLIAGGTGFSYARSILLAALAEQPDREVSIYWGGREAVHLYDLGELEALSIKYP
                     QLKVIPVVEQPEEGWRGRTGTVLSAVLQDYGSLAEQDIYIAGRFEMAKIARERFCVER
                     GAQEEHIFGDAFAFI"
     gene            complement(312270..313433)
                     /gene="fadA"
                     /locus_tag="YPTB_RS01545"
                     /old_locus_tag="YPTB0266"
     CDS             complement(312270..313433)
                     /gene="fadA"
                     /locus_tag="YPTB_RS01545"
                     /old_locus_tag="YPTB0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAM9.1"
                     /note="FadA; fatty acid oxidation complex component beta;
                     functions in a heterotetramer with FadB; similar to
                     FadI2J2 complex; functions in beta-oxidation of fatty
                     acids; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="WP_002211545.1"
                     /db_xref="GI:488140337"
                     /translation="MENVVIIDAVRTPMGRSKGGAFRHVRAEDLSAHLMRAVISRNPG
                     LNAAEIDDIYWGCVQQTLEQGFNIARNASLLAEIPHSVPAVTVNRLCGSSMQALHDGA
                     RAIMVGDAKISLIGGVEHMGHVPMNHGVDFHPGMGRTVAKAAGMMGLTAEMLAKIHNI
                     SRQSQDEFAFRSHQRAYAATQAGHFAKEIVATNGHDAEGVLKRFDFDEVIRPETNLSG
                     LAALRPAFDPVNGTVTAGTSSALSDGASAMLIMSESRAKSLGLTPRARIRSMAVVGCD
                     PSIMGYGPVPASQLALKRAGLELADIGLFELNEAFAAQSLACLKGLGLLESMDDKVNL
                     NGGAIALGHPLGCSGARISTTLLNLMERRDVQFGLATMCIGLGQGIATVFERL"
     gene            complement(313445..315634)
                     /gene="fadB"
                     /locus_tag="YPTB_RS01550"
                     /old_locus_tag="YPTB0267"
     CDS             complement(313445..315634)
                     /gene="fadB"
                     /locus_tag="YPTB_RS01550"
                     /old_locus_tag="YPTB0267"
                     /EC_number="1.1.1.35"
                     /EC_number="4.2.1.17"
                     /EC_number="5.1.2.3"
                     /EC_number="5.3.3.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005274741.1"
                     /note="includes enoyl-CoA hydratase,
                     delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase,
                     3-hydroxyacyl-CoA dehydrogenase, and 3-hydroxybutyryl-CoA
                     epimerase; catalyzes the formation of an hydroxyacyl-CoA
                     by addition of water on enoyl-CoA; also exhibits
                     3-hydroxyacyl-CoA epimerase and 3-hydroxyacyl-CoA
                     dehydrogenase activities; forms a heterotetramer with
                     FadA; similar to FadI2J2 complex; functions in
                     beta-oxidation of fatty acids; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid oxidation complex subunit alpha"
                     /protein_id="WP_011191547.1"
                     /db_xref="GI:499504907"
                     /translation="MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTKTVANLGEALN
                     VLEKQSELKGLLLRSAKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLP
                     VPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGA
                     DSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPK
                     LEPLKLNPTEAAMCFTIAKGRVMQVAGKHYPAPLTAVKTIEAAAKFGRTEALNLETNS
                     FVPLAGSNEARALVGIFLNDQYVKAQAKKLSKGVAAPKLAAVLGAGIMGGGIAYQSAL
                     KSVPVIMKDINENSLDLGMNEAAKLLNKQLERGKVDGLKMASILATIRPTLDYAGIER
                     AQVIVEAVVENPKVKAAVLAEVEALIGEDTVLASNTSTIPIDQLAKSLKRPENFCGMH
                     FFNPVHQMPLVEIIRGAKTSDKTLAAVVAYATQMGKTPIVVNDCPGFFVNRVLFPYLA
                     GFGMLVRDGGDFHQIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPERMNK
                     DYRDAVDVMFDNQRFGQKNGQGFYRYTQDAKGKPRKENDEQVDKLLAEISQPLQEFSD
                     EDIIARTMIPMINEVVRCLEEGIIASAAEGDMALVYGLGFPPFHGGVFRYLDTLGSAN
                     YVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPVAAALLDVSTNQPA"
     gene            315961..317292
                     /locus_tag="YPTB_RS01555"
                     /old_locus_tag="YPTB0268"
     CDS             315961..317292
                     /locus_tag="YPTB_RS01555"
                     /old_locus_tag="YPTB0268"
                     /EC_number="3.4.13.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q0WAP4.1"
                     /note="catalyzes the hydrolysis of dipeptides with a
                     proline at the C-terminal; also catalyzes the low
                     efficiency hydrolysis of organophosphate di- and
                     tri-esters; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro dipeptidase"
                     /protein_id="WP_011191548.1"
                     /db_xref="GI:499504908"
                     /translation="METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRLFLD
                     DRDYPFKVNPQFKAWVPVTEVPNCWLWVDGVNTPKLWFYSPVDYWHSVEPLPDSFWTK
                     NIDVQPLLNADDIAQQLPVQRERVAYIGYAQQRAQALGFSAENINPQPVLDYLHYYRS
                     YKTDYELACMREAQKTAVVGHRAAYEAFQSGMSEFDINLAYLMATGHRDTDVPYDNIV
                     ALNEHSAVLHYTILQHQPPAEIRSFLIDAGAEYNGYAADLTRTYAADRDSDFAALISD
                     LNTEQLALIDTIKSGERYTDYHVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLP
                     HGLGHPLGLQVHDTAGFMQDDKGTNLNAPSKYPYLRCTRVLQPRMVLTIEPGLYFIDS
                     LLAPWRIGEFSKHFNWDRIDALKPYGGIRIEDNIVIHDKRVENMTRDLKLA"
     gene            317292..317903
                     /locus_tag="YPTB_RS01560"
                     /old_locus_tag="YPTB0269"
     CDS             317292..317903
                     /locus_tag="YPTB_RS01560"
                     /old_locus_tag="YPTB0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002231137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002231137.1"
                     /db_xref="GI:488159929"
                     /translation="MQPYLIPAMPVTISEEIKKSRFITLLAHTCGVNEAKDFIQQVKQ
                     QHPTARHHCWAFVAGPPTDSQQLGFSDDGEPSGTAGKPILAQLMGSDIGEITAVVVRY
                     YGGIKLGTGGLVKAYGSGVQQALKQVAVKYKVPQVEYTLQCDYAQLAMVEMLLQQVEG
                     QILRGEYTELVTLHLTLPATQASQVGDKLRDLSRGTLQLTPIS"
     gene            317943..319394
                     /locus_tag="YPTB_RS01565"
                     /old_locus_tag="YPTB0270"
     CDS             317943..319394
                     /locus_tag="YPTB_RS01565"
                     /old_locus_tag="YPTB0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004720468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_002211550.1"
                     /db_xref="GI:488140342"
                     /translation="MHFRAITRIVGLLVILFSGTMFIPGLVALIYRDGAGRAFSETFF
                     VAVSIGLLLWLPNRKQKHELKPREGFLIVVLFWTVLGSVGALPFLFSERPNLSLTDAF
                     FESFSGLTTTGATTLVGLDSLPKAILFYRQMLQWLGGMGIIVLAVAILPILGVGGMQL
                     YRAEMPGPLKDNKMRPRIAETAKTLWLIYVLLTIACALALWGAGMSVFDAISHSFSTI
                     AIGGFSTHDASIGYFNSPTINTIIGIFLLISGCNFGLHFAVLSGRSLKVYWRDPEFRM
                     FIFVQLTLVIVCTLVLWQHSVYKSGIETLNQAFFQVVSMATTAGFTTDSIAKWPLFLP
                     LLLLCSAFIGGCAGSTGGGLKVIRILLLYLQGSRELKRLVHPNAVYTIKLGRRALPER
                     ILEAVWGFFSAYALVFIISMLAIVATGVDEFSAFAAVTATLNNLGPGLGVVADNFTSM
                     NPAAKWILVITMLFGRLEVFTLLVLFTPTFWRE"
     gene            319416..319949
                     /locus_tag="YPTB_RS01570"
                     /old_locus_tag="YPTB0271"
     CDS             319416..319949
                     /locus_tag="YPTB_RS01570"
                     /old_locus_tag="YPTB0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="WP_002215920.1"
                     /db_xref="GI:488144712"
                     /translation="MKILILYSSRDGQTKTIASYIAKQLTEAATCEIQDLSQVGQIDL
                     SQYQQVIIGASVRYGHFSPVLNKFVNKHVAQLSQMPSAFFAVNLTARKPEKRSPQTNT
                     YVRKFLLNTPWQPTLCSVFAGALRYPRYSWIDRIMIQLIMRMTGGETDTSKEVEYTDW
                     QEVSRFTQDFLALQYKK"
     gene            complement(320233..320418)
                     /locus_tag="YPTB_RS01575"
     CDS             complement(320233..320418)
                     /locus_tag="YPTB_RS01575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002218887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041175485.1"
                     /db_xref="GI:752489465"
                     /translation="MFDLLTFTCVKAAVLKDYFLQICILTGVKMFTALVTLQDLILFL
                     PAETGVDIVLRVPTQIV"
     gene            320421..321970
                     /locus_tag="YPTB_RS01580"
                     /old_locus_tag="YPTB_RNA_99"
     rRNA            320421..321970
                     /locus_tag="YPTB_RS01580"
                     /old_locus_tag="YPTB_RNA_99"
                     /product="16S ribosomal RNA"
     gene            322070..322146
                     /locus_tag="YPTB_RS01585"
                     /old_locus_tag="YPTB_RNA_9"
     tRNA            322070..322146
                     /locus_tag="YPTB_RS01585"
                     /old_locus_tag="YPTB_RNA_9"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:322104..322106,aa:Ile,seq:gat)
     gene            322198..322273
                     /locus_tag="YPTB_RS01590"
                     /old_locus_tag="YPTB_RNA_10"
     tRNA            322198..322273
                     /locus_tag="YPTB_RS01590"
                     /old_locus_tag="YPTB_RNA_10"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:322231..322233,aa:Ala,seq:tgc)
     gene            322483..325417
                     /locus_tag="YPTB_RS01595"
                     /old_locus_tag="YPTB_RNA_100"
     rRNA            322483..325417
                     /locus_tag="YPTB_RS01595"
                     /old_locus_tag="YPTB_RNA_100"
                     /product="23S ribosomal RNA"
     gene            325510..325625
                     /locus_tag="YPTB_RS01600"
                     /old_locus_tag="YPTB_RNA_101"
     rRNA            325510..325625
                     /locus_tag="YPTB_RS01600"
                     /old_locus_tag="YPTB_RNA_101"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            326089..327126
                     /gene="murB"
                     /locus_tag="YPTB_RS01605"
                     /old_locus_tag="YPTB0272"
     CDS             326089..327126
                     /gene="murB"
                     /locus_tag="YPTB_RS01605"
                     /old_locus_tag="YPTB0272"
                     /EC_number="1.1.1.158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012229941.1"
                     /note="catalyzes the reduction of UDP-N-acetylglucosamine
                     enolpyruvate to form UDP-N-acetylmuramate in peptidoglycan
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="WP_011191549.1"
                     /db_xref="GI:499504909"
                     /translation="MSNQRSSLKHLNTFALPAYASNVISAGSVETLIAAWHESKAKRQ
                     PVLLLGEGSNVLFIKNFSGTVLLNRIMGITSTEDSAAWHLHVGAGENWHQLVCHSLQN
                     NMPGLENLALIPGCVGSAPIQNIGAYGVELKQVCEYVDLLDMDKGTIQRISAEECQFG
                     YRDSIFKHRYGNGFAIVSVGIKLMKSWTPTLGYGDLIHMDPLTVTATDIFNSVCTMRR
                     SKLPDPMVTGNAGSFFKNPVVSAAIAEEIVHCYPNAPHYLQPDGSVKLAAGWLIDQCS
                     LKGYQIGGAAVHQQQALVLINQSEATGQDVIHLARYIRQQVAQRFSIWLEPEVRFIAD
                     NGEVNAVEHLS"
     gene            327123..328082
                     /locus_tag="YPTB_RS01610"
                     /old_locus_tag="YPTB0273"
     CDS             327123..328082
                     /locus_tag="YPTB_RS01610"
                     /old_locus_tag="YPTB0273"
                     /EC_number="6.3.4.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080256.1"
                     /note="catalyzes the formation of biotinyl-5'-AMP, also
                     acts as a transcriptional repressor of the biotin operon;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional biotin--[acetyl-CoA-carboxylase]
                     synthetase/biotin operon repressor"
                     /protein_id="WP_011191550.1"
                     /db_xref="GI:499504910"
                     /translation="MKDIRVPLRLVSILSDGFFHSGEQLGETLGMSRAAINKHMQTIR
                     DWGLDVFTVPGKGYSLPTSIQLLDEQKILSYLPTGHVTVLPVVDSTNQYLLDRITELK
                     SGDACVAEYQQAGRGRRGRQWVSPFGANLYLSMYWRLEQGPAAAMGLSLVVGIVMAEV
                     LQNLGAEKVRVKWPNDLYLNDKKLAGILVELTGKTGDAAQLVIGAGINLTMRGSETNA
                     INQDWINLQDAGVTIDRNKLTAEILSELRLAVVKFENDGLSAFLSRWQKMDNYLNRPV
                     KLIIGNQEIFGIARGIDQQGALLLEQDGNIKPYIGGEISLRGV"
     gene            complement(328117..329067)
                     /locus_tag="YPTB_RS01615"
                     /old_locus_tag="YPTB0274"
     CDS             complement(328117..329067)
                     /locus_tag="YPTB_RS01615"
                     /old_locus_tag="YPTB0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAN6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="WP_002212290.1"
                     /db_xref="GI:488141082"
                     /translation="MTKREQSLATPYLQFDRTQWAALRDSVPLTLTEEEIVKLKGINE
                     DLSLDEVAQIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQRIPYVIGIAGSVAVGKS
                     TTARLLQALLSRWPEHRSVELITTDGFLHPNKVLNERGLMKKKGFPESYDMHNLVKFV
                     SEVKSGADYVTAPVYSHLIYDVVPDGNKVIKQPDILILEGLNVLQSGMDYPHDPHHVF
                     VSDFVDFSIYVDAPEDLLQSWYINRFLKFRQGAFSNPDSYFHNYAKLPETEAIKIATQ
                     LWNEINGLNLKQNILPTRERASLIMTKSANHAVESVRLRK"
     gene            complement(329278..329829)
                     /locus_tag="YPTB_RS01620"
                     /old_locus_tag="YPTB0275"
     CDS             complement(329278..329829)
                     /locus_tag="YPTB_RS01620"
                     /old_locus_tag="YPTB0275"
                     /EC_number="2.3.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_011191551.1"
                     /db_xref="GI:499504911"
                     /translation="MKIVLLNAATFPIYRSGLASLLIDAVTYGASVGYNTHTLSQEEA
                     EGYFHSLHPAIEREALLLWIARDEIGIIGTIQLVLCQKPNGLNRAEIQKLLVHSRSRR
                     TGIGHKLIIAAENTAVQLRRGLIYLDTQSGSSAESFYRAQGYRYVGEIPDYACTPNGN
                     YHPTAIYFKRLFTVVQPHTAIQN"
     gene            330225..330300
                     /locus_tag="YPTB_RS01625"
                     /old_locus_tag="YPTB_RNA_11"
     tRNA            330225..330300
                     /locus_tag="YPTB_RS01625"
                     /old_locus_tag="YPTB_RNA_11"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:330258..330260,aa:Thr,seq:tgt)
     gene            330319..330403
                     /locus_tag="YPTB_RS01630"
                     /old_locus_tag="YPTB_RNA_12"
     tRNA            330319..330403
                     /locus_tag="YPTB_RS01630"
                     /old_locus_tag="YPTB_RNA_12"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:330353..330355,aa:Tyr,seq:gta)
     gene            330553..330627
                     /locus_tag="YPTB_RS01635"
                     /old_locus_tag="YPTB_RNA_13"
     tRNA            330553..330627
                     /locus_tag="YPTB_RS01635"
                     /old_locus_tag="YPTB_RNA_13"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:330586..330588,aa:Gly,seq:tcc)
     gene            330634..330709
                     /locus_tag="YPTB_RS01640"
                     /old_locus_tag="YPTB_RNA_14"
     tRNA            330634..330709
                     /locus_tag="YPTB_RS01640"
                     /old_locus_tag="YPTB_RNA_14"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:330667..330669,aa:Thr,seq:ggt)
     gene            330818..332002
                     /gene="tuf"
                     /locus_tag="YPTB_RS01645"
                     /old_locus_tag="YPTB0276"
     CDS             330818..332002
                     /gene="tuf"
                     /locus_tag="YPTB_RS01645"
                     /old_locus_tag="YPTB0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1CN86.2"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_002210669.1"
                     /db_xref="GI:488139461"
                     /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQ
                     YDFPGDDTPVIRGSALKALEGDAEWEAKIIELAEALDSYIPQPERAIDRPFLLPIEDV
                     FSISGRGTVVTGRVERGIVKVGEEVEIVGIIDTIKTTCTGVEMFRKLLDEGRAGENVG
                     VLLRGTKRDDVQRGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNVNMVVNLIAPIAMDDGLRFAIREGGRTVGAGVVAKV
                     IE"
     gene            332253..332636
                     /gene="secE"
                     /locus_tag="YPTB_RS01650"
                     /old_locus_tag="YPTB0277"
     CDS             332253..332636
                     /gene="secE"
                     /locus_tag="YPTB_RS01650"
                     /old_locus_tag="YPTB0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004393381.1"
                     /note="forms a complex with SecY and SecG; SecYEG forms a
                     putative protein-conducting channel to which secA binds
                     and translocates targeted polypeptides across the
                     cytoplasmic membrane, a process driven by ATP and a
                     proton-motive force; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_002210670.1"
                     /db_xref="GI:488139462"
                     /translation="MSANTEAPGSGRGLETAKWLIVAVLLVVAIVGNYYYREYSLPLR
                     ALAVVVIIAVAGAVALMTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTA
                     VMSLILWGLDGILVRLVSFITGLRF"
     gene            332638..333183
                     /gene="nusG"
                     /locus_tag="YPTB_RS01655"
                     /old_locus_tag="YPTB0278"
     CDS             332638..333183
                     /gene="nusG"
                     /locus_tag="YPTB_RS01655"
                     /old_locus_tag="YPTB0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004953928.1"
                     /note="Modulates Rho-dependent transcription termination;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination
                     protein NusG"
                     /protein_id="WP_002210671.1"
                     /db_xref="GI:488139463"
                     /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHDMEELFGEVMV
                     PTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAP
                     ISDKEVDAIMNRLQQVGDKPRPKTLFEPGELVRVSDGPFADFNGVVEEVDYEKSRLKV
                     SVSIFGRATPVELDFSQVEKG"
     gene            333374..333802
                     /locus_tag="YPTB_RS01660"
                     /old_locus_tag="YPTB0279"
     CDS             333374..333802
                     /locus_tag="YPTB_RS01660"
                     /old_locus_tag="YPTB0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005165805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_002210672.1"
                     /db_xref="GI:488139464"
                     /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNA
                     KTESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGVPNKDKVGKVT
                     SAQVREIAETKAADMTGSDVDAMMRSIEGTAHSMGLVVEG"
     gene            333806..334510
                     /locus_tag="YPTB_RS01665"
                     /old_locus_tag="YPTB0280"
     CDS             333806..334510
                     /locus_tag="YPTB_RS01665"
                     /old_locus_tag="YPTB0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAP2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_002210673.1"
                     /db_xref="GI:488139465"
                     /translation="MAKLTKRMRVIRDKVDVTKQYDINEAVALLKELATAKFVESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFAQGANAEAAKEAGAELVGMDDLAD
                     QIKKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQ
                     VRYRNDKNGIIHTTIGKVDFDSDKLKENLESLVVALKKAKPATAKGIYIKKISLSTTM
                     GAGVAIDQSGLTAVVN"
     gene            334875..335372
                     /gene="rplJ"
                     /locus_tag="YPTB_RS01670"
                     /old_locus_tag="YPTB0281"
     CDS             334875..335372
                     /gene="rplJ"
                     /locus_tag="YPTB_RS01670"
                     /old_locus_tag="YPTB0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004722253.1"
                     /note="binds the two ribosomal protein L7/L12 dimers and
                     anchors them to the large ribosomal subunit; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_002210674.1"
                     /db_xref="GI:488139466"
                     /translation="MALNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRRA
                     GREAGVHMQVVRNTLLRRIVEGTPFECLKDTFVGPTLIAFSAEHPGAAARLFKAFAKD
                     NAKFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRD
                     QKEAA"
     gene            335439..335807
                     /gene="rplL"
                     /locus_tag="YPTB_RS01675"
                     /old_locus_tag="YPTB0282"
     CDS             335439..335807
                     /gene="rplL"
                     /locus_tag="YPTB_RS01675"
                     /old_locus_tag="YPTB0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JIH9.1"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_002210675.1"
                     /db_xref="GI:488139467"
                     /translation="MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPA
                     AAVEAAEEQTEFDVVLASFGENKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNK
                     DEAETLKKSLEEAGASVEIK"
     gene            336150..340178
                     /gene="rpoB"
                     /locus_tag="YPTB_RS01680"
                     /old_locus_tag="YPTB0283"
     CDS             336150..340178
                     /gene="rpoB"
                     /locus_tag="YPTB_RS01680"
                     /old_locus_tag="YPTB0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004876764.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_002210676.1"
                     /db_xref="GI:488139468"
                     /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPE
                     GQHGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRL
                     VIYEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSD
                     KGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNFTTA
                     QILDLFFEKVVFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKARRITARHIRQ
                     LEKDGIDRIEVPVEYIAGKVVAKDYVDASTGELICAANMELSLDLLAKLSQAGHKQIE
                     TLFTNDLDHGAYISETLRVDPTSDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSE
                     DRYDLSAVGRMKFNRSLLRDEIEGSGILSKEDITEVMKKLIDIRNGRGEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEG
                     PNIGLINSLSVYAQTNEYGFLETPYRRVRDGVVTDEINYLSAIEEGNFVIAQANSNLD
                     DEGRFLEDLVTCRSKGESSLFSREQVDYMDVSTQQIVSVGASLIPFLEHDDANRALMG
                     ANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTSVAKRGGTVQYVDASRIVIKVNEDE
                     MHPGEAGIDIYNLTKYTRSNQNTCINQMPCVNLGEPIERGDVLADGPSTDLGELALGQ
                     NMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPN
                     VGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLF
                     ARIHAVLVSGGIEAEKLSKLPRERWLELGLTDEDKQNQLEQLAEQYDEMKSEFEKKMD
                     AKRRKITQGDDLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYD
                     ENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGEKINAMLKKQEEVAKLREFIQ
                     KAYDLGDNVCQKVDLSTFTDDEVLRLAENLKKGMPIATPVFDGATEKEIKELLQLGGL
                     PTSGQITLFDGRTGEQFERQVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGK
                     AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMP
                     ESFNVLLKEIRSLGINIELEEE"
     gene            340307..344527
                     /locus_tag="YPTB_RS01685"
                     /old_locus_tag="YPTB0284"
     CDS             340307..344527
                     /locus_tag="YPTB_RS01685"
                     /old_locus_tag="YPTB0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004393389.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. Subunit beta'
                     binds to sigma factor allowing it to bind to the -10
                     region of the promoter; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_002210677.1"
                     /db_xref="GI:488139469"
                     /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERRQIL
                     TEEQYLDALEEFGDEFDAKMGAEAIQALLKNMDLEAECEILREELNETNSETKRKKLT
                     KRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTRDCVNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEEIRNTEGESITR
                     TSIIDTTVGRAILWMIVPQGLPYSIVNQPLGKKAISKMLNTCYRILGLKPTVIFADQI
                     MYTGFAYAARSGASVGIDDMVIPEAKAGIIEEAETEVAEIQEQFQSGLVTAGERYNKV
                     IDIWAAANERVAKAMMDNLSVEDVVNRDGVVEQQVSFNSIFMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEDDCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVIKPGSADI
                     LVPRNTLLDEKWCDLLEENSVDSVKVRSVVSCETDFGVCANCYGRDLARGHIINKGEA
                     VGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSLKLSNVKFVTNAAGK
                     LVITSRNTELKLIDEFGRTKESYKVPYGAVMAKGDGAEVQGGETVANWDPHIMPVVTE
                     VSGFIRFADMVDGQTITRQTDELTGLSSLVVLDSAERTGSGKDLRPALKIVDAKGNDV
                     LIPGTDMPAQYFLPGKAIVQLEDGIQIGAGDTLARIPQESSGTKDITGGLPRVADLFE
                     ARRPKEPAILAEISGIISFGKETKGKRRLVISPLDGSDAYEEMIPKWRQLNVFEGEVV
                     ERGDVVSDGPESPHDILRLRGVHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLR
                     KGTIVDAGSTDFLEGEQAEMSRVKIANRKLAAEGKIEATFTRDLLGITKASLATESFI
                     SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRKAQGEA
                     PVVPQVSADEATANLAELLNAGFGNNKG"
     gene            344678..344790
                     /locus_tag="YPTB_RS01690"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(344833..345963)
                     /gene="thiH"
                     /locus_tag="YPTB_RS01695"
                     /old_locus_tag="YPTB0285"
     CDS             complement(344833..345963)
                     /gene="thiH"
                     /locus_tag="YPTB_RS01695"
                     /old_locus_tag="YPTB0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210678.1"
                     /note="in Escherichia coli this enzyme functions in
                     thiamine biosynthesis along with thiFSGI and iscS; with
                     ThiFSG catalyzes the formation of thiazole phosphate from
                     tyrosine, cysteine and 1-deoxy-D-xylulose-5-phosphate;
                     forms a complex with ThiG; contains an iron-sulfur center;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiH"
                     /protein_id="WP_002210678.1"
                     /db_xref="GI:488139470"
                     /translation="MSEDFNQRWQQLDWDDISLTINSKKPADVERALNAIKPTREDLM
                     ALISPAALAYLEPMAQKAQQLTRQRFGNTVSFYVPLYLSNLCANDCTYCGFSMSNRIK
                     RKTLDEAEIIRECEAIKALGFEHLLLVTGEHQTKVGMDYFRRHLPTIRSRFSSLMMEV
                     QPLAEDEYTELKALGLDGVMVYQETYHPATYQQHHLRGHKQDFHWRLATPDRLGRAGI
                     DKIGLGALIGLSNSWRTDCYMLAEHLFYLQQTYWQTRYSISFPRLRPCAGGIEPASIM
                     SEPQLLQLICAFRLFAPDVELSLSTRESPFFRDNVIPVAINNVSAGSKTQPGGYADDH
                     PELEQFAPHDNRSPEQVAQALTKAGLQPVWKDWDSHLGRSLR"
     gene            complement(345956..346771)
                     /locus_tag="YPTB_RS01700"
                     /old_locus_tag="YPTB0286"
     CDS             complement(345956..346771)
                     /locus_tag="YPTB_RS01700"
                     /old_locus_tag="YPTB0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66FP9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase"
                     /protein_id="WP_002228257.1"
                     /db_xref="GI:488157049"
                     /translation="MLKIADTTFTSRLFTGTGKFSSPELMLEALRASGSQLITMAMKR
                     VDLQSGNDAILAPLRQLGVRLLPNTSGAKTAEEAIFAARLAREALNTHWVKLEIHPDV
                     RYLLPDPIETLKAAEVLVKEGFVVLPYCGADPVLCKRLEEVGCAAVMPLGSPIGSNLG
                     LRTRDFLQIIIEQSKVPVVVDAGIGAPSHALEALELGADAVLVNTAIAVAHSPVQMAH
                     AFRLAVESGERARLAGLGASPFNPSQPDTLQLRATATSPLTGFLSQLEEQDHV"
     gene            complement(346773..346988)
                     /locus_tag="YPTB_RS01705"
                     /old_locus_tag="YPTB0287"
     CDS             complement(346773..346988)
                     /locus_tag="YPTB_RS01705"
                     /old_locus_tag="YPTB0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002217275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiS"
                     /protein_id="WP_002217275.1"
                     /db_xref="GI:488146067"
                     /translation="MKTNYIPIMLNDQPLEVECNLTAEMLLNQLKHHQPGTALAINQV
                     IIPRADWQNHRLQAGDHILLFQAIAGG"
     gene            complement(346985..347782)
                     /locus_tag="YPTB_RS01710"
                     /old_locus_tag="YPTB0288"
     CDS             complement(346985..347782)
                     /locus_tag="YPTB_RS01710"
                     /old_locus_tag="YPTB0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein MoeB"
                     /protein_id="WP_002210680.1"
                     /db_xref="GI:488139472"
                     /translation="MKNDQTLSDSEFLRYSRQLLLEDIGPEGQRKLKGASVLIVGLGG
                     LGSPAALYLAAAGVGQLLLADDDQLDLTNLQRQILYRTADIGQTLSNPTSSVSHNKAR
                     LAQRHLQQLNPQIRIVALDTRLTGQVLTDAVANADLVLDCSDNMETRHQVNAACVTAQ
                     KPLISGSAVGFSGQLLVIEPPYAQGCYACIYPDKELPQRNCRTAGVLGPVVGVIGTLQ
                     ALEAIKMLAGIPLALSGKLRLFDGKQQSWSTLQLTRAAHCPACGGGL"
     gene            complement(347772..348446)
                     /locus_tag="YPTB_RS01715"
                     /old_locus_tag="YPTB0289"
     CDS             complement(347772..348446)
                     /locus_tag="YPTB_RS01715"
                     /old_locus_tag="YPTB0289"
                     /EC_number="2.5.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012303440.1"
                     /note="catalyzes the formation of thiamine monophosphate
                     from 4-methyl-5-(beta-hydroxyethyl)-thiazole monophosphate
                     and 4-amino-5-hydroxymethyl pyrimidine pyrophosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="WP_012303440.1"
                     /db_xref="GI:501260422"
                     /translation="MSQLDALSPVATPGFPSTEQRLGLYPVVDSLLWIERLLAAGVTT
                     LQLRIKNADDAQVEQDIVAAIELGKRYQARLFINDYWQLAVKHGAYGVHLGQEDLETA
                     DLAAIQQAGLRLGISTHDEHELAVAKTLRPSYIALGHIFPTQTKQMPSSPQGLASLSR
                     QVKNTPDYPTVAIGGISIERVPHVLATGVGSVAVVSAITLASDWQRATAQLLHLIEGK
                     ELADEK"
     gene            complement(348433..350478)
                     /locus_tag="YPTB_RS01720"
                     /old_locus_tag="YPTB0290"
     CDS             complement(348433..350478)
                     /locus_tag="YPTB_RS01720"
                     /old_locus_tag="YPTB0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012229040.1"
                     /note="catalyzes the formation of
                     4-amino-2-methyl-5-phosphomethylpyrimidine from
                     5-amino-1-(5-phospho-D-ribosyl)imidazole and
                     S-adenosyl-L-methionine in thiamine biosynthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase"
                     /protein_id="WP_002210682.1"
                     /db_xref="GI:488139474"
                     /translation="MSNNTTSLPAENSSHPRKGTPIRKKQREEAQQFINTLQGVTFPN
                     SQRIYLQGSRPDIQVPMREIQLSPTQIGGSKNEPRYEDNEAIPVYDTSGPYGDPQAKL
                     DVHNGLPKLRAAWVADRQDTEALASVSSGFTQQRLADEGLDHLRFEHLPRPRKAATGQ
                     CVTQLHYARQGKITPEMEFIALRENMGRERIRGEVLLQQHPGQAFGAHLPENITAEFV
                     RQEVAAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTR
                     WGADTVMDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGVAENLTWEMFRDTL
                     LEQAEQGVDYFTLHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFR
                     EICQICAAYDVSLSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGP
                     GHVPMQMIRRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAML
                     CYVTPKEHLGLPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWED
                     QFNLALDPATARAYHDETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAAAQEQAAA
                     QAQAATPTTAAQPIDITQPINMLQSGMEKMSAEFRSRGSELYHRPANLSAEANNEPT"
     gene            complement(350581..>350697)
                     /locus_tag="YPTB_RS01725"
     CDS             complement(350581..>350697)
                     /locus_tag="YPTB_RS01725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228187.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032466894.1"
                     /db_xref="GI:694126301"
                     /translation="KQTQAETVNSGSAEPDRVNTREGNKSNLSLQARYSPSG"
     gene            complement(350853..351362)
                     /locus_tag="YPTB_RS01730"
                     /old_locus_tag="YPTB0291"
     CDS             complement(350853..351362)
                     /locus_tag="YPTB_RS01730"
                     /old_locus_tag="YPTB0291"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66FP4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of sigma D"
                     /protein_id="WP_011191553.1"
                     /db_xref="GI:499504913"
                     /translation="MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKE
                     KHTPLNAKTLENFCHNLVDYLSSGHFHIYDRIIKEVEGASSPKMALTAKIHPALKNNT
                     QTIMAFHDRYTNIEIDDDSCTEYQQALSDIGEALDARFKLEDQLIQWAAESWQAAQLA
                     DADKKSQVN"
     gene            351459..352241
                     /gene="nudC"
                     /locus_tag="YPTB_RS01735"
                     /old_locus_tag="YPTB0292"
     CDS             351459..352241
                     /gene="nudC"
                     /locus_tag="YPTB_RS01735"
                     /old_locus_tag="YPTB0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66FP3.1"
                     /note="can catalyze hydrolysis of broad range of
                     dinucleotide pyrophosphates but prefers reduced form of
                     NADH; requires divalent metal ions such as magnesium and
                     manganese and produces two mononucleoside 5'-phosphates;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH pyrophosphatase"
                     /protein_id="WP_011191554.1"
                     /db_xref="GI:499504914"
                     /translation="MELQLTGKESGWWIVSHENKLWLPKGELPQGNAANWSLQGATAR
                     QIGEWQGQPVWLIRQMMPSGMGSVRQLLDVDRGLFQLAGRGVQLAEFYRSHRFCGYCG
                     HEMHASRTEWASLCNHCRERYYPQIAPCVIVAIRRGDEILLAQHVRHRGGINTVLAGF
                     VEVGETLEQAVSREVLEESNIHIKNLRYVTSQPWPFPHSLMMAFMADYDSGELCHDPK
                     ELLNAGWYRYDQLPLLPPPGTVARRLIEDTVVLCREHSDLSQ"
     gene            352334..353119
                     /locus_tag="YPTB_RS01740"
                     /old_locus_tag="YPTB0293"
     CDS             352334..353119
                     /locus_tag="YPTB_RS01740"
                     /old_locus_tag="YPTB0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002210685.1"
                     /db_xref="GI:488139477"
                     /translation="MRPIITQTVQPVTSMYPSLPKAFIQDKVMLSLHNKAALDSTIKG
                     DAVRALLLHAYVDIKGNEVERRTTAVGIQKLYEEVLQELLYQDPKCISVMISHTANPP
                     TPLSIASPERVMQMMHQNIRQDIASQKTITDRTQTLHNLLSYKNQFQYKAIYDQPRLK
                     PEENYNFKMVNDVHENLHSIQTDSCCKAGALTGATYFLQDSPGEIHVFGIRITQANEE
                     SGKVELFQGLKSDVQTNNKLDSLYLLLRGNSHQSPDDISSSVG"
     gene            353238..354305
                     /gene="hemE"
                     /locus_tag="YPTB_RS01745"
                     /old_locus_tag="YPTB0294"
     CDS             353238..354305
                     /gene="hemE"
                     /locus_tag="YPTB_RS01745"
                     /old_locus_tag="YPTB0294"
                     /EC_number="4.1.1.37"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004876779.1"
                     /note="catalyzes the formation of coproporphyrinogen from
                     uroporphyrinogen III; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_011191555.1"
                     /db_xref="GI:499504915"
                     /translation="MNELKNDRYLRALLRQPVDMTPVWMMRQAGRYLPEYKATRAIAG
                     DFMSLCKNAELACEVTMQPLRRYPLDAAILFSDILTIPDAMGLGLYFETGEGPRFQSP
                     ITCRADVEKLPIPDPEQELGYVMNAVRTIRRELAGSVPLIGFSGSPWTLATYMVEGGS
                     SKAFTKLKKMMYAEPQTLHLLLDKLADSVILYLNAQIKAGAQSVMIFDTWGGVLTGRD
                     YHEFSLNYMHKIVDGLIRENEGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWTTDIA
                     DARRRVGDKVALQGNMDPSVLYAPPARIEQEVSTILASFGQGEGHVFNLGHGIHQDVP
                     PAHAGAFVNAVHALSRPYHQK"
     gene            354371..355075
                     /locus_tag="YPTB_RS01750"
                     /old_locus_tag="YPTB0295"
     CDS             354371..355075
                     /locus_tag="YPTB_RS01750"
                     /old_locus_tag="YPTB0295"
                     /EC_number="3.1.21.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZAQ8.1"
                     /note="Selectively cleaves double-stranded DNA at the
                     second phosphodiester bond 3' to a deoxyinosine leaving
                     behind the intact lesion on the nicked DNA; cleaves DNA
                     containing urea residues, AP sites, base mismatches,
                     insertion/deletion mismatches, flaps, and pseudo-Y
                     structures; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="WP_011191556.1"
                     /db_xref="GI:499504916"
                     /translation="MFDTKALQAEQRQRASEISLHDGIDNQFVRFIAGADVGFEQHGE
                     ITRAAIAILRYPSLALVEYQVARVATSLPYIPGLLSFREYPALLAAWAQLQQRPDLIL
                     VDGQGIAHPRRLGVASHFGLLVDVPTIGVAKSRLCGDFLPLHQDVGAVQPLFDNDEQL
                     GWVWRSKIRCNPLFISPGHRVSVGSALAWVQRCMAGYRLPEPTRWADAIASNRPQFQR
                     WLRKNPDFLGKRRDMI"
     gene            355121..355711
                     /locus_tag="YPTB_RS01755"
                     /old_locus_tag="YPTB0296"
     CDS             355121..355711
                     /locus_tag="YPTB_RS01755"
                     /old_locus_tag="YPTB0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005166074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002230622.1"
                     /db_xref="GI:488159414"
                     /translation="MLRNPIHLRLEKLESWQHLTFMACLCERMYPNYQQFCLETGFGD
                     PAVYRRILDLIWETLVVKDAKVNFDSQLEKLEEAIPSSDDYAIYGVYPAIDACIALSE
                     AIHSRLSGETLEHAIAISEASIRTVAMLEMTLAGKEMTDEELKILPAIEEEWDIQWEI
                     FRLLADCEERDLDLIKGLRSDLREAAVSNIGINLTQ"
     gene            355900..356175
                     /locus_tag="YPTB_RS01760"
                     /old_locus_tag="YPTB0297"
     CDS             355900..356175
                     /locus_tag="YPTB_RS01760"
                     /old_locus_tag="YPTB0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004712420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002210689.1"
                     /db_xref="GI:488139481"
                     /translation="MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDPVQL
                     VGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVKS"
     gene            356225..356878
                     /locus_tag="YPTB_RS01765"
                     /old_locus_tag="YPTB0298"
     CDS             356225..356878
                     /locus_tag="YPTB_RS01765"
                     /old_locus_tag="YPTB0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012303442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012303442.1"
                     /db_xref="GI:501260424"
                     /translation="MRRVLITFGLTLGLSACSSLSDPPQFSASGYIADSGVVRLWRQD
                     NAQQQPQVLMSVYSPYFGGNTRVTFYEYQNGILREIRRNDLGATPQSVQLRFDEQGQV
                     SFMQRQLASRRESLSADDIAVYQLEAKRILELSRVLRAGDVRLIQGRWQDGMLTTCAG
                     KTLRLNLDDNSQAWLTTRGEKNTQPLGVAWLDSSEGQQLLLVANQDFCRWEPQAGSL"
     gene            complement(357064..358350)
                     /locus_tag="YPTB_RS01770"
                     /old_locus_tag="YPTB0299"
     CDS             complement(357064..358350)
                     /locus_tag="YPTB_RS01770"
                     /old_locus_tag="YPTB0299"
                     /EC_number="6.3.4.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011055270.1"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="WP_011191558.1"
                     /db_xref="GI:499504918"
                     /translation="MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLE
                     NVDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLE
                     GSKAFTKDFLARHNIPSAEYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMT
                     LEEAETAVNDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRV
                     GDGDTGPNTGGMGAYSPAPVVTDDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMI
                     SADGQPKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGV
                     VLAAGGYPADYRQGDVIHGLPQQEVKDGKVFHAGTKLNGNHEVVTNGGRVLCVTALGE
                     TVAQAQQYAYQLAEGIQWEGVFCRKDIGYRAIARGK"
     gene            complement(358410..359999)
                     /gene="purH"
                     /locus_tag="YPTB_RS01775"
                     /old_locus_tag="YPTB0300"
     CDS             complement(358410..359999)
                     /gene="purH"
                     /locus_tag="YPTB_RS01775"
                     /old_locus_tag="YPTB0300"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011055271.1"
                     /note="involved in de novo purine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional purine biosynthesis protein PurH"
                     /protein_id="WP_011191559.1"
                     /db_xref="GI:499504919"
                     /translation="MQQRRPIRRALLSVSDKAGIIEFAQALSQRGIELLSTGGTARLL
                     ADAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDGIMAQHGIQPIDIVV
                     VNLYPFAQTVARPDCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYPAIITEL
                     DNNDGSLTYPTRFNLAIKAFEHTAAYDSMIANYFGTLVPPYHGDTEQPSGHFPRTLNL
                     NYIKKQDMRYGENSHQQAAFYIEEDVKEASVATAQQLQGKALSYNNIADTDAALECVK
                     EFSEPACVIVKHANPCGVAIGDSILAAYERAYQTDPTSAFGGIIAFNRELDAATANAI
                     ISRQFVEVIIAPTVSSDALALLAAKQNVRVLTCGQWQARSAGLDFKRVNGGLLVQERD
                     LGMVTAADLRVVSKRQPTEQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSR
                     VYSAKIAGIKAADEGLEVAGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEV
                     IAAADEHGIAMIFTDMRHFRH"
     gene            complement(360491..360676)
                     /locus_tag="YPTB_RS01780"
     CDS             complement(360491..360676)
                     /locus_tag="YPTB_RS01780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002218887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032466595.1"
                     /db_xref="GI:694126000"
                     /translation="MFDLLTFTCVKAAVLKDYFLQIGILTEVTMFTALVTLQDLILFL
                     PAETGVDIVLRVPTQIV"
     gene            360679..362227
                     /locus_tag="YPTB_RS01785"
                     /old_locus_tag="YPTB_RNA_102"
     rRNA            360679..362227
                     /locus_tag="YPTB_RS01785"
                     /old_locus_tag="YPTB_RNA_102"
                     /product="16S ribosomal RNA"
     gene            362361..362436
                     /locus_tag="YPTB_RS01790"
                     /old_locus_tag="YPTB_RNA_15"
     tRNA            362361..362436
                     /locus_tag="YPTB_RS01790"
                     /old_locus_tag="YPTB_RNA_15"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:362395..362397,aa:Glu,seq:ttc)
     gene            362680..365616
                     /locus_tag="YPTB_RS01795"
                     /old_locus_tag="YPTB_RNA_103"
     rRNA            362680..365616
                     /locus_tag="YPTB_RS01795"
                     /old_locus_tag="YPTB_RNA_103"
                     /product="23S ribosomal RNA"
     gene            365708..365823
                     /locus_tag="YPTB_RS01800"
                     /old_locus_tag="YPTB_RNA_104"
     rRNA            365708..365823
                     /locus_tag="YPTB_RS01800"
                     /old_locus_tag="YPTB_RNA_104"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            366224..366490
                     /locus_tag="YPTB_RS01805"
                     /old_locus_tag="YPTB0301"
     CDS             366224..366490
                     /locus_tag="YPTB_RS01805"
                     /old_locus_tag="YPTB0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008814936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002213260.1"
                     /db_xref="GI:488142052"
                     /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKK
                     FGGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKF"
     gene            366496..367323
                     /locus_tag="YPTB_RS01810"
                     /old_locus_tag="YPTB0302"
     CDS             366496..367323
                     /locus_tag="YPTB_RS01810"
                     /old_locus_tag="YPTB0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_032467102.1"
                     /db_xref="GI:694126519"
                     /translation="MQKRDAVEYLLAAYRIGVRRGCRLMMQSRTVYNYRSHRDDRAIT
                     QRIREIAETRIRYGCPRIHILLRREGWLVNHKKTHRIYCLEGLNLRSKRPRRHVTAKH
                     RHARPEVTALEQCWSMDFVADNLFNGRRVRALTIVDNFSRECLAIEVGQGLRGDDVVA
                     VMDRLKHSLGRIPQRLQTDNGSEFISKSMDRWAYENRVTMDCSRPGKPTDNAFIESFN
                     GSLRDECLNVHGFLSLEDAQEKIEQWRQEYNHFRPYSSLNNLTPAEFARSHQKGPDL"
     gene            complement(367716..368495)
                     /locus_tag="YPTB_RS01815"
                     /old_locus_tag="YPTB0303"
     CDS             complement(367716..368495)
                     /locus_tag="YPTB_RS01815"
                     /old_locus_tag="YPTB0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016243248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001297096.1"
                     /db_xref="GI:485651601"
                     /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
                     HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERN
                     ENIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQR
                     GVMAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDA
                     ALTSAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
     gene            complement(368495..369517)
                     /locus_tag="YPTB_RS01820"
                     /old_locus_tag="YPTB0304"
     CDS             complement(368495..369517)
                     /locus_tag="YPTB_RS01820"
                     /old_locus_tag="YPTB0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001582750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000255944.1"
                     /db_xref="GI:446178089"
                     /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEP
                     PKYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIR
                     SLSVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMR
                     YDTLETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFS
                     PRLCRPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVA
                     NQRKHETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDS
                     FCRGVA"
     gene            369677..370834
                     /locus_tag="YPTB_RS01825"
                     /old_locus_tag="YPTB0305"
     CDS             369677..370834
                     /locus_tag="YPTB_RS01825"
                     /old_locus_tag="YPTB0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_011191561.1"
                     /db_xref="GI:499504921"
                     /translation="MNGAAFVSSMILAVIFTTTTVQASPVAYQKEAITENNLPVFYPQ
                     LKQQMNYQSSWLAGKYTDFALWRSDTRKILRQALLTPNSTITFSAEKIEQQDRGSYIA
                     EKIALNITDESRVLGLLLTPKTKGPHPAIVLLHDHGSKFDIGKEKMIRPWGDSAKLAS
                     AQAWSDKFFSGKFVGDELAKRGYVVFSIDSIGWGDRGPMSYERQQALASNFFNLGRSL
                     AGTMAYEDMRTVDFMTTLPSVDRKRIGVLGFSMGAYRAWQLAALSDQVAATAAISWFG
                     NYKGLMTPDNNVLRGQSSFYMLHPGIANKLDFPDIASLAAPRPMLLFNGGKDKLFPAQ
                     AVEQAYDKVHAIWRSQNAEPRLVTRSWPTLGHVFYQEQQDVVFLWLDRWLK"
     gene            complement(370908..372563)
                     /gene="actP"
                     /locus_tag="YPTB_RS01830"
                     /old_locus_tag="YPTB0306"
     CDS             complement(370908..372563)
                     /gene="actP"
                     /locus_tag="YPTB_RS01830"
                     /old_locus_tag="YPTB0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZJ73.1"
                     /note="member of the sodium:solute symporter family;
                     cotranscribed with the acs gene which encodes acetyl
                     coenzyme A synthase; mutations affect acetate uptake;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation/acetate symporter ActP"
                     /protein_id="WP_011191562.1"
                     /db_xref="GI:499504922"
                     /translation="MKIRHWSALSLFVLPALAQAEALTGEVHRQPLNIQAIVMFLLFV
                     GGTLYITYWASKRTRSRQDYYTAGGRITGFQNGLAIAGDYMSAASFLGISALVYASGY
                     DGLIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSACGSLVVVA
                     LYLIAQMVGAGKLIQLLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAVMLLS
                     GATFMAIMVMKSVNFNFNTLFSEAVKVHPKGLSIMSPGGLVSDPISALSLGLALMFGT
                     AGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVGPNQTFKDAA
                     GALLGGNNMAAVHLANAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASV
                     IKKGKANERDELRVSKITVIILGIVAIGLGILFEKQNIAFMVGLAFSIAASCNFPIII
                     ISMYWDKLTTRGAMIGGWLGLSTAVILMILGPTIWVTILGHEKPIYPYEYPALFSMIA
                     AFVGTWFFSITDNSETGKQERLLFKSQFVRSQTGLGASKGGAH"
     gene            complement(372560..372871)
                     /locus_tag="YPTB_RS01835"
                     /old_locus_tag="YPTB0307"
     CDS             complement(372560..372871)
                     /locus_tag="YPTB_RS01835"
                     /old_locus_tag="YPTB0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002209030.1"
                     /db_xref="GI:488137822"
                     /translation="MNDSIYQEIEDNPRFQELVKKRSRFAWLLSLITLTMYVAFIFLI
                     AFEPQWLGTPIYTGSSVTRGIPVGVGLIVTSFILTGIYVIRANGEFDRLTAEIIREVK
                     Q"
     gene            complement(372928..374886)
                     /locus_tag="YPTB_RS01840"
                     /old_locus_tag="YPTB0308"
     CDS             complement(372928..374886)
                     /locus_tag="YPTB_RS01840"
                     /old_locus_tag="YPTB0308"
                     /EC_number="6.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8D1G8.2"
                     /note="Acs; catalyzes the conversion of acetate and CoA to
                     acetyl-CoA; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthetase"
                     /protein_id="WP_011191563.1"
                     /db_xref="GI:499504923"
                     /translation="MSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGK
                     IIDWIKPYKTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDP
                     NQSKTVTYKQLHHDVCQFANVLKSLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
                     VIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVV
                     VFQRTGNASYWEDGRDVWWHDLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVH
                     TTGGYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVP
                     NYPGVNRLSQVVDKHKVNILYTAPTAIRALMAEGDKAIEGTKRDSLRIMGSVGEPINP
                     EAWEWYYNKIGNSKCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVD
                     NLGNPQEGVAEGNLVITDSWPGQARTLFGDHDRFEQTYFSTFKGMYFSGDGARRDEDG
                     YYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLN
                     HGEEPTPELYTEVRNWVRKEIGPLATPDILHWTDSLPKTRSGKIMRRILRKIATGDTS
                     NLGDTSTLADPSVVEKLLEEKQSMQTPS"
     gene            375741..377057
                     /locus_tag="YPTB_RS01845"
                     /old_locus_tag="YPTB0309"
     CDS             375741..377057
                     /locus_tag="YPTB_RS01845"
                     /old_locus_tag="YPTB0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proton glutamate symport protein"
                     /protein_id="WP_011191564.1"
                     /db_xref="GI:499504924"
                     /translation="MKSIKISLAWQILIALVLGILVGAVLHNQIESREWLVSNILSPA
                     GDIFIRLIKMIVVPIVISTLIVGIAGVGDAKKLGRIGLKTIIYFEVITTIAIIIGITL
                     ANVFQPGVGIDMSALTVVDISQYEKTTEQVQSGSHSLVSTILSLIPANVFASMAKGDM
                     LPIIFFSVLFGLGLSSLPKETKEPLLNVFKAVSESMFKVTHMIMRYAPIGVFGLISVT
                     VANFGFASLIPLAKLVILVYAAILFFALVILGTVARLCKLRIWILIRILKDELILAYS
                     TASSETVLPRIIEKMEAYGAPKAITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIE
                     LSIGQEIILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMA
                     RTALNVVGNALAVLVIAKWENQFDDKKAKAYEKALFAAEQTPANQS"
     gene            complement(377235..377867)
                     /locus_tag="YPTB_RS01850"
                     /old_locus_tag="YPTB0310"
     CDS             complement(377235..377867)
                     /locus_tag="YPTB_RS01850"
                     /old_locus_tag="YPTB0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011191565.1"
                     /db_xref="GI:499504925"
                     /translation="MNTKLLIVDDHELIIHGIKNMLAAYPRYLIVGQADNGLEVYNLC
                     RQTEPDMVILDLGLPGMDGLDVIIQLLRRWPAMKILTLTARNEEHYASRTFNSGALGY
                     VLKKSPQQILMAAIQTVAIGKRYIDPALDASMVIKLTQGPANTPTVLTPRERQILKLI
                     TEGSCNRVIAAQLSISQKTVETHRLNMMKKLDVHKVAELIHWSYRLGLNV"
     gene            complement(377880..380699)
                     /locus_tag="YPTB_RS01855"
                     /old_locus_tag="YPTB0311"
     CDS             complement(377880..380699)
                     /locus_tag="YPTB_RS01855"
                     /old_locus_tag="YPTB0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209035.1"
                     /note="phosphorylates the response regulator SsrB; is
                     involved in the expression of the virulence genes of
                     Salmonella pathogenicity island-2; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011191566.1"
                     /db_xref="GI:499504926"
                     /translation="MGKASSLVTRLTLLLGVTLTVIWLILIATTAFFSYENTRQILIN
                     ELTHMASMRADLSNHQFEGAERDAASLISRRESLQSTSPLPEISIKHYDSCYIPFNLD
                     SCNINQHKNDLWIIQAYGTAGQTYYLDSFIIKQKEGIVLFPPQKSSSDYLNQRRKDLL
                     LLPKFPTHNNIYWGAPTYTPQGGWHVSVAVCDKVGTLAGFALKLNDLIAYNHPVEQRD
                     INLLLDKNGELLPISQQATSSNQLHEILNQLKNSKLHDGWQQTPDYLVLRTQLKGPGW
                     QQLVIYPRIGFAWEALKPALYQLPFALVILLLLTSVLSLLLRYYLAIPLWNFINIIGA
                     TGPQAMEPRLPINRIDELGHIARAYNNLLDTLNEQYDTLEMKVKERTLALAKAKRAAE
                     QANRRKSDHLTTISHEIRTPLNGALGAVELLQNTPLDAGQMRLAETAHQCSLSLLAII
                     NNLLDFSRIESGQMTLSLEKTALLPLLDQAMLTIHSQALSKSLALSTFISADIPLELE
                     LDTLRLRQILVNLLGNAVKFTPQGRIQLRVRRQNQTLCFTVEDTGCGIDVQHQQTIFQ
                     PFMQTSDHEQGTGLGLAIADNLAKMMGGHLTVFSEPGQGSCFSLCLPFNAITPPMPFH
                     GELFAPQRLHAQLSAWGMTCQPELANQPSRYFVDNALCYLPGRLYANLKQYLQGAETE
                     VLKSLPLQPWQMHILLVDDSETNRDITGMMLQQLGHQVTLADSGTTALAIGRQHRFDL
                     VLMDIRMPVLDGLATTARWRHDPANIDSHCMITALSANASPDEQIKTSQAGMNHYLSK
                     PVTLGQLAEMLDLTAQFQLERGVDLSPQLSEPQPLLDLADSALSLKLYQSLQVLIQQA
                     KDAIENLPVLSHTLHTIKGCAGQAGLIELQDAVIQLEHALDTHETLTQQDIIQLDEII
                     HVLLQPPTTCESTFIISQGQSLMVK"
     gene            380944..382443
                     /locus_tag="YPTB_RS01860"
                     /old_locus_tag="YPTB0312"
     CDS             380944..382443
                     /locus_tag="YPTB_RS01860"
                     /old_locus_tag="YPTB0312"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002425231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane secretin SsaC"
                     /protein_id="WP_032466605.1"
                     /db_xref="GI:694126010"
                     /translation="MRKITGLILLFFATLLPYGKFSYGKAIPWQGEPFFIYSRGMTVS
                     ELLKDLGMNYGIPVVISSEINEHFTGKIRDKTPEKILSELAGRYNITWYYDGETLYFY
                     PVQSIKREFISPDGLAANTLVKYLQRGDVLAGKNCAIKAIPHLDTLEVKGVPICIERV
                     KSVSKMLSEQVRHQNQNKETVKVFPLKYASAADSDYQYRDQNVRLPGLVSVLRELNQG
                     NNLPLAGGNQPDGNQASSPVFSADPRQNAVIIRDRQANMPIYRSLITQLDQRPIQIEI
                     SVTIIDVDAGDISQLGVDWSASASIGGTGVSFNSTFAKNNAEGFSTVIGDTGNFMVRL
                     NALQKNSRARILSQPSVVTLNNIQAVLDKNVTFYTKLQGEKVAKLESVTSGSLLRVTP
                     RMIETEGVQEVLLNLNIQDGQQQASTNSNEPLPEIRNSDISTQATLQVGQSLLLGGFI
                     QDTQIESQNKIPLLGDIPLLGGLFRSTDKQSHSVVRLFLIKAVPVNAGE"
     gene            382445..383659
                     /locus_tag="YPTB_RS01865"
                     /old_locus_tag="YPTB0313"
     CDS             382445..383659
                     /locus_tag="YPTB_RS01865"
                     /old_locus_tag="YPTB0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion protein SsaD"
                     /protein_id="WP_011191568.1"
                     /db_xref="GI:499504928"
                     /translation="MTTVFKLRLLNGDLNGRELILPEGEFTLGEQGCDVLLPLSDGNI
                     VTLCVNEYQVMIQVAEEVWINGAQHDLHTPLPLLQSIEIAGLVFVLGEQTDILSGIKV
                     THRARFPLLVWLAIAICVPLSLLFVFLFWLTTQPETLRASIPADVPTQLAERLREPAL
                     QGIKGTWLADGSVTLSGHCASSSMMEPLQHFLLRNHIAFRNQLVCDDRLIASVSDLLH
                     QHGYHDIEVRIGDEPGNIVIYGAVQMGDQWLTVQDTLAAVSGLKGWLVVNAHSGQIQQ
                     LVERLRAAGLLGFLSMTESNKELAISGVLSSEQQQQLKETLAALSQQQPGFPSVRYQN
                     IPASDRTDQFLPAKVVSYGGNTQSAFVRLANGGRLQQGSVLANGYKVVFIGEQGLTLL
                     KANNLVHIPMDF"
     gene            383678..383899
                     /locus_tag="YPTB_RS01870"
                     /old_locus_tag="YPTB0314"
     CDS             383678..383899
                     /locus_tag="YPTB_RS01870"
                     /old_locus_tag="YPTB0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191569.1"
                     /db_xref="GI:499504929"
                     /translation="MQHITVLEEDIKHDPTAIQQRKEILARGRRLITCQLSLLQTPEN
                     YQSLNNMMLALQRAEEIIEILTLRYGNKE"
     gene            384006..384713
                     /locus_tag="YPTB_RS01875"
                     /old_locus_tag="YPTB0315"
     CDS             384006..384713
                     /locus_tag="YPTB_RS01875"
                     /old_locus_tag="YPTB0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011171760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_011171760.1"
                     /db_xref="GI:499485120"
                     /translation="MKSIQFILFRQEGVLRSDGERYVIPAGKLVIADEQASASAFANS
                     AITSILCYPIDLFPIYQDLARRTLPLNKGHLPHAVNDKYKVLPANVEIIQAAEELINI
                     ERVASLRFLYLYCLGIDNVYFSKLLDSIVGTNNELLEFFEKNRLNPWSVSRYANELGI
                     STRKLNFLFYEKFGMSAKQWLLDQRLKKGCELLLSTRLRVADIAMECGFSNHAHFSDS
                     FRRRFQQCPSHMRSLIE"
     gene            384723..384938
                     /locus_tag="YPTB_RS01880"
                     /old_locus_tag="YPTB0316"
     CDS             384723..384938
                     /locus_tag="YPTB_RS01880"
                     /old_locus_tag="YPTB0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002216328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion protein"
                     /protein_id="WP_011191571.1"
                     /db_xref="GI:499504931"
                     /translation="MQISSPMGQLTNDIQQARQAYQNQMAAVNINEPEQMLKSQFTMN
                     QYSAFLDLKSIEMKMINDIRNRILSRI"
     gene            384935..385183
                     /locus_tag="YPTB_RS01885"
                     /old_locus_tag="YPTB0317"
     CDS             384935..385183
                     /locus_tag="YPTB_RS01885"
                     /old_locus_tag="YPTB0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system protein, SsaH family"
                     /protein_id="WP_002209040.1"
                     /db_xref="GI:488137832"
                     /translation="MSLLSADCRQLVVEAALAGVNHSLLAEAHDIVNALPLLIPDPQV
                     RLVCEAMLRFGLGDKVQARALLATSGEEDAQILLGLLQ"
     gene            385281..385532
                     /locus_tag="YPTB_RS01890"
                     /old_locus_tag="YPTB0318"
     CDS             385281..385532
                     /locus_tag="YPTB_RS01890"
                     /old_locus_tag="YPTB0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion apparatus protein, YscI/HrpB"
                     /protein_id="WP_002209041.1"
                     /db_xref="GI:488137833"
                     /translation="MNMSSAQAVAGLFQATEPPVGNTQQVAKFTQLMAQPASTELMMT
                     PESLLMQQAEWMHASLAIDLTAKVAGVMGQNINKLVNMQ"
     gene            385529..386260
                     /locus_tag="YPTB_RS01895"
                     /old_locus_tag="YPTB0319"
     CDS             385529..386260
                     /locus_tag="YPTB_RS01895"
                     /old_locus_tag="YPTB0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion protein SsaJ"
                     /protein_id="WP_011191572.1"
                     /db_xref="GI:499504932"
                     /translation="MKSLRQMLAIVLMTLSLSGCDMELYSGLSEGEANQMLALLMLHQ
                     INAEKQIEKSGMVGLTVDKRQFINAVELLRQNGFPRQRFITVDELFPANQLVTSPTQE
                     QAKMVFLKEQQLENMLSHMDGVIHADVTVAMPMSVDGKNPLPHTASVFIKYSPEVNLQ
                     SYQSQIKGLVRDAVPGIDYAKISVVMQPANYRFSASEAEQQQGPQTTVQWLLRHVGMV
                     QNMVGVAFISLIVLMFVGWFYSRRR"
     gene            386455..387048
                     /locus_tag="YPTB_RS01900"
                     /old_locus_tag="YPTB0320"
     CDS             386455..387048
                     /locus_tag="YPTB_RS01900"
                     /old_locus_tag="YPTB0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011055276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209043.1"
                     /db_xref="GI:488137835"
                     /translation="MAFSPSIDVQYLHQLAWRPAQFAHPLWLAAVGVNPENYGYGRSR
                     ALDSALNGMLIQRRKFPQQRLPAVLNPRQQRQIAQRQRLPALCLALGVVSLQCDDYLR
                     LRRYRQVLSPLLNDDDIQQIIGMGYRGQWQASLSPQQLPDVALRLGQSLACQVRSNNI
                     IWQAVSILLPPNPRALCLSRSMQAQTEAWLSRLERLL"
     gene            387045..387692
                     /locus_tag="YPTB_RS01905"
                     /old_locus_tag="YPTB0321"
     CDS             387045..387692
                     /locus_tag="YPTB_RS01905"
                     /old_locus_tag="YPTB0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion protein HrpE"
                     /protein_id="WP_011191573.1"
                     /db_xref="GI:499504933"
                     /translation="MNPFHLDIEKYGYPLPPGVVIPAAYLAEAMHSQDLLAQANAQAA
                     EILQAAEQARVLLLDQAAEQADALIGQARVQMETALLAQHVRWLVGAEQLESLLITQV
                     RHRILAAITSVVTTWSGEQPMSQILIQRLGDQAEKMAQQGELTLRVHPQHLPAVTTAL
                     GERLRCVGNTEMAADQAQLSSPMLQLTLSLHHHLSQLVLWLQQSPDLFDEENVYE"
     gene            387685..389733
                     /locus_tag="YPTB_RS01910"
                     /old_locus_tag="YPTB0322"
     CDS             387685..389733
                     /locus_tag="YPTB_RS01910"
                     /old_locus_tag="YPTB0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105852.1"
                     /note="with SsaC forms part of a protein export system
                     across the inner and outer cell membranes; part of the
                     Salmonella pathogenicity island 2; part of the type III
                     secretion system; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion system apparatus protein SsaV"
                     /protein_id="WP_011191574.1"
                     /db_xref="GI:499504934"
                     /translation="MSKSALVRGLTMITARQDIFLAVMLLVAVFMMILPLPTTMVDLL
                     IAINLAFSVILLMISIYLRDPLEFSVFPSLLLITTLYRLALTISTTRLVLLQHDAGEI
                     VEAFGQFVVGGNLAVGMIIFTIITVVQFIVITKGSERVAEVSARFSLDGMPGKQMSID
                     GDMRAGAIDSVEAKRLRERVQKESRLFGAMDGAMKFVKGDAIAGIIVILVNIIGGITI
                     GVMQHKMSAEEAMNTYAVLSIGDGLCAQIPSLLISITAGIIVTRVPGSNKQSLANELA
                     VQVGRQPDALWLAAAILTVFALLPGFPFLIFITLAAAVAAPAFLLYRKNRRISQDGRA
                     NGGGEEGAATGQRMTPGAVPLMLHCASNLHHPHLGRDIDGLRWRWFEHLGVPLPEVEI
                     RCDPTLAENTLSVQVYQERVLEVVLPPDSLLLTRPCSSLVTNNQALGAKMGSFDWLDA
                     KQAMQARTLGIPYVEGHQRIITCLTRVFERYTAEFIGVQETRYLMDAMEGRYGELVKE
                     LQRQIPVGKVAEILQRLVEENISIRDLRTIFGALVVWAPKEKDIVMLTEYVRIALRRH
                     LCRRFSHNKTWISVLRLGDGVEHLIRDSIRQTSSGTYSALEERQSLLILNKIKNAFAE
                     NQDAVLLTTLDVRRFVRKIIERDLFVLPVLSWQELGDEMNLKVAGTIELIGDELDETA
                     "
     gene            389720..391057
                     /locus_tag="YPTB_RS01915"
                     /old_locus_tag="YPTB0323"
     CDS             389720..391057
                     /locus_tag="YPTB_RS01915"
                     /old_locus_tag="YPTB0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system ATPase"
                     /protein_id="WP_002209046.1"
                     /db_xref="GI:488137838"
                     /translation="MKLPDIARLTPRLQQQLTRPSAPPEGLRYRGPIVEIGPTLLRAS
                     LPNVAQGELCRIEPQGMLAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVG
                     ADLAGRILDGLGAPIDGGPPLTGQWRELDCPPPSPLTRQPVEQMLTTGIRAIDGILSC
                     GEGQRIGIFAAAGVGKSTLLSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARA
                     RTVVVVATSDRPALERLKGLSTATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAA
                     GEPPAAGSFPPSVFANLPRLLERTGNSDRGSITAFYTVLVEGDDMNEPVADEVRSLLD
                     GHIVLSRRLAGAGHYPAIDIAASVSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQ
                     IGEYQAGEDLQADEALQRYPAICAFLQQDHSLTRDPDTAHLDTTLEHLAQVVG"
     gene            391054..391455
                     /locus_tag="YPTB_RS01920"
                     /old_locus_tag="YPTB0324"
     CDS             391054..391455
                     /locus_tag="YPTB_RS01920"
                     /old_locus_tag="YPTB0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion protein"
                     /protein_id="WP_002209047.1"
                     /db_xref="GI:488137839"
                     /translation="MNHSQQRTLQRLLALRQRQERRLRQQLGQLRREQQQQEQQLENG
                     RRRHQQLCQQLQQLAQWCGMLTPREADEQKVLRQAVYQAERQAKKQLNAWVAQGRQQV
                     SAIERQQARLRRNQREQEKLRMLTEDESNRY"
     gene            391436..391834
                     /locus_tag="YPTB_RS01925"
     CDS             391436..391834
                     /locus_tag="YPTB_RS01925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002218091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032466018.1"
                     /db_xref="GI:694125423"
                     /translation="MSRIDIEGALPPLREQGYSKERSTHWDHERQRQQFARCFSSPLP
                     RIQNIACTVAGYDDNGLMETHYRIVSGPLCGTKVSVSMTAHGLRIVLSHTESKLIERL
                     QRIQNRWQRQLHQLGFPCLLEVTCADESDA"
     gene            391812..392774
                     /locus_tag="YPTB_RS01930"
                     /old_locus_tag="YPTB0326"
     CDS             391812..392774
                     /locus_tag="YPTB_RS01930"
                     /old_locus_tag="YPTB0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion protein SsaQ"
                     /protein_id="WP_012413433.1"
                     /db_xref="GI:501381867"
                     /translation="MLTNLTPELRALSTLIGSGRQTAGVSVALTEIDGEGVYLPLHYG
                     GQECGLWLSQSCWQHWLNTTLATDNPQLLAAELVIAMANWAVTPLLAPFTDLVVLAES
                     PQKRSLPKQWAVTVAFELEGQPIIGVLQDWPQAALADTLSHWPHEAVTAPDLLWQSGL
                     VAGWCHLSLRQLRQLGPGEGLRLSMAAELDKEACWVWHHASPQIYIKLEGGNRMTIQQ
                     INEASDPLACGSRAESPPLAAVQLEDLPQTLVMEIGRLTLPLGEIKQLAVGQTLACQT
                     HCYGEVNICLNGQSVGRGSLLRCDEKLVVRIAQWGLQNGENIME"
     gene            392901..393551
                     /gene="ssaR"
                     /locus_tag="YPTB_RS01935"
                     /old_locus_tag="YPTB0327"
                     /gene_synonym="yscR"
     CDS             392901..393551
                     /gene="ssaR"
                     /locus_tag="YPTB_RS01935"
                     /old_locus_tag="YPTB0327"
                     /gene_synonym="yscR"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002221023.1"
                     /note="part of a set of proteins involved in the infection
                     of eukaryotic cells; in plant pathogens involved in the
                     hypersensitivity response; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliP"
                     /protein_id="WP_002221023.1"
                     /db_xref="GI:488149815"
                     /translation="MELLNSSYQLIALLFMLSVLPLLVVMGTAFLKLSVVFSLLRNAL
                     GVQQVPPNIAIYGLALVLTIFIMAPVGLDVQARLQNEELSNDIGALAHQIDQNALVPY
                     RDFLQRNTDIEQVTFFNDIVQNKWPERYRDSVKPDSLLILMPAFTLSQLNEAFKIGLL
                     LFLPFVAIDLIVSNILLAMGMMMVSPMTLSLPFKLLVFVLVDGWSLVLGQLVGSYL"
     gene            393548..393841
                     /locus_tag="YPTB_RS01940"
                     /old_locus_tag="YPTB0328"
     CDS             393548..393841
                     /locus_tag="YPTB_RS01940"
                     /old_locus_tag="YPTB0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system protein SsaS"
                     /protein_id="WP_002209051.1"
                     /db_xref="GI:488137843"
                     /translation="MNNHMSSYHENAIIVHLATELLWLVLLLSLPVVVVASTVGLVIS
                     LVQALTQIQDQTLQFLIKLLAVSATLLMTYHWMGATLLNYTQQSFLQITSMRP"
     gene            393843..394637
                     /locus_tag="YPTB_RS01945"
                     /old_locus_tag="YPTB0329"
     CDS             393843..394637
                     /locus_tag="YPTB_RS01945"
                     /old_locus_tag="YPTB0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion protein"
                     /protein_id="WP_002209052.1"
                     /db_xref="GI:488137844"
                     /translation="MTDVLPGLTALALAMMRPYGILLILPLFTARSLGSSLLRNGLIV
                     AIALPVTPLFLSAPIITNSSPVTWIGVLCTELLIGVVMGFVAALPFWAMNMAGFLIDT
                     LRGATMSTLFNPGMGVESSLFGVLFTQILTVLFLISGGFNQVLAALYGSYDSLPIGQG
                     IQPAADLLLFLQTEWQMMFELCLCFALPALLVMVLADLSLGLINRSARQLNVFFLAMP
                     IKSALALFLLLISLPYGLHHYLSRMSDTEQKIGTLIPLIKGGNDVH"
     gene            394627..395694
                     /locus_tag="YPTB_RS01950"
                     /old_locus_tag="YPTB0330"
     CDS             394627..395694
                     /locus_tag="YPTB_RS01950"
                     /old_locus_tag="YPTB0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion system apparatus protein SsaU"
                     /protein_id="WP_011191577.1"
                     /db_xref="GI:499504937"
                     /translation="MSTEKNEKPTPKRLKEAKEKGQVVKSVEITSGVQLVALVIYFLL
                     TGYSLVEQAKALIRSSIIQLQQPLTLALARIGAECMTVLMHIVVVLGGALIVVTIIAG
                     IAQVGPLLATKAVSFKGERINPIQNAKQLFSLRSVFELMKSLLKVGVLTLIFGYLLMQ
                     YAPSFGYLTHCGSRCALPVFSTLMGWLLGSLIACYLVFSLMDYAFQRYTIMKQLKMSH
                     DEVKREHKDSNGDPHIKQKRRQLQHEVQSGSFATNVRRSTAVVRNPTHFAVCLIYHPE
                     ETPLPIVIEKGHDEQAALIVSLAEQSGIPVVENIALARALHRDVACGDTIPEQFFEPV
                     AALLRMALELDYQPSSDDPPR"
     gene            396077..397291
                     /locus_tag="YPTB_RS01955"
                     /old_locus_tag="YPTB0331"
     CDS             396077..397291
                     /locus_tag="YPTB_RS01955"
                     /old_locus_tag="YPTB0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002209054.1"
                     /db_xref="GI:488137846"
                     /translation="MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGE
                     FTRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRIDGMMIIGMFAGCIAAALWANNIK
                     LRKPQHTIRIAQALVGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAAGSY
                     FGAKFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQ
                     PKLGIAMLCGIGFGLLIERAQICFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYV
                     QLGVEPKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQIHYWWVGLGNIIGA
                     TLLAYYWDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQ
                     KATTSALIKESL"
     gene            397321..397557
                     /locus_tag="YPTB_RS01960"
                     /old_locus_tag="YPTB0332"
     CDS             397321..397557
                     /locus_tag="YPTB_RS01960"
                     /old_locus_tag="YPTB0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002353607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041175486.1"
                     /db_xref="GI:752489466"
                     /translation="MAAPIVPDYRLDMVGEPCPYPAVATLEAMPQLKPGEILEVISDC
                     PQSINNIPLDARNYGYTVLDIQQDGPTVRYLIQR"
     gene            complement(397635..398618)
                     /locus_tag="YPTB_RS01965"
                     /old_locus_tag="YPTB0333"
     CDS             complement(397635..398618)
                     /locus_tag="YPTB_RS01965"
                     /old_locus_tag="YPTB0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002209056.1"
                     /db_xref="GI:488137848"
                     /translation="MSIDENTFAFSAKINNHAIYKHLENFIKIVECNSLSIAAHKLNI
                     TPSSTSRSLAQLEEKLGVVLLKRTTRSIVLTDAGDYLFHQARQLLLDLDETLVNTHSF
                     YNHPQGQLKITCSIAFGVCHLMHLFSQYKETNSDVCLSVDLNDQLVNLNEEHFDIALR
                     ITSIPPPNFAIRRICTINWVYCGSKEYLMKRGVPATIEDLEQHDCLVNPNVSDAWLYK
                     STEGESVPLKIKNTVQANSSLGLLHAALHHQGIVCLPTYMLGDYITSGKLVPILLDYN
                     AKDKEYGLYALYYPSKYNDPKIRSFIDFMLDELSMDVPWDKWRADYQISLS"
     gene            398788..400074
                     /locus_tag="YPTB_RS01970"
                     /old_locus_tag="YPTB0334"
     CDS             398788..400074
                     /locus_tag="YPTB_RS01970"
                     /old_locus_tag="YPTB0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016261769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_002209057.1"
                     /db_xref="GI:488137849"
                     /translation="MSEISSSKSELKKLYKSVPFTQYDVGWVILCIGMAIGSGIVFMP
                     VQVGIKGIWVFIAAVIISYPAIYLLQNLYLRTLSESDNCTDYTSVITQYLGKNWGVGL
                     GIAYFLMLLHGMFSYSLAVTFDSASYIKTFGLTEGLLSDSIWYGLIILTVLVAIAAQG
                     EKILFKVSGPMVCVKFGIIVVLGVVMVPYWDFNNISAFPELFSFLRDVLLTLPFTLFS
                     ILFVQILSPMNIAYRKVESDKRIATYRAIRANRVAYIILAVAVLFFAFSFTFSISHEQ
                     AVSAFEQNISALAIAAQVIPGSIVRIMTALLNIFAILTAFLGIYLGFQEAIKGIVVNI
                     ISRFIPEENINQKVLHIGVCVGVILTLWLWVSTRFSILFFLQLGGPLFGVVSCLIPCY
                     LVYKVPVLHKLKGPTIWFISFFGILLCLSPFFKFFE"
     gene            400120..401301
                     /locus_tag="YPTB_RS01975"
                     /old_locus_tag="YPTB0335"
     CDS             400120..401301
                     /locus_tag="YPTB_RS01975"
                     /old_locus_tag="YPTB0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304697.1"
                     /note="catalyzes the formation of L-homocysteine from
                     cystathionine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase"
                     /protein_id="WP_002215044.1"
                     /db_xref="GI:488143836"
                     /translation="MNKKDISSFGISTQITQLGRNPQEQTGFVNTPIYRGSTVIFNTV
                     DDIVNNRAVFNYGTAGTPTIANLESAWTALAGAAGTVISPSGLGVIALALLTTLKAGD
                     HLLMPDSVYKPTRLLCAGLIARMGVETTYYDPLIGAEIETLMKPNTSTLFLESPGSQS
                     FEIQDIPMMTAITKRRGIATIIDNTWASPLFFAAHKHGCDLSLEAGTKYLGGHSDLLM
                     GLVSANEQWWPKLRETYDSMAMLPGAEDCFLALRGLRTLHLRIKEAEKRGLEMAQWLK
                     ERPEVLRVLHPAFPDCPGHEFWKRDFTGSSGLFSIVLKPEFTQKGLAEMLDNMSIFAM
                     GFSWGGYESLVIPFDCSEYRTVTKWNPGGLTIRLQIGLEDMEDLKEDLAQGFIRLASN
                     S"
     gene            complement(401442..402242)
                     /gene="hmuV"
                     /locus_tag="YPTB_RS01980"
                     /old_locus_tag="YPTB0336"
     CDS             complement(401442..402242)
                     /gene="hmuV"
                     /locus_tag="YPTB_RS01980"
                     /old_locus_tag="YPTB0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q56993.1"
                     /note="with HmuTU is involved in the transport of hemin;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin import ATP-binding protein HmuV"
                     /protein_id="WP_002209058.1"
                     /db_xref="GI:488137850"
                     /translation="MVDMAVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIG
                     PNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSV
                     SEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLW
                     QPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRI
                     MLLAQGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ"
     gene            complement(402235..403239)
                     /locus_tag="YPTB_RS01985"
                     /old_locus_tag="YPTB0337"
     CDS             complement(402235..403239)
                     /locus_tag="YPTB_RS01985"
                     /old_locus_tag="YPTB0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q56992.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter permease"
                     /protein_id="WP_002209059.1"
                     /db_xref="GI:488137851"
                     /translation="MNGRVQPRLMLGFLLILLVILALGSANMGALSLSFRTLWNTSTN
                     DAMWHIWLNIRLPRVLLAVVVGCALAVSGTIMQGLFRNPLADPGLLGISSGAALCVGL
                     IIVMPFSLPPLLALYSHMVGAFIGSLAISTIIFTLSRWGHGNLARLLLAGIAINALCG
                     AAVGVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPTCILGLLQARQLNLL
                     QLGDEEAHYLGVNVRQAKLRLLLLSAILIGAAVAVSGVIGFIGLVVPHLIRMRIGADH
                     RWLLPGAALGGACLLLTADTLARTLVAPAEMPVGLLTSLLGGPYFLWLILRQREQRSG
                     "
     gene            complement(403236..404075)
                     /locus_tag="YPTB_RS01990"
                     /old_locus_tag="YPTB0338"
     CDS             complement(403236..404075)
                     /locus_tag="YPTB_RS01990"
                     /old_locus_tag="YPTB0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter substrate-binding protein"
                     /protein_id="WP_011191579.1"
                     /db_xref="GI:499504939"
                     /translation="MRLRLLSLPLILSLCAPLLPLNTLAAERIVTIGGDVTEIAYALG
                     AGDEIVARDSTSQQPQAAQKLPDVGYMRTLNAEGILAMKPTMLLVSELAQPSLVLTQI
                     ASSGVNVVTVPGQTTPESVAMKINAVATALHQTEKGQKLIEDYQQRLAAVNKTPLPVK
                     VLFVMSHGGLTPMAAGQNTAADAMIRAAGGSNAMQGFSRYRPLSQEGVIASAPDLLLI
                     TTDGVKALGSSANIWKLPGMALTPAGKHKRLLVVDDMALLGFGLETPQVLAQLREKME
                     QMQ"
     gene            complement(404072..405109)
                     /locus_tag="YPTB_RS01995"
                     /old_locus_tag="YPTB0339"
     CDS             complement(404072..405109)
                     /locus_tag="YPTB_RS01995"
                     /old_locus_tag="YPTB0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q56990.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin transporter HmuS"
                     /protein_id="WP_002209061.1"
                     /db_xref="GI:488137853"
                     /translation="MNASLYQQYVQAKAEHPGKYARDLATLMGISEAELTHSRVGHDA
                     KRLQSDARALLAALESVGEVKAITRNTYAVHEQVGRYENQHLNGHAGLILNPRALDLR
                     LFLNQWASAFTLTEETRHGVRHSIQFFDHQGDALHKVYVTEQTDMSAWEALLAQFIIP
                     ENPALQLEPLSTPEAVEPTADDATVDSEWRAMTDVHQFFQLLKRNNLTRQQAFRAVGD
                     DLAYQVDNNSLTQLLHIAQQDQNEIMIFVGNRGCVQIFTGLIEKVTPHNEWINVFNQR
                     FTLHLIETAIAESWITRKPTKDGFVTSLELFAADGTQLAQLYGQRTEGQPEQNQWREQ
                     IARLINKDIAA"
     gene            complement(405228..407258)
                     /locus_tag="YPTB_RS02000"
                     /old_locus_tag="YPTB0340"
     CDS             complement(405228..407258)
                     /locus_tag="YPTB_RS02000"
                     /old_locus_tag="YPTB0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q56989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel protein"
                     /protein_id="WP_011191580.1"
                     /db_xref="GI:499504940"
                     /translation="MLRSTSDRFRWSSLSLAIACTLPLATQAADTTTTQTSSKKHSTD
                     TMVVTATGNERSSFEAPMMVTVIEGNAPTSQTAATAADMLRQVPGLTVTGSGRTNGQD
                     VVMRGYGKQGVLTLVDGVRQGTDTGHLNSTFLDPALVKRIEIVRGPAALLYGSGALGG
                     VIAYETVDAADMLQPGQNSGYRVYSSAATGDHSFGLGASAFGRTDDLDGILSFGTRDI
                     GNIRQSDGFNAPNDETISNVLAKGTWQIDSIQSLSANLRYYNNSAIEPKNPQTSAPSS
                     TNVMTNRSTIQRDAQLRYNIKPLDQEWLNATAQVYYSEVEINARPQGSAEEGRKQTTE
                     GVKLENRTRLFIESPASHLLTYGTETYKQEQTPGGATESFPQAKIRFSSGWLQDEITL
                     RDLPVSILAGTRYDNYSGSSDGYADVDADKWSSRGAISITPTDWLMLFGSYAQAFRAP
                     TMGEMYNDSKHFAIPIRPGLTLTNYWVPNPNLKPETNETQEYGFGLRFSDLLMAEDDL
                     QFKVSYFDTKAKDYISTRVDMQAMTTTSVNIDQAKIWGWDASMSYKTALFNWDLAYNR
                     TRGKNQNTDEWLDTINPDTVTSIVDVPVANSGFSVGWIGTFANRSSRVSSSTPQAGYG
                     VNDFYVSYKGQEAFKGMTTTMLLGNAFEKEYYAPQGIPQDGRNVKFFVSYQW"
     gene            407257..407550
                     /locus_tag="YPTB_RS02005"
     CDS             407257..407550
                     /locus_tag="YPTB_RS02005"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032466020.1"
                     /db_xref="GI:694125425"
                     /translation="MSAILHIFFQKHIDRLLAALIRKSGWLAVSVIHTLGISWVHKRE
                     LFCQYKFSRFGLAQLIAFALMDDKGYAVLSQQLFAGDRQRLTCHRIFGGRFVI"
     gene            complement(407666..408316)
                     /locus_tag="YPTB_RS02010"
                     /old_locus_tag="YPTB0342"
     CDS             complement(407666..408316)
                     /locus_tag="YPTB_RS02010"
                     /old_locus_tag="YPTB0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191582.1"
                     /db_xref="GI:499504942"
                     /translation="MRPWLIFGAGRGVGAHLLALANQHADSASNPRPVTLLIRNQQQA
                     EELRNKGLTVVCGDACDPASVREACQLAGEDAAIISTLGNNNANYQGNRLIIDTAEQL
                     GLKRMLLVTSIGCGDSWPTLSPAARAAFGQAVRETSLAESWLQTSNLIYTLIRPGGLL
                     DQPATGNAIRLQTEAHGMVTRADVAHHISQMIEDPATYYQAYALIEPGLARKVKMN"
     gene            complement(408350..408877)
                     /locus_tag="YPTB_RS02015"
                     /old_locus_tag="YPTB0343"
     CDS             complement(408350..408877)
                     /locus_tag="YPTB_RS02015"
                     /old_locus_tag="YPTB0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002230449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme utilization carrier protein"
                     /protein_id="WP_032466021.1"
                     /db_xref="GI:694125426"
                     /translation="MNRSSSMNRSPLAEFLATQPDGTLEQIAQDYQVSVLDVVRALPE
                     RVLVGAEHFDRIWDSMTEWGDVTTLVHTADVILEHKGPLPSGTHRHGYFNLRSKQGLS
                     GHIRAQNCQAIALLERPFMGMATASVQFFNQQGEVMFKVYVGRDEHRQLRADGLAAFH
                     QLAQQLLIEDPTLVK"
     gene            complement(408910..410223)
                     /locus_tag="YPTB_RS02020"
                     /old_locus_tag="YPTB0344"
     CDS             complement(408910..410223)
                     /locus_tag="YPTB_RS02020"
                     /old_locus_tag="YPTB0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019084272.1"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_002209066.1"
                     /db_xref="GI:488137858"
                     /translation="MNIDLMPYYAQPGPLPFPKRWATMPWRDSRPLPAESLQDSWQSL
                     LQKALPRNKRLLYLHIPFCATHCTFCGFYQNPLQSGSTERYTDYLLRELSMEADSPLL
                     QGGPIHAIYFGGGTPSALSAQQLHSIISQLRKSLPLAPDCEITVEGRIFNFDDERIDA
                     CLEAGANRFSIGVQTFNTRIRQRMGRKADRDQAIRFLTDLATRDRAAVVCDLMFGLPH
                     QTPEIWQEDLAIVRQLPLDGVDLYALNLLPTTPLAKSVENNRVELPTLAQQCDFYCSG
                     ADSLAQAGWHQLSNSHWARTTRERNLYNLLIKQGADCLALGSGAGGSLQGHAYMQHRS
                     LDNYYRLIDSGQKPLMMMTQASGEHPWRAKLQSGIEVGRLDLSELIADPYPLMPLISQ
                     WYQSNLLKDNSFCLRLTDSGRFWASNIMQALQNIIPSLITAESHS"
     gene            complement(410564..411364)
                     /locus_tag="YPTB_RS02025"
                     /old_locus_tag="YPTB0345"
     CDS             complement(410564..411364)
                     /locus_tag="YPTB_RS02025"
                     /old_locus_tag="YPTB0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylenetetrahydrofolate reductase"
                     /protein_id="WP_011191584.1"
                     /db_xref="GI:499504944"
                     /translation="MERKLSFEMNSAKNEKEMENIFKLIEFTDTLDPIYYTVNTEIGS
                     SVWSDTYRTVIELREKTDVSLIPHITINNKKEREIMQIIEKYINVGICEFFVIRGDKH
                     VYDQDNPINYGVELIELIRRSHKHIGIKTSLYPDFHKETTEVKEEIDWNERKYQLGVN
                     EFISQLTLNTNALDFLSHWVDKERPFTPSIMPLGNFSFIEKFTSSNSIDYPLWIKKFA
                     NSKSNSNEDKENIGIEIIRFLCREYLNQRERLHVFTLNKVDVMKKIFQ"
     gene            complement(411679..412167)
                     /locus_tag="YPTB_RS02030"
                     /old_locus_tag="YPTB0346"
     CDS             complement(411679..412167)
                     /locus_tag="YPTB_RS02030"
                     /old_locus_tag="YPTB0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein TerW"
                     /protein_id="WP_002209068.1"
                     /db_xref="GI:488137860"
                     /translation="MLLSTKQFRHYTLALLLASGKPVDADDIYDKLSCSGPTLTRALK
                     ELRETYNAEIRYSKSTHSYQLTEKGTLTPKVLRHIKDAIASHMIIKSHEELVASHVIL
                     DKEKKRSISLSLRMSVIRKIDRVVNQLEITRSEAVEILVNTYISELMLSVSQPPKGKK
                     SV"
     gene            complement(412564..413523)
                     /locus_tag="YPTB_RS02035"
                     /old_locus_tag="YPTB0347"
     CDS             complement(412564..413523)
                     /locus_tag="YPTB_RS02035"
                     /old_locus_tag="YPTB0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_002209069.1"
                     /db_xref="GI:488137861"
                     /translation="MKSTPSAYALGATLYMPATRTDIADIIIHNKISGLRSLVICLED
                     AVSEDDVPLAISQLSTLLGTLAVEKKRDGSAHWPLIFVRPRHEAMGLALITRFNLSAI
                     NGFVLPKFTQASITTWWEIMKETHLCMMPTLETEDVFDVAKMSTLARELENHPSRQRI
                     VALRIGGNDLMSVISMRRSRKLTLYDGPMGYVIKMLVSVFCPKNFALTAPVCEQIDNP
                     QLLETELALDIAHGLVGKTAIHPSQIEVIQRALMVDTHDHADALRILNSTQAVFKSQG
                     AMCEPSTHKRWAAAILERAQYYGIMPDFTAMAVRDAPRKHQSG"
     gene            complement(413523..414602)
                     /locus_tag="YPTB_RS02040"
                     /old_locus_tag="YPTB0348"
     CDS             complement(413523..414602)
                     /locus_tag="YPTB_RS02040"
                     /old_locus_tag="YPTB0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209070.1"
                     /db_xref="GI:488137862"
                     /translation="MHDITPFSGSYLPDDIQFLLKPIQIEMTPVEVKEKLIQSGARHY
                     SDMLSQEPAPTEHHLTLFARALDQGATRMAREVVMLAKALINRFGDTPIVLASLVRAG
                     VPLGVMLHHTLRALGKTSFHYGISIIRDRGIDEVALSYIEQKHGTEGLVFVDGWTGKG
                     AITGELTRSLQGRPGYPELPRLVVLADPCGCSWLSATDDDWLIPFGIMGAPVSGLVSR
                     SLWSEKGLHGCVHCEHLQEFECSQLLVNTVADCRQQLDLSQIPAAEWDYQQNAALRIQ
                     SHQVVKKMAEQFEINSVNRIKPGIAEATRAVLRRVPDHVLVRHIDDPDVSLLVYLAKQ
                     KKIAIKEVGNELGQYRAITIIKKVI"
     gene            complement(414595..415407)
                     /locus_tag="YPTB_RS02045"
                     /old_locus_tag="YPTB0349"
     CDS             complement(414595..415407)
                     /locus_tag="YPTB_RS02045"
                     /old_locus_tag="YPTB0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209071.1"
                     /db_xref="GI:488137863"
                     /translation="MNKPVFLCDLDDTLFQTRRKMVDELDLPPFRVGALDRSLTPRSF
                     MTEEQSMLVDWLLEHAEFIPVTARGTEEISRVNIPFSSWAITTHGAVILTPDRQPDAG
                     WQDTVLTNLQPYRDRLIAMESRINDMMAERGLNAWCRINYEYGDTPVYFVMKHRDSTQ
                     IAELYAFNDQLESLFSTDGFYIHRNSNNIAWLPVCIEKGLATTYLLDKLRHEHGAFPV
                     LGFGDSLSDFSFMRHCHWFGMPAKSQFSQALTSHLFDNTTFNKNNVNGDNDA"
     gene            complement(415400..416536)
                     /locus_tag="YPTB_RS02050"
                     /old_locus_tag="YPTB0350"
     CDS             complement(415400..416536)
                     /locus_tag="YPTB_RS02050"
                     /old_locus_tag="YPTB0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209072.1"
                     /db_xref="GI:488137864"
                     /translation="MMTTQPPVYRRELSGGTLTVIPNSSNIPLDSLFDIAERRNPKRA
                     FLFVSKVLGRHIPVSPATMRNVYRQLAERFPADLPGPVLFIGMAETAVGLAAGVFQEL
                     RGTVAEPVFLTSTRHPVDGDLLCEFKENHSHATDHLLYLPSDPVLRARLQRARSVVLI
                     DDEATTGNTFINLLQALRDANLNGLEKVVAVTLTDWSGSALTERCPLPVTTVSLITGE
                     WNWSPIPDAPVPVMPACNVTARGKVAITDKQNWGRLGMDETRADIGHKVHVLAGEKVL
                     VLGTSEFVWQPFLLAERLEHAGANVKFSSITRSPIAQGHAINSIIAFSDNYGLGIPNF
                     LYNVAHQHFDRIIVCVETPAESIDPTLIEQLRTVAPCVEVIAYE"
     gene            complement(416548..417609)
                     /locus_tag="YPTB_RS02055"
                     /old_locus_tag="YPTB0351"
     CDS             complement(416548..417609)
                     /locus_tag="YPTB_RS02055"
                     /old_locus_tag="YPTB0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191585.1"
                     /db_xref="GI:499504945"
                     /translation="MKKNIWFMGGLSSQRDIISGVKNTSELHGNAIQVFASHHQHRYE
                     ILEKADVAFIEPSDLDTKMAFIRHIVKAFDIEAIHTGRSCLWFEQHRAAIEGLGVKLT
                     TGAQCPATFTLADNKVEYAAYMAQKGLPVVPSIQIASPDELREWLANPPFDTEKLCIK
                     PVTGIYGMGFWKLDQSISAMDCFDRTDNRVVHPDLYLAALERTEKMQPMVLMPYLPGP
                     ESSVDMLVEKGKVIAAVARRKEGSVQHLHQSGAAFELAKSSAELMQADGLVNVQTRCD
                     HHGQPLLLEINLRPSGGIGYTRHSGVNLPGLFALRQLDLMSQDEVSSQAVAHFKPVSV
                     RAMTDALPFPAELQNLTHF"
     gene            417885..418478
                     /locus_tag="YPTB_RS02060"
                     /old_locus_tag="YPTB0352"
     CDS             417885..418478
                     /locus_tag="YPTB_RS02060"
                     /old_locus_tag="YPTB0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein TerZ"
                     /protein_id="WP_011191586.1"
                     /db_xref="GI:499504946"
                     /translation="MISLSKNQTISLAKESSALSRVQFGLGWDPVKKKKSFLGGLFGG
                     GSASDSIDLDASCVMLSQTGKPVDTVSFRHLTSKCRSVQHTGDNLTGEGDGDDEVINV
                     DLSRLPAEVEYLAFTVNSFRGQTFNEVENAFCRVVDQTGKELARYVLTEQGSHTGIVI
                     SSLRRNNGQWDFTAHGRACRGRTIEDMMSEIIETVVR"
     gene            418478..419662
                     /locus_tag="YPTB_RS02065"
                     /old_locus_tag="YPTB0353"
     CDS             418478..419662
                     /locus_tag="YPTB_RS02065"
                     /old_locus_tag="YPTB0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein TerA"
                     /protein_id="WP_011191587.1"
                     /db_xref="GI:499504947"
                     /translation="MNLMPGGNAPVASQTLTVRVLSGASVDVSAFRLYASGKVRGDTD
                     MVFYGQPVTDDSTIRLSGQGVNTAFSVNLQAINHDVQKIAFTATCDSNQTLSQLGNLS
                     IQVELNGSVLMKGDVETQGRQEAALILGELYRRNTEWKFRFVAQGFNGGLKPLAEHFG
                     VVVEDEPAAPTPVPTPVSTPAPTAPPVAKPINLSKVSLTKEKPVISLTKRDDFGEIRV
                     NLNWHRGGGAPAKGFLQGIFNSNKGIDLDLGAFVALNDGSRGVIQALGNNFGSYHSEP
                     YVQLQGDDRTGDVSDGEWMHINGREWKHVKEVLIFAFIYEGVPSWGSTDGIVTINVPG
                     QAPIETQMNEGNDRKNMCAVARLVNESGNIKVERINRYFSGHKEMDEAFGWGFRWKAG
                     SK"
     gene            419695..420150
                     /locus_tag="YPTB_RS02070"
                     /old_locus_tag="YPTB0354"
     CDS             419695..420150
                     /locus_tag="YPTB_RS02070"
                     /old_locus_tag="YPTB0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein"
                     /protein_id="WP_002209076.1"
                     /db_xref="GI:488137868"
                     /translation="MSFFNKVKNAISAGRTELTNQVGRFKNRKFMEGTVAVCAHISMA
                     SNGAGPEEKQKMIMFIKQSPELSVFDTNEVIEFFNKLVTSYEFDADIGKGEAMKYIMA
                     LKSQPEAAQLALRVGIAVAKSDGVFDEMEEAAAREICVTLGFVPADFQL"
     gene            420172..421209
                     /locus_tag="YPTB_RS02075"
                     /old_locus_tag="YPTB0355"
     CDS             420172..421209
                     /locus_tag="YPTB_RS02075"
                     /old_locus_tag="YPTB0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein TerC"
                     /protein_id="WP_011191588.1"
                     /db_xref="GI:499504948"
                     /translation="MESTHIGFPIETVAVFILLSVGAICIDLFMHRHDKPISLKSAAL
                     WSLFWVAIAFVFAGFLYLHHGAEAASLFVTGYALEKVLSIDNLFVMMAIFSWFAVPDR
                     LRHRVLYWGIIGAIVFRGIFVAIGTGLLMLGPWVEVVFAIVVAWTAVMMLRKGDDDDA
                     IEDYSQHIAYRLVKRFFPIWPKLRGNAFILSQKEVDAELAKPENADVQVGRKGGVARY
                     ATPLMLCLAVVELSDVMFAFDSVPAVIAVSREPLIVYSAMMFAILGLRTLYFVLEALK
                     QYLVHLEKAVIVLLFFIAAKLGLNASDHFFNHGYDISANVSLFVVIGVLALGIVASFL
                     FPEKDSKEGQH"
     gene            421273..421851
                     /locus_tag="YPTB_RS02080"
                     /old_locus_tag="YPTB0356"
     CDS             421273..421851
                     /locus_tag="YPTB_RS02080"
                     /old_locus_tag="YPTB0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemical-damaging agent resistance protein C"
                     /protein_id="WP_002209078.1"
                     /db_xref="GI:488137870"
                     /translation="MGVSLSKGGNVSLSKEAPTMTNVLIGLGWDARSTDGQDFDLDAS
                     AFLLTANGKVRNDADFIFYNNLKSSDGSVMHTGDNRTGEGEGDDESLKIKLPLIPADV
                     DKIVFVVTIHDAQARRQSFGQVANAFIRLVNDDNGVEIARYDLSEDASTETAMLFGEL
                     YRHNAEWKFRAVGQGYAGGLSSVCAQYGINAS"
     gene            422035..422610
                     /locus_tag="YPTB_RS02085"
                     /old_locus_tag="YPTB0357"
     CDS             422035..422610
                     /locus_tag="YPTB_RS02085"
                     /old_locus_tag="YPTB0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein TerE"
                     /protein_id="WP_002209079.1"
                     /db_xref="GI:488137871"
                     /translation="MAVSLVKGGNVSLTKEAPTMNIAVVGLGWDARVTDGSEFDLDAS
                     VFMVGENGKVLSDQHFIFFNNKVSPCGSVVHQGDNRTGAGDGDDEQIKIDLKKVPADV
                     KKIIFSVTIYDAEARKQNFGMVSNSFMRVVNEDNSAEIARFDLSEDASTETAMIFGEL
                     YRNNDEWKFKAVGQGFAGGLSALASQHGVSV"
     gene            423323..423961
                     /locus_tag="YPTB_RS02090"
                     /old_locus_tag="YPTB0358"
     CDS             423323..423961
                     /locus_tag="YPTB_RS02090"
                     /old_locus_tag="YPTB0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209080.1"
                     /db_xref="GI:488137872"
                     /translation="MKKPLTQIAILSSLVVSISAASAAVPTAELKVVGTMTVPSCTVV
                     SPDAGIYDIGKLSSSLVKPGTTVTVLAQINKTWTVNCDANTYLNFTPVDNRVGSSSDG
                     SAAAFGLGKINDTGKIGYYTVQMRNATVDGKKSGVFTASSASFSQADTSYLNRGQRTG
                     WAAGANTQNSGKVFVADLLVTPVLAGTNTMNGAITEDAKIDGSLTMNFAFGI"
     gene            424212..426590
                     /locus_tag="YPTB_RS02095"
                     /old_locus_tag="YPTB0359"
     CDS             424212..426590
                     /locus_tag="YPTB_RS02095"
                     /old_locus_tag="YPTB0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191589.1"
                     /db_xref="GI:499504949"
                     /translation="MVARCINLQCIAFLFSFFPTLAFPVTEEGEVVFDIETLERLGYS
                     AELAKFFSGQDRFLPGQHDVTIIINASKTYRIAATFDSEGKLCMDKALLMALKLRNTE
                     SDGSCENMEARWPGMVVKLFPGQFRVEITLPQEAFDPEMEGSEYQQGGHALLLNYNIF
                     GQRVESNNSRFNLVQGQFEPGINFKNWVLRNRGSYSYNQGVSQYYNQETSALRAVESL
                     KSVVQLGEFGLVGNTFSGLPVTGIQLYSDDAQRDDTQLIVPIEGIANTNATIEIRQRG
                     RVIYRTIVAPGPFSLSNISNFSSGVNTDVSIIEEDGTQQNFTVTSALDINAEQQASIY
                     QLAVGRYRDMFTGEDRPSPLLLSGEMSFNPAATFYMTSAGLLSSGYQNIRVQNLYSGW
                     DQAWFSAAASYANTKDAGQGYQFSVQNQMTINGNFGVSWSSVYGSANYWSPDDALSSS
                     NNLNDLMFGKLKNATSVAVSWVHPRWGAFSYALSNNMYYQASGRTYHIFSISEQFGRA
                     TTILSSQLSSQGQNSLYVGINMPLGNGTLSGRVQRNNGNVALGSTYQGRWGDNKDYSV
                     GISGDNRQRRINGSMNIRTAYSQLTGGVSQATNNSRSAYLSSRGSVAYVNNTFATSSS
                     SVGDTFAVVNIPNQPGLRVSSPSSGIAITDYAGIALLPLVRPYTASKVQISTQTLPLN
                     IRLNNTSADLLMTRGSVATHHFETTETRQLLLTIRGSDGEMLPIGANVLDEKGNFLGT
                     IIGDGNFMLENKAIGVTLRVKANNRDECRVNYREPEKFDPDVLYEVADAVCQ"
     gene            426662..427405
                     /locus_tag="YPTB_RS02100"
                     /old_locus_tag="YPTB0360"
     CDS             426662..427405
                     /locus_tag="YPTB_RS02100"
                     /old_locus_tag="YPTB0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_002209082.1"
                     /db_xref="GI:488137874"
                     /translation="MQNFPTHHRDIGATIIYVNSVNRFNIFFVFTLLILLSSWSAVSY
                     ASFKLESTTVILQESEARTSFTIDNISSNPILLVTKLTDLDGKSFSKQILISPPVTRI
                     NAGQSQQVNFVLKKGSVLNNEVLLKASFEGVEQVPGNAAVMPIRQEIGFLIQPSAVPQ
                     IRMPWQTLVFSISGNNLVIKNPGKHVVRLGPQIILVPSNEVVALGNPYIMPETSKLFP
                     ITSSPTAVKVTPLSRYGFVQTEVTLPVTR"
     gene            427416..427598
                     /locus_tag="YPTB_RS02105"
     CDS             427416..427598
                     /locus_tag="YPTB_RS02105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012304693.1"
                     /db_xref="GI:501261675"
                     /translation="MWGDHLYTEGGIFFPVVEIDMPQEFAGSARAIGCPIGYLPSLRL
                     QTLWLFSRYLPRDSRR"
     gene            428862..430181
                     /locus_tag="YPTB_RS02110"
                     /old_locus_tag="YPTB0362"
     CDS             428862..430181
                     /locus_tag="YPTB_RS02110"
                     /old_locus_tag="YPTB0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012304692.1"
                     /db_xref="GI:501261674"
                     /translation="MMHTENNSPPGLIPLPDWYPVAFSHLDAMEYASVTRLWHHEPVL
                     RDLVDELDKRNPGLITFTHCPHCHSADICPGTRPEEYRCRTCHRCSSPYTHTPFFDLH
                     HARHSRLYAVLVTLWGTWQVEDAAWLSDCKSKQIWKQYCHRLKPILALIGGRAVTHTP
                     RYLRGFTPGQQGLHCPACASTQLVYSETMPVGNPEVHCQVCQTDFVMYPDIPKGIDPF
                     AVNTPQYDIPLPRWFSRLFSHASQAQYQHLREVWQREPVLREAVDRLDAQNPEQGAVY
                     ACPYCQNKHISPRKTASSIEGYYCPACDNPFTATTGTVFTRMRQEHFWRLYAVLVMLW
                     TQWRPTQIFELCQLRSVHPFLTYHKRLAPLLAEFDGAPITPYPRNLLGFTPGQQGVCC
                     VYCQSTKLITEGITVMPLDNPYICCLDCGQRFMLRVWRKQVKSNEKK"
     gene            430698..430901
                     /locus_tag="YPTB_RS02115"
     CDS             430698..430901
                     /locus_tag="YPTB_RS02115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002228683.1"
                     /db_xref="GI:488157475"
                     /translation="MRLIPEAYPVSSRCRLPATRIIVGICVFTQKIKNGKTKTQRGKM
                     DILTIDSTGKHIIFMAKNNILNT"
     gene            431190..433247
                     /locus_tag="YPTB_RS02120"
                     /old_locus_tag="YPTB0364"
     CDS             431190..433247
                     /locus_tag="YPTB_RS02120"
                     /old_locus_tag="YPTB0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding protein"
                     /protein_id="WP_011191591.1"
                     /db_xref="GI:499504951"
                     /translation="MKIIDKNVSTYETLQKGFNLRWPPNVEQGAETIYICTTPDEVFA
                     AANTALAAGNRITVRSGGHCYEGFVSNKLSTERLSIIDLGEMSGLDYDEDKTITSLWD
                     ANKNTYRFKSLTGNQNWNGYVSLYKRSGRTIPGGSCYSVGVGGHISGGGYGLLSRLHG
                     LTVDWVTGVDILVPVGNAHRLAFRHVRADSVSEVDRELFMACCGAGGGNFGIIIAYYF
                     DDLPKAPQKAYWIPLTYPWSSLKATFPAFLKAYWQWFADNDVNATSTKEGVGNGGLFT
                     LLKLNHIDASDNVVLAIQYTGPNGQVGGANDIPLNDFIEKMNAAAGMTPTIYDDFILP
                     NIPPFKHLYPGRKIGRTVDESASMDWLHVTQMINGSGSNQRGKYKSDYQIKQFSDEMC
                     HALLTHLTTATADKRFNQSLVQIDSYGGAINSRGIGATAVSQRNSLLKAQYQTYWTNE
                     ADDQTHLTWIRNIYAAVHNGKPAPPEFEGCYINYPDIDMKYTDSGEEDPNWLNLYYGW
                     DTQLIKRLIALKARIDPNNIFHHELSIPLVTELPKAPVNLHSTGQTTTSISLMWGSSI
                     GALPVASYAIYRDGHEVKLLNGTQTSAEDAGLQPNTEYRYFVAAGDEHGNLSVPSNVL
                     TVSTQGTHPAWVLNGSYAVGDVVSNLGKLWRCIQSHVAYDPLWAPGTNGGITLWAGYT
                     AGR"
     gene            complement(433591..437385)
                     /locus_tag="YPTB_RS02125"
                     /old_locus_tag="YPTB0365"
     CDS             complement(433591..437385)
                     /locus_tag="YPTB_RS02125"
                     /old_locus_tag="YPTB0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter"
                     /protein_id="WP_011191592.1"
                     /db_xref="GI:499504952"
                     /translation="MHIQFREPISTSPAQPDAGRQHLFSRVPAAVMNPITLAIIVAFS
                     TLVLPQTAWAACNSSGVGTYVCEGENNTAISLFGTDIAVETRPGFGITEHEITDSALS
                     LTGSGTISYLDTNSSALDTDSRYSLYIKNDTLITEQSASINVQSNGSISSGVYIDNQS
                     SDDSTIRVDLSGILSSSLSGAPALSIFSSAGNDSTIILNTHAISGVTGIQSDNNSQNG
                     ATITHVDVTGDINVENSGVSIRNAANGGTSIINFNSKSINTEYDSFYIQNTNYVGGVI
                     TDINIDGDISSANSQAARIYNYTNGGLASLRFRANNVTGSTGLYIDNSSQNGAVTDII
                     LTGDLTATSGSALQANAYSDEGNIETAIKLNNVYSLYDALNISDYTRSGNILHDLDIS
                     GTITAENGTGIKVMGAAGEGSSTMLINVNNITSSSQSLDINNYNFLGSAFSAITATGH
                     LTAEWGQGAMLQTHSSLGDATTLIHFNDITAMSSGISLINEANQGTSTTDITVTGQIN
                     VSHGEGITLNALTTDGRTLVNVDVNNIASEYDAIRLYNYNYNDNYATGVDDGTGADNG
                     TSTIDLITRGALVSQQGYGINIETNTADTYVTVGGLVHGGNGTAIGIHRLDNIQTSAT
                     LELQSGYALEGVTQALVFNGSYAEINDAALDLANSHLVLGGTGDAAFDLTRIDNREEA
                     ILDGDPNRITGFGTLTKTNNSIWTLTGANMADGDANAFLSANIAGGILVLDNATLGLT
                     PATTILNRLSAADIAADPTLVATETGALTLAEGGALSSLGDSVLSGNLISAGGILLSN
                     TYTGGNGAATDDRLTVTGTYFGENNGSGEGAWLALDTVLGDDDSATDRLVINGDATGT
                     TSVRVNNAGGLGDKTLNGINLITVDGLAQDDTFLLAGDYVTTDGYQAVVAGAYAYTLQ
                     ADGEAATAGRNWYLSSELMLTEGVRYQVGVPLYEQYPQVLAALNTLPTLQQRVGNRYG
                     APGALADLNFDDNQWAWGRIEGSHQVTDPARSTSGSQREIDVWKLQTGIDVPLYQSQG
                     GSLLTGGVNFTYGKAKADIHSFFGDGRINSAGYGLGTSLTWYGNNGVYVDGQLQTMWF
                     DSDLSSRTAGHAVASGNNGRGYTSAIEAGKGYALGNGLSLTPQMQVTYSRVDFDTFRD
                     PFDSEVSLQEGDSLRGRLGVSLDKETTWSAKDGTTRRSHIYSHLDLHNEFLNGSKVQV
                     SGVEFATRDERQSVGLGAGGTYEWQNGRYAVYGNVNLLGATRNVSDNYAVGGTIGARV
                     SW"
     gene            438217..438741
                     /locus_tag="YPTB_RS02130"
                     /old_locus_tag="YPTB0366"
     CDS             438217..438741
                     /locus_tag="YPTB_RS02130"
                     /old_locus_tag="YPTB0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZJ20.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Chorismate pyruvate-lyase"
                     /protein_id="WP_002209087.1"
                     /db_xref="GI:488137879"
                     /translation="MFIGDASILKPIQWCATEHPELPADIADWLMELGSMTRRFEQHC
                     QRVHVEPQRECFITRDALGEEAEHLPVSQRYWLREIVLFGDNVPWLLGRTVIPEETLS
                     GPDRALVDLGTLPLGRYLFSGDALTRDYIHVGRQDNLWARRSLLRLSGNPLLLTEVFL
                     PASPLYTHCDSIPK"
     gene            438907..439773
                     /gene="ubiA"
                     /locus_tag="YPTB_RS02135"
                     /old_locus_tag="YPTB0367"
     CDS             438907..439773
                     /gene="ubiA"
                     /locus_tag="YPTB_RS02135"
                     /old_locus_tag="YPTB0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66FH0.1"
                     /note="catalyzes the conversion of 4-Hydroxybenzoate into
                     3-octaprenyl-4-hydroxybenzoate, as part of the ubiquinone
                     biosynthesis pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="WP_002209088.1"
                     /db_xref="GI:488137880"
                     /translation="MKGSTVHTKWQAYCRLMRIDKPIGSLLLLWPTLWALWLAGRGIP
                     EAKILVVFVLGVFFMRAAGCVVNDYADRHIDGFVKRTASRPLPSGTISEKESKILFVV
                     LILLSFGLVLTLNSMTIWLSLAALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAA
                     VSESLPLVCWLLLLANICWTVAYDTQYAMVDRDDDLRIGVKSTAILFGQHDKLIIGLL
                     QLATLLLMVAIGWLMNLGGAFYWSILLAGALFTHQQKMIAQREREPCFRAFLNNNYVG
                     LVLFLGILISYW"
     gene            complement(439954..442458)
                     /locus_tag="YPTB_RS02140"
                     /old_locus_tag="YPTB0368"
     CDS             complement(439954..442458)
                     /locus_tag="YPTB_RS02140"
                     /old_locus_tag="YPTB0368"
                     /EC_number="2.3.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66FG9.1"
                     /note="PlsB; catalyzes the formation of 1-acyl-sn-glycerol
                     3-phosphate by transfering the acyl moiety from acyl-CoA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_011191593.1"
                     /db_xref="GI:499504953"
                     /translation="MSGWRKIYYKLLNLPLKLLVKSKVIPADPVSELGLDPSRPILYV
                     LPYNSKADLLTLRAQCLAQDLPDPLIPLEIDGVQLPSHVFIENGPRVFRYYVPKQESV
                     KLFHDYLDLHRNNPALDIQMLPVSVMFGRSPGREGHGTPHLRVLNGVQKFFAVLWLGR
                     DSFVRFSTTVSLRRMASEHGTDKTIAHKLARVARMHFSRQRLAAVGPSLPARQDLFKK
                     LLASKAIEKAVADEARSKKISHEKAQQNAITLMEEIAANFSYEAVRLSDRVLSWTWNR
                     LYQGINVHNAERVRQLAQDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINL
                     NFWPAGPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFTRGYSVEYFVEGGRSRTGR
                     LLEPKTGTLSMTIQAMLRGGTRPITLVPIYIGYEHVMEVGTYAKELRGAIKEKENLLQ
                     MLRGLRKLRNLGQGYVNFGEPLPLTTYLNTHVPQWRDAIDPIEAQRPSWLTPAVNDLA
                     NQIMVRINNAAAANAMNLCSTALLASRQRSLTREQLLEQLDCYLQLMRNAPYAKDTTV
                     PDKTPEELLNHALNMNKFEVEKDTIGDIIILPREQAVLMTYYRNNIQHLLILPSLIAS
                     MVMYHRRITRTELLHKISMIYPMLKAELFLHYSKEQLPETLDTLIDELARQQLICDKG
                     SELVLNPARIRPLQLLAAGVRETLQRYAITLSLLSATPSINRGALEKESRIMAQRLSV
                     LHGINAPEFFDKAVFSTLVATLREEGYISDSGDAIQEHTLEVYNMLSALMTPEVKLTI
                     ESVSMPAETSNQPEAPETPETPETPETPEPEGKTES"
     gene            442586..442957
                     /locus_tag="YPTB_RS02145"
                     /old_locus_tag="YPTB0369"
     CDS             442586..442957
                     /locus_tag="YPTB_RS02145"
                     /old_locus_tag="YPTB0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209089.1"
                     /note="catalyzes the phosphorylation of diacylglycerol to
                     form diacylglycerol phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_002209089.1"
                     /db_xref="GI:488137881"
                     /translation="MANQSTGLTRIYKAAGYTVKGLTAAWNNEAAFRQESVAAVIAII
                     LAFWLDVGAIARILLICSVVLVLIVEVINSAIEAVVDRIGSEFHALSGRAKDMGSAAV
                     FLTILMALFVWITVLWQHVAR"
     gene            443082..443690
                     /locus_tag="YPTB_RS02150"
                     /old_locus_tag="YPTB0370"
     CDS             443082..443690
                     /locus_tag="YPTB_RS02150"
                     /old_locus_tag="YPTB0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004948794.1"
                     /note="Represses a number of genes involved in the
                     response to DNA damage; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LexA repressor"
                     /protein_id="WP_002209090.1"
                     /db_xref="GI:488137882"
                     /translation="MKALTTRQQEVYDLVRDHLAQTGMPPTRAEIAQRLGFRSPNAAE
                     EHLKALARKGVIEIVSGASRGIRLLMEEEEGLPLIGRVAAGEPLLAQQHIEGHYKVDP
                     SLFKPGADFLLRVNGMSMRDIGILDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKK
                     QGNIVHLLPENSEFQPIVVDLREQSFTIEGLAVGVIRNGDWI"
     gene            complement(443899..444408)
                     /locus_tag="YPTB_RS02155"
                     /old_locus_tag="YPTB0371"
     CDS             complement(443899..444408)
                     /locus_tag="YPTB_RS02155"
                     /old_locus_tag="YPTB0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002214647.1"
                     /note="Acts as a negative controlling element, employing
                     Zn(2+) as a cofactor to bind the operator of the repressed
                     genes znuACB; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002214647.1"
                     /db_xref="GI:488143439"
                     /translation="MNPINQEKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAISA
                     YDLLDLLRVAEPQAKPPTVYRALDFLLEQGFIHRVESANSYVLCHHFEEPTHTSALFI
                     CDRCKIVTERPTVGIEEALAQLAKQSGFTLRHSVVEAHGLCTECGVVEACESHDDCEH
                     DHSIVVKKK"
     gene            444663..445700
                     /locus_tag="YPTB_RS02160"
                     /old_locus_tag="YPTB0372"
     CDS             444663..445700
                     /locus_tag="YPTB_RS02160"
                     /old_locus_tag="YPTB0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZJ14.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase A"
                     /protein_id="WP_011191594.1"
                     /db_xref="GI:499504954"
                     /translation="MHEAQTFSSTPATKPQYPLQRFSVAPMLDWTDRHCRYFHRLLTK
                     QALLYTEMVTTGAIIHGKADYLAYSEQDHPVALQLGGSDPQALAHCAKLAEQRGYNEI
                     NLNVGCPSDRVQNGRFGACLMGEADLVADCIKAMRDAVAIPVTVKTRIGIDQLDSYEF
                     LCEFVQTVAERGECEIFTIHARKAWLSGLSPKENREVPPLDYERVYQLKRDFPALTIA
                     INGGVKTLAEAKEHLKHLDGVMMGREAYQNPGILTQVDRELFDPHAPVVDSVKAIEAL
                     YPYIEQELSQGAYLGHITRHILGIFQGIPGARQWRRHLSENAHKPGAGVSVVEEALAL
                     VSPSYYESVGG"
     gene            446216..446434
                     /locus_tag="YPTB_RS02165"
                     /old_locus_tag="YPTB0373"
     CDS             446216..446434
                     /locus_tag="YPTB_RS02165"
                     /old_locus_tag="YPTB0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005165239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage-shock protein"
                     /protein_id="WP_002209093.1"
                     /db_xref="GI:488137885"
                     /translation="MLEIFFVIGFFMVLMVTGISLLGILAALLVAAVFMMLGGLFVMM
                     IKLLPWLILAVVVAWIWRSMQKPVIRRY"
     gene            complement(446779..447762)
                     /locus_tag="YPTB_RS02170"
                     /old_locus_tag="YPTB0374"
     CDS             complement(446779..447762)
                     /locus_tag="YPTB_RS02170"
                     /old_locus_tag="YPTB0374"
                     /EC_number="1.6.5.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011055281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_011191595.1"
                     /db_xref="GI:499504955"
                     /translation="MAKHIQFTTTGGPDVLQYLEFTPSDPAPHEVQVENKAIGINYID
                     TYVRSGLYPPAHLPSGLGTEAAGIVSKVGAAVSSVKVGDRVVYAQSALGAYSEVHNVP
                     ADKIALLPEQISFEQAAASFLKGLTAYYLLRQTHEIKPGEVFLFHAAAGGVGLIACQW
                     AKALGAKLIGTVGSDEKAQLAKAAGAWATINYRTENIAQRVAELTEGEKVGVVYDSVG
                     KSTWEASLDSLKRRGLLVSFGNASGPVTGVNLGILNQKGGIYVTRPSLNVYVANRQEL
                     ESASQQLFSMITSGAINVDVAQAQQFPLCDAQRAHETLEGRQTTGSSLLIP"
     gene            448094..449500
                     /locus_tag="YPTB_RS02175"
                     /old_locus_tag="YPTB0375"
     CDS             448094..449500
                     /locus_tag="YPTB_RS02175"
                     /old_locus_tag="YPTB0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004876397.1"
                     /note="unwinds double stranded DNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="WP_002209095.1"
                     /db_xref="GI:488137887"
                     /translation="MAAKKPTNKMTEPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNER
                     WDNVSERVASKDFFSRPHRRIFTEMQRLLENSKPIDLITLSESLEQKGDLDSVGGFAY
                     LAELSKNTPSAANIGAYADIVRERAVVREMISVANEIADAGYDPQGRSSEDLLDLAES
                     KVFQIAESRASKDEGPKSVDRILEDTVARIEQLYQRPHDGVTGVSTGFTDLDKKTAGL
                     QKSDLIIVAARPSMGKTTFAMNLCENAAMMQDKPVLIFSLEMPGDQIMMRMLASLSHV
                     DQTRIRTGQLDDEDWARISSTMGILMEKRNMYIDDSSGLTPTEVRSRARRIFREHGGL
                     SLIMIDYLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADK
                     RPVNSDLRESGSIEQDADLIMFIYRDEVYHENSDEKGIAQIILGKQRNGPIGSVRLKF
                     NGQWSRFDNYAGPQYDDE"
     gene            449597..450676
                     /gene="alr"
                     /locus_tag="YPTB_RS02180"
                     /old_locus_tag="YPTB0376"
     CDS             449597..450676
                     /gene="alr"
                     /locus_tag="YPTB_RS02180"
                     /old_locus_tag="YPTB0376"
                     /EC_number="5.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304687.1"
                     /note="converts L-alanine to D-alanine which is used in
                     cell wall biosynthesis; binds one pyridoxal phosphate per
                     monomer; forms a homodimer; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_011191596.1"
                     /db_xref="GI:499504956"
                     /translation="MKAATAVIDRHALRHNLQQIRRLAPQSRLVAVVKANAYGHGLLA
                     AAHTLQDADCYGVARISEALMLRAGGIVKPILLLEGFFDAEDLPVLVANHIETAVHSL
                     EQLVALEAATLSAPINAWMKLDTGMHRLGVRPDQAEAFYQRLSACRNVIQPVNIMSHF
                     SRADEPEVAATQQQLACFDAFAAGKPGKQSIAASGGILRWPQAHRDWVRPGIVLYGVS
                     PFDTPYGRDFGLLPAMTLKSSLIAVREHKAGESVGYGGTWVSERDTRLGVIAIGYGDG
                     YPRSAPSGTPVWLNGREVSIVGRVSMDMISIDLGPESTDKVGDEALMWGAELPVERVA
                     ACTGISAYELITNLTSRVAMEYLGE"
     gene            450862..452055
                     /locus_tag="YPTB_RS02185"
                     /old_locus_tag="YPTB0377"
     CDS             450862..452055
                     /locus_tag="YPTB_RS02185"
                     /old_locus_tag="YPTB0377"
                     /EC_number="2.6.1.57"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304686.1"
                     /note="catalyzes the formation of L-glutamate and an
                     aromatic oxo acid from an aromatic amino acid and
                     2-oxoglutarate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid aminotransferase"
                     /protein_id="WP_011191597.1"
                     /db_xref="GI:499504957"
                     /translation="MFQNVDAYAGDPILSLMESFKADNRAHKVNLSIGLYYNEQGEIP
                     QMQAVDAAEAQLSAQPHGTPVYLPMEGLQSYRTAIQQLLFGHDHPMLVQQRVATIQTV
                     GGSGALKVGADFLNHYFPDSQVWVSDPTWENHVAIFSGAGFKVNTYPYFDNDKLAVKF
                     DPMLATLQQLPARSIVLLHPCCHNPTGSDLTNAQWDRLIDVVKERELIPFLDIAYQGF
                     GAGLNEDAYAIRAMAAAGLPCLISNSFSKIFSLYNERVGGLSVVCESDEAAGRVLGQL
                     KATVRRNYSSPPNFGAQVVSKVLNDTVLRAQWQAEVEQMRLRILDMRHTLVEALKASL
                     PERNFDYLLQQRGMFSYTGFSEAQVDRLREEFGVYLIASGRMCMAGVNHQNVEQVAVA
                     FAAVQ"
     gene            452582..452941
                     /locus_tag="YPTB_RS02190"
                     /old_locus_tag="YPTB0378"
     CDS             452582..452941
                     /locus_tag="YPTB_RS02190"
                     /old_locus_tag="YPTB0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209098.1"
                     /db_xref="GI:488137890"
                     /translation="MNHSALLEYCLSKPGAEQCEHEQWQTNQIKVADVMFAMVGNIGG
                     RPSISLKSSPKLAERLREQHPEIVPSEHLNKTHWNTVFLDGKLPNSQFYTLIDHSYQL
                     VLQGLPEQRRQDLSSHL"
     gene            complement(453034..455877)
                     /locus_tag="YPTB_RS02195"
                     /old_locus_tag="YPTB0379"
     CDS             complement(453034..455877)
                     /locus_tag="YPTB_RS02195"
                     /old_locus_tag="YPTB0379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UvrABC system protein A"
                     /protein_id="WP_011191598.1"
                     /db_xref="GI:499504958"
                     /translation="MDNIEVRGARTHNLKNINLIIPRDKLIVVTGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIHDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVISQPEGRRLMLLAPVVKDRKG
                     EHTKILENLAAQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVVDRFKVREDLAQRLA
                     ESFETALALSGGTAVVADMDDPHVEELLFSANFACPICGYSMRELEPRLFSFNNPAGA
                     CPTCDGLGVQQFFDPDRVLQNPELSLAGGAIRGWDRRNFYYFQMLRSLAEHYKFDIEA
                     PFNSLDSAVQQAVLYGSGKDTIEFKYINDRGDTTVRRHPFEGVLHNMERRYKETESSA
                     VREELAKFISNRSCASCSGTRLRREARYVFVENTTLPEISELSIGHALSFFQNMKLSG
                     QRAQIAEKILKEIGDRLKFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGV
                     MYVLDEPSIGLHQRDNERLLETLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGV
                     HGGEVVAEGTVDDIMAAPASLTGQFLSGKRSIAIPEKRVSADPSKVLKLIGATGNNLK
                     DVTLTLPVGLFSCITGVSGSGKSTLINDTLYSIAQRQLNGATITEPAPYREIQGLEHF
                     DKVIDIDQSPIGRTPRSNPATYTGIFTPIRELFAGVPESRTRGYTPGRFSFNVKGGRC
                     EACQGDGVIKVEMHFLPDIYVPCDHCKGKRYNRETLEIKYKGKSIHEVLAMTIEEARE
                     FFDAVPALARKLQTLIDVGLSYICLGQSATTLSGGEAQRVKLSRELSKRGTGQTLYIL
                     DEPTTGLHFADIQQLLAVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGE
                     ILVSGTPETVAECAASHTARFLKPMLQRKPQTV"
     gene            456318..456866
                     /locus_tag="YPTB_RS02200"
                     /old_locus_tag="YPTB0380"
     CDS             456318..456866
                     /locus_tag="YPTB_RS02200"
                     /old_locus_tag="YPTB0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZJ06.1"
                     /note="binds to single stranded DNA and PriA helcase
                     facilitate replication restart; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_002209100.1"
                     /db_xref="GI:488137892"
                     /translation="MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDK
                     QTGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGALQTRKWQDQSGQERYTTEV
                     VVNVGGTMQMLGGRQGGGAPAGGGAAPQDGGAQGGWGQPQQPQGGNQFSGGQASRPAQ
                     PAPAAPQGGNEPPMDFDDDIPF"
     gene            complement(457114..457428)
                     /locus_tag="YPTB_RS02205"
                     /old_locus_tag="YPTB0381"
     CDS             complement(457114..457428)
                     /locus_tag="YPTB_RS02205"
                     /old_locus_tag="YPTB0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66FF7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-rhamnose mutarotase"
                     /protein_id="WP_002209101.1"
                     /db_xref="GI:488137893"
                     /translation="MIRKAFVMAVNPDAHAEYQRRHTPIWPELESVLKAHGAHHYSIF
                     LDETRNLLFGVVEIESEERWNAVAQTAECQRWWQHMADVMPSHPDNSPVSQALREVFY
                     LE"
     gene            complement(457442..458590)
                     /locus_tag="YPTB_RS02210"
                     /old_locus_tag="YPTB0382"
     CDS             complement(457442..458590)
                     /locus_tag="YPTB_RS02210"
                     /old_locus_tag="YPTB0382"
                     /EC_number="1.1.1.244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_011191599.1"
                     /db_xref="GI:499504959"
                     /translation="MSFMLALPKISLHGTGAIGDMVKLLSDKQWGKALIVTDGQLVEL
                     GLLDSLFAALAQYQLPYGLFGEVFPNPTEELVQAGFAAFTQHQCDYLIAFGGGSPIDT
                     AKAIKILTANPGPSTAYSGVGKVKQTGVPLIAINTTAGTAAELTSNAVIIDSQRQVKE
                     VIIDTNLIPDIAVDDPSVMLNIPASVTAATGMDALTHAIEAYVSLGAHTLTDHSALES
                     IRLISQWLPLAVADGKNLQAREMMACGQYLAGMAFNSAGLGLVHALAHQPGATHNLPH
                     GVCNAILLPVIEEYNRPQATRRFARIAQAMGVDTQDMSDEQASHQAIAAIRQLSLQVG
                     IPAGFSALGIEESDIEGWLDKALADPCAPCNPRSADREQIRTLYLQAL"
     gene            complement(458657..459481)
                     /locus_tag="YPTB_RS02215"
                     /old_locus_tag="YPTB0383"
     CDS             complement(458657..459481)
                     /locus_tag="YPTB_RS02215"
                     /old_locus_tag="YPTB0383"
                     /EC_number="4.1.2.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016674148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnulose-1-phosphate aldolase"
                     /protein_id="WP_011191600.1"
                     /db_xref="GI:499504960"
                     /translation="MQAILSSWFIQGMIKATSDMWHKGWDERNGGNISLRLLAEEVEP
                     YRRDFYQQPRKVELTQPAPELANSWFLVTGSGKFFRNVELNPAENLVLLQVSNDGMAY
                     DIHWGLTQGGLPTSELAAHFQSHIVRMQVSGGTNRVIMHCHATNLIALSYVQKLENAS
                     FTRLLWEGSTECLVVFPDGIGIVPWMVPGTDGIGTQTAEQMREHSLVLWPFHGIFGSG
                     PTLDDAFGLIDTAEKSAEIMVKVLSMGGKKQTISREQLIALAARFDVTPMAAALDA"
     gene            complement(459494..460750)
                     /locus_tag="YPTB_RS02220"
                     /old_locus_tag="YPTB0384"
     CDS             complement(459494..460750)
                     /locus_tag="YPTB_RS02220"
                     /old_locus_tag="YPTB0384"
                     /EC_number="5.3.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7FN82.1"
                     /note="catalyzes the formation of L-rhamnulose from
                     L-rhamnose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="l-rhamnose isomerase"
                     /protein_id="WP_011191601.1"
                     /db_xref="GI:499504961"
                     /translation="MTNSIEQAWDLAKQRFAAVGVDVDAALTRLDTLPVSMHCWQGDD
                     VTGFEDPDGVLTGGIQATGNYPGKARNATELRSDLELALALIPGPKRLNLHAIYLESD
                     TPVARNKIEPRHFSHWVTWAKKHQLGLDFNPSCFSHPLSADGFTLSHADPEIRQFWIE
                     HCQASRRVSAYFGEQLGTPSVMNIWIPDGMKDTPIDRLAPRQRLLSALDEVISEKLNP
                     AHHIDAVESKLFGIGAESYTVGSNEFYMGYAASRQTALCLDAGHFHPTEVISDKISSA
                     MLYVPRLLLHVSRPVRWDSDHVVLLDDETQAIASEIIRHNLFDRVHIGLDFFDASINR
                     IAAWVIGTRNMKKALLRALLEPTDMLRQLELRGDYTARLALLEEQKSLPWQAIWEGYC
                     QRNDVPVDARWLDAVREYEQQILSQR"
     gene            complement(460747..462204)
                     /locus_tag="YPTB_RS02225"
                     /old_locus_tag="YPTB0385"
     CDS             complement(460747..462204)
                     /locus_tag="YPTB_RS02225"
                     /old_locus_tag="YPTB0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66FF3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnulokinase"
                     /protein_id="WP_002209105.1"
                     /db_xref="GI:488137897"
                     /translation="MVAIDLGASSGRVMLASYYPGQQQLTLREVCRFTNQIKSIDGSD
                     VWDIDAIEQSIREGLSQLDSEGIALDSIGIDSWGVDFVLLDKQGKRIGQPVSYRDSRT
                     QGVMARAQQTLGSNAIYRRTGIQFLPFNTLYQLRALSEQQPHLLADVAHLLLIPDYLH
                     YRLTGQLNWEYTNASTTQLLNIETGDWDSDLLAYAGVPAHWFAKPGKPGNTIGYWHSA
                     NGQQVPVVAVATHDTASAVLAAPLIDADAAYLSSGTWSLMGFESGTPLTHQQAQCSNI
                     TNEGGAEGRYRVLKNIMGLWLLQRATDELQIDDLPQLIEQAARQPACRSLINPNDSRF
                     INPPNMCREIQNACREHQFPVPNTAAQLARCIFDSLAMLYRQVAQELATLRGRPISHL
                     HIVGGGCQNQFLNQLCADACGLNVSMGPVEASTLGNIGSQLISLGEVADVTHYRRIVA
                     NNFPLHHLSPHDNSDFAAHWLQFQSLSQLPKELCI"
     gene            462203..462379
                     /locus_tag="YPTB_RS02230"
     CDS             462203..462379
                     /locus_tag="YPTB_RS02230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole synthetase"
                     /protein_id="WP_012304683.1"
                     /db_xref="GI:501261665"
                     /translation="MCRAAFGDVTADGEHVDGEHVDGVGMISGLLFLNANSVEICLFD
                     DLLITANRYGLMAE"
     gene            462376..462519
                     /locus_tag="YPTB_RS02235"
     CDS             462376..462519
                     /locus_tag="YPTB_RS02235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209107.1"
                     /db_xref="GI:488137899"
                     /translation="MTKVKVKQLTVSYLGGSPFPCDPAHTFQHCHAYLKKIAAKVVFN
                     VKN"
     gene            462601..463422
                     /locus_tag="YPTB_RS02240"
                     /old_locus_tag="YPTB0386"
     CDS             462601..463422
                     /locus_tag="YPTB_RS02240"
                     /old_locus_tag="YPTB0386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004706026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator RhaS"
                     /protein_id="WP_011191602.1"
                     /db_xref="GI:499504962"
                     /translation="MTVLHSIDFFSSSSAPVAIEARAPQSAFPEHHHDFYEIVIVEEG
                     AGVHVFNGNPYTLSRGCVCFVRDHDRHLFESTDDLFLTNVLFRAPDAFRFLSGVGHFL
                     PRECDGVYPSHWRVNGQVLQQIKCLIACLEHAPKSDRVEDIALHESVFMQLLVKLWQG
                     CQTQAGDDQEGRLYQLLDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQR
                     YLTRLRLLQARHQLCYSDNSVTDIAYLCGFGDSNHFSTLFKREFSQSPRDLRSQL"
     gene            463555..464427
                     /locus_tag="YPTB_RS02245"
                     /old_locus_tag="YPTB0387"
     CDS             463555..464427
                     /locus_tag="YPTB_RS02245"
                     /old_locus_tag="YPTB0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1JNC4.1"
                     /note="activates the expression of rhaRS in response to
                     L-rhamnose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional activator RhaR"
                     /protein_id="WP_011191603.1"
                     /db_xref="GI:499504963"
                     /translation="MRAPLLLESRDYLLSEQMPVAVTNRYPQETFVEHTHQFCEIVIV
                     WRGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHDLVLDNIIYCPERLHLNAQWHK
                     LLPPLGPEQNQGYWRLTTQGMAQARPIIQQLAQESRKTDSWSIQLTEVLLLQLAIVLK
                     RHRYRAEHAHLLPDGEQLDLIMSALQQSLGAYFDMADFCHKNQLVERSLKQLFRQQTG
                     MSISHYLRQIRLCHAKCLLRGSEHRISDIAARCGFEDSNYFSAVFTREAGMTPRDYRQ
                     RFIRSPVLPAKNEP"
     gene            complement(464576..465610)
                     /locus_tag="YPTB_RS02250"
                     /old_locus_tag="YPTB0388"
     CDS             complement(464576..465610)
                     /locus_tag="YPTB_RS02250"
                     /old_locus_tag="YPTB0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1C0W4.1"
                     /note="transports L-rhamnose and L-lyxose into the cell;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="l-rhamnose-proton symporter"
                     /protein_id="WP_002209111.1"
                     /db_xref="GI:488137903"
                     /translation="MNNAIILGIIWHLVGAASAACFYAPFKQVKKWSWETMWSIGGLV
                     SWLILPWTVSYLLLPDFWQYYGSFSIATLLPVFLFGAMWGIGNINYGLTMRYLGMSMG
                     IGIAIGITLIIGTLMTPILQGRFDVLLGTPGGRMTLLGVFVALIGVAIVSYAGLLKER
                     AMGIQAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHEAASALGINSLYVALPSYV
                     IIMGGGAIINLSYCFIRLATLKNLSVKADFSVAKPLLITNILFSALAGLMWYLQFFFY
                     AWGHAKIPQQYDYMSWMLHMSFYVLCGGIVGLLLKEWKCSTKKPVAVLCIGCLVIILA
                     ANIVGLGMAA"
     gene            465764..466054
                     /locus_tag="YPTB_RS02255"
                     /old_locus_tag="YPTB0389"
     CDS             465764..466054
                     /locus_tag="YPTB_RS02255"
                     /old_locus_tag="YPTB0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191604.1"
                     /db_xref="GI:499504964"
                     /translation="MMMITKWHSGGRLTGFMALTAVSQQKLRCPCSSLSLSVVDLKIS
                     SVVDLKINSVVDLKINKRLGINELPHLNRINAVQKGSRLLASRSNLGISLLS"
     gene            complement(466490..466915)
                     /locus_tag="YPTB_RS02260"
                     /old_locus_tag="YPTB0391"
     CDS             complement(466490..466915)
                     /locus_tag="YPTB_RS02260"
                     /old_locus_tag="YPTB0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="subtilase"
                     /protein_id="WP_002209112.1"
                     /db_xref="GI:488137904"
                     /translation="MRYLLSLSVFLIVSLNPAFAEWTGDNVEGMHSGMIINKFHSGQV
                     DGKPYFCIEAFKPSTTITACSVKDTSIWGASYNTLYDQAMYYYTTGKRIRVYYAPDVW
                     TNNSFVRALTANALVGFSTCISESSCFGPDRKKHKFTVH"
     gene            467145..467312
                     /locus_tag="YPTB_RS02265"
                     /old_locus_tag="YPTB0392"
     CDS             467145..467312
                     /locus_tag="YPTB_RS02265"
                     /old_locus_tag="YPTB0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191605.1"
                     /db_xref="GI:499504965"
                     /translation="MATFSDGSFFIDNKTPYFNLLIMGELLIIYEVLDIFQNNFLYVN
                     ITNELHWGFNL"
     gene            467342..469897
                     /locus_tag="YPTB_RS02270"
                     /old_locus_tag="YPTB0393"
     CDS             467342..469897
                     /locus_tag="YPTB_RS02270"
                     /old_locus_tag="YPTB0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enhancing factor"
                     /protein_id="WP_041175436.1"
                     /db_xref="GI:752489416"
                     /translation="MRQVTKSKKIKILPYPEWLVKAGMSKGIDHDRQHLGIILAAGEM
                     IKVRQVNAEYKEKLKLYLLNDNKNTQRSISFNTDWIELSVDAVSVPFINTPYSDGIIP
                     EIIFEYPDTSKLLPVYEKGEDESIFFESWDKQNAEFGVVESEYVIILIPEVSKDRLKS
                     FSTSGGIDTVLGFYQDIFSFNNSLAGLSFEPQRYSDGNTRNRYFAKADKGGGGAAYYS
                     NNWIASSSGSINTFWLSPNATNWGCLHEIAHGYQGGFIDDKYFSTREVWNNIYAACYQ
                     DVMLGAEKFNKGWLYNFGKQKEVEKSILNNINNGKEVNAWGERSKLYFIMLMLEKAGV
                     NCFTHFNQIYRERKNTDQSVGSVLDMLSNSFATVENRVDVTPFLQMVGGHISKNQYQR
                     NLFSHAKAVYPLNQLLQGDELTAVKKTLDLNSELSLVDVDSIEFTDIKSNLTLQFSID
                     DFAQIYGEELLILNGDNYVYNQSIMDKKQTLYNLPVGAYTLRIPTGRNKKYASQINYL
                     IVKNEDSQTQVDFVHRIGSPIVSQKISLQGLNDYTFATIFFDQENDTVSVDITKTKPH
                     YHFPGMYARIRIKDKDNNELLNEVITGTNQSLSKNDFPLSSCYVIDIFHKEPGRVKLT
                     PAYKGVIDNKSSYNEFIITPYGLQNIKLNNDPKVFLLENIKSAAETLRSHPIMWHANF
                     SEAKDNIYLAIDVFPSPQKEGLLEQYADCISSYYEKPNEDLGNAFSFIFKGINDREFL
                     TTKLNLVTKKLEVKIVSGTPHSGFNRTYAVLRYFNADGNELLNLDIIGSKKQAGQEWV
                     FPISGYGGEKLYLQHVEPKNRLVITNIMQGIRLSSRTSIQTYEIESLGLSRCT"
     gene            complement(470331..470406)
                     /locus_tag="YPTB_RS02275"
                     /old_locus_tag="YPTB_RNA_85"
     tRNA            complement(470331..470406)
                     /locus_tag="YPTB_RS02275"
                     /old_locus_tag="YPTB_RNA_85"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(470371..470373),aa:Phe,seq:gaa)
     gene            complement(470551..471126)
                     /locus_tag="YPTB_RS02280"
                     /old_locus_tag="YPTB0395"
     CDS             complement(470551..471126)
                     /locus_tag="YPTB_RS02280"
                     /old_locus_tag="YPTB0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011055284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002209117.1"
                     /db_xref="GI:488137909"
                     /translation="MQREQVLSNALNLLEQQGLANTTLEMLAKALSVEVSDLTRFWPD
                     REALLYDCLRYHSQQIDTWRRQLQLDETLSPQQKLLARYQTLSEQVQNQRYPGCLFIA
                     ACSFYPDTEHPIHQLAEQQKQASLHYTKALLQEMDADDADMVAQQMELILEGCLSKLL
                     IKRQLADVEVAKCLAEDILTVAQCRKNGALS"
     gene            471546..473561
                     /locus_tag="YPTB_RS02285"
                     /old_locus_tag="YPTB0396"
     CDS             471546..473561
                     /locus_tag="YPTB_RS02285"
                     /old_locus_tag="YPTB0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105760.1"
                     /note="unknown function; in E. coli the aegA gene is
                     regulated by Fnr, NarXL, and NarQ (but not ArcA), induced
                     under anaerobic conditions and repressed in the presence
                     of nitrate (anaerobic); Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase Fe-S-binding subunit"
                     /protein_id="WP_011191607.1"
                     /db_xref="GI:499504967"
                     /translation="MNPFIVADAESCIGCRSCEVACVVAHHEGQFPDKPEYFTPRVKV
                     FKGDQCATAVFCHHCEDAPCASTCPNGAIVELNNSIQVIQEKCIGCKTCMIACPFGMM
                     TVVTETVQPASHRLADVYRRTEAQKCDLCLDQPDGPACIKTCPTQALTLVDQQYLLHQ
                     QQQKRQHMALNEHNGRLFSRAVVQAASASSNKSIRDATPVNLLQRPRAPRLEPKKIPL
                     AERKTGFAEIYLPFTESQIHEQAERCLECGDKTICQWTCPLHNAIPKWISLAHQGRIH
                     EAAELSHQTSSLPEVCGRVCPQDRLCEQSCTLNDHDGAVTIGQIERHITETALATGWR
                     PDLSQVKPSGKRVAIIGAGPAGLGCADILVRNGITPVVFDRYPEIGGLLTFGIPAFKL
                     EKSVMTRRREIFTEMGVEFCLNTEIGRDITMENLLHDFDALFLGVGTYRSMRSGLENE
                     DAQGVYDALPFLIGNTQHLMGYTANGAHPYVSMQDQRVVVLGGGDTAMDCVRTSLRQG
                     ASRVVCAYRRDEKNMPGSKREVKNAREEGAEFMFNLQPMSIVVDESGQVTGIKMVRTE
                     MGQADAQGRRQALPIAGSEHLIPADAVIMAFGFSPHRMSWLAEHNVVLDKQGRVVAPT
                     ISGYPYQTSNPKIFAGGDIVRGADLIVTAIAEGRKAAESIAYYLNVL"
     gene            473584..474141
                     /locus_tag="YPTB_RS02290"
                     /old_locus_tag="YPTB0397"
     CDS             473584..474141
                     /locus_tag="YPTB_RS02290"
                     /old_locus_tag="YPTB0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_002209119.1"
                     /db_xref="GI:488137911"
                     /translation="MNRFVIADMTQCIGCRTCEIACVVAHSADNKVSTLMPEQFHPRL
                     SVMKSFAVSTPILCHQCEDAPCENACPNGAIITGSHGVQLLASRCIGCKTCMLVCPFG
                     AMSIIERPADGQQAADSQPVMASGSGRAQAHKCDLCHQRESGPACIEVCPTNALKLVT
                     PGVLEALQREKQLRAARGSAPGIAR"
     gene            474164..476311
                     /locus_tag="YPTB_RS02295"
                     /old_locus_tag="YPTB0398"
     CDS             474164..476311
                     /locus_tag="YPTB_RS02295"
                     /old_locus_tag="YPTB0398"
                     /EC_number="1.2.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191608.1"
                     /note="selenocysteine-containing polypeptide; hydrogen
                     linked formate dehydrogenase which catalyzes the oxidation
                     of formate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase"
                     /protein_id="WP_011191608.1"
                     /db_xref="GI:499504968"
                     /translation="MKKILTVCPYCGSGCKLNLLVEDGEIVGAEPADGVTNQGALCLK
                     GYYGWDFLNDTRLLTPRLTTPLLRRQRGEAFQPVSWEAAIAFITAKLSAIKERHGPDA
                     IMMTGSSRGPGNEANYVMQKFARAAIGTNNIDCCARLCHGPSVAGLQQTLGNGAMSNS
                     IGEIENTDCILVFGYNAADSHPIVARRILKAKNKGAKLIVCDPRHIETARIADQWLPL
                     KNGANMALVNAFIHVLIEEKLYDANYVRDHTRGFDELKAGVAAYRPEDVEPITGLSAK
                     AVRQAMRTYAAAPAATLLWGMGVTQWGQAVDVVKGLSSLALLTGNLGRPNVGVGPVRG
                     QNNVQGACDMGVLPNTFPGYEKVTDSEARARFAHAWGVAELPAHVGYSITDVPHKVAE
                     GKLKAYYVFGEDPIQTEPDLAAMRAAFAALDLVVVQDIFMTKTAELADVVLPATSWGE
                     HEGVYTSADRGFQHFNKAIEPKGDVKPDWEIISLISTAMGYPMAYQNTQQIWDEMRGL
                     CPPFAGATYDKLAGLGYVQWPCPTEDHPGTPYLYTDNQFATADGKGLLSCAPWQPPHE
                     QTDSDYPLALCTVREVGHYSCRSMTGNCATLKILADEPGYVQIHPEDASYLGVIDQAL
                     IWISSRRGRVIARASVTERANRGAVYMTYQWWIGACNELTVDHVDPVSKTPEFKHCAV
                     KVEAISDQTAAEQYVEQQYSQLKKRLSDAAVVP"
     gene            complement(476373..478160)
                     /gene="dipZ"
                     /locus_tag="YPTB_RS02300"
                     /old_locus_tag="YPTB0399"
     CDS             complement(476373..478160)
                     /gene="dipZ"
                     /locus_tag="YPTB_RS02300"
                     /old_locus_tag="YPTB0399"
                     /EC_number="1.8.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIY9.1"
                     /note="two electrons are transferred from cytoplasmic
                     NADPH to thioredoxin and then to the inner membrane
                     protein DsbD which keeps the disulfide isomerase DsbC in a
                     reduced state in the oxidizing periplasm; DsbC in turns
                     rearranges incorrectly made disulfide bonds in the
                     periplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein DsbD"
                     /protein_id="WP_011191609.1"
                     /db_xref="GI:499504969"
                     /translation="MAQRFITLILLLCSVLLAPHSAQSSLFGENTSFGAKNSQSRFIP
                     VDQAFAFDFHQQGDQLNLSWQIHPGYYLYRQQIKIVPQQAALGAFTLPEGITHHDEFY
                     GEVEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTAS
                     GTAAVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLIS
                     AVILGREKPHSQRRILILAVVYVQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLS
                     VLFVLLALSMFGLYSLQLPSSLQTRLTQWSNSQRGGSLAGVFAMGALAGLICSPCTTA
                     PLSAILLYIAQSGNMLAGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAF
                     GFVILALPVFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAA
                     LLIVARPLQDWAFNGNTQQNAVKHINFQPVANLPQLQAVLAQAQGKPVMLDLYADWCV
                     ACKEFEKYTFSDDKVQRQLANTLLLQADVTANNAEHATLLNKFNVLGLPTILFFDSQG
                     NEITAARVTGFMDAAQFLQHLQNTPAVTK"
     gene            complement(478136..478459)
                     /locus_tag="YPTB_RS02305"
                     /old_locus_tag="YPTB0400"
     CDS             complement(478136..478459)
                     /locus_tag="YPTB_RS02305"
                     /old_locus_tag="YPTB0400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002353622.1"
                     /note="copper binding protein required for copper
                     tolerance; involved in resistance toward heavy metals;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="divalent ion tolerance protein CutA"
                     /protein_id="WP_002353622.1"
                     /db_xref="GI:488282414"
                     /translation="MSYSNAIVVLCTAPDEASAQNLAAQVLGEKLAACVTLLPGATSL
                     YYWEGKLEQEYEVQLLFKSNTDHQQALLTYIKQHHPYQTPELLVLPVRDGDKDYLSWL
                     NASLL"
     gene            complement(478680..479981)
                     /locus_tag="YPTB_RS02310"
                     /old_locus_tag="YPTB0401"
     CDS             complement(478680..479981)
                     /locus_tag="YPTB_RS02310"
                     /old_locus_tag="YPTB0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209123.1"
                     /note="functions in anaerobic transport of
                     C4-dicarboxylate compounds such as fumarate; similar to
                     dcuB; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_011191610.1"
                     /db_xref="GI:499504970"
                     /translation="MIAVELVIVLLAIFLGARLGGIGIGFAGGIGVLVLAIIGVKPGS
                     IPFDVISIIMAVIAAISAMQVAGGMDYLVQQTEKLLRKNPKHITILAPLVTYFLTIFA
                     GTGNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGQ
                     GVSYLHLLMIVIPSTLCAVLVMSLIVSWCFSSKLSDDPIYLKRLEEGLVTLRGDTVKV
                     IKPRAKTSVLLFLAGVLCVVAYAIINSPSVGLVETPLMNTTNAILIIMLSVATITTLV
                     CSVDTDSILNSSTFKAGMSACICILGVAWLGDTFVQHNLEWIKETAGSLIQAHSWLLA
                     VIFFFCSALLYSQAATAKALMPMALALNVSPLAAIASFAAVSGLFILPTYPTLVAAVQ
                     MDDTGTTRIGRFVFNHPFFIPGTIGVALAVCFGFVMGGLVL"
     gene            complement(480101..481537)
                     /gene="aspA"
                     /locus_tag="YPTB_RS02315"
                     /old_locus_tag="YPTB0402"
     CDS             complement(480101..481537)
                     /gene="aspA"
                     /locus_tag="YPTB_RS02315"
                     /old_locus_tag="YPTB0402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005175569.1"
                     /note="catalyzes the formation of fumarate from aspartate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="WP_002230464.1"
                     /db_xref="GI:488159256"
                     /translation="MSNNIRIEEDLLGTREVPAEAYYGVHTLRAIENFYISNSKISDV
                     PEFVRGMVMVKKAAAMANKELHTIPRKIADIIIQACDEVLDKGKCMDQFPVDVFQGGA
                     GTSLNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASI
                     LKLIDAINQLGEGFGRKSKEFEKILKMGRTQLQDAVPMTLGQEFRAFQVLLNEETKNL
                     QRTAELLLEVNLGATAIGTALNTPEGYSQLAVQKLAEISGLACVPAEDLIEATSDCGA
                     YVMVHSALKRLAVKMSKICNDLRLLSSGPRTGLNEINLPELQAGSSIMPAKVNPVIPE
                     VVNQVCFKVIGNDTCITMAAEAGQLQLNVMEPVIGQAMFESIHILTNACYNLLEKCIN
                     GITANKEVCERYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKNVREVVLERGLLTE
                     AELDDIFSVENLMHPAYKAKRYTDENEQ"
     gene            481985..482563
                     /locus_tag="YPTB_RS02320"
                     /old_locus_tag="YPTB0403"
     CDS             481985..482563
                     /locus_tag="YPTB_RS02320"
                     /old_locus_tag="YPTB0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exclusion suppressor FxsA"
                     /protein_id="WP_002209126.1"
                     /db_xref="GI:488137918"
                     /translation="MRWLPFALIFLLAYIEISIFIKVAAVLGVPITLLLVIISSCVGI
                     SLVRNQGIKTFIQMQQKLAAGESPAAEMIKSVSLVLAGILLLIPGFFTDFLGLLLLLP
                     WVQKTLTLKLMPHLNIYRGGSFGGAGFGNGGFGNDSFGNRHGSGPMSGGDTFDGEFQR
                     KDDDRFTVEHRPDKNEQVANSRSNDDSFKDDK"
     gene            482818..483111
                     /gene="groES"
                     /locus_tag="YPTB_RS02325"
                     /old_locus_tag="YPTB0404"
     CDS             482818..483111
                     /gene="groES"
                     /locus_tag="YPTB_RS02325"
                     /old_locus_tag="YPTB0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JIP2.1"
                     /note="10 kDa chaperonin; Cpn10; GroES; forms
                     homoheptameric ring; binds to one or both ends of the
                     GroEL double barrel in the presence of adenine nucleotides
                     capping it; folding of unfolded substrates initiates in a
                     GroEL-substrate bound and capped by GroES; release of the
                     folded substrate is dependent on ATP binding and
                     hydrolysis in the trans ring; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="WP_002209127.1"
                     /db_xref="GI:488137919"
                     /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGTAAGKSTRGEVLAVG
                     NGRILDNGEIKPLDVKVGDVVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
     gene            483158..484804
                     /gene="groEL"
                     /locus_tag="YPTB_RS02330"
                     /old_locus_tag="YPTB0405"
     CDS             483158..484804
                     /gene="groEL"
                     /locus_tag="YPTB_RS02330"
                     /old_locus_tag="YPTB0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004706989.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_002209128.1"
                     /db_xref="GI:488137920"
                     /translation="MAAKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSF
                     GSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITE
                     GLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGE
                     LIAQAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP
                     FILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAV
                     KAPGFGDRRKAMLQDIATLTAGTVISEEIGLELEKTTLEDLGQAKRVVINKDTTIIID
                     GVGDEAAIQGRVAQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEK
                     KARVEDALHATRAAVEEGVVAGGGVALIRAAHAIAGLKGDNEDQNVGIKVALRAMESP
                     LRQIVVNAGEEASVIANKVKAGEGSFGYNAYTEEYGDMIAMGILDPTKVTRSALQYAA
                     SIAGLMITTECMVTDLPRDDKGADMGAGGMGGMGGMGGMM"
     gene            485482..485826
                     /locus_tag="YPTB_RS02335"
                     /old_locus_tag="YPTB0406"
     CDS             485482..485826
                     /locus_tag="YPTB_RS02335"
                     /old_locus_tag="YPTB0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004873944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_032465615.1"
                     /db_xref="GI:694125014"
                     /translation="MKIKTLLGLSAVLVLAGCSSSNTLSSAGEQVKFSDTQPGSECQL
                     VGQVTGTQSNWLSGQGGESSSMRGAANDLRNKAAAMGGNVIYGATSPSETFLSSFAPL
                     ESKMVGQVYKCP"
     gene            complement(486111..487139)
                     /locus_tag="YPTB_RS02340"
                     /old_locus_tag="YPTB0407"
     CDS             complement(486111..487139)
                     /locus_tag="YPTB_RS02340"
                     /old_locus_tag="YPTB0407"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EF-P beta-lysylation protein EpmB"
                     /protein_id="WP_002228125.1"
                     /db_xref="GI:488156917"
                     /translation="MASIVTRNMPIREDWLQQLADVITDPDELLRILFLNEHPHLQQG
                     SGARRLFPLRVPRAFVARMQPGNASDPLLLQVLTAREEFITAPGFTHDPLDEQRSVVP
                     GLLHKYRNRALLLVKGGCAVNCRYCFRRHFPYQDNQGNKANWLQALDYIRQHPELDEI
                     IFSGGDPLMAKDHELSWLLDQLEDIKHIRRLRIHTRLPVVIPARITATLCQRLGSSRL
                     QVLMVTHINHANEIDPPLRDSMARLKQAGVTLLNQSVLLRGVNNDADVLATLSNALFD
                     AGILPYYIHVLDKVQGAAHFMVDDDEARQLMKGLLSRVSGYLVPRLTREVGGEPSKTP
                     LDLRLTQN"
     gene            487175..487741
                     /locus_tag="YPTB_RS02345"
                     /old_locus_tag="YPTB0408"
     CDS             487175..487741
                     /locus_tag="YPTB_RS02345"
                     /old_locus_tag="YPTB0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004873942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="WP_002209131.1"
                     /db_xref="GI:488137923"
                     /translation="MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMR
                     RLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGD
                     NGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGA
                     VVKVPLFVQVGEIIKVDTRSGEYVSRVK"
     gene            487988..488302
                     /locus_tag="YPTB_RS02350"
                     /old_locus_tag="YPTB0409"
     CDS             487988..488302
                     /locus_tag="YPTB_RS02350"
                     /old_locus_tag="YPTB0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004392447.1"
                     /note="member of the SMR family of proton-dependent drug
                     efflux transporters; quaternary ammonium compound efflux
                     pump; confers resistance to cetylpyridinium,
                     cetyldimethylethyl ammonium and cetrimide cations; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quaternary ammonium compound-resistance protein
                     SugE"
                     /protein_id="WP_002228124.1"
                     /db_xref="GI:488156916"
                     /translation="MAWIILVIAGLLEVIWAIGLKYSHGFSRLTPSIITLVAMAASVF
                     LLAYAMKSLPAGTAYAVWTGIGAVGTAILGIVLLGESASLARILSLGLILAGIIGLKL
                     AS"
     gene            complement(488467..488823)
                     /locus_tag="YPTB_RS02355"
                     /old_locus_tag="YPTB0410"
     CDS             complement(488467..488823)
                     /locus_tag="YPTB_RS02355"
                     /old_locus_tag="YPTB0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit D"
                     /protein_id="WP_002209134.1"
                     /db_xref="GI:488137926"
                     /translation="MNQVPKRSDEPIFWGLFGAGGMWGAIIAPVIILLVAILLPLGAF
                     PGDALSYERILAFCQSFIGRVFLLLMIILPLWCGLHRIHHAMHDLKIHVPAGKWVFYG
                     LAAILSVVTFIGVLTL"
     gene            complement(488840..489232)
                     /locus_tag="YPTB_RS02360"
                     /old_locus_tag="YPTB0411"
     CDS             complement(488840..489232)
                     /locus_tag="YPTB_RS02360"
                     /old_locus_tag="YPTB0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002426754.1"
                     /note="part of four member fumarate reductase enzyme
                     complex FrdABCD which catalyzes the reduction of fumarate
                     to succinate during anaerobic respiration; FrdAB are the
                     catalytic subcomplex consisting of a flavoprotein subunit
                     and an iron-sulfur subunit, respectively; FrdCD are the
                     membrane components which interact with quinone and are
                     involved in electron transfer; the catalytic subunits are
                     similar to succinate dehydrogenase SdhAB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit C"
                     /protein_id="WP_002209135.1"
                     /db_xref="GI:488137927"
                     /translation="MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSIPAVWFSVLLI
                     YGVFALKSGPAGWEGFVSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSE
                     KMGPEPMIKALWVVTVVASAIILAVALL"
     gene            complement(489249..489983)
                     /locus_tag="YPTB_RS02365"
                     /old_locus_tag="YPTB0412"
     CDS             complement(489249..489983)
                     /locus_tag="YPTB_RS02365"
                     /old_locus_tag="YPTB0412"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005175554.1"
                     /note="part of four member fumarate reductase enzyme
                     complex FrdABCD which catalyzes the reduction of fumarate
                     to succinate during anaerobic respiration; FrdAB are the
                     catalytic subcomplex consisting of a flavoprotein subunit
                     and an iron-sulfur subunit, respectively; FrdCD are the
                     membrane components which interact with quinone and are
                     involved in electron transfer; the catalytic subunits are
                     similar to succinate dehydrogenase SdhAB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase iron-sulfur subunit"
                     /protein_id="WP_002209136.1"
                     /db_xref="GI:488137928"
                     /translation="MTDMKVLKMEVMRYNPERDSEPHFETFEVPYDEQTSLLDALGYI
                     KDNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLREYTAGMKVEALGNFPIERD
                     LVVDMTHFIESLEAIKPYIIGNERLPKDGPNKQTPAQMAKYHQFSGCINCGLCYAACP
                     QFGLNPEFIGPAAITLAHRYNLDNRDHGKKERMPQLNGKNGVWSCTFVGYCSEVCPKH
                     VDPAAAIQQGKIDSAKDFMIAMLKPQ"
     gene            complement(489976..491799)
                     /locus_tag="YPTB_RS02370"
                     /old_locus_tag="YPTB0413"
     CDS             complement(489976..491799)
                     /locus_tag="YPTB_RS02370"
                     /old_locus_tag="YPTB0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011815417.1"
                     /note="part of four member fumarate reductase enzyme
                     complex FrdABCD which catalyzes the reduction of fumarate
                     to succinate during anaerobic respiration; FrdAB are the
                     catalytic subcomplex consisting of a flavoprotein subunit
                     and an iron-sulfur subunit, respectively; FrdCD are the
                     membrane components which interact with quinone and are
                     involved in electron transfer; the catalytic subunits are
                     similar to succinate dehydrogenase SdhAB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="WP_002209137.1"
                     /db_xref="GI:488137929"
                     /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRS
                     HTVAAEGGSAAVTQDHDTFDYHFHDTVAGGDWLCEQDVVDHFVHSCPEEMAQLEIWGC
                     PWSRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLD
                     ILVDEGQARGVVAMNMMEGTRVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAF
                     HHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLG
                     EPKNKYMELGPRDKVSQAFWHEWRAGRTVATPRGDVVYLDLRHLGEKKLLERLPFICE
                     LAKAYVGVDPVKEPIPVRPTAHYTMGGIETNPQCETRIKGLFAVGECSSVGLHGANRL
                     GSNSLAELVVFGRVAGEQAALRAMESGPANGSALDAQTRDVETRLSNLMKQEGTENWS
                     KIRDEMGLSMEEGCGIYRTPELMQKTVDKLAELKERFKRVKITDHSSVFNTDLLYTIE
                     LGYGLDVAECMAHSALNRKESRGAHQRLDEGCTERDDVNFLKHTLAFHTPGGAPRIEY
                     SDVKITKLVPAKRVYGGEATAQDAKDAKDAQDLKDKEQAND"
     gene            491906..492097
                     /locus_tag="YPTB_RS02375"
     CDS             491906..492097
                     /locus_tag="YPTB_RS02375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002209138.1"
                     /db_xref="GI:488137930"
                     /translation="MSHYSLGILNIIIPLTYFSAVNLMILRIAISYFLYGIIILNDKS
                     QKFDVIDCFVLFEPPQMHY"
     gene            492257..493234
                     /locus_tag="YPTB_RS02380"
                     /old_locus_tag="YPTB0414"
     CDS             492257..493234
                     /locus_tag="YPTB_RS02380"
                     /old_locus_tag="YPTB0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIX3.1"
                     /note="poxA; regulates pyruvate oxidase poxB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P--(R)-beta-lysine ligase"
                     /protein_id="WP_002209139.1"
                     /db_xref="GI:488137931"
                     /translation="MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMS
                     QATVTDIHLVPFETRFVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNE
                     EAGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNID
                     PLSAEKAQLREVAAKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPAS
                     QASLAEISTEDHRVAERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQ
                     NPIDMNLIAALKQGLPDCSGVALGVDRLVMLALNAERLSDVIAFPVNIA"
     gene            complement(493479..496820)
                     /locus_tag="YPTB_RS02385"
                     /old_locus_tag="YPTB0415"
     CDS             complement(493479..496820)
                     /locus_tag="YPTB_RS02385"
                     /old_locus_tag="YPTB0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011906457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive channel protein"
                     /protein_id="WP_032466065.1"
                     /db_xref="GI:694125470"
                     /translation="MRPIISWSFGLLLSFFLLMPLHAATQPNEEQVRQELKLAESNKT
                     TPNQAEIVQALQGALSWLADAKESDIRAQQYQKAIDDFPKLTRELRQQLAQEGDKPLP
                     VPSNLSTSDLEQQVLQVSSQLLELNRLSQQEQDRAREISESLGQLPQQQSEARRMLAE
                     IGPRIQSQSNPSSPVAQAQLTLLQAEAVARKAKVNELELSQLSANNRQELSRLQVELY
                     KKREARVQAQLQSLRNNLNNQRQQAAEQALERTELLAEQGGDLPESITQQLQRNRELS
                     QALNQQVQRIDLISSQQRQAVAQTQQVRQALNTIREQAQWLGVSTALGETLRAQVAKL
                     PEMPKSQQLDRDMAQLRVQRLQYEDMLEKLQQQKTTLKQDDGTPLTPDQQRILDAQWR
                     TQSELLNSLLSGYDTQILELTKLKVANSQLVDALNGVREATHRYLFWVADVSPISLSY
                     PLAVAQDLTRLLSLDTLSQLSGAFVMMMTSQETLLPIIAALLFVGFSVSSRRHYHAFL
                     ERASSRVGKVTQDHFSLTLRTVFWSILMALPLPVLWAALGYGLQNAWSYPMAIAIGNA
                     VTATVPVLWVFMISASFAHPHGLFITHFRWSPTQVARAMRFYRLSIWLIVPLMMALIT
                     FENYNDREFAGTLGRLCFILLCIALSLVTNSLKRAGIPLYLDKKGSGENMINVALWGL
                     LLSAPLIAALASALGYLTTSQALLARLETSVAIWFFLLVVYHIIRRWMLIQRRRIAFD
                     RAKQRRADILAQRARGEEDSPHSNSTEGSIDVEEPIIDLDVISAQSLRLVRSILTMIA
                     LVSVIVLWSEIHSAFGFLENIRLWDVSSTINGIESVQPITMGSLLIAVLVLIITAQLV
                     RNLPALLELALLQHLDLTPGTGYAISTITKYLVILFGGLLGFSLLGIEWAKFQWLVAA
                     LGLGLGFGLQEIFANFVSGLIILFEKPIRIGDTVTIRDLTGSVTKINTRATTISDWDR
                     KEIIVPNKAFITEQFINWSLSDSITRVVLTVPAPAETSSEEVTNVLMTAAQRCTLVLD
                     TPPPEVYLVDLQQGIQIFELRIYAAEMGHRMPLRHEIHQLILAGYREHGITLPFPPFQ
                     ARLETLGRGTGRTISSGRSRTPGSL"
     gene            complement(496862..497743)
                     /locus_tag="YPTB_RS02390"
                     /old_locus_tag="YPTB0416"
     CDS             complement(496862..497743)
                     /locus_tag="YPTB_RS02390"
                     /old_locus_tag="YPTB0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002423325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase proenzyme"
                     /protein_id="WP_002209141.1"
                     /db_xref="GI:488137933"
                     /translation="MLDSIKIKLQYLLPKQGLTQLAGWGANKQGGWLTQLVIKAFARY
                     YKVDMKEAQDPEFSAYRTFNEFFVRPLRAGVRPVVAEENLLAQPADGAISQLGAIREG
                     QILQAKGHNYSLEALLAGNYLLAAEFQNGQFVTTYLAPRDYHRVHMPCDGVLREMIYV
                     PGDLFSVNPLTAANVPNLFARNERVICIFDTAFGPMAQILVGATIVGSIETVWAGTIT
                     PPREGVIRRWTYPQAGCEGAITLEKGQEMGRFKLGSTVINLFAEGKVYFAPQLNSGAV
                     TRMGEVLAEAVPTTPSY"
     gene            complement(498068..499120)
                     /locus_tag="YPTB_RS02395"
                     /old_locus_tag="YPTB0417"
     CDS             complement(498068..499120)
                     /locus_tag="YPTB_RS02395"
                     /old_locus_tag="YPTB0417"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005156445.1"
                     /note="EngC; RsgA; CpgA; circularly permuted GTPase;
                     ribosome small subunit-dependent GTPase A; has the pattern
                     G4-G1-G3 as opposed to other GTPases; interacts strongly
                     with 30S ribosome which stimulates GTPase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase RsgA"
                     /protein_id="WP_002209142.1"
                     /db_xref="GI:488137934"
                     /translation="MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVI
                     SRFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHER
                     TSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNK
                     IDLLDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVG
                     KSSLLNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLW
                     HLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILE
                     SMEQAKPRKTSDSDEK"
     gene            complement(499127..499321)
                     /locus_tag="YPTB_RS02400"
     CDS             complement(499127..499321)
                     /locus_tag="YPTB_RS02400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015683799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015683799.1"
                     /db_xref="GI:505721391"
                     /translation="MIFPICKPGEQPNKRLINKIMCIIVLLVATSDISKELGVASRWQ
                     ANIANTPYNAKSEGDKCRFK"
     gene            499320..499865
                     /locus_tag="YPTB_RS02405"
                     /old_locus_tag="YPTB0418"
     CDS             499320..499865
                     /locus_tag="YPTB_RS02405"
                     /old_locus_tag="YPTB0418"
                     /EC_number="3.1.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004873932.1"
                     /note="3'-5' exoribonuclease specific for small
                     oligoribonuclotides; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoribonuclease"
                     /protein_id="WP_011191612.1"
                     /db_xref="GI:499504972"
                     /translation="MAENQNNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGP
                     VLAVHQSAEQLGLMDEWNVRTHTGSGLVERVKTSPFNDRDAELQTIEFLKQWVPAGVS
                     PICGNSVGQDRRFLFRYMPELEAYFHYRYVDVSTLKELARRWKPEILAGFKKQNTHQA
                     LDDIRESVAELAYYREHFIQS"
     gene            complement(500018..>500428)
                     /locus_tag="YPTB_RS02410"
     CDS             complement(500018..>500428)
                     /locus_tag="YPTB_RS02410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011171766.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041175437.1"
                     /db_xref="GI:752489417"
                     /translation="PALDMTYLVLNLSSHACEFFIGTGCALYEKSVLPQAPESKKIIF
                     LFKCRLKQQYGVFTSTRQSIYPKSLVEQQAGSKQTHPDELTSVSDSGKCAQLTPLLFQ
                     VSREFPTSLEQQAGSKQTRPDELTSVSDSGNARS"
     gene            500424..500499
                     /locus_tag="YPTB_RS02415"
                     /old_locus_tag="YPTB_RNA_16"
     tRNA            500424..500499
                     /locus_tag="YPTB_RS02415"
                     /old_locus_tag="YPTB_RNA_16"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:500457..500459,aa:Gly,seq:gcc)
     gene            500591..500666
                     /locus_tag="YPTB_RS02420"
                     /old_locus_tag="YPTB_RNA_17"
     tRNA            500591..500666
                     /locus_tag="YPTB_RS02420"
                     /old_locus_tag="YPTB_RNA_17"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:500624..500626,aa:Gly,seq:gcc)
     gene            500734..500809
                     /locus_tag="YPTB_RS02425"
                     /old_locus_tag="YPTB_RNA_18"
     tRNA            500734..500809
                     /locus_tag="YPTB_RS02425"
                     /old_locus_tag="YPTB_RNA_18"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:500767..500769,aa:Gly,seq:gcc)
     gene            complement(501121..502356)
                     /locus_tag="YPTB_RS02430"
                     /old_locus_tag="YPTB0419"
     CDS             complement(501121..502356)
                     /locus_tag="YPTB_RS02430"
                     /old_locus_tag="YPTB0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epoxyqueuosine reductase"
                     /protein_id="WP_002209144.1"
                     /db_xref="GI:488137936"
                     /translation="MAHPLDLNQLAQHIKQWGQSLGFQQVGICDTDLTAEEPRLQAWL
                     DKQYHGEMAWMARHGMLRARPHELLPGTLRVISVRMNYLPAKAAFASTLNNPELGYVS
                     RYALGRDYHKLLRQRLKKLGDQIQHYCLEQNNLDRHDLELHDLEQHDSERQGQPEQHT
                     ASEINFRPFVDSAPIMERSLAAKAGIGWVGKHSLILNRDAGSWFFLGELLIDLPLPVD
                     KPQEEQCGRCVACMTTCPTGAIVAPYTVDARRCISYLTIELEGAIPEEFRPLMGNRIY
                     GCDDCQLICPWNRFSQLTDEDDFSPRAVLHTPQLLDLFAWNEEKFLRVTEGSAIRRIG
                     HLRWLRNISVALGNAPYLDSIVLALETRRGLHPMLDEHIEWAISQQLARRATQAVEVQ
                     LPQKKRLIRAIEKGLPRDA"
     gene            502355..503869
                     /locus_tag="YPTB_RS02435"
                     /old_locus_tag="YPTB0420"
     CDS             502355..503869
                     /locus_tag="YPTB_RS02435"
                     /old_locus_tag="YPTB0420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_011191613.1"
                     /db_xref="GI:499504973"
                     /translation="MTDHSKKQTRVSLPHSVFSADWVRQNEAAAAAHFSLTLFDLMVR
                     AGNAAFELAHKQYPIARHWLILCGHGNNGGDGYIVANRALAAGIDVTLIACPGNRPLP
                     AEAKEAQSQWLAIGGVIHQPDTQWPQDIDLIIDGLLGIGLRAAPQGIYETLIDMANRH
                     RAAKVALDIPSGLCADNGAALGSVLRADHTLTFVALKPGLLTGQARDWVGQLHYDDLG
                     LATWLDTQSAQIERITADHLPQWLKPRRPCAHKGDYGRLLLVGGDRGFGGAIRMAGEA
                     ALRSGAGLVRVLTHFEHVAPILAARPELMVQALTAETLEQSMQWADVLVVGPGLGQSD
                     WSRNALKRLQQSDKPTLWDADALNLLALNPHRRQNWVLTPHPGEAARLLGCRVVDIES
                     DRLLSARNIVKQYGGVVVLKGAGTLIANEQGEMAIADVGNAGMASGGMGDILFGIIGG
                     LIAQKLALYDAACAGCVVHGVAADKLAEVQGTRGLLATDLLPVIPKYINPELAK"
     gene            503880..504350
                     /locus_tag="YPTB_RS02440"
                     /old_locus_tag="YPTB0421"
     CDS             503880..504350
                     /locus_tag="YPTB_RS02440"
                     /old_locus_tag="YPTB0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005156441.1"
                     /note="needed for nucleoid integrity; possibly involved in
                     cell wall synthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-binding protein"
                     /protein_id="WP_011191614.1"
                     /db_xref="GI:499504974"
                     /translation="MKELVLLLPDEAATVALGATLARAFGGASVIYLFGDLGAGKTTF
                     SRGFLQALGHNGHVKSPTYTLVEPYTLTPRPVYHFDLYRLADPEELEFMGIRDYFDPQ
                     AICLVEWPQQGAGFLPQADVELHLTYQAAGREARLVAISEAGADVLRRLAAVQG"
     gene            504358..506271
                     /locus_tag="YPTB_RS02445"
                     /old_locus_tag="YPTB0422"
     CDS             504358..506271
                     /locus_tag="YPTB_RS02445"
                     /old_locus_tag="YPTB0422"
                     /EC_number="3.5.1.28"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_012413447.1"
                     /db_xref="GI:501381881"
                     /translation="MMHSLSLICRWKHGFATIRHFTTICHFTTVRRVITARRFATVTR
                     MVIGLLTLSLFALPPAFAMKLTDIKVTNGASESKVTLSFDGKPIYAFFSLNSPERVVL
                     DVRQSGNISGLPLEFSGQNLLKRIRSSTPKDEQSTRLVLELTQKVKTRAVTQQSGNNY
                     TVVLTMTAVASAPVRQAQASLNQTNTPSPNAGRVVPQVTSKDSVAKNPFNNKPVVVVS
                     SENVTTNTARQIKTVSAANSSRVVVAIDAGHGGQDPGAIGQNGLKEKNVTISIARRLE
                     ALLNRDPMFKPVLTRNGDYFISVMGRSDVARKQGANVLISIHADAAPNRSATGASVWV
                     LSNRRANSEMGNWLEQHEKQSELLGGAGDVLANTASDPYLSQAVLDLQFGHSQRVGYD
                     VATKVLRELQTVGDIHKRKPEHASLGVLRSPDIPSLLVETGFISNSTEERLLGSSAYQ
                     EKIAQAIYKGLRSYFLANPLQADPKVESRPLIETAAVDSSTQRSGISQPEPIVNNISS
                     NAQSGRSSATLPAGKSKIHNVQRGETLSGIASQYGVSMAVLRQNNTLKNDVVWVGQRL
                     KVPASGSTVTAVKPKTAAVAKSKPIKHQVKRGDTLSAIAARYGVSMSEIERVNKIKSG
                     NVQLGQTLTIPQS"
     gene            506287..508194
                     /locus_tag="YPTB_RS02450"
                     /old_locus_tag="YPTB0423"
     CDS             506287..508194
                     /locus_tag="YPTB_RS02450"
                     /old_locus_tag="YPTB0423"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIW4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="WP_002209148.1"
                     /db_xref="GI:488137940"
                     /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDI
                     DIERGGAKLIRIRDNGCGISKDDLALALARHATSKISSLEDLEAILSMGFRGEALASI
                     SSVSRLILTSRTAEQSEAWQAYAEGRDMAVTIKPAAHPVGSTLEVLDLFYNTPARRKF
                     MRTEKTEFGHIDEVVRRIALARFDVAINLNHNGKLIRQYRAAPDPAQHERRLASICGP
                     AFLQHALAIAWQHGDLNIHGWVADPAASHTLSEMQYCYVNNRMMRDRLINHAIRQAYQ
                     DRLNDAQQPAYVLYLDIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQAVTAVLQQTNA
                     PILNISEEGEVDAPRWQQENRVAAGTNKYAQPEAAKSSAAEQAVARERSSARERAAPA
                     YKEDHPYQKQQGELYRQLLQPSAAAKPATSPAAIPASSVSSPSIPVQRITQAEEPLHG
                     DNYSFGRVLTVFPPCYALIEYQGGVALLSLAVAERWLKQAQLSPPEEGLRPQPLLIPL
                     KITLDKNEIAACQNHEKLLITMGIELSVEQGRATLRAVSLPLRQQNLQKLIPELLGYL
                     SQHEEISPDTLATWLARHLGSEHEVWNVSQAIQLLTEVERLCPQLVQSPPAGLLQPID
                     IKAALATLTHE"
     gene            508187..509128
                     /gene="miaA"
                     /locus_tag="YPTB_RS02455"
                     /old_locus_tag="YPTB0424"
     CDS             508187..509128
                     /gene="miaA"
                     /locus_tag="YPTB_RS02455"
                     /old_locus_tag="YPTB0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JIR4.1"
                     /note="IPP transferase; isopentenyltransferase; involved
                     in tRNA modification; in Escherichia coli this enzyme
                     catalyzes the addition of a delta2-isopentenyl group from
                     dimethylallyl diphosphate to the N6-nitrogen of adenosine
                     adjacent to the anticodon of tRNA species that read codons
                     starting with uracil; further tRNA modifications may
                     occur; mutations in miaA result in defects in translation
                     efficiency and fidelity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA dimethylallyltransferase"
                     /protein_id="WP_002209149.1"
                     /db_xref="GI:488137941"
                     /translation="MNDIENLDRPPAIFIMGPTASGKTALSIALRQRLPVELVSVDSA
                     LIYRGMDIGTAKPSAQELALAPHRLIDIRDPAESYSAADFRKDALKEMADITAAGRIP
                     LLVGGTMLYFKALLDGLSPLPSADPQVRQRIEQQASELGWGALHQQLAVIDPVAAARI
                     HPNDPQRLSRALEVFFISGKTLTELTKISGETLPYRVHQFAIAPASRELLHQRIELRF
                     HQMLDAGFEAEARVLFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNDMVYRGVCATR
                     QLAKRQMTWLRGWSSVQWLDSDKPGEALDSVIQVVSA"
     gene            509245..509550
                     /gene="hfq"
                     /locus_tag="YPTB_RS02460"
                     /old_locus_tag="YPTB0425"
     CDS             509245..509550
                     /gene="hfq"
                     /locus_tag="YPTB_RS02460"
                     /old_locus_tag="YPTB0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIW2.3"
                     /note="HF-I, host factor for RNA phage Q beta replication;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA chaperone Hfq"
                     /protein_id="WP_002209151.1"
                     /db_xref="GI:488137943"
                     /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVI
                     LLKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE"
     gene            509649..510935
                     /locus_tag="YPTB_RS02465"
                     /old_locus_tag="YPTB0426"
     CDS             509649..510935
                     /locus_tag="YPTB_RS02465"
                     /old_locus_tag="YPTB0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105752.1"
                     /note="involved in modulation of proteins HflK and HflC;
                     part of the hflA locus (high frequency of lysogenization)
                     which governs the lysis-lysogeny decision of bacteriophage
                     lambda by controlling stability of the phage cII protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase HflX"
                     /protein_id="WP_002209152.1"
                     /db_xref="GI:488137944"
                     /translation="MFDRYEAGEQAVLVHIYFSQNKDTEDLREFEALVSSAGVEALQI
                     VTGSRKAPHPKYFVGEGKAEEIADAVKASGASVVLFDHALSAAQERNLERLCQCRVID
                     RTGLILDIFAQRARTHEGKLQVELAQLRHIATRLVRGWTHLERQKGGIGLRGPGETQL
                     ETDRRLLRDRISLILSRLERVAKQREQGRRARTRADIPTVSLVGYTNAGKSSLFNKIT
                     AADVYAADQLFATLDPTLRRINVADVGDTVLADTVGFIRHLPHDLVAAFKATLQETRQ
                     ASLLLHIIDAADPRVAENMAAVDTVLAEIEADEIPTLLVMNKIDLLDDFVPRIDRNED
                     NLPVRVWLSAQTGAGIPLLFQALTERLSGEIAHFELRLPPQAGRLRSRFYQLQAIEKE
                     WIDEDGNVGMVVRMPIVDWRRLCKQEQELVSYIQNN"
     gene            511176..512438
                     /locus_tag="YPTB_RS02470"
                     /old_locus_tag="YPTB0427"
     CDS             511176..512438
                     /locus_tag="YPTB_RS02470"
                     /old_locus_tag="YPTB0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191616.1"
                     /note="with HflC inhibits proteolysis of lambda cII
                     protein by FtsH; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_011191616.1"
                     /db_xref="GI:499504976"
                     /translation="MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNNKGGRDQGPPDLD
                     DIFRKLSKKLSSLGGKGSGSGGNGASHGPGFSGRVVGIAVVAVVVIWAASGFYTIKEA
                     ERGVVTRLGKLSHIVQPGLNWKPTFIDEVVPVNVEAVRELAASGVMLTSDENVVRVEM
                     NVQYRVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRV
                     LEETIRPYQMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQP
                     RANGQAQRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVL
                     GKTNKVLANDKGNNLMVLPLDQMLRGQGAANKVDGNKDTSLIRLNPAPSSQQTGASNS
                     NTSSGSGSIMDQRRVNAQRDTSTRVGRE"
     gene            512442..513446
                     /locus_tag="YPTB_RS02475"
                     /old_locus_tag="YPTB0428"
     CDS             512442..513446
                     /locus_tag="YPTB_RS02475"
                     /old_locus_tag="YPTB0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004875464.1"
                     /note="with HflK inhibits proteolysis of lambda cII
                     protein by FtsH; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_002209155.1"
                     /db_xref="GI:488137947"
                     /translation="MRKSFLLIVVVVLIALFASLFVVEEGQRGIVLRFGKVLRDSDNK
                     PLVYAPGLHFKIPFIETVKRLDARIQTMDNQADRFVTNEKKDLIVDSYLKWRISDFSR
                     YYLATGGGDVSQAEVLLKRKFSDRLRSEIGRLNVRDIVTDSRGRLTSDVRDALNTGSV
                     GDEAATTEADDAIASAAARVEQETRGKQPAVNPNSMAALGIEVVDVRIKQINLPAEVS
                     DAIFQRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAERQARITRGGGDAE
                     AARLFAEAFSQDPDFYAFIRSLRAYENSFSSGNDVMVLSPDSDFFRYMKSPDNSSKRP
                     "
     gene            513618..513818
                     /locus_tag="YPTB_RS02480"
                     /old_locus_tag="YPTB0429"
     CDS             513618..513818
                     /locus_tag="YPTB_RS02480"
                     /old_locus_tag="YPTB0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002217227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002217227.1"
                     /db_xref="GI:488146019"
                     /translation="MNSTILLALGLVLVLEGLGPMLYPKAWRKMIQAMTQLPDATLRR
                     FGGGLVVAGCVIYYMLRSHMGS"
     gene            513918..515216
                     /locus_tag="YPTB_RS02485"
                     /old_locus_tag="YPTB0430"
     CDS             513918..515216
                     /locus_tag="YPTB_RS02485"
                     /old_locus_tag="YPTB0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004707016.1"
                     /note="catalyzes the formation of
                     N6-(1,2,-dicarboxyethyl)-AMP from L-aspartate, inosine
                     monophosphate and GTP in AMP biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthetase"
                     /protein_id="WP_002209157.1"
                     /db_xref="GI:488137949"
                     /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTL
                     VINGEKTVLHLIPSGILRENVISIIGNGVVLAPDALMKEMTELEARGVPVRERLLLSE
                     ACPLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFAI
                     KLKEIVEYHNFQLVHYYKEAAVDYQKVLDDVLAIADILTAMVVDVSELLDNARKQGEL
                     IMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGA
                     GPFPTELNDETGEFLRKQGNEYGATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLD
                     VLDGLKEVKLCVGYRMPDGREVDTTPLAAEGWEGIEPIYETMPGWSETTFGVKEHSKL
                     PQAALNYIQRVEELTGVPIDIISTGPDRDETMILRDPFDA"
     gene            515605..516030
                     /locus_tag="YPTB_RS02490"
                     /old_locus_tag="YPTB0431"
     CDS             515605..516030
                     /locus_tag="YPTB_RS02490"
                     /old_locus_tag="YPTB0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JIS1.1"
                     /note="negatively regulates the transcription of genes
                     upregulated by nitrosative stress; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002217229.1"
                     /db_xref="GI:488146021"
                     /translation="MQLTSFTDYGLRALIYMASLPDGQMTSISQVTEVYGVSRNHMVK
                     IINQLSRVGLVTAVRGKNGGIRLGKPADQILIGDVVRQMEPLTLVNCSSDFCHITPAC
                     RLKQVLNQAVQSFLKELDNYTLADMVKDNSPLYKLLLVE"
     gene            516271..518805
                     /locus_tag="YPTB_RS02495"
                     /old_locus_tag="YPTB0432"
     CDS             516271..518805
                     /locus_tag="YPTB_RS02495"
                     /old_locus_tag="YPTB0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413448.1"
                     /note="3'-5'exoribonuclease that acts nonspecifically on
                     poly(A), poly(U) and ribosomal RNAs; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exoribonuclease R"
                     /protein_id="WP_002209159.1"
                     /db_xref="GI:488137951"
                     /translation="MSQDPFLEREAEKYESPIPSREFILAHLAKRETPASREELANEL
                     NLTGEEPLEALRRRLRAMERDGQLVFTRRQCYALPERLDLLRGTVIGHRDGYGFLRVE
                     GSKDDLYLSAEQMKMAIHGDVVLAQVVGADRKGRREARIVRVLVPKTSQIVGRYFTDA
                     GTGFVVPDDSRLSFDILIPAEATCGARMGFVVVVELTQRPTRRTKAVGKIVEVLGENM
                     GTSMAVDIALRTHEIPHTWPPQVEKQVADLKEQVPEEAKKGRVDLRDLPLVTIDGEDA
                     RDFDDAVYCEKKRGGGWRLWVAIADVSYYVRPQTALDDEARSRGNSVYFPSQVIPMLP
                     EVLSNGLCSLNPQVDRLCMVCEMTISSQGKLSSYKFYEAVMSSHARLTYTKVWRIIDG
                     EESLREQYKPLVPHLEELHAMYKVLDQARAERGGIAFETEEAKFIFNAERRIERIEPT
                     VRNDAHKLIEECMILANIAAARFVEKHEEPALFRVHDRPSDDHIVALRSVLNELGLTL
                     GGGLKPQPKDYSVLMDEISDRPDHEMLQTMLLRSMKQAVYDPENRGHFGLALASYGHF
                     TSPIRRYPDLAMHRAIKYQLAKEHGNLKDRWTPTGGWHSDFEDMLQLGQHCSMTERRA
                     DEATRDVADWLKCDFMLDQVGNVFTGIIASVTGFGFFVRLDDLFIDGLVHVSSLDNDY
                     YRYDNIGQRLIGESSGVVYRLGDTVEIRVDAVHMDERKIDFALVSSTRKPRGEGKTAR
                     DKAKNNGQRTLRSNSAGRGSSSGSSRRDGAPTAGGQKRPRRAKKPVNFEPDSAFRPDA
                     AAAKPDDKALAEKKAKAKAKRASAKTKKIAAATKAKRAKKKTTSDQ"
     gene            518924..519664
                     /locus_tag="YPTB_RS02500"
                     /old_locus_tag="YPTB0433"
     CDS             518924..519664
                     /locus_tag="YPTB_RS02500"
                     /old_locus_tag="YPTB0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIV4.1"
                     /note="Specifically methylates the ribose of guanosine
                     2251 in 23S rRNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (guanosine-2'-O-)-methyltransferase
                     RlmB"
                     /protein_id="WP_002209161.1"
                     /db_xref="GI:488137953"
                     /translation="MSEIIYGIHAVKALLERDPQRFLEVFILKGRDDRRLQPLIAELE
                     AAGLVIQVASRQWLDSQVEGGVHQGIVARVREGRQYQENDLPALLESVETPFLLVLDG
                     VTDPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLART
                     LRVLQEHNVWIVGTAGEADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPM
                     AGSVSSLNVSVATGVCLFEVVRQRGLKA"
     gene            520084..521715
                     /locus_tag="YPTB_RS02505"
                     /old_locus_tag="YPTB0434"
     CDS             520084..521715
                     /locus_tag="YPTB_RS02505"
                     /old_locus_tag="YPTB0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002353634.1"
                     /note="catalyzes the formation of 3-methylcrotonyl-CoA
                     from isovaleryl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isovaleryl-CoA dehydrogenase"
                     /protein_id="WP_032466990.1"
                     /db_xref="GI:694126407"
                     /translation="MDWQTHLVFNQPEPLSNSNLFLSDLALREAVVREHAGWDGENLS
                     LIGLQLGSLESLELGRLANAHPPELLRYDGAGQRLGQVRFHPAWHVLMQGLIHHRVHN
                     LPWQEDARNGSFVARAARFILHAQVDAGALCPITMTFGAIPLLQQTLPPLFQNWLSPL
                     LSDRYDPHLSLGNQKRGLLIGMGMTEKQGGSDVLSNTTRAEPLSIRGQGEAYRLIGHK
                     WFFSVPQSDAHLVLAQAEGGLSCFFLPKILPDGTHNAIRLERLKEKLGNCSNASSEVE
                     FDNATAWLLGEEGDGIRQILKMGGYTRFDCALGSHGLMRRAFSVALYHALQRQVFGKA
                     LVEQPLMRQVLSRMALRLEGHTALLLRLARAWEASGEVHEQIFSRLLTPAAKYRVCGQ
                     GSAFVAEAMEVLGGIGYCEQSELPRLYREMPVNSIWEGSGNIMCLDVLRTLRKLPTAV
                     EMLQQEFYSVRGQNRLFDRAWRQLQQRLKNPKEEQGRALTQQLFDLCCASQLLRFASP
                     RLADAWCRMTLDHRDQYMLPEAVCARLLERATGAH"
     gene            complement(521825..522136)
                     /locus_tag="YPTB_RS02510"
                     /old_locus_tag="YPTB0435"
     CDS             complement(521825..522136)
                     /locus_tag="YPTB_RS02510"
                     /old_locus_tag="YPTB0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215294.1"
                     /note="in Escherichia coli, mutation of this gene affects
                     biofilm maturation, stress response, and motility; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_002215294.1"
                     /db_xref="GI:488144086"
                     /translation="MINIKRTIAFLLLTLGLSGCNAFNITPVPPPAIQPYAQEITRAQ
                     SLRLQKVGTVSAQVYGSPGDVETEIQRRANASGAPYYLIVMISDSVYPGIWYANALLY
                     R"
     gene            522327..523076
                     /locus_tag="YPTB_RS02515"
                     /old_locus_tag="YPTB0436"
     CDS             522327..523076
                     /locus_tag="YPTB_RS02515"
                     /old_locus_tag="YPTB0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002230471.1"
                     /note="YjfP; esterase activity towards palmitoyl-CoA and
                     pNP-butyrate in vitro; unknown function and substrate in
                     vivo; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_011191618.1"
                     /db_xref="GI:499504978"
                     /translation="MIEMSLENINGIEVIHSAPVGQRQQPLPTIFFYHGYTSSKEVYS
                     YFAYAFAQAGFRTISPDADMHGARFNGNETQRLSHFWEILKSNIDELPDLKRHYQQAG
                     LIEGERIGVAGASMGGMTALGAFARYPWIRVAADFMGSGYFTSLAHSLFPPRDAGREI
                     SQQAFERRLAPLADYELTHQLEKITERPLLVWHGEADDVVPAAESARLVQALRTRGGD
                     NNLTYLTEAGIGHKITPTALRAGSDFFTQYL"
     gene            523151..523429
                     /locus_tag="YPTB_RS02520"
                     /old_locus_tag="YPTB0437"
     CDS             523151..523429
                     /locus_tag="YPTB_RS02520"
                     /old_locus_tag="YPTB0437"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191619.1"
                     /db_xref="GI:499504979"
                     /translation="MGLIEPSKNSFGNLVMILLVNLAKNSPVSTITGNEQKMRFKLAH
                     RHNRNKSPAVLEFPTAHKYSYASFFSRTQTRSLPPWAAVDPIRRLNNP"
     gene            523443..523835
                     /gene="rpsF"
                     /locus_tag="YPTB_RS02525"
                     /old_locus_tag="YPTB0438"
     CDS             523443..523835
                     /gene="rpsF"
                     /locus_tag="YPTB_RS02525"
                     /old_locus_tag="YPTB0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004093642.1"
                     /note="binds cooperatively with S18 to the S15-16S
                     complex, allowing platform assembly to continue with S11
                     and S21; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="WP_002210153.1"
                     /db_xref="GI:488138945"
                     /translation="MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGR
                     RQLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPM
                     VKAKDERRERHDFASEANDDSEAGDSEE"
     gene            523844..524161
                     /locus_tag="YPTB_RS02530"
                     /old_locus_tag="YPTB0439"
     CDS             523844..524161
                     /locus_tag="YPTB_RS02530"
                     /old_locus_tag="YPTB0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015344308.1"
                     /note="binds single-stranded DNA at the primosome assembly
                     site; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal replication protein n"
                     /protein_id="WP_002430134.1"
                     /db_xref="GI:488360749"
                     /translation="MTTNRLVLSGTVCKTPVRKVSPSGIPHCQFVLEHRSTQQEAGFS
                     RQTWCRMPIVVSGQQSQALTHSITVGSQLTVEGFISCHQGRNGLNKLVLHAEQIEFID
                     SGD"
     gene            524166..524393
                     /gene="rpsR"
                     /locus_tag="YPTB_RS02535"
                     /old_locus_tag="YPTB0440"
     CDS             524166..524393
                     /gene="rpsR"
                     /locus_tag="YPTB_RS02535"
                     /old_locus_tag="YPTB0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012986941.1"
                     /note="binds as a heterodimer with protein S6 to the
                     central domain of the 16S rRNA; helps stabilize the
                     platform of the 30S subunit; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="WP_002210155.1"
                     /db_xref="GI:488138947"
                     /translation="MARYFRRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRI
                     TGTRAKYQRQLARCIKRARYLSLLPYTDRHQ"
     gene            524433..524885
                     /gene="rplI"
                     /locus_tag="YPTB_RS02540"
                     /old_locus_tag="YPTB0441"
     CDS             524433..524885
                     /gene="rplI"
                     /locus_tag="YPTB_RS02540"
                     /old_locus_tag="YPTB0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004699845.1"
                     /note="in Escherichia coli this protein is wrapped around
                     the base of the L1 stalk; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="WP_002210156.1"
                     /db_xref="GI:488138948"
                     /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNV
                     EFFEARRAELEAKLADVLAAAEARATKINELVSVTISSKAGDEGKLFGSIGTRDIADA
                     VTAAGVEVAKSEVRLPNGVLRTAGEHEVHFQVHSDVFAKLNVVVVPEA"
     gene            complement(524951..525406)
                     /locus_tag="YPTB_RS02545"
                     /old_locus_tag="YPTB0442"
     CDS             complement(524951..525406)
                     /locus_tag="YPTB_RS02545"
                     /old_locus_tag="YPTB0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002210157.1"
                     /db_xref="GI:488138949"
                     /translation="MMKYQLSFVLLLTPLAVFAEQHCPAIDAIKLIGGVYTAKATSGE
                     EWVGILQGPLPQESGIKRFSEALFVVEGENNGNNVTGSGKFQKCTYDLQAENIQLDMY
                     YGGTTWIASIRGKPYWEYEKGGFFEIYTCSNVAPEYCKFDILVPGSASR"
     gene            complement(525546..526286)
                     /locus_tag="YPTB_RS02550"
                     /old_locus_tag="YPTB0443"
     CDS             complement(525546..526286)
                     /locus_tag="YPTB_RS02550"
                     /old_locus_tag="YPTB0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002396228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein LysM"
                     /protein_id="WP_002210158.1"
                     /db_xref="GI:488138950"
                     /translation="MGRIAPRRRKNNRVYQPLLHSWLTIRQKVLPDAKNTDEQNLISE
                     INAPEQRVDPDNVTEPALAPTQRKGVQSIKELWLKIWHLPDSFQWMEPLPFFHRRGVI
                     IATTVLLLALLWPASRDNTDLSFPVSAPSTSVPLQAQLQDNNDVPVPPKVSPSETTQG
                     NWQSYQVQTGKTLAQLFRDNNLPVNDVFAMAQVEGSDKPLSNLKAGQEVKIMLDAQGA
                     VTALAIETPENTEVLFSRQNDGSYRREH"
     gene            526650..527270
                     /locus_tag="YPTB_RS02555"
                     /old_locus_tag="YPTB0444"
     CDS             526650..527270
                     /locus_tag="YPTB_RS02555"
                     /old_locus_tag="YPTB0444"
                     /EC_number="5.2.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191620.1"
                     /note="FKBP-type; rotamase; catalyzes the cis-trans
                     isomerization of proline imidic peptide bonds in
                     oligopeptides; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_011191620.1"
                     /db_xref="GI:499504980"
                     /translation="MTTPSFDSVEAQASYGIGLQIGQQLQESGLQGLLPEALLAGLRD
                     AMEGNTPTVPVDVIHRALQEVHEKADKVRVERQQALVDEGKTFLEENAKRDDVTTTES
                     GLQFSVLQAGDGPIPSRQDRVRVHYTGRLVDGTVFDSSVERGQPADFPVSGVIPGWIE
                     ALSMMPVGSKWKLYIPHNLAYGERGAGATIPPFSALMFEVELLEIL"
     gene            complement(527368..528033)
                     /locus_tag="YPTB_RS02560"
                     /old_locus_tag="YPTB0445"
     CDS             complement(527368..528033)
                     /locus_tag="YPTB_RS02560"
                     /old_locus_tag="YPTB0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66F95.1"
                     /note="Involved in anaerobic NO protection and iron
                     metabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster repair protein YtfE"
                     /protein_id="WP_011191621.1"
                     /db_xref="GI:499504981"
                     /translation="MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKL
                     NLDIDALEAQLSALQTEPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKV
                     ERVHGDKPTCPRGLAAELSAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAE
                     HDAVGQQLDVVKQLTQNVTPPEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRAL
                     RGE"
     gene            complement(528162..530132)
                     /gene="cpdB"
                     /locus_tag="YPTB_RS02565"
                     /old_locus_tag="YPTB0446"
     CDS             complement(528162..530132)
                     /gene="cpdB"
                     /locus_tag="YPTB_RS02565"
                     /old_locus_tag="YPTB0446"
                     /EC_number="3.1.3.6"
                     /EC_number="3.1.4.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191622.1"
                     /note="periplasmic enzyme; functions during ribonucleic
                     acid degradation; 2',3'-cyclic nucleotides are first
                     converted to 3'-nucleotide and then cleaved to yield a
                     ribonucleotide and a phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-nucleotidase"
                     /protein_id="WP_011191622.1"
                     /db_xref="GI:499504982"
                     /translation="MEKAMFKRPLTLSLLASLIAVATSLSAATVDLRVLETTDLHSNM
                     MDFDYYKDKPTEKFGLVRTASLIIAARQQATNSVLVDNGDVIQGSPLGDYIAAKGLND
                     GEIHPVYKAMNTLDYAVGNIGNHEFNYGLDYLKKSLAGAKFPYVNANVIDVKTGKPLF
                     QPYLIIDTPVKDRDGKSHNLRIGYIGFVPPQVMIWDKANLSGKVTVNDITETAKKWVP
                     EMREQGADLVVAIPHSGLSSDPYKTMAENSVYYLSQVPGIDTIMFGHAHGVFPSKDFA
                     AIKGADITQGTLNGIPAVMPGQWGDHLGVVDFVLNNDQGKWQVIDAKAEARPIYDKTA
                     QKSLAAENAKLVEVLAVDHQSTRDFVSQPIGEASDNMYSYLALIQDDPTVQIVNNAQR
                     AYTEHFIQGDPDLADLPVLSAAAPFKAGGRKNDPTSFVEVEKGKLTFRNAADLYLYPN
                     TLVVVKASGAEVKQWLECSAAQFNQTDINSSKPQSLINWDGFRTYNFDVIDGVEYEID
                     VSQPARYDGECTLINDQAERIKNLTFNGKPIDPKATFLIATNNYRAYSGKFAGTGDSH
                     IAFASPDENRAVLSAYISAETKKKGQVIPQADNNWRLATLDSKQPLDVRFETSPTAKA
                     ADFIKQKAQYPMKVQGTDEVGFAVYQIDLQRK"
     gene            530584..531324
                     /locus_tag="YPTB_RS02570"
                     /old_locus_tag="YPTB0447"
     CDS             530584..531324
                     /locus_tag="YPTB_RS02570"
                     /old_locus_tag="YPTB0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002220539.1"
                     /note="catalyzes the formation of AMP from
                     adenosine-3',5'-bisphosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine-3'(2'),5'-bisphosphate nucleotidase"
                     /protein_id="WP_032466061.1"
                     /db_xref="GI:694125466"
                     /translation="MLEQIGQLAREAGVAIMAVYQGDKPLDIAHKKDDSPVTAADLAA
                     HQIIKAGLARLTPDIPLLSEEDPPAWDVRQHWQRYWLVDPLDGTKEFLNRNGEFTVNI
                     ALIDQGEPVLGVVYVPVTEVMYSAANGQAWKEECGRRMQIQVRDALPPLVVVSRSHSD
                     AELEDYLSQLGEHQTISVGSSLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGA
                     QVHDWQGKTLSYTPRESFLNPGFRVSLF"
     gene            complement(531327..531890)
                     /locus_tag="YPTB_RS02575"
                     /old_locus_tag="YPTB0448"
     CDS             complement(531327..531890)
                     /locus_tag="YPTB_RS02575"
                     /old_locus_tag="YPTB0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002223134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002210162.1"
                     /db_xref="GI:488138954"
                     /translation="MIKNSLLIISLIFTPLLVSAHNIQDNQRVPPVGVRDKGELDYDK
                     TTNQFNYKNWNSSQLPGKTRVIQHIAGRTSAKEMNAPLIDAIKQANLPRERYQTTTIV
                     NTDDAIIGTAMFVRNSIESSKREFPWSQFIIDSKGNVAKAWGLTEKSSAIVVLDPQGN
                     VKFVKDGALTSAEVQQVIDQLHQLVQQ"
     gene            532226..532438
                     /locus_tag="YPTB_RS02580"
                     /old_locus_tag="YPTB0449"
     CDS             532226..532438
                     /locus_tag="YPTB_RS02580"
                     /old_locus_tag="YPTB0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002210163.1"
                     /db_xref="GI:488138955"
                     /translation="MRIFQRYNPAKVAMYVKTLFRGRLYIKDMGAFEFDNGKILVPKV
                     KDKRHFEVMAEVNRQVLRLQADTLLT"
     gene            complement(532546..533877)
                     /locus_tag="YPTB_RS02585"
                     /old_locus_tag="YPTB0450"
     CDS             complement(532546..533877)
                     /locus_tag="YPTB_RS02585"
                     /old_locus_tag="YPTB0450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012230150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002210164.1"
                     /db_xref="GI:488138956"
                     /translation="MLNSILLILFLIAVSAFFSLSEISLAASRKIKLKLLADEGDTNA
                     LRVLKLQETPGMFFTVVQIGLNAVAILGGIVGDAAFSPSFKLVFERFMAPELADQASF
                     VCSFVLVTSLFILFADLTPKRIGMISPEAVAVRIVNPMRFCLMIFRPLVWFFNGMANL
                     IFRLFKLPMVRNDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTS
                     RENVIYFDLRESEDSIKDKISTHPHSKFLVCDGHIDQVVGYVDSKDLLNRVLGNQSLV
                     LSSGVQIRSALIVPDTLTLSEALESFKTAGEDFAVILNEYALVVGIITLNDVMTTLMG
                     DLVGQGQEEQIVARDENSWLIEGGTPIEDVMRVLHIDDFPQSGNYETIGGFMMYMLRK
                     IPKRTDFVKYAGYKFEVVDIDSYKIDQLLVTRLSDQPAPILPKAPHESSDA"
     gene            complement(534155..534793)
                     /locus_tag="YPTB_RS02590"
                     /old_locus_tag="YPTB0451"
     CDS             complement(534155..534793)
                     /locus_tag="YPTB_RS02590"
                     /old_locus_tag="YPTB0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZB94.1"
                     /note="this stereospecific enzymes reduces the S isomer of
                     methionine sulfoxide while MsrB reduces the R form;
                     provides protection against oxidative stress; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide methionine sulfoxide reductase MsrA"
                     /protein_id="WP_002210165.1"
                     /db_xref="GI:488138957"
                     /translation="MQNVDNTAVIDAANALPGRLTSIPVSPLHAVHGHSMTYIPEGMD
                     LAFFAMGCFWGAERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFD
                     PAVISYQQLLQIFWENHDPAQGMRQGGDVGTQYRSAIYVLTPEQEEQAHKSRERFQQA
                     MEKAGDQRVITSEITVALPFYYAEDDHQQYLHKNPHGYCGLGGIGVCLPPNV"
     gene            535068..536804
                     /locus_tag="YPTB_RS02595"
                     /old_locus_tag="YPTB0452"
     CDS             535068..536804
                     /locus_tag="YPTB_RS02595"
                     /old_locus_tag="YPTB0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191624.1"
                     /db_xref="GI:499504984"
                     /translation="MLRYPILCFMCLLLATPIAYAANVRLQVEGLSGDLERNVRARLS
                     TIGTDEVTADGRFRSRVDEAIRQGLRALGYYDPTITFELQNRPAPARSVLIAKVVPGE
                     PVLIAGVDIVLQGGAKTDPDYQALVRRDTPKIGSVLNHGDFDNFTSSLTGLALRRGYF
                     DANMIKSQLGVAAQLHEAFWDIDFDSGQRYRFGKVIFQGSQIREDYLQNLVPFHEGEF
                     YTSDELAELNRRLAATNWFNSVVVSPDFQDAKESKILPLDAVVTPRTENTVELGGGYA
                     TDVGPRLTASWRKPWMNSFGHSLTTTTALSAPEQTLDFSYRIPLLRNPLEQYYLIQGG
                     FRRTDLNDTNSDTTTLNVARFWDLSSGWQRAINLRWSLDHFTQGRVTDTTMLLYPGVS
                     INRTRQRGGAMPVWGDSQRYSIDVSDTTWGSDVDFGIFQAQNVWIRTLGEKNRFVARG
                     NVGWIETNNFDRVPPSLRFFAGGDRSIRGYKFRNISPRDSDGKLTGASKLATGSLEYQ
                     YNFTGRWWGAVFVDSGEAVNNFSKSDLKTGAGVGVRWASPVGPIKLDIAAPIGDNETH
                     GVQFYIGLGPEL"
     gene            536801..540739
                     /locus_tag="YPTB_RS02600"
                     /old_locus_tag="YPTB0453"
     CDS             536801..540739
                     /locus_tag="YPTB_RS02600"
                     /old_locus_tag="YPTB0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191625.1"
                     /db_xref="GI:499504985"
                     /translation="MKWVKRLSIAFLLIILLLVGALGGLLGTTSGLHFLINSAARWVP
                     GLDIASVSGGWRGLTLTGIQYQMPGVTVKAGQFYLSLQLSCLKNSELCVNALTAQNID
                     VVVNTQAMPPTSSTPASTDPMGELSTPYPIFLRLLSLNNVKVTIDDTAISLDEFRTGA
                     HWKQRSLALMPTKINGLLIALPKTVSAGVPDAVKPAVETAMAAKEAVAQLSAAPGRSA
                     TASGQSTTASGRSATASGQSATASGQSATTGGQLATVPAEPATPLGESLKALFAKPLL
                     PALPDFRLPLDLQIEEISGQQLRLTGDNEVLISSLLLQASTQDQRITLDTLEIKSPQG
                     GLSAQGQATLADKWPLDLVVNSALNIDSLKGEKVKLTVGGALREELKVTLNLSGPVSA
                     QLETETSLAKAGLPLSLTLQSKQLRWPLTGEPQYQMNNLRMRLNGQATDYALSIRSDI
                     KGTDLPPAVFTLEGKGNVEQFNLTRLRLAALQGHTDLTGVVDWRQAISWNSVLTLSGI
                     NTAKQWPEWPAKLEGKIVTRGSIHGGSWQLQVPELVLDGNVKQNRVTARGSLTGNAAG
                     QWHIPGINLALGRNKLDMKGELNDNWLLDANVDAPQLDGALPGLGGVVKGSLKLRGNL
                     KTPQLLADLTANRLQWQELHINRIKVDGDVRSTDQIQGQLAVRVEQLKQADFVVSLLT
                     LDARGSEKQHQLRLNMQGDPVSGQLSLEGSFDKQQQRWRGTLNNTRFDTPVGEWRLSR
                     AMTLDYQNSAQRITIGPHCWLNPNAELCAPRPIEAGPSGQASVVLNRFDLAMIKPFLG
                     PDTTMNGVFTGRAEVSWKEGGKLPDVRVSLSGNGVKVQQMVQGSPLPIAFETLNLNGG
                     LANGQVRADWLVKLVNNGQFSGQVQVADPEGRRNLSGNVAISNLSLAMINPILSDGEK
                     AAGILNANLRLAGNAKSPLVYGRLALDKVDIDGSWMPFDITEGRLAMNFDGMTSTLEG
                     LIRTSQGQLNLSGDADWRDISAWHARVAAKGNKLRVTIPPTARVDVSPDIVFEATPQL
                     FTLNGSVDIPWARITVQEVPETAVGVSSNEVMLNDQLQPIAPQSASIPISSNLVIRIG
                     NDVRLNAFGLKARLQGDLRMMQDQRGLGLNGQINIPSGSFRAYGQDLIVNKGILLFSG
                     PPDQPLLNIEAIRNPDSTANGVIAGVRVTGMADSPRMEVFSDPAMSQQEALSYLLRGQ
                     GLGNSGADSSMMTSMLIGMGVAQSGKLVGKIGEAFGVSNLALDTQGVGDSSQVVVSGY
                     VTKDLQIKYGVGIFDSLATLTLRYRLMPRLYLEAVSGIDQALDLLYQFEF"
     gene            540742..541098
                     /locus_tag="YPTB_RS02605"
                     /old_locus_tag="YPTB0454"
     CDS             540742..541098
                     /locus_tag="YPTB_RS02605"
                     /old_locus_tag="YPTB0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002210168.1"
                     /db_xref="GI:488138960"
                     /translation="MRIIVYGSLRRKQGNSHWMTDAQLLGEHDLEGYEMYNLGHYPAV
                     IPGDGTVHCEVYRINSSIMNELDELKSNTKDYRRELIKTPYGSAWIYLYRLPTEGLPR
                     IYSGDWLKRHEEIDKP"
     gene            complement(541216..541743)
                     /locus_tag="YPTB_RS02610"
                     /old_locus_tag="YPTB0455"
     CDS             complement(541216..541743)
                     /locus_tag="YPTB_RS02610"
                     /old_locus_tag="YPTB0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004905951.1"
                     /note="catalyzes the hydrolysis of pyrophosphate to
                     phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="WP_002210169.1"
                     /db_xref="GI:488138961"
                     /translation="MSLNQVPAGKDLPEDIYVVIEIPANADPIKYEIDKETGSLFVDR
                     FMSTAMFYPCNYGYINNTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGE
                     DAKLVAVPHSKLTKEYDHVKDVQDLPELLKAQIKHFFEHYKDLETGKWVKVDGWEDAA
                     AAKAEILSSFERAKK"
     gene            complement(541943..542956)
                     /locus_tag="YPTB_RS02615"
                     /old_locus_tag="YPTB0456"
     CDS             complement(541943..542956)
                     /locus_tag="YPTB_RS02615"
                     /old_locus_tag="YPTB0456"
                     /EC_number="3.1.3.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JIU6.1"
                     /note="catalyzes the formation of D-fructose 6-phosphate
                     from fructose-1,6-bisphosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose 1,6-bisphosphatase"
                     /protein_id="WP_011191626.1"
                     /db_xref="GI:499504986"
                     /translation="MKTLGEFIVEKQLDFSHATGELTALLSAIKLGAKIIHRDINKAG
                     LVDILGASGVSNIQGEDQMKLDLFANEKLKAALKARGEVAGIASEEEDDIVIFDGGRA
                     ENAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPFGTPITEEDFLQPGTKQVAAGY
                     VVYGSSTMLVYTTGYGVHAFTYDPSLGVFCLSHEKVRYPATGCMYSINEGNYIKFPLG
                     VKKYIKYCQEQDEATKRPYTSRYIGSLVADFHRNLLKGGIYIYPSTASHPQGKLRLLY
                     ECNPMAFLAEQAGGKATDGVNRILDIVPEKLHQRAPFFVGTKSMVEDAEGFIAKFPDE
                     EAK"
     gene            543127..544512
                     /locus_tag="YPTB_RS02620"
                     /old_locus_tag="YPTB0457"
     CDS             543127..544512
                     /locus_tag="YPTB_RS02620"
                     /old_locus_tag="YPTB0457"
                     /EC_number="6.3.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191627.1"
                     /note="ligates
                     L-alanyl-gamma-D-glutamyl-meso-diaminopimelate to
                     UDP-N-acetylmuramic acid for reincorporation into
                     peptidoglycan; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="WP_011191627.1"
                     /db_xref="GI:499504987"
                     /translation="MRIHILGICGTFMGGLAMLARSLGHEVTGADANVYPPMSTLLEN
                     QGIDLIQGYDPAQLNPIPDLVIIGNAMTRGNPCVEAVLEQGIPYVSGPQWLHDHVLPE
                     RWVLAVAGTHGKTTTAGMLAWILEACGYEPGFVIGGVPGNFDVSARLGNSPFFVIEAD
                     EYDCAFFDKRSKFVHYSPRTLIMNNLEFDHADIFDDIKAIQKQFHHLVRLVPGKGKII
                     LPDNDNHLKQVMAMGCWSEQELVGETGSWFARKVSTDASVYEVLLDNNVVGEVNWSLV
                     GEHNMHNGLMAIAAARHVGVLPADACRALGDFINASRRLELRGEAHGVTVYDDFAHHP
                     TAILATLAALRSKVGGTARILAVLEPRSNTMKLGLCKNELAPSLGRADEVFLFQPQHI
                     PWQVVEVAEACIQPAYWSADIDQLVDMIVKTAQPGDHILVMSNGGFGGIHDKLLSALD
                     KKAEQATALLD"
     gene            544599..544805
                     /locus_tag="YPTB_RS02625"
     CDS             544599..544805
                     /locus_tag="YPTB_RS02625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002217708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002217708.1"
                     /db_xref="GI:488146500"
                     /translation="MLMGHCRLLTNPDDAILNGEDRQRSKASAPRMARLEPTWMYLRR
                     LYDLPVLSVAGTLSITSLAVIIYT"
     gene            complement(544808..545071)
                     /locus_tag="YPTB_RS02630"
                     /old_locus_tag="YPTB0458"
     CDS             complement(544808..545071)
                     /locus_tag="YPTB_RS02630"
                     /old_locus_tag="YPTB0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002210172.1"
                     /db_xref="GI:488138964"
                     /translation="MNIKTTVATMSILSALSFGVFAADSINENQATQLQPMGTITVSG
                     LNGAPSDIRQALSDKADTVGAKAYKVIEVRSENNWHATANIYK"
     gene            complement(545460..545930)
                     /locus_tag="YPTB_RS02635"
                     /old_locus_tag="YPTB0459"
     CDS             complement(545460..545930)
                     /locus_tag="YPTB_RS02635"
                     /old_locus_tag="YPTB0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZBA2.1"
                     /note="regulates arginine biosynthesis when complexed with
                     arginine by binding at site that overlap the promotors of
                     the arginine biosynthesis genes; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine repressor"
                     /protein_id="WP_002210173.1"
                     /db_xref="GI:488138965"
                     /translation="MRNPAKQEDLIKAFKALLKEEKFSSQGEIVLALQEEGFENINQS
                     KVSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDVDYNDSVVVINTSP
                     GAAQLIARLLDSLGKAEGILGSIAGDDTIFTTPARGFTVKQLHEAILRLFEQEL"
     gene            546394..547332
                     /locus_tag="YPTB_RS02640"
                     /old_locus_tag="YPTB0460"
     CDS             546394..547332
                     /locus_tag="YPTB_RS02640"
                     /old_locus_tag="YPTB0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P61892.1"
                     /note="oxidizes malate to oxaloacetate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_002210174.1"
                     /db_xref="GI:488138966"
                     /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSDLSLYDIAPVTPGVAV
                     DLSHIPTAVNIKGFSGEDATPALQGADIVLISAGVARKPGMDRSDLFNVNAGIVRNLV
                     EQIARTCPNALIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGITTLDTIRSNTFVAE
                     LKGKQPQDIEVPVIGGHSGVTILPLLSQIPGVSFTEQEVADLTKRIQNAGTEVVEAKA
                     GGGSATLSMGQAAARFGLSLVRALQGESNVVECSYVEGDGKYARFFAQPILLGKNGVA
                     ERKDIGKLSAFEQQALENMLDVLHKDIELGEKFVNQ"
     gene            complement(547766..548041)
                     /locus_tag="YPTB_RS02645"
                     /old_locus_tag="YPTB0461"
     CDS             complement(547766..548041)
                     /locus_tag="YPTB_RS02645"
                     /old_locus_tag="YPTB0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_002210175.1"
                     /db_xref="GI:488138967"
                     /translation="MILRKSDWHPADIIAALRKKGTTLAALSRKAGLSSSTLANALTR
                     PWPKGEWLIAECLDIHPSEIWPTRYFDPKTGNLLDRKVRIRPTTTQP"
     gene            548225..548572
                     /locus_tag="YPTB_RS02650"
                     /old_locus_tag="YPTB0462"
     CDS             548225..548572
                     /locus_tag="YPTB_RS02650"
                     /old_locus_tag="YPTB0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_002210176.1"
                     /db_xref="GI:488138968"
                     /translation="MKKEWFAAKELAGLEGLPSSPQGINLMAKREGWEQRRRRGVQGK
                     AVEYHIGSLPITILNSLQLREEPAQYATTRQDPLTLWVEAYYRFTEAEREQVISFIFR
                     EGAKSLIERLEMD"
     gene            complement(548669..549640)
                     /locus_tag="YPTB_RS02655"
                     /old_locus_tag="YPTB0463"
     CDS             complement(548669..549640)
                     /locus_tag="YPTB_RS02655"
                     /old_locus_tag="YPTB0463"
                     /EC_number="2.5.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octaprenyl diphosphate synthase"
                     /protein_id="WP_011191628.1"
                     /db_xref="GI:499504988"
                     /translation="MNLEKIIELTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGG
                     KRIRPMIAVLVARALNYQGSKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAA
                     FGNAASVLVGDYIYTRSFQMMTGLQSMRVLTLMSEATNVIAEGEVLQLMNCNNPDITE
                     ESYMQVIYSKTARLFEAAAQSAAILSDASEEQELALQNYGRYLGTAFQLIDDLLDYSA
                     EGSTLGKNTGDDLNEGKPTLPLLHAMHNGTPEQAAMIRQAIEQGNGRHLLEPVLAAME
                     HCGSLVYTRQRAEEEADKAIAALHALPESDYRLALEGLAHISVHRRF"
     gene            549900..550211
                     /gene="rplU"
                     /locus_tag="YPTB_RS02660"
                     /old_locus_tag="YPTB0464"
     CDS             549900..550211
                     /gene="rplU"
                     /locus_tag="YPTB_RS02660"
                     /old_locus_tag="YPTB0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013024339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="WP_002210178.1"
                     /db_xref="GI:488138970"
                     /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMIANG
                     EEINIGAPLVDGGKIKAEIIAHGRGEKIKIVKFRRRKHYRKQQGHRQWFTDVKITGIS
                     A"
     gene            550231..550488
                     /gene="rpmA"
                     /locus_tag="YPTB_RS02665"
                     /old_locus_tag="YPTB0465"
     CDS             550231..550488
                     /gene="rpmA"
                     /locus_tag="YPTB_RS02665"
                     /old_locus_tag="YPTB0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A8G8Z2.1"
                     /note="involved in the peptidyltransferase reaction during
                     translation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="WP_002210179.1"
                     /db_xref="GI:488138971"
                     /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGEAVLAGSIIVRQRGTK
                     FHAGINVGCGKDHTLFALADGKVKFEVKGPKNRKFISIEAE"
     gene            550576..551562
                     /locus_tag="YPTB_RS02670"
                     /old_locus_tag="YPTB0466"
     CDS             550576..551562
                     /locus_tag="YPTB_RS02670"
                     /old_locus_tag="YPTB0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002210180.1"
                     /db_xref="GI:488138972"
                     /translation="MDTKQQAGLGIFLALTTAVFWGALPIAMKQVLEVMEPFTIVWYR
                     FMMAAIGLGIILASRRQLPSLKLFRQRRWLALLIIATCGLLGNFIFFSSSLQYLSPTT
                     SQVIGQLSPVGMMVASVLVLKERMRITQVIGAGMLICGLLLFFNTSLHEIFTRLTDYT
                     LGVALGVCAAVVWVSYGVAQKVLLRRMASQQILLLLYTLCAIALFPLAKPAVIFQLSG
                     WQFACLLFCGVNTLVGYGALAEAMARWQAAQVSALITLTPLFTLFFSILLALAWPDMF
                     AAPSLNLVGYAGAFVVVAGAMFSAIGHRWWPRRTEINLVALQKQPVNDLRRK"
     gene            551563..552735
                     /gene="obgE"
                     /locus_tag="YPTB_RS02675"
                     /old_locus_tag="YPTB0467"
                     /gene_synonym="cgtA; obg; yhbZ"
     CDS             551563..552735
                     /gene="obgE"
                     /locus_tag="YPTB_RS02675"
                     /old_locus_tag="YPTB0467"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66F73.1"
                     /note="ObgE; essential GTPase; exhibits high exchange rate
                     for GTP/GDP; associates with 50S ribosomal subunit;
                     involved in regulation of chromosomal replication; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase Obg"
                     /protein_id="WP_002210181.1"
                     /db_xref="GI:488138973"
                     /translation="MKFVDEAAILVVAGDGGNGCVSFRREKYIPNGGPDGGDGGDGGD
                     IYLLADENLNTLIDYRFVKSFRAERGQNGQSRDCTGKRGKDITIKVPVGTRVLDQGTG
                     EIVGDMVRHGQRLMVAKGGFHGLGNSRFKSSVNRAPRQKTMGTEGETRELMLELLLLA
                     DVGMLGLPNAGKSTFIRAVSAAKPKVADYPFTTLIPSLGVVRMDYEQSFVIADIPGLI
                     EGASDGAGLGIRFLKHLERCRVLLHLVDLAPIDESDPAENAKVIVNELQQYSENLAEK
                     PRWLVFNKIDLIDPEEAEKRAKAIVETLGWEGKYYMISAANRDNVNALCWDVMSFLNS
                     QPKAMAIAESVPEKVEFMWDDYHREQLAEVEAEAEDDWDDDWDEEDDDGVEIIYER"
     gene            complement(552830..553897)
                     /locus_tag="YPTB_RS02680"
                     /old_locus_tag="YPTB0468"
     CDS             complement(552830..553897)
                     /locus_tag="YPTB_RS02680"
                     /old_locus_tag="YPTB0468"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002227439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein BasS/PmrB"
                     /protein_id="WP_011191629.1"
                     /db_xref="GI:499504989"
                     /translation="MISMRRRLLLMLALILLVTQLISAFWLWHESQEQISFLVDETLS
                     AKARNEQVDKEIAEAIASLLAPSLIMMTITLLLSFWAISWIIRPLDQLQQKLAERSAD
                     NLSPLVVNSEMQEIVSVTSTLNQLLLRLSNTIQQERLFTADAAHELRTPLAGIRLHLE
                     LMEKQGIAESKSLINRIDLLMHTIEQLLMLSRAGQNFASGHYQTLDWVNDVVPPLQEE
                     LAEMCELRRQTIQWELPPHARMEGDATLLRLMLRNLVENAHRYSPVGSQIIVTLSTEN
                     QGVLLQVTDEGPGIKQNQAGELTQAFRRMDQRYGGSGLGLNIVIRIAQLHQGKLTLEN
                     RLDRTGLKAQCWLPATTYSQK"
     gene            complement(553894..554556)
                     /locus_tag="YPTB_RS02685"
                     /old_locus_tag="YPTB0469"
     CDS             complement(553894..554556)
                     /locus_tag="YPTB_RS02685"
                     /old_locus_tag="YPTB0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_002210183.1"
                     /db_xref="GI:488138975"
                     /translation="MKLLIVEDDELLQRGIAMALTSEGYVCDCAATAAEAHSLLQTSQ
                     YSMIILDLGLPDQDGTLLLRQWRRQHVTLPVLILTARDALEDRVDGLDAGADDYLVKP
                     FALAELLARVRALIRRYQGQSDNLVQQDDLSLNLSTQQVCLQGQPLEITPKEFAILSR
                     LIMRAGQTVNRELLQQDLYTWNDDLSSNTLEVHIHNLRRKLGKDRIRTVRGIGYRLEA
                     LS"
     gene            complement(554562..556010)
                     /locus_tag="YPTB_RS02690"
                     /old_locus_tag="YPTB0470"
     CDS             complement(554562..556010)
                     /locus_tag="YPTB_RS02690"
                     /old_locus_tag="YPTB0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004720377.1"
                     /note="penicillin binding protein 4; penicillin sensitive;
                     catalyzes the formation of D-alanine from
                     D-alanyl-D-alanine; one of four, DD-carboxypeptidase
                     low-molecular weight penicillin-binding proteins that
                     remove terminal D-alanine from pentapeptide side chains;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="WP_002217314.1"
                     /db_xref="GI:488146106"
                     /translation="MHFSRIVSGLACSIILNISVSNANAAQVENYTQYLPDGANLALM
                     VQKIGASTPAIDYHAQQMALPASTQKVLTALAALLQLGPDFRFNTTLESHGTITDGVL
                     RGNLIARFGGDPTLTRQQLRNMVATLRKAGVKQIAGDVVIDTSVFASHDKAPGWPWND
                     MTQCFSAPPAAAIVDRNCFSVSLYSAPNPGDTAFIRVASYYPVQMFSEVRTLAKGSPD
                     AQYCELDVVPGELNRFTLTGCLTQRSEPLPLAFAVQNGASYAGAILKDELKKADIQID
                     GNLRRQTIPSPAGNVLAQTQSAPLHDLLKIMLKKSDNMIADTVFRTIGHQRFGVPGTW
                     RSGADAVRQILRQKAGVDLGNSIVVDGSGLSRHNLISPATMMQVLQYIAQNDQELNFI
                     SMLPLAGYDGTLRYRGGLHEAGVNGKVSAKTGALQGVYNLAGFITTASGQRMAFVQFL
                     SGYAVPPEDQKNRRAPLVRFESRLYKDIYQNN"
     gene            556268..556744
                     /gene="greA"
                     /locus_tag="YPTB_RS02695"
                     /old_locus_tag="YPTB0471"
     CDS             556268..556744
                     /gene="greA"
                     /locus_tag="YPTB_RS02695"
                     /old_locus_tag="YPTB0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZBB3.1"
                     /note="necessary for efficient RNA polymerase
                     transcription elongation past template-encoded arresting
                     sites; arresting sites in DNA have the property of
                     trapping a certain fraction of elongating RNA polymerases
                     that pass through, resulting in locked ternary complexes.
                     Cleavage of the nascent transcript by cleavage factors
                     such as GreA or GreB allows the resumption of elongation
                     from the new 3'terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreA"
                     /protein_id="WP_002210184.1"
                     /db_xref="GI:488138976"
                     /translation="MKQIPMTVRGADKLREELDYLKGVRRPKIISDIADAREHGDLKE
                     NAEYHAAREQQGFCEGRIQEIEAKLSNAQVIDITKMPNNGRVIFGATVRVLNLNTEEE
                     QNYRIVGDDEADFKQNLISVNSPIARGLIGKEVDDVVVIHTPGGEVEYEILSVEYV"
     gene            complement(556872..557165)
                     /locus_tag="YPTB_RS02700"
                     /old_locus_tag="YPTB0472"
     CDS             complement(556872..557165)
                     /locus_tag="YPTB_RS02700"
                     /old_locus_tag="YPTB0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210185.1"
                     /note="RNA binding protein found associated to pre-50S
                     subunit of the ribosome; putative role in ribosome
                     assembly; necessary for optimal growth but not cell
                     viability; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_002210185.1"
                     /db_xref="GI:488138977"
                     /translation="MNLNNKQKQHLKSLAHPLKPVVMLGNNGLTEGVLAEIEQTLAHH
                     ELIKVKITAEERETKALIADAIVRETGAVNVQMIGNILVLYRPAKERKIILPR"
     gene            557312..557941
                     /gene="rrmJ"
                     /locus_tag="YPTB_RS02705"
                     /old_locus_tag="YPTB0473"
     CDS             557312..557941
                     /gene="rrmJ"
                     /locus_tag="YPTB_RS02705"
                     /old_locus_tag="YPTB0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005156285.1"
                     /note="Specifically methylates the uridine in position
                     2552 of 23S rRNA in the fully assembled 50S ribosomal
                     subunit; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA large subunit methyltransferase E"
                     /protein_id="WP_002228196.1"
                     /db_xref="GI:488156988"
                     /translation="MSNKKRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQ
                     SDKLFKQGMTVVDLGAAPGGWSQYAVTQIGSKGRVIACDLLPMDPIVGVDFLQGDFRD
                     ELVLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMYLVELALDMCRDVLAPGGS
                     FLVKVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVATGRKL"
     gene            557998..559932
                     /gene="hflB"
                     /locus_tag="YPTB_RS02710"
                     /old_locus_tag="YPTB0474"
                     /gene_synonym="ftsH"
     CDS             557998..559932
                     /gene="hflB"
                     /locus_tag="YPTB_RS02710"
                     /old_locus_tag="YPTB0474"
                     /gene_synonym="ftsH"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005186455.1"
                     /note="inner membrane metalloprotease; may be involved in
                     degradation of aberrant cytoplasmic and membrane proteins;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent metalloprotease"
                     /protein_id="WP_002228195.1"
                     /db_xref="GI:488156987"
                     /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNGRRVDYSTFMSDVTQD
                     QVREARINGREINVSKKDNSKYTTFIPVNDPKLLDTLLTKNVKVVGEPPEEQSLLASI
                     FISWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTSFADVAGCDEA
                     KEEVSELVDYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISG
                     SDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLN
                     QMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVH
                     MRRVPLDTDIDASVIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKI
                     MMGAERRSMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLP
                     EGDAISASRQKLESQISTLYGGRLAEEIIYGPEKVSTGASNDIKVATSIARNMVTQWG
                     FSEKLGPLLYAEEEGEIFLGRSVAKAKHMSDETARIIDQEVKLLVERNYQRARKLLLE
                     NMDVLHSMKDALMKYETIDAPQIDDLMNRKEVRPPAGWDNVTKNKSSDNDNTPTATMP
                     ADEPNTPTSGNTVSEQLGDK"
     gene            560052..560885
                     /gene="folP"
                     /locus_tag="YPTB_RS02715"
                     /old_locus_tag="YPTB0475"
     CDS             560052..560885
                     /gene="folP"
                     /locus_tag="YPTB_RS02715"
                     /old_locus_tag="YPTB0475"
                     /EC_number="2.5.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002360692.1"
                     /note="catalyzes the formation of dihydropteroate from
                     2-amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine
                     diphosphate and 4-aminobenzoate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="WP_011191630.1"
                     /db_xref="GI:499504990"
                     /translation="MHLTARGLTLDLSRPQVMGILNVTPDSFSDGGRHNNLDQALQHA
                     QRMLSAGATLIDIGGESTRPGAAEVSEQEELDRVVPVVEALAQRFDVWLSVDTSKAAV
                     ITESAHAGAHLINDIRSLQEPGALEAAAKTGLPVCLMHMQGQPKNMQHSPYYDDLMTD
                     INRFFQHHIERCVAAGIAKNKLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGM
                     SRKSMVGQLLNVPPQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSAK
                     G"
     gene            560895..562235
                     /gene="glmM"
                     /locus_tag="YPTB_RS02720"
                     /old_locus_tag="YPTB0476"
     CDS             560895..562235
                     /gene="glmM"
                     /locus_tag="YPTB_RS02720"
                     /old_locus_tag="YPTB0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004707057.1"
                     /note="catalyzes the conversion of glucosamine-6-phosphate
                     to glucosamine-1-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="WP_002210189.1"
                     /db_xref="GI:488138981"
                     /translation="MSNRKYFGTDGIRGKVGESPITPDFVLKLGWAAGKVLARHGSRK
                     IIIGKDTRISGYMLESALEAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISAS
                     HNPFYDNGIKFFSIDGTKLPDDVEEAIEAEMEKPLTCVESAELGKANRIVDAAGRYIE
                     FCKGTFPSELSLNELKIVVDCANGATYHIAPSVLRELGATVITIGCEPDGMNINEECG
                     ATDVRLLQERVLAEGAHVGLAFDGDGDRLMMVDHLGNKVDGDQILYIIAREGLRQGQL
                     KGGAVGTLMSNMGLQLALKDLGIPFVRAKVGDRYVLEAMQEKGWRIGAENSGHVILLD
                     KTTTGDGIVAGLQVLTAMVRNHMSLHDLCSGMKLLPQILVNVRFSGEHNPLKSDEVEE
                     VTRQVEKELGGRGRVLLRKSGTEPLIRVMVEGDAEESLIAEMANRIADAVKAAG"
     gene            562458..562793
                     /gene="secG"
                     /locus_tag="YPTB_RS02725"
                     /old_locus_tag="YPTB0477"
     CDS             562458..562793
                     /gene="secG"
                     /locus_tag="YPTB_RS02725"
                     /old_locus_tag="YPTB0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015670611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="WP_002210190.1"
                     /db_xref="GI:488138982"
                     /translation="MYEALLVFFLLISIGLVALIMLQQGKGADMGASFGAGASATLFG
                     SNGSGNFMTRMTAVLATLFFVISLILGNMSSNQGQKSSEWENLGQPLKTEQTATPVAP
                     VKPSSDIPQ"
     gene            562886..562972
                     /locus_tag="YPTB_RS02730"
                     /old_locus_tag="YPTB_RNA_19"
     tRNA            562886..562972
                     /locus_tag="YPTB_RS02730"
                     /old_locus_tag="YPTB_RNA_19"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:562920..562922,aa:Leu,seq:gag)
     gene            563033..563109
                     /locus_tag="YPTB_RS02735"
                     /old_locus_tag="YPTB_RNA_20"
     tRNA            563033..563109
                     /locus_tag="YPTB_RS02735"
                     /old_locus_tag="YPTB_RNA_20"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:563067..563069,aa:Met,seq:cat)
     gene            563325..563777
                     /locus_tag="YPTB_RS02740"
                     /old_locus_tag="YPTB0478"
     CDS             563325..563777
                     /locus_tag="YPTB_RS02740"
                     /old_locus_tag="YPTB0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004385061.1"
                     /note="required for the maturation of the 30S ribosomal
                     subunits; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation factor RimP"
                     /protein_id="WP_002222054.1"
                     /db_xref="GI:488150846"
                     /translation="MSTLEQKLTEIISAPVEALGYELVGIEFIRGRQSTLRIYIDSDD
                     GITVDACADVSHQVSAVLDVEDPITVAYNLEVSSPGLDRPMFTAEHYTRYLGEEVTLV
                     LRMAMQNRRKWQGIIKAVDGEMITVTVDGKDEVFALSNIQKANLVPHF"
     gene            563799..565286
                     /gene="nusA"
                     /locus_tag="YPTB_RS02745"
                     /old_locus_tag="YPTB0479"
     CDS             563799..565286
                     /gene="nusA"
                     /locus_tag="YPTB_RS02745"
                     /old_locus_tag="YPTB0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011055289.1"
                     /note="modifies transcription through interactions with
                     RNA polymerase affecting elongation, readthrough,
                     termination, and antitermination; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor NusA"
                     /protein_id="WP_002209253.1"
                     /db_xref="GI:488138045"
                     /translation="MNKEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIE
                     VRVSIDRKTGDFDTFRRWVAVDEVTMPTREITLDAAQFEDPSLQLGDYVEDQIESVTF
                     DRITTQTAKQVIVQKVREAERAMVVEQFRQYLGQIVTGIVKKVSRDSIALDLGHNAEA
                     VIGREDMLPRENFRPGDRIRGVLYDVRPEARGAQLFVSRSRSEMLVELFRIEVPEIGE
                     ELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLW
                     DDNPAQFVINAMAPADVASIVVDEDKHTMDVAVEASNLAQAIGRNGQNVRLAAQLSGW
                     ELNVMTADDLQAKHQAEAHAAIDTFTKYLDIDEDFATVLVEEGFSSLEELAYVPMKEL
                     LEIDGLDEDTVEALRDRAKAALTTLALAQEESFGDQKPADDLLNLAGLERSMAFKLAA
                     RGVCTLEDLAEQGIDDLADIEGLSDEQAGELIMAARNICWFGDNA"
     gene            565311..567989
                     /gene="infB"
                     /locus_tag="YPTB_RS02750"
                     /old_locus_tag="YPTB0480"
     CDS             565311..567989
                     /gene="infB"
                     /locus_tag="YPTB_RS02750"
                     /old_locus_tag="YPTB0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZBC2.2"
                     /note="Protects formylmethionyl-tRNA from spontaneous
                     hydrolysis and promotes its binding to the 30S ribosomal
                     subunits during initiation of protein synthesis. Also
                     involved in the hydrolysis of GTP during the formation of
                     the 70S ribosomal complex; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_002223151.1"
                     /db_xref="GI:488151943"
                     /translation="MTDVTVKSLAAEIQTPVDRLVQQFADAGIKKSDVDSVTQQEKEI
                     LLAHLNREHGSVPNKLTLQRKTRSTLNIPSTGGKSKSVQIEVRKKRTYVNTPEAEQAK
                     AEEQAQREAEEQAQREAEATAQKIAEEKAKREAEEQAKREAAEKAKRQAAEKEKVTNQ
                     QTDEKTKPAQTDKARREAEAAELKRSVEEETRRKVEEDAKRVAEEARKMAAENEGKWP
                     EPVAEQTESADYHVTTSQHARAAEDENDAKVEGDRRSRTRGGKATKQKKGNKLSESKA
                     DREEARAVGRKGKRKPSTLQQSFNKPVVAVNRDVVIGETVTVAELANKMAVKGSQVIK
                     AMMKLGAMATINQVIDQETAQLVAEEMGHKVILRRENELEEALMSDRDIGVEAAAEHR
                     APVVTIMGHVDHGKTSLLDYIRSTKVASGEAGGITQHIGAYHVETENGMITFLDTPGH
                     AAFTSMRARGAQATDIVVLVVAADDGVMPQTIEAIQHAKAANVPVVVAVNKIDKPEAD
                     PDRVKTELSQYGIQPEEWGGESQFINVSAKAGIGIDELLNAILLQAEVLELKAVRTGM
                     ANGVVIESFLDKGRGPVATVLVQQGTLNKGDIVLCGFEYGRVRAMRDELGRDITSAGP
                     SIPVEILGLSSVPAAGDEVTVVRDEKKAREVALYRQGKFREVKLARQQKSKLENMFAN
                     MTEGEVSELNIVIKSDVQGSCEAICDSLEKLSTDEVKVRIVGSGVGGITETDATLAAA
                     SGAIILGFNVRADASARRVVETEGLDLRYYSVIYSLIDEVKQAMSGMLAPEYKQQIIG
                     LAEVRDVFKSPKFGAIAGCMVTEGVIKRNNPIRVLRDNVVIYEGELESLRRFKDDVSE
                     VRNGMECGIGVKNYNDVRTGDVIEVFEIIEIKRTIA"
     gene            568055..568465
                     /gene="rbfA"
                     /locus_tag="YPTB_RS02755"
                     /old_locus_tag="YPTB0481"
     CDS             568055..568465
                     /gene="rbfA"
                     /locus_tag="YPTB_RS02755"
                     /old_locus_tag="YPTB0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JIX0.1"
                     /note="associates with free 30S ribosomal subunits;
                     essential for efficient processing of 16S rRNA; in
                     Escherichia coli rbfA is induced by cold shock; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="WP_002209255.1"
                     /db_xref="GI:488138047"
                     /translation="MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSR
                     DLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAY
                     DNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK"
     gene            568465..569439
                     /gene="truB"
                     /locus_tag="YPTB_RS02760"
                     /old_locus_tag="YPTB0482"
     CDS             568465..569439
                     /gene="truB"
                     /locus_tag="YPTB_RS02760"
                     /old_locus_tag="YPTB0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZBC4.1"
                     /note="catalyzes isomerization of specific uridines in RNA
                     to pseudouridine; responsible for residues in T loops of
                     many tRNAs; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="WP_002209256.1"
                     /db_xref="GI:488138048"
                     /translation="MGRPRRRGRDINGVLLLDKPLGLSSNDVLQKVKRLFSANRAGHT
                     GALDPLATGMLPICLGEATKFSQFLLDSDKRYRVVARLGQRTDTSDAEGALISEREVN
                     LTQAQIDTALESFRGESQQIPSMYSALKHQGKPLYEYARQGIEVEREARSITVYELLF
                     IRWEGNDLELEIHCSKGTYIRTIIDDLGELLGCGAHVSYLRRLQVATYPSERMVTLEQ
                     LTAMVEAAQAEGRSPNPELDSLLLPMDSAVLNFPEVNLLPSVAAYVKQGQPVHVSGAP
                     SEGMVRITEGKERNFIGIGTIAEDGRVAPKRLVVESVEVENLPVENKK"
     gene            569561..569830
                     /locus_tag="YPTB_RS02765"
                     /old_locus_tag="YPTB0483"
     CDS             569561..569830
                     /locus_tag="YPTB_RS02765"
                     /old_locus_tag="YPTB0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004933502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_002209257.1"
                     /db_xref="GI:488138049"
                     /translation="MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFS
                     EHKKDHHSRRGLLRMVSTRRKLLDYLKRQDVARYASLIERLGLRR"
     gene            complement(569847..570030)
                     /locus_tag="YPTB_RS00020"
     misc_RNA        complement(569847..570030)
                     /locus_tag="YPTB_RS00020"
                     /product="SraG RNA"
     gene            570094..572208
                     /locus_tag="YPTB_RS02770"
                     /old_locus_tag="YPTB0484"
     CDS             570094..572208
                     /locus_tag="YPTB_RS02770"
                     /old_locus_tag="YPTB0484"
                     /EC_number="2.7.7.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66F56.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="WP_011191631.1"
                     /db_xref="GI:499504991"
                     /translation="MLTPIIRKFQYGQHTVTIETGMMARQATAAVMVSMDDTAVFVTV
                     VGQKKAKPGQSFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLTSRLIDRPIRPL
                     FPDSFLNEVQVIATVVSVNPQINPDIVALIGASAALSLSGIPFNGPIGAARVGFINDQ
                     YVLNPTTDELKESRLDLVVAGTAGAVLMVESEADILSEEQMLGAVVFGHEQQQVVIEN
                     INALVAEAGKPKWDWQAEPVNEALHARVAELAEARLGDAYRITEKQERYTQVDAIKAD
                     VTEALLAQDDTLDAAEIQDILASVEKNVVRSRVLRGEPRIDGREKDMIRGLDVRTGIL
                     PRTHGSALFTRGETQALVTATLGTARDAQNIDELMGERTDSFLLHYNFPPYCVGETGM
                     VGSPKRREIGHGRLAKRGVLAVMPSASEFPYTIRVVSEITESNGSSSMASVCGASLAL
                     MDAGVPIKAAVAGIAMGLVKEGDNFVVLSDILGDEDHLGDMDFKVAGSRDGVTALQMD
                     IKIEGITREIMQVALNQAKGARLHILGVMEQAISTPRGDISEFAPRIYTMKINPEKIK
                     DVIGKGGSVIRALTDETGTTIEIEDDGTIKIAATDGDKAKHAIRRIEEITAEIEVGRI
                     YAGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQDVPVKVMEVDRQ
                     GRIRLSIKEATTPDAEAPEAAE"
     gene            572333..573217
                     /locus_tag="YPTB_RS02775"
                     /old_locus_tag="YPTB0485"
     CDS             572333..573217
                     /locus_tag="YPTB_RS02775"
                     /old_locus_tag="YPTB0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015670618.1"
                     /note="lipoprotein that appears to be involved in cell
                     division; interacts with the periplasmic protease Prc and
                     may be activated by protease processing; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein NlpI"
                     /protein_id="WP_002209260.1"
                     /db_xref="GI:488138052"
                     /translation="MKPFLRWCYVATALMLAGCSNHDWRKDEVLAIPLQPTLQQEVIL
                     ARMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYL
                     GIYLTQAGNFDAAYEAFDSVLELDPTYNYARLNRGIALYYGGRFPLAQDDLQAFYQDD
                     PNDPFRSLWLYLVEREIDPKAAVVALQQRYEKSDRGQWGWNIVEFYLGKISEKSLMER
                     LKADATDNTSLAEHLSETDFYLGKHYLSLGDKNTASVLFKLTVANNVHNFVEHRYALL
                     ELALLGQEQDDLSESDQQ"
     gene            573404..575398
                     /locus_tag="YPTB_RS02780"
                     /old_locus_tag="YPTB0486"
     CDS             573404..575398
                     /locus_tag="YPTB_RS02780"
                     /old_locus_tag="YPTB0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209261.1"
                     /note="participates in the assembly of the large subunit
                     of the ribosome; plays a key role in optimal cell growth
                     at low temperature and is required for normal cell
                     division; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box family ATP-dependent RNA helicase"
                     /protein_id="WP_002209261.1"
                     /db_xref="GI:488138053"
                     /translation="MTTELETSFADLGLSAPILSALTDLGYEKPSPIQLECIPHLLNG
                     RDVLGMAQTGSGKTAAFGLPLLHNIKADLKSPQVLVLAPTRELAVQVAEALSSFSKHI
                     NGVNVVALYGGQRYDVQLRALRQGPQVVVGTPGRLLDHLKRGTLNLSNLSGLVLDEAD
                     EMLRMGFIEDVETIMAQIPAEHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTR
                     PDISQSYWRVGGGYRKNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAA
                     LNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHR
                     IGRTGRAGRAGRALLFVENRERRLLQNIERTMKLTIPEVELPNADLLSERRLAKFAAK
                     VSQQLESSDLDMYRALLAKLQPEEEFDIETLAAALLKMAQGERPLILPPEAPRRPQRE
                     FNSRDDRGNDRGSRDRGDSRRDNRSDSRSADSRDGGERPARRERRDVGEMELYRIEVG
                     RDDGVEVRHIVGAIANEGDISSRYIGNIKLFASHSTIELPKGMPGEMLSHFTRTRILN
                     KPLNMQLLGDAQPHERRERPAGGNGGERRGGGRPFSGERREGAGAPPRRSFSGDRAPT
                     GGGERRGNRDGQRSAAPRRDDAAAPAAAAAAPARRRFGDA"
     gene            575418..575591
                     /locus_tag="YPTB_RS02785"
                     /old_locus_tag="YPTB0487"
     CDS             575418..575591
                     /locus_tag="YPTB_RS02785"
                     /old_locus_tag="YPTB0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002209262.1"
                     /db_xref="GI:488138054"
                     /translation="MIKRKNQPSGWFFYGYYLSLYHDYLLLIFYAHLLIKPNLFGLTA
                     MPIALDREMYLLT"
     gene            575634..576002
                     /locus_tag="YPTB_RS02790"
                     /old_locus_tag="YPTB0488"
     CDS             575634..576002
                     /locus_tag="YPTB_RS02790"
                     /old_locus_tag="YPTB0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002214818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002214818.1"
                     /db_xref="GI:488143610"
                     /translation="MGRDDQNHKRRKNFPIRLLGSARKELSDLDAINRAEFLVAIDVF
                     ELHGPGSGVPNVEKIGGDMYELKTHSRSHWLRGFYFHYVDGLYIVTHIFAKKTNKAPD
                     SSKALGLRRYKDFLRSQGEE"
     gene            576026..576337
                     /locus_tag="YPTB_RS02795"
                     /old_locus_tag="YPTB0489"
     CDS             576026..576337
                     /locus_tag="YPTB_RS02795"
                     /old_locus_tag="YPTB0489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002209263.1"
                     /db_xref="GI:488138055"
                     /translation="MKSDLTLHAWDEVRAELLQDEETARAYAIVMLRKALLNSLVAVR
                     KSKQLTQVDIAKRIGVSRQAISKFEKGESAPTLDTLIGYTAAMDIDFAANMKKIFTQT
                     F"
     gene            complement(576592..577647)
                     /locus_tag="YPTB_RS02800"
                     /old_locus_tag="YPTB0490"
     CDS             complement(576592..577647)
                     /locus_tag="YPTB_RS02800"
                     /old_locus_tag="YPTB0490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002214817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191632.1"
                     /db_xref="GI:499504992"
                     /translation="MDDSMIDNTGSVVDKNTVPLSVLDLSPIAQGKTARDAFHASLDL
                     AQHAEKWGYQRYWLAEHHNMTGIASAATSVLIGYIAGGTNKIRVGAGGVMLPNHSPLV
                     IAEQFGTLASLYPDRIDLGLGRAPGSDQRTMMALRRHLSGEVDNFPADVRELQNYFAE
                     VQPGQAVQAVPGQGLHVPLWLLGSSLYSAQLAAAMGLPFAFASHFAPDMLLQALSLYR
                     ENFTPSAQWPKPYAIVCVNVVAADSERDARFLFTSMQQQFVSLRRGTPGQLPPPVENM
                     AAICSPAEQFGVDQALRLSIVGDKSKVRHGLQSLLRETQADELMINGQIFDHQARLYS
                     FKTVASLQQDLMHTPRR"
     gene            578155..579315
                     /locus_tag="YPTB_RS02805"
                     /old_locus_tag="YPTB0491"
     CDS             578155..579315
                     /locus_tag="YPTB_RS02805"
                     /old_locus_tag="YPTB0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavine resistance protein E"
                     /protein_id="WP_002209266.1"
                     /db_xref="GI:488138058"
                     /translation="MHSKIILACLVFTLVACDQSSSPSATPSRQEVGVVTLKTQPVTL
                     SSDLSGRTVAAMTSEVRPQVDGIIKKRLFTEGSEVTAGQVLYQIDPASYQAAYDTAKA
                     ALQNVQVSVKSAKLKAQRYAALAKENGVSQQDADDAQTSYQQALANVAEKTAALETAR
                     INLAYTQVRAPISGRIGISSVTPGALVTANQTTALATIRNLDPIYVDLTQSSAQLLAL
                     RKQQQAGNDTVANAPVQLTLEDGSVYAHEGSLQLTEVAVDEATGAVTLRAKFPNPEHQ
                     LLPGMFVRASVRNGVNNTAILAPQQGITHDAKGNATALVVNQQQQVERREVVTERTID
                     SYWLISRGLAAGDRLIVEGTEKVSVGDDVKPVEVSTTLPVVAEPTTPSTGEK"
     gene            579319..582444
                     /locus_tag="YPTB_RS02810"
                     /old_locus_tag="YPTB0492"
     CDS             579319..582444
                     /locus_tag="YPTB_RS02810"
                     /old_locus_tag="YPTB0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter permease
                     subunit"
                     /protein_id="WP_011191633.1"
                     /db_xref="GI:499504993"
                     /translation="MFARFFIYRPVFAWVIAIVIMLGGVVALETLPIAQYPDVAPPSI
                     SIKATYTGASAETLENSVTQVIEQELTGLDGLLYFSSSSGSDGNAKIVATFKQGTNAD
                     TAQVQVQNKVQQALTRLPTEVQAQGVTVTKSQTNFLLIMSLYDEKDKHTGTDIADYLV
                     SNLQDPLARLEGVGSVQVFGSQYAMRIWLNPTKLAAYNLMPSDVQSAITAQNTQVSAG
                     KIGALPSGKEQQLTATVMAQSRLKTPEQFNNIIVKSDSTGAVVRLRDVARVELGNEDY
                     SVTTRLNGHPAAGIAVMLAPGANALATAERVKAKAAEFELNLPDGYKIAYPKDSTDFI
                     KVSVEEVVKTLIEAILLVVIVMYIFLQNIRATLIPAIAVPVVLLGTFGVLAIFGYSIN
                     TLTLFGMVLSIGLLVDDAIVVVENVERVMREDNLPPREATEKSMSEISSALIGIALVL
                     SAVFLPMAFFGGATGVIYRQFSITIVSAMALSVLVALTLTPALCATFLKPNHKPPSEH
                     GFFGGFNRRYDRMQTRYESLVGHVIHRSLRYLLIYAVLIGVMCVLFIRLPTGFLPTED
                     QGDVMVQYTLPAGATSGRTMEVSKAVENYFMTQEKDNTKAVFTISGFGFSGSGQNAGM
                     AFIALKHWRDRPGSENTATAIADRAMKALSSIRDAQIFSMTPPAVDGLGQSNGFTFEL
                     QATGDTSREQLLTLRDQLISKANKDPILASVRANTLQQMPQLQVDIDNDKVAALGLSI
                     SDVNATLSAAWGGTYINDFIDRGRVKKVYMQGDVDTRSKPEDLNQWFVRGSSDAMTSF
                     SAFATTRWIYGPETLSRYNGQTSYEIQGQAASGSSSGTAMDQMEKLAAELPGTSYAWS
                     GLSYQERLASGQALSLYAISILVVFLCLAALYESWSVPFSVMMVIPLGIIGAVAAATL
                     RGLENDIYFQVALLTTLGLASKNAILIVEFAEAAYLRGEPLVAAALQGAATRLRPILM
                     TSLAFIAGVMPLAMSTGAGANSRISIGSGIIGGTLTATVLAVFFVPLFFVLIRRVFSG
                     KSKNITEHKGV"
     gene            582446..583852
                     /locus_tag="YPTB_RS02815"
                     /old_locus_tag="YPTB0493"
     CDS             582446..583852
                     /locus_tag="YPTB_RS02815"
                     /old_locus_tag="YPTB0493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_011191634.1"
                     /db_xref="GI:499504994"
                     /translation="MFSRILILSLPALLAGCISLDPDYQRPVAPVPATLPYSTASSSK
                     AADIPWQETIIDPKLRQVIALALESNRDLRQAIADIEAARAQYGVQRAAQLPTVNAGV
                     NGSRGRGLSDTSDGNNNTAISQSYGAQASVSAFELDLFGKKSSLSHAEFETYLATEEA
                     AKTTRITLIADTATAWVTLAADQNQLLLAEETLKSAEQSLKLAQLRQKNGIASRIDVA
                     AMETLYQSARADVAQYKTTVAQDKNALDLLVGQPVAAHLLPVAASTLPEVIKAVPVGL
                     SSDVLLNRPDVLEAEHKLKSANANIGAARAAFFPSVTLTASGGVSSSALSTLLSEGAG
                     IWSLAPAITLPIFDGGANRAALEYSQAQKTGYIAAYEKAIQTAFKEVADALARKATIQ
                     EQRAAQQAYVAAAQESVELAQKRYKQGIDTYLNMLDAQRTLYAAQTRLIAVQQIQTNN
                     LITLYKVLGGGVSDVAKE"
     gene            complement(583993..584871)
                     /locus_tag="YPTB_RS02820"
                     /old_locus_tag="YPTB0494"
     CDS             complement(583993..584871)
                     /locus_tag="YPTB_RS02820"
                     /old_locus_tag="YPTB0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_002209269.1"
                     /db_xref="GI:488138061"
                     /translation="MKYALGAVLYYWPKTEIETFYHAAANSSADIIYLGENVCTKRRE
                     MKVGDWLALAKAVASSGKQVVISTLALLQAPSELNELKRYVENGEFLLEANDLGAVNM
                     AAERGLPFVAGHALNCYNAYTLRILHRQGMIRWCMPVELSRDWLSNVLQQCDALGFRH
                     QFEVEVLSYGHLPLAYSARCFTARSEDRAKDECETCCIKYPQGRKVMSQEDQQVFILN
                     GIQTQSGYCYNLGNDLISMQGLVDIIRLSPQGLETLSVIDQFRANEQGLSPLPVANKA
                     DCNGYWHRVAGLELVS"
     gene            complement(584883..585878)
                     /locus_tag="YPTB_RS02825"
                     /old_locus_tag="YPTB0495"
     CDS             complement(584883..585878)
                     /locus_tag="YPTB_RS02825"
                     /old_locus_tag="YPTB0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004720416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_011191635.1"
                     /db_xref="GI:499504995"
                     /translation="MELLCPAGNLPALKAAIDNGADAVYIGLKDDTNARHFAGLNFTD
                     KKLQEAVNYVHSRKRKLHIAINTFAHPDGYARWQRAVDMAAQLGADALILADLAMLEY
                     AAERYPQVERHVSVQASATNDEAIRFYQRHFDVARVVLPRVLSMHQVKQLSRTSPVPL
                     EVFAFGSLCIMAEGRCYLSSYLTGESPNTVGACSPARFVRWQQTPQGMESRLNDVLID
                     RYEDHENAGYPTLCKGRYRVDDQRYHALEEPTSLNTLELLPELFAANIASVKIEGRQR
                     SPAYVSQVAKVWRQAIDLYQANPAQFAAKAEWMEQLSAMSEGTQTTLGAYHRKWQ"
     gene            complement(585988..586113)
                     /locus_tag="YPTB_RS02830"
     CDS             complement(585988..586113)
                     /locus_tag="YPTB_RS02830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209271.1"
                     /db_xref="GI:488138063"
                     /translation="MLTYENGLYRQILHQNIFRCIAKYQKSVTNAKETALNQGAM"
     gene            586194..586715
                     /locus_tag="YPTB_RS02835"
                     /old_locus_tag="YPTB0496"
     CDS             586194..586715
                     /locus_tag="YPTB_RS02835"
                     /old_locus_tag="YPTB0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SCP-2 sterol transfer family protein"
                     /protein_id="WP_002209272.1"
                     /db_xref="GI:488138064"
                     /translation="MLGKLRAHLVRQGPALLRGPLKVTPFALQRQVLEHVLGWQFRQA
                     LLDGELAFLESRWLKIEVRDLALQWFVTVENGKLLVSQQADADVSFSGDANDLILIAA
                     RKEDPDTLFFQRRLRIEGDTELGLYVKNLMDAIDLESMPTLLRVGLQQLAEFIEAGQQ
                     EGAVATSRGLASC"
     gene            586709..587212
                     /locus_tag="YPTB_RS02840"
                     /old_locus_tag="YPTB0497"
     CDS             586709..587212
                     /locus_tag="YPTB_RS02840"
                     /old_locus_tag="YPTB0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_011191636.1"
                     /db_xref="GI:499504996"
                     /translation="MLIRVEIPVDAPGIDALLRRAFQQGDEAELVQQLREDGLLTLGI
                     VATDDEGVVIGYAAFSPVEVGGEDRQWVALAPLAVEEGLRRQGLGEKLVYEGLDALNE
                     FGYAAVVVLGAPAYYSRFGFVPAARHQLTCRWPGSEEAFQVYALAEDTLVNTKGEVVF
                     SAPFNRF"
     gene            complement(587307..587414)
                     /locus_tag="YPTB_RS02845"
     CDS             complement(587307..587414)
                     /locus_tag="YPTB_RS02845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_038400500.1"
                     /db_xref="GI:740614986"
                     /translation="MDNAIFSLVNEGLTAPRGTPVAYATTTPTARFPFN"
     gene            complement(587387..587674)
                     /locus_tag="YPTB_RS02850"
                     /old_locus_tag="YPTB0498"
     CDS             complement(587387..587674)
                     /locus_tag="YPTB_RS02850"
                     /old_locus_tag="YPTB0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66F42.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease"
                     /protein_id="WP_011191637.1"
                     /db_xref="GI:499504997"
                     /translation="MSDSLWHLYLLRTASGMLYTGITTDVARRLAQHQAGKGAKALRG
                     KGELTLVFHCEAGDRSTALKLEYRVKQLSKQQKEKLVIDQPRLLTTLFLAS"
     gene            complement(587902..589920)
                     /locus_tag="YPTB_RS02855"
                     /old_locus_tag="YPTB0499"
     CDS             complement(587902..589920)
                     /locus_tag="YPTB_RS02855"
                     /old_locus_tag="YPTB0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alginate lyase"
                     /protein_id="WP_011191638.1"
                     /db_xref="GI:499504998"
                     /translation="MKQFTDRQMVKIRQRVVKQPEIIATLIADNQVVLETDTLVPATG
                     IATWNHYYYCPEHGVQLVWDRFSPQAHRCPVDDHLFSGEPYDGAWWRALNGLNAKACN
                     QLGLLWQLTGEIRYFDKVRDILMSYARYYPDYEVHGGIPYNGPGKANAQTLCEANCLL
                     DFALGYDFIADTLSQEQRDCLAERLLRVGADFLMQHRTRQLHNHEVKISSAIAVIGLI
                     LEEEHYIEFAVNADYGLRYQLEHGLFNEGLWFEGSVHYHFYALQGFWSFEKLAAGSRY
                     SLLALPYYRDMLSFPLKLLMPNGTFPRINDCTAGQEQLNHAHLYEFAYQIYGNREYAA
                     ALQHIYRQQPRLNLDALLYGAESLPLQIIDVIPTDTLHAPDCGLTILRQPQASRALLI
                     KHSPYGGEHDHYDRLNLILFDRGHEVLPDLGTTGYGAQRHYDYYKNSATHNTLSINQK
                     NQPPAVPYIRQWHQAANFSWLDTEVDWRQTAPKLDSHIRIQWDEASYRDVKFRRRILW
                     LEDTIIDISNIVNPHQQSWNWTLYIDGTATEQKGEMTSFGDSGPMQYVHQVTAQPLNG
                     VIPCRYQTTARPLTLWLAADATLFQGLAPANPSVRDLSYLMLRNQQPAAQVTCVFDLN
                     DSNPLLHVEVETNGEILSIELIRQQQTMRINLPLTSNQLPQFSQAYPS"
     gene            complement(589944..591167)
                     /locus_tag="YPTB_RS02860"
                     /old_locus_tag="YPTB0500"
     CDS             complement(589944..591167)
                     /locus_tag="YPTB_RS02860"
                     /old_locus_tag="YPTB0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alginate lyase"
                     /protein_id="WP_012304649.1"
                     /db_xref="GI:501261631"
                     /translation="MMLNSGAKNLLLTILLGTSPFIYAAESHPLLLKMDDINYSIEQI
                     KQNNPLYEKSYKNLMAKADKALKKPLYSVMDKSLLAASGDKHDYYSFPPYWWPDPSKK
                     DGMPYLRKDGETNPAANSDATDKKRMNSFSEDVYYLALAYSFTGKPEYAQKAHEQLVN
                     WFVNPETKMNPNLQYAQAIPGINEGRGIGLIDSRALVDVIDAVELIRPANVLSDSDYQ
                     AIKSWYGDFYQWMTTSQNGFEEDNWHNNHGTYFDMQAASFALFSDQKAAAQKRLEITQ
                     LRRIPSHFDMQGRQNAELERTRPWHYSNFHLEAYNKLGRLGEVGEKDIWDFSLDEHSL
                     KKGYQYVAGFINTDQAWPYKDLDGVQDKKALVNMITAARAYPADVEFQQKAQYLIAKY
                     PDTVEILLYPITTQK"
     gene            591728..593041
                     /locus_tag="YPTB_RS02865"
                     /old_locus_tag="YPTB0501"
     CDS             591728..593041
                     /locus_tag="YPTB_RS02865"
                     /old_locus_tag="YPTB0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_011191640.1"
                     /db_xref="GI:499505000"
                     /translation="MKTQMIMSKVKIKSLLLLTYLAMGIPSLHAAETLQVWIRASNDS
                     KNIYKKEADTFEKKTGIKIEYFNATTDFEQRLARAAAGNALPDLIFNDAVAIGQFVQL
                     GIVEPIEPKNIIGGENIFDTAWKSTQYIDGKYYGVPTSAQTFALFVRKDWREKLGLEQ
                     PKNWQDISTLAKAFTFNDPDGNGKNDTYGFILPGSTTRGYASWFISSYLWQAGGDFIR
                     PAGEGKFIASLEEPAATETLSFMRGMVCDKTVQPGAINATTADAIPSFRSGQSGMFFS
                     GPYHIALFDKDPGTEAFEVIPPPTGPKGQATLAEGTTVFMMKSSQKKAAAQKFIEFMI
                     SPEGQQIGMGMGTKNMPVVRLSINKLVDTKAVYDDPRWAMFADLYAEQGRYIPQVPNW
                     TPIRQVTAEGFNRILANCDSDIAAELKAVNQKVNDELAKQNVLGQ"
     gene            593049..593933
                     /locus_tag="YPTB_RS02870"
                     /old_locus_tag="YPTB0502"
     CDS             593049..593933
                     /locus_tag="YPTB_RS02870"
                     /old_locus_tag="YPTB0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011815457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_011191641.1"
                     /db_xref="GI:499505001"
                     /translation="MITLTPRLKRNLVPWLFLAPALVIFTWFKFIPMLQGLVMSFYKV
                     NFNQPNEWVGFANFSRAFGDEALHSAVFNTLLYVLVTMVVAAFIAFFLAMLLEGPARH
                     LRFIRTAIFLPAVTSAAIVAEMWRILFNPTSNGVVNHVLSWFSIEAQGFLADTDQALW
                     TVMLLHIWKAVPYNMVIFIAGLVGISRDLYDASNVDGANWWNRLRYVTLPGMIPALSV
                     VLMLSFIRGFRVFAEVYATTGGGPSNATEMIMTHIYKLGFEQFDYGYASAVSFLLFAF
                     TVMLTMGHLTLKKRIARY"
     gene            593952..594791
                     /locus_tag="YPTB_RS02875"
                     /old_locus_tag="YPTB0503"
     CDS             593952..594791
                     /locus_tag="YPTB_RS02875"
                     /old_locus_tag="YPTB0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004707080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_002209279.1"
                     /db_xref="GI:488138071"
                     /translation="MKSKSWNSIGRWIIYGLLLIVFVGPYWGIIATAFSGAPVKPGEL
                     LAWPNQFSWDNFIFAWMDIGVWQYLLNSIIVVFFGTVLQVSVSALAAYALARKKFVGV
                     SLTSLIILSTMMLPEEVIAIPLYMIINWQLPVIDASLYNSYLGMILPIVGWAFSIFVL
                     TEFMAAIPKELEEAARIDGASEWQIFFHVILPLVKPALGTVVTFGFIMIWDQYLLPLI
                     VVNQDSLNTIPVILGTLRTDESITPNIFIAITLLAMLPSIIVYLGLQKHFNRGIMSGA
                     VKG"
     gene            594803..595897
                     /locus_tag="YPTB_RS02880"
                     /old_locus_tag="YPTB0504"
     CDS             594803..595897
                     /locus_tag="YPTB_RS02880"
                     /old_locus_tag="YPTB0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_002209280.1"
                     /db_xref="GI:488138072"
                     /translation="MGSVVLKNVCKSYGDIHVIRDVSLEIPDGEFCVLVGPSGCGKST
                     LLRMIAGLEEISGGTVGINDKDVTDVEPKMRDIAMVFQSYALYPQMTVRENMGFALKM
                     AKMSKADINQKVESTAELLGLQALLERLPKDLSGGQRQRVAMGRAIVRNPQVFLFDEP
                     LSNLDAKLRTQVRGEIRELHQRLKTTSVYVTHDQIEAMTMGQMIVVLREGRIEQVGSP
                     LDLYDRPANLFVAGFIGSPEINQLKGTVVQEGDKFLLQLEDNSLLALPTGLNVTEGQN
                     VVYAIRPEQVNVVDETHCASALKATITAIENTGSDMQLFCSTGGGRFTSVFKQRLAVS
                     EGETVYLQPKLAGIHIFDAATGLRVDCQAA"
     gene            595912..597078
                     /locus_tag="YPTB_RS02885"
                     /old_locus_tag="YPTB0505"
     CDS             595912..597078
                     /locus_tag="YPTB_RS02885"
                     /old_locus_tag="YPTB0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alginate lyase"
                     /protein_id="WP_002209281.1"
                     /db_xref="GI:488138073"
                     /translation="MTPIKTAVTAMKLYTLDVNCLIKAKAILQQPFSPLQPALRRLLS
                     EADILRDQSPESVTHKTLLPVSGDIHDYYSFGTYWWPNPRKPNGLPYVRRDGHTNPQS
                     QNDDTDTQRIARMCDRCLTLGLAYYFTGNSRYAQVAAEQIRCWFLDAKTRMNPHLNYG
                     QAIPGIVSGRGTGLIDTRMMWMVIDTLGLISPAKLLDTEDTAVLQQWFRDFNHWMFHS
                     EVGHSEYVWHNNHGTWYDVQRAANAMFYGDRGLVTTIIRQGITQRLAAQIAQDGKQWM
                     ELERTVPFHYSLFNMEAHLLLCRYGEHIEIDRWEWVQDGRNVQQGVDYLLPFIAEPEL
                     WPYRDLRGIDYDSALRLLLQAARGYPQDAKRYQAVLATFPAETLTSRDRLLWQS"
     gene            597207..597650
                     /locus_tag="YPTB_RS02890"
                     /old_locus_tag="YPTB0506"
     CDS             597207..597650
                     /locus_tag="YPTB_RS02890"
                     /old_locus_tag="YPTB0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZBE9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191642.1"
                     /db_xref="GI:499505002"
                     /translation="MNNPDDVLLINRFLRQQHVLTLCAGSGMDMWCASCFYVFDENQM
                     ALFLMTEKHTRHSELMLINPQVAGTVATQSRTIALIKGIQYRGDISLLSGDAEQAARN
                     RYCRRFPVAKVSSAPLWQLNLLEIKMTNNALGFGKKLHWSRVEPL"
     gene            597802..598440
                     /locus_tag="YPTB_RS02895"
                     /old_locus_tag="YPTB0507"
     CDS             597802..598440
                     /locus_tag="YPTB_RS02895"
                     /old_locus_tag="YPTB0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209283.1"
                     /db_xref="GI:488138075"
                     /translation="MAKVLLLGASGLVGGELLRLLRLDARVTSIIAPTRNPLPAMNKL
                     INPHGENIGQLLKMLHEPVDLVFCALGTTRKQAGSQAAFRQVDYRLVLLSGETGRRLG
                     ARHFLLVSALGANPDSWLFYNRTKGEAERDLQAQGWPQLTFARPSMLAGQRATPRLLE
                     NLSAPLFALLPAKWRLINAKDVAQAMLDQAFAPPQEGVTVLSSAQMQPTLRP"
     gene            complement(598486..599238)
                     /gene="phnP"
                     /locus_tag="YPTB_RS02900"
                     /old_locus_tag="YPTB0508"
     CDS             complement(598486..599238)
                     /gene="phnP"
                     /locus_tag="YPTB_RS02900"
                     /old_locus_tag="YPTB0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304647.1"
                     /note="required for the use of phosphonates and phosphite
                     as phosphorus sources; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein PhnP"
                     /protein_id="WP_002209284.1"
                     /db_xref="GI:488138076"
                     /translation="MQLTLLGTGCAQQVPVFGCDCVICTQASVDPARRRKPCSAMLYY
                     QGETTLIDAGLPTLDQQFRAGEIQRFLLTHYHMDHVQGLFPLRWGCGNKIPVYGPPDL
                     DGCDDLFKHPGILDFRPPLTAFQPLQFGELRVTPVPLVHSKITFGYLLQSPNRAIAYL
                     TDTVGLSADSALFLASKSIDLLVLDCSHAPQSPPPRNHNDVTMALAIRDLLMPEETLL
                     THASHQLDRWLLNNSLPTGVSVAYDNQTVTLV"
     gene            complement(599229..599810)
                     /locus_tag="YPTB_RS02905"
                     /old_locus_tag="YPTB0509"
     CDS             complement(599229..599810)
                     /locus_tag="YPTB_RS02905"
                     /old_locus_tag="YPTB0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7CKG8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 1,5-bisphosphate phosphokinase PhnN"
                     /protein_id="WP_002209285.1"
                     /db_xref="GI:488138077"
                     /translation="MARLIYLMGPSGAGKDCLLSALRNATPQNRVVAHRYITRPADAG
                     AENHVALSKQEFIQRAEQGLFALHWQAHQHCYAIGIEINLWLQHGLDVLVNGSRAYLP
                     EAQRRYRHQLLPLCLTVSPAILAQRLRQRGRENSEQIDARLQRAQHYQQQLPSHCLQL
                     CNDGELQHTLNQLQQLLTLDTPLSDPVEDKPCN"
     gene            complement(599810..600946)
                     /locus_tag="YPTB_RS02910"
                     /old_locus_tag="YPTB0510"
     CDS             complement(599810..600946)
                     /locus_tag="YPTB_RS02910"
                     /old_locus_tag="YPTB0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein PhnM"
                     /protein_id="WP_011191643.1"
                     /db_xref="GI:499505003"
                     /translation="MILNNVSLILEDSVVSGSLEIVDGVIRSYSDRPTQLPAAIDGEN
                     GWLLPGLIELHTDNLDKFFTPRPNVDWPAHSAMSSHDALMVACGITTVLDAVAVGDVR
                     DGGHRLDNLQKMINAVVDSQRAGLNRAEHRIHLRCELPYENTLPLFEALMAQPALSLV
                     SLMDHSPGQRQFASREKYREYYQGKYHLSDPQMAAFEEEQVALSARWAGPNRSAIAAQ
                     CRERGIALASHDDATAAHVAESQALGSVIAEFPTTEVAATASHQLGLQVLMGAPNIVR
                     GGSHSGNVAAHHLASLGVLDILSSDYYPASLMDAAFRIAHDASNRFTLPQAVNLVTRN
                     PARALGLNDRGVIAEGKRADLILARAHGENVYVQNVWRQGARVF"
     gene            complement(600943..601662)
                     /locus_tag="YPTB_RS02915"
                     /old_locus_tag="YPTB0511"
     CDS             complement(600943..601662)
                     /locus_tag="YPTB_RS02915"
                     /old_locus_tag="YPTB0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter ATP-binding protein"
                     /protein_id="WP_011191644.1"
                     /db_xref="GI:499505004"
                     /translation="MNPLQLRVENISKTFVLHHQHGIRLPVLHQISLEVNRGECVVLH
                     GHSGSGKSTLLRSLYANYLPDSGHIWIKHQGEWIDIVAAEARQIMAVRHHTVGWVSQF
                     LRVIPRISALNVVMQPLLELGVDRHTCQQRAQDLLTRLNVPPRLWDLAPSTFSGGEQQ
                     RVNIARGFIVDYPILLLDEPTASLDSANSAVVVSLIDEAKQRGAAIVGIFHDESVRNH
                     VSDRLLTMTPAPSEIRTEIPV"
     gene            complement(602051..602842)
                     /gene="phnK"
                     /locus_tag="YPTB_RS02920"
                     /old_locus_tag="YPTB0512"
     CDS             complement(602051..602842)
                     /gene="phnK"
                     /locus_tag="YPTB_RS02920"
                     /old_locus_tag="YPTB0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase"
                     /protein_id="WP_011191645.1"
                     /db_xref="GI:499505005"
                     /translation="MMSAQSTPQPLLSVENLTHLYAPGKGFSDVSFQLYPGEVLGIVG
                     ESGSGKTTLLKAISARLAPQQGQIIYRTGTQQPVDLYEMAESQRRRLLRTEWGMVHQH
                     PLDGLRPQVSAGGNIGERLMATGQRHYGEIRQLAGRWLEDVEIPLSRLDDLPTTFSGG
                     MQQRLQIARNLVTHPKLVFMDEPTGGLDVSVQARLLDLLRNLVVEMQLAVVIVTHDLG
                     VARLLANRLLVMKEGQVIESGLTDRVLDDPHHPYTQLLVSSVLQN"
     gene            complement(602842..603723)
                     /locus_tag="YPTB_RS02925"
                     /old_locus_tag="YPTB0513"
     CDS             complement(602842..603723)
                     /locus_tag="YPTB_RS02925"
                     /old_locus_tag="YPTB0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209289.1"
                     /note="required for use of phosphonate and phosphite;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex subunit PhnJ"
                     /protein_id="WP_011191646.1"
                     /db_xref="GI:499505006"
                     /translation="MTEVLTGYNLGYLDEQTKRTLRRAILKAVAIPGYQVPFGGREMP
                     MPYGWGTGGIQLTACLIGHTDVLKVIDQGADDTTNAVSIRRFFQRVSGVATTEKTTEA
                     TLIQTRHRIPETPLTEDQILIYQVPIPEPLRFIEPRETETRKMHALEEYGVMQVKLYE
                     DIARYGHIATTYAYPVKVNDRYVMDPSPIPKFDNPKMHMMPALQLFGAGREKRLYALP
                     PFTKVESLDFDDHPFSVQQWDDPCALCGSRHSYLDEVVMDDQGSRMFVCSDTDFCQQQ
                     LAQASAQEATSPTEVPV"
     gene            complement(603716..604894)
                     /locus_tag="YPTB_RS02930"
                     /old_locus_tag="YPTB0514"
     CDS             complement(603716..604894)
                     /locus_tag="YPTB_RS02930"
                     /old_locus_tag="YPTB0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304643.1"
                     /note="required for the use of phosphonate and phosphite;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex subunit PhnI"
                     /protein_id="WP_011191647.1"
                     /db_xref="GI:499505007"
                     /translation="MYVAVKGGEKAIAAAHQLLENQRRGDTQIPAIDCEQIEQQLGLA
                     VDRVMTEGGIYDRELAALAIKQASGDLVEAIFLLRAYRTTLPRLAVSLPLATDTMRLE
                     RRISAIYKDLPGGQVLGPTYDYTHRLLDFTLLASGETPLAPRGEEALPEPCAHVFDLL
                     TQEQLALPEQDDGTPPDDITRNPPVYPCNRSARLQQLVRGDEGFLLALGYSTQRGYGR
                     THPFAAEIRTGYLTIAIQPEELGFAIDIGEILLTECEMVNGFVDPVSEPPHFTRGYGL
                     VFGRGERKAMSIALMDRALQSREYQEAVSSPAQDEEFVLSHADNVEAAGFVSHLKLPH
                     YVDFQAELALLKRLRSEHLAASSALFTPQLSSSSLPSSSLPSSSSLPSSSQRQEPHHD
                     "
     gene            complement(604894..605520)
                     /gene="phnH"
                     /locus_tag="YPTB_RS02935"
                     /old_locus_tag="YPTB0515"
     CDS             complement(604894..605520)
                     /gene="phnH"
                     /locus_tag="YPTB_RS02935"
                     /old_locus_tag="YPTB0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase system protein PhnH"
                     /protein_id="WP_011191648.1"
                     /db_xref="GI:499505008"
                     /translation="MSLLTHFDQPVVEAQYAFRRILKALSEPGVQVTLPHSTGWQPLN
                     PATTSILLTLADQETPLYLDSQIASEGVQHNLRFHTGAPLTADLATACFAVLGNELTE
                     VQLATCPPGNELSPEQSVTVIIQVDSLNQGTPLRLHGPGIEQNRIVSPQLPQPLMNYL
                     LMNHPLINRQLMNHPLNRPAVFPAGLDFLLTCGEHLMALPRTTHVEVC"
     gene            complement(605520..605996)
                     /locus_tag="YPTB_RS02940"
                     /old_locus_tag="YPTB0516"
     CDS             complement(605520..605996)
                     /locus_tag="YPTB_RS02940"
                     /old_locus_tag="YPTB0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein PhnG"
                     /protein_id="WP_002209292.1"
                     /db_xref="GI:488138084"
                     /translation="MESTLMTRQNWLSILAHSQPTELLAHWQPLNLSPEYQVIRAPEM
                     GLNQLQARMGATGRRFILGDMTVTRAVIKLNDCTDIYGYSYIAGRNKPHAELCALLDA
                     LLQYSTLKGRPAGLNELLLKTVIHPLAAIQQKRRQLRAQHIAASKVDFFTLVRGED"
     gene            complement(605997..606722)
                     /locus_tag="YPTB_RS02945"
                     /old_locus_tag="YPTB0517"
     CDS             complement(605997..606722)
                     /locus_tag="YPTB_RS02945"
                     /old_locus_tag="YPTB0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304641.1"
                     /note="may be involved in phosphonate uptake and
                     biodegradation; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism transcriptional regulator
                     PhnF"
                     /protein_id="WP_011191649.1"
                     /db_xref="GI:499505009"
                     /translation="MNLSRPPTSYPTRYQHIAAQLEQELRGHYRCGDYLPSEQQLADH
                     YQVNRHTLRRAVDELVERGWLQRRQGIGILVLMRPYDYPLHANARFSQNLLDQGSDPT
                     SERLLAVLRPAAEPVAKALSLTEGESVIHLRTLRRVNGVPVCIIDHYLPDLSWWPVLQ
                     RFHSGSLHQFIAQHLQQPLKRSQTRISARRAQAKESALLEIATHAPLLCVRTLNTRVD
                     SQQVAEYSLSLTRADMIELTMEH"
     gene            complement(607050..607514)
                     /locus_tag="YPTB_RS02950"
                     /old_locus_tag="YPTB0518"
     CDS             complement(607050..607514)
                     /locus_tag="YPTB_RS02950"
                     /old_locus_tag="YPTB0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005156200.1"
                     /note="activates anaerobic ribonucleoside-triphosphate
                     reductase under anaerobic conditions; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside-triphosphate reductase
                     activating protein"
                     /protein_id="WP_025470743.1"
                     /db_xref="GI:645916758"
                     /translation="MNYHQYYPVDVINGPGTRCTLFVSGCVHQCVGCYNKSTWRLNSG
                     KPFTREMEDKIIADLNDSRIRRQGLSLSGGDPLHPQNLSAILQLVQRVHHECDGKDIW
                     LWTGYTLAELTAEQQQVVDLINVLIDGKFVQDLKDPSLIWRGSSNQVIHCLR"
     gene            complement(607691..609829)
                     /locus_tag="YPTB_RS02955"
                     /old_locus_tag="YPTB0519"
     CDS             complement(607691..609829)
                     /locus_tag="YPTB_RS02955"
                     /old_locus_tag="YPTB0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002354965.1"
                     /note="Catalyzes the reduction of nucleoside
                     5'-triphosphates to 2'-deoxynucleoside 5'-triphosphates;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside triphosphate reductase"
                     /protein_id="WP_002209296.1"
                     /db_xref="GI:488138088"
                     /translation="MKTVVIKRDGCQVPFDEVRIKEAVERAALAVGVVDADYCATVAR
                     VVAQTMENQPKVDIREIQNAVENQLMAGQYKQLARAYIEYRHDRDISRELRGRLNQEI
                     QGLVEQSNKALLNENANKDSKVIPTQRDLLAGIVAKHYAKQHLLPRDVVLAHERGEIH
                     YHDLDYAPFFPMFNCMLIDLEGMLTQGFKMGNAEIEPPKSISTATAVTAQIIAQVASH
                     IYGGTTINRIDEVLAPFVTESFNKHKAVAEEWQIPDVAGYAMSRTEKECYDAFQSLEY
                     EVNTLHTANGQTPFVTFGFGLGTSWQSRMIQQAILRNRIAGLGKNRKTAVFPKLVFAI
                     RDGLNHKFGDANYDIKQLALECATKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVYE
                     EEGQQIHDGRNNLGVISLNLPRIALEAKGDENQFWQLLDERLLIAKKALMTRIARLEG
                     IKARVAPILYMEGACGVRLQADDNIAEIFKNGRASISLGYIGIHETINALFGHQTHLF
                     DDQKLREKAIAIVAHLKQATDDWKDETGYAFSLYSTPSENLCDRFCRLDTAEFGVVEG
                     VTDKGYYTNSFHLDVEKKVNPYDKLDFEAPYPPLANGGFICYGEYPNLQHNIRALEDV
                     WDYSYSRVPYYGTNTPIDECYECGFTGEFSCTSKGFTCPKCGNHEPSKVSVTRRVCGY
                     LGSPDARPFNAGKQEEVKRRVKHLANGQLG"
     gene            complement(610263..610979)
                     /locus_tag="YPTB_RS02960"
                     /old_locus_tag="YPTB0520"
     CDS             complement(610263..610979)
                     /locus_tag="YPTB_RS02960"
                     /old_locus_tag="YPTB0520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_002209297.1"
                     /db_xref="GI:488138089"
                     /translation="MALIEVNNLQVSFAQKNQIKTAVESVSFAVEANETFSLIGASGC
                     GKSTVLRTLAGLQREWQGEITLLGQRLQPGQRFTGQLRKDVQMVFQDPYASLHPQHNI
                     QRTLGEPLKIHGEKNIAQRIAQALEQVGLPASAALRYPHQFSGGQRQRIAIARALLLR
                     PKLLLLDEPTSALDMSVQAEILNLLNHLKREYGMTYLLVSHDSDVVAHMSERAVLMEN
                     GHIVREYSREDLASAEHSMG"
     gene            complement(610966..611844)
                     /locus_tag="YPTB_RS02965"
                     /old_locus_tag="YPTB0521"
     CDS             complement(610966..611844)
                     /locus_tag="YPTB_RS02965"
                     /old_locus_tag="YPTB0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011055296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_002209298.1"
                     /db_xref="GI:488138090"
                     /translation="MTDSIFTVDNLCVDFQQQRVVDNISFHLGHERVALVGESGSGKS
                     ITARALMGLVRHPGKVSAKKLSYYSDNTDDQGHSGQIIEHDLLRLNTRQWSALRGSEI
                     AMVLQDPRYALNPVQPVGKQIEESLLLHNTLSSADAHERVLNALASVGLNASAYHSYP
                     GQLSGGMGQRAMLAIALVNNPRVLIADEPTSALDAKLRNQILELIVEQTEQRKMSLLL
                     ISHDLPLVAEHCHRVLVMYQGKLVDQGLAADLPHSTHPYTHTLWACRPNAHTYGTDLP
                     VLDRSVDFSGGSRGTD"
     gene            complement(611837..612673)
                     /locus_tag="YPTB_RS02970"
                     /old_locus_tag="YPTB0522"
     CDS             complement(611837..612673)
                     /locus_tag="YPTB_RS02970"
                     /old_locus_tag="YPTB0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_002209299.1"
                     /db_xref="GI:488138091"
                     /translation="MPIIKFYRTLKRSPSTSIGLFILSLLVIIAVFAPWLAPQDPNWQ
                     NAADRLLPPGDSGHLLGTDSYGRDMLSRLIYGTRPTLGLVLLVTVITLPLGLLVGVLS
                     GYYGGWLERILMRITDVVMSMPRLILAFAFVAMLGPGLLNGALALALTTWPAYARQAR
                     AEIQLLRKSDYLAAAEMMGIRGLRLLWGHILPMCLPSAVVRLALDLAGIILAAAGLGF
                     LGLGARPPMSEWGSMVADGMQVIFDQWWIAAIPGCAILLSSMAFNLLGDGLRDILDPH
                     HD"
     gene            complement(612692..613741)
                     /locus_tag="YPTB_RS02975"
                     /old_locus_tag="YPTB0523"
     CDS             complement(612692..613741)
                     /locus_tag="YPTB_RS02975"
                     /old_locus_tag="YPTB0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002354959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_002209300.1"
                     /db_xref="GI:488138092"
                     /translation="MSVALNTTPGTPSRRHLLVFLQGLFTLALTLFGLLVITFFLSAL
                     SPVDRVLQIVGDHASEATYQQVKQQLGLDQPLFVQFWHYLVRLAHGDLGVASASGQPV
                     LQDLLTVFPASLELATLSLLVGGALGIFLGLLCARWAGSKLDITIRFITLLGNSVPIF
                     WLGLLMLLLFYARLQWSPGPGRLDDIYQYTVEAKTGFVLIDTWRSGDMGAFNNALGHM
                     ILPVSLLAYYALASITRLTRSACLSELNKEYITLARAKGAGEMRILLMHVLPNIRGTL
                     LTVIALAYTSMLEGAVLTETVFAWPGIGRYLTSALFAGDTTAIMGGTLLLGMCFILIN
                     NVTDLLVRLLDPRTR"
     gene            complement(613837..615405)
                     /locus_tag="YPTB_RS02980"
                     /old_locus_tag="YPTB0524"
     CDS             complement(613837..615405)
                     /locus_tag="YPTB_RS02980"
                     /old_locus_tag="YPTB0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012105726.1"
                     /db_xref="GI:501054213"
                     /translation="MKAKVLSLFVLAALSGGTLAATPPDTLIVVQSLDDIVSLDPAES
                     NELSSIQTVPSLYQRLVQADRDNPAKVVPVLAESWEGDAAAKTLTVKLRPQAVFASGN
                     PVQADDVIYSFTRAVKMNRSPAFILNVLGWQADNIDQHLKKIDNNTVQVSWSADVSPA
                     VALNILSTPIASIVDKKTVTANTKDDDYGNAWLKMHSAGSGAFKMRVYQPHQAIVLDA
                     NPTSPGNQPLIKNIIIKNVPDPSARRLLIQQGDADIARELGPDQITALKTQAGVKVVE
                     IPSAEQNYLVFNTANAANPLLSRPELWQAARYLVDYQGITKDLLKDQYFIHQSFLPVG
                     LPGALASNPFTFDPATAKKILAKAGIKDATLTLDVENKPPFITIAQSLQASFAQGGVK
                     LVLLPAAGSQVYGRVRAKQHQSAIRLWIPDYFDAHSNASTFAYNDGKSSTVAGLNGWV
                     IPELNKQTLAAVAEADPEKRTQLYTQLQQELQQNSPYIFIDQAKAQVVLRDNVKGYQQ
                     GLNADMVYYDRVSK"
     gene            616044..616502
                     /locus_tag="YPTB_RS02985"
                     /old_locus_tag="YPTB0525"
     CDS             616044..616502
                     /locus_tag="YPTB_RS02985"
                     /old_locus_tag="YPTB0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012230161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209301.1"
                     /db_xref="GI:488138093"
                     /translation="MIIGNIHHLALLPYLPAQLRDAIEYVKSHINADTPLGKHDIDGN
                     NVFVLVSNDSTDLLENRRAEYHAKYLDIQIILAGQEGMAFSNLPAGKPDTDWLADKDI
                     AFLPAGTDEKHVVLQTGDFVVFFPGEVHKPLCAVGEPANVRKAVVKIAVK"
     gene            complement(616765..617772)
                     /locus_tag="YPTB_RS02990"
                     /old_locus_tag="YPTB0526"
     CDS             complement(616765..617772)
                     /locus_tag="YPTB_RS02990"
                     /old_locus_tag="YPTB0526"
                     /EC_number="2.1.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7FMM5.1"
                     /note="catalyzes the formation of ornithine and
                     carbamylphosphate from citrulline in the arginine
                     catabolic pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="WP_011191651.1"
                     /db_xref="GI:499505011"
                     /translation="MNQFYKRHFLRLLDFTPAEIIALLDLATELKKDKKSGCEQQKLV
                     GKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPGGSQIGHKESIKDTARVLGRMYD
                     GIQYRGYGQRVVETLAEFAGVPVWNGLTNEFHPTQLLADLLTMREHLPNKSLNKMTLA
                     YLGDTRNNMGNSLLEAAALVGMDLRLVAPKACWPEEAFVISCQALAQKTGGKITLTED
                     IAEGVNGADFLYTDVWVSMGEPKEVWQERITLLKPYQVNMRVLTLTGNPQVKFLHCLP
                     AFHDDQTTIGKQMAEQYDLPGGMEVTEEVFESAHSIVFDQAENRLHTIKAVMVATMSK
                     I"
     gene            617983..618414
                     /locus_tag="YPTB_RS02995"
                     /old_locus_tag="YPTB0527"
     CDS             617983..618414
                     /locus_tag="YPTB_RS02995"
                     /old_locus_tag="YPTB0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005156155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNase E inhibitor protein"
                     /protein_id="WP_002209303.1"
                     /db_xref="GI:488138095"
                     /translation="MANRELLDEQRDETRLIIEELLEDGSDPDALYTIEHHLSAEKFE
                     VLEKAAVEAFKLGYEVTDAEELEVEDGSMVMCCDVISEVALNAEIIDAQVEQLVALAE
                     ACGVNYDGWGTYYEDPNAEDDEDGEYDDEELVDEDDDGKRH"
     gene            complement(618773..619276)
                     /locus_tag="YPTB_RS03000"
                     /old_locus_tag="YPTB0528"
     CDS             complement(618773..619276)
                     /locus_tag="YPTB_RS03000"
                     /old_locus_tag="YPTB0528"
                     /EC_number="2.3.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_011191652.1"
                     /db_xref="GI:499505012"
                     /translation="MTTTTPIRLLVRPITARDNLAIANVIREVSAEFGLTADKGYTVS
                     DPNLDHLYELYSQPRSAYWVIEVDGHIAGGGGVAPLLGGEADLCELQKMYFLPILRGK
                     GLAKQLALQALAFARQQGFGRCYLETTASLTSAVGLYERLGFEHIGGAMGNTGHVDCE
                     VTMLKTL"
     gene            complement(619419..622295)
                     /locus_tag="YPTB_RS03005"
                     /old_locus_tag="YPTB0529"
     CDS             complement(619419..622295)
                     /locus_tag="YPTB_RS03005"
                     /old_locus_tag="YPTB0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004389284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valyl-tRNA synthetase"
                     /protein_id="WP_032466996.1"
                     /db_xref="GI:694126413"
                     /translation="MNKTEPSLDKTYSPQEIEQPLYEHWEKQGYFKPNGDTSKESYCI
                     MIPPPNVTGSLHMGHAFQQTIMDTLIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIA
                     AEEGKTRHDYGRDAFIDKIWEWKGESGGTITRQMRRLGNSVDWERERFTMDEGLSNAV
                     KEVFVRLHKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHLRYPLADGAKTA
                     EGKDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKEVILPLVGRRIPILGDEHADM
                     EKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRSEAEVFDTHGEATDAFSNA
                     IPAQFQGLERFAARKAVVAEFEKLGLLEEVKPHDLTVPYGDRGGVVIEPMLTDQWYVR
                     TAPLAKVAIEAVENGEIQFVPKQYENMYYSWMRDIQDWCISRQLWWGHRIPAWYDEQG
                     NVYVGRDEAEVRRDNNLGAEVALRQDEDVLDTWFSSGLWTFSTLGWPEQTDALKTFHP
                     TSVVVSGFDIIFFWIARMIMLTMHFMKDENGKPQVPFKTVYMTGLIRDDEGQKMSKSK
                     GNVIDPLDMVDGISLEALLEKRTGNMMQPQLAEKIRKRTEKQFPNGIEPHGTDALRFT
                     LAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEGQDCGQNGGEMVLSLADR
                     WILAEFNQTIKAYREAMDTYRFDLAAGILYEFTWNQFCDWYLELTKPVMNSGSEAELR
                     GTRHTLIQVLEALLRLAHPIIPYITETIWQRVKNLKGITADTIMLQPFPEYDASQVDE
                     QALSDLEWIKQTIIAVRNIRAEMNIAPGKPLEVMLRGANAQAQRRVLENQSFIQSLAR
                     LSSLTLLAEGDKGPVSVTKLVEGAEVLIPMAGLIDKATELDRLAKEVAKLDAEIERIE
                     GKLGNEGFVARAPEAVVAKERERLAACAEAKQKLIEQQATIAAL"
     gene            complement(622329..622778)
                     /locus_tag="YPTB_RS03010"
                     /old_locus_tag="YPTB0530"
     CDS             complement(622329..622778)
                     /locus_tag="YPTB_RS03010"
                     /old_locus_tag="YPTB0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209309.1"
                     /note="binds to single-strand binding (SSB) protein and
                     acts as a bridge between the DnaX clamp loader complex and
                     the SSB; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit chi"
                     /protein_id="WP_002209309.1"
                     /db_xref="GI:488138101"
                     /translation="MKNATFYLLEHDTPAGELRAHEALACEIAAERWRAGKRVLIACE
                     SQEQAQRLDEALWQRAPEQFVPHNLAGEGPKYGAPVELAWPERRGNSPRDLLISLLPE
                     FAGFATAFHEVVDFVPYEENLKQLARDRYKSYRSVGFHLTTATPPTN"
     gene            complement(622929..624440)
                     /locus_tag="YPTB_RS03015"
                     /old_locus_tag="YPTB0531"
     CDS             complement(622929..624440)
                     /locus_tag="YPTB_RS03015"
                     /old_locus_tag="YPTB0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015698812.1"
                     /note="catalyzes the removal of N-terminal amino acids
                     preferably from various peptides; a cyteinylglycinase,
                     transcription regulator and site-specific recombination
                     factor; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosol aminopeptidase"
                     /protein_id="WP_002209310.1"
                     /db_xref="GI:488138102"
                     /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYIS
                     ALLRRGELEGKVGQTLLLHHVPNILSERILLIGCGKERELDERQYKQVIQKTINTLND
                     TGSMEAVCFLTELHVKGRNTYWKVRQAVETAKETLYTFDQLKSNKTEPRRPLRKMVFN
                     VPTRRELTSGERAIQHGLAIASGIKAAKDLGNMPPNICNAAYLASQARQLADAFSTNT
                     VTRVIGEQQMKELGMHAYLAVGHGSQNESLMSVIEYKGNPNKDAKPIVLVGKGLTFDS
                     GGISIKPAEGMDEMKYDMCGAATVYGVMRVVAELQLPLNVVGVLAGCENMPGGRAYRP
                     GDILTTMSGQTVEVLNTDAEGRLVLCDALTYVERFEPELVIDIATLTGACVVALGNHL
                     TGLMSNHNPLAHELIGASEQAGDRAWRLPLGEEYYEQLDSNFADMANIGGRAGGAITA
                     GCFLSRFTRKYSWAHLDIAGTAWRSGKNKGATGRPVALLSQFLLNRAGLNGDD"
     gene            624720..625814
                     /locus_tag="YPTB_RS03020"
                     /old_locus_tag="YPTB0532"
     CDS             624720..625814
                     /locus_tag="YPTB_RS03020"
                     /old_locus_tag="YPTB0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004389287.1"
                     /note="with LptBGC is involved in lipopolysaccharide
                     export; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS ABC transporter permease LptF"
                     /protein_id="WP_002209311.1"
                     /db_xref="GI:488138103"
                     /translation="MIIIRYLVRETLKSQIAILFILLLIFFSQKLVRILGAAVDGEIP
                     TNVVLSLLGLGVPEMAQLILPLSLFLGLLMTLGKLYTESEITVMNACGMGKKSLIMAA
                     LILALFTSGLAAINTIWLGPWSSKHQDVVLNDAKANPSLAALGGGQFKSSNDGNSALF
                     IGNVAGKEFNRVFLAQLRPNGNQRPSVVVADSGHMSELPDGSQMVILNKGTRYEGTAL
                     LRDFRITDFVDYQAVIGHKQVQQSSNGADQMSMKELWRSQEPDARAEFHWRLTLIVSV
                     VIMALLVVPLSVVNPRQGRVLSMLPAMLLYLIFFLLQSSLRSKAGNGQLDPLVWMWAV
                     NGAYLALAIILNLWDGLMARKLRARLRGAA"
     gene            625814..626890
                     /locus_tag="YPTB_RS03025"
                     /old_locus_tag="YPTB0533"
     CDS             625814..626890
                     /locus_tag="YPTB_RS03025"
                     /old_locus_tag="YPTB0533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002223173.1"
                     /note="with LptABCF is involved in the transport of
                     lipopolysaccharides; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS ABC transporter permease"
                     /protein_id="WP_002223173.1"
                     /db_xref="GI:488151965"
                     /translation="MFGVLDRYIGRTILNTILMTLLMLVSLSGIIKFVDQLRKVGQGD
                     YSAASAGMYTILSIPKDIAVFFPMAALLGALLGLGTLASRSELVVMQASGFTRMQIAA
                     SVMKTAIPLVLLTMAIGEWVAPQGEQTARNFRTQQMYGGSLLSTQSGLWAKDGSDFIY
                     IQRVSGESELTGVNIYHFDKEDRLLSVRYAATATYEKDNKTWRLSQVDESDLSNPTQV
                     TGSQTLTGEWKTNLTPEKLGVVAMDPDSLSISGLHDYSKYLQQSGQESNRYELSMWSK
                     VFAPFSVAVMMLMALSFIFGPLRSVPMGVRVVTGIFFGFVFYVLDQVFGRLSLVYGIP
                     PMLGALLPSMLFLLISICLLLKRR"
     gene            626995..627079
                     /locus_tag="YPTB_RS03030"
                     /old_locus_tag="YPTB_RNA_21"
     tRNA            626995..627079
                     /locus_tag="YPTB_RS03030"
                     /old_locus_tag="YPTB_RNA_21"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:627029..627031,aa:Leu,seq:caa)
     gene            627278..628544
                     /locus_tag="YPTB_RS03035"
                     /note="integrase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     misc_feature    627278..628513
                     /locus_tag="YPTB_RS03035"
                     /note="similar to Yersinia pestis YPO3438 intB; integrase
                     (98.7% evalue=0); Escherichia coli b4271 intB; prophage p4
                     integrase (int(P4)) (79.1% evalue=1.E-169) with a stop
                     codon.;integrase pseudogene"
                     /pseudo
                     /db_xref="PSEUDO:CAH19774.1"
     gene            complement(628794..632042)
                     /locus_tag="YPTB_RS03040"
                     /old_locus_tag="YPTB0535"
     CDS             complement(628794..632042)
                     /locus_tag="YPTB_RS03040"
                     /old_locus_tag="YPTB0535"
                     /EC_number="3.1.21.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_011191654.1"
                     /db_xref="GI:499505014"
                     /translation="MTTFKTEAQFEQAFIEVLTHKGWETEILNNKTEADLLQNWASIL
                     FENNRQRDRLNDVPLTATEMQQIIEQIKELKTPLKLNGLINGKTVAIKRDNPADTLHM
                     GKEVSLKIYDRQEIAAGQSRYQIVQQPKFERGSPLRNDRRGDVLLLINGMPVIHLELK
                     RSGTPVSQAVNQIEKYSKEGVFSGLFSLIQVFVAMEPNEAKYFANPGLDGKFNPDYQF
                     NWADFNNEPMNHWKDIASTLLSIPMAHQLIGFYTVADDTDGVLKVMRSYQYYAANAIS
                     DKVAKTNWQQLGSAANNPDRLGGYVWHTTGSGKTMTSFKSAQLIAQSKDADKVIFLMD
                     RIELGTQSLTEYRNFAGDGEDVQATENTHVLITKLKSSATADTLIVSSIQKMSNIFEE
                     VDDEGTATNSADIEKIRAKRLVFIIDEAHRSTMSGGKENKEGMLVRIKKTFPKALFFG
                     FTGTPIHDENQVNSNTTADVFGNELHRYSIADGIRDGNVLGFDPYKICTFKDKGLRQA
                     VALEQAKADSVADAMSTAAKKKKFNYFMNDVLMAGHKDATGKYIKGIEDYVPKEQYLT
                     ADHQEKVVEDILAEWDVLSQGNKFHAILATNSIAEAIDYYRRLKAAKPELKVSALFDP
                     NIDNDGSGDRGPTFKGDALDEIMADYNARYGQDFDFARHAAFKKDLAARLAHKKPYER
                     IHTEPSKQLDILIVVDQMLTGFDSKWLNTLYLDKVIKYQNIIQAFSRTNRLFGPDKPH
                     GIIRYYRYPHTMEQYINDAVKLYSGDRPIGLFVDKLESNLKAMNELVADITELFVSAG
                     VENFEKLPDDIETCAQFAKLFNTFSQHLEAAKVQGLHWEQSVYSPTENDVEHEVTLAI
                     DEQTYLSLVLRYKELVAKGDGGGAGGGDVPFDISGYLTEIDTGKIDADYMNSRFDKFL
                     KELNQHQDPASIETTLNELHKSFASLTQSEQKYAKLFLHDLQRGDAQLIEGHTFRDYI
                     NTYKDNAENAQLNAVVNALGLDKERLIALMADSVNDKNLNDFGRFDALKDSVNKAKAK
                     IYFEKQDGVIIPPFKLNIRIDQFLKQFILAQTDDFLSDRDVVGDVMDVPPSA"
     gene            complement(632052..633335)
                     /locus_tag="YPTB_RS03045"
                     /old_locus_tag="YPTB0536"
     CDS             complement(632052..633335)
                     /locus_tag="YPTB_RS03045"
                     /old_locus_tag="YPTB0536"
                     /EC_number="3.1.21.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction endonuclease subunit S"
                     /protein_id="WP_011191655.1"
                     /db_xref="GI:499505015"
                     /translation="MSVEKKVPEIRFKGFSGAWVENNLGELIDIRSAARVHKEQWTEA
                     GVPFFRTSDVVSIYKGQENTKSYISPEVYNGLSEKIGKVTKDDLLITGGGSIGIPYLV
                     PNDDPLYFKDADLLWLKNNKKFNGYFLYTFFFSAPFKKHIKSISHTGTIAHYTIEQAK
                     ATPINTCYDEEQTQIGNYFQKLDSLINQHQQKHDKLSNIKKAMLEKMFPKPGKTIPEI
                     RFKGFSGKWEEMPFGTCFVNVSNNTLSRADLNYEDGMAKNIHYGDVLIKFGEVLDATN
                     ELLPFITNNDVTNKLKHAALRDGDIIIADAAEDSMVGKCTELFNIGEQLVLSGLHTIA
                     VRPTLNFASKYLGYYLNSSSYHDQLLSLMQGTKVLSISKTAIQNTNIVFPKSAEEQVE
                     IGKYFQKLDALINQHQQQITKLNNIKQACLRKMFI"
     gene            complement(633337..635928)
                     /locus_tag="YPTB_RS03050"
                     /old_locus_tag="YPTB0537"
     CDS             complement(633337..635928)
                     /locus_tag="YPTB_RS03050"
                     /old_locus_tag="YPTB0537"
                     /EC_number="2.1.1.72"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012146784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification protein subunit
                     M"
                     /protein_id="WP_011191656.1"
                     /db_xref="GI:499505016"
                     /translation="MNKQQLAAKIWESANQMRSKIEANEYKDYILGFIFYKYLSDQLV
                     QFVTRQGMTPEDIKALNEEDADTVKYVQGNLGYFIAYDNLFSTWVDSTSDFDESNVRD
                     ALSAFSRLISPTYKKLFEGIFTTLETGLSKLGESAGKRTKAISDLLHLIKSIPMNGNQ
                     GYDVLGYIYEYLLEKFAANAGKKAGEFYTPHEVSVLMSNIIAYELKHKDTIKIYDPTS
                     GSGSLLINIGEAFEKYAKNKDSITYYAQELKANTYNLTRMNLIMRGIKASNIKTRNGD
                     TLEDDWPFFDDSDPQGSYYALHVDAVVSNPPYSQNWDPSFKDSDPRYSRFGLAPKTKA
                     DFAFLLHDLYHLKPDGIMAIVLPHGVLFRGGEEGQIRKQLIEQNHIDTIIGLPANIFF
                     GTGIPTVILVLKQKRQNTDVLVVDASKHFMKEGKNNKLQASDIKRITDAVIKRESIDK
                     FSQLVSKQTLRDNGYNLNIPRYVDSSAATPSWDLHATMLGGIPNSEIAELHNYWQAFP
                     QLHDTLFTPKSAAYSELAIAKQNVNASISGHPQVLAFISAYNQAFNGFDDYLNTQLIQ
                     NWHSVKRNQQEAVLSTELFTRLAPIALIDKYQAYQFLNNQWQLISADLEMMQTEGFAA
                     AKQVDANIVIKKKNGQDTEVQDGWKGHILPFDLVQQTYLSDDLQALAAKETRLAEIAS
                     TLEEILESLTEEEKEQDTVKESQDGFANAELSKAAKVFLKEQKDAKTKFAEDSYEAKI
                     IRANKLIDEEKTLKKTVKDAATALHLKTKTTIEALTDEQVNNLLHLKWIAPLSTELAA
                     MPNAVINQLTRQVQALADKYAVTYSQVANEIKNTEQELAQMMSELTGNEFDMQGLNEL
                     TRLLKGE"
     gene            complement(636271..637317)
                     /locus_tag="YPTB_RS03055"
                     /old_locus_tag="YPTB0538"
     CDS             complement(636271..637317)
                     /locus_tag="YPTB_RS03055"
                     /old_locus_tag="YPTB0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M48"
                     /protein_id="WP_002209176.1"
                     /db_xref="GI:488137968"
                     /translation="MIVEGYYQYPGRAAREAARLLLNEIGDNVTLLRDGEQHYFSLSQ
                     LNVSSSLGSIPLNLTFPDGGRFVPSDDALFRKWLYQQRSPGVVHRLERHKSGVLLTLL
                     ITPLLILAYIYWLLPWASSEIALRIPTTAEQKLGEHSLEWLQQSGFKPSALPAERQEA
                     IQQLFLQVMPPQMRQERTPLKLVLMTAPTTANAFMLPDGTMVISDDLIKLTTSDDALA
                     AVMLHEMGHHAHRHSMQMVVRSSLVALTFMWMTGDVNGIGDTLLQSAAFIHEMQFSRT
                     IESEADSWAIAEMQREKRSLLAMEDIYHALQQTTTPEEAETRAGIPEWLSSHPDMPAR
                     LDVIRAAREKMAQE"
     gene            complement(637364..638560)
                     /locus_tag="YPTB_RS03060"
                     /old_locus_tag="YPTB0539"
     CDS             complement(637364..638560)
                     /locus_tag="YPTB_RS03060"
                     /old_locus_tag="YPTB0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016598657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191657.1"
                     /db_xref="GI:499505017"
                     /translation="MADNASQNKSLHRMAFKGEGGEYFSIWLVNLLLTIITLGVYSAW
                     ATVRRRRYFYGNTELNGDRFDYHAEPIEILKGRLMVIGGVILFYILLAIAPTLGLLVA
                     LVLLALIPWIIIRSWRYNAIMTSYRGVRFNYHCQTGQAYWALLFCPLLLILGLYAVMI
                     VMAMFLGSVASTPSTAITLIVVSAILLVPLLAVINGIVSTLQHSLYVNNLSFGNSSFI
                     STLKKSAFIKIAFFSVLIFIPFFFVAMMFAGAFFADLFQSALNGSIANENKTAMLIIQ
                     NFSNLLFMMLILLLGTMVSSSYRIVAQRNYLFSQTTLQGDIKLRSSMKLLSYMGLLMT
                     NSLITVCSLGLATPIAEVRHARYMANATEIEGDLSLLNIHAHQDTANSALAEEAVQAL
                     DLGTGF"
     gene            639266..639802
                     /locus_tag="YPTB_RS03065"
                     /old_locus_tag="YPTB0540"
     CDS             639266..639802
                     /locus_tag="YPTB_RS03065"
                     /old_locus_tag="YPTB0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209178.1"
                     /db_xref="GI:488137970"
                     /translation="MPIPERLTPGKATKNRTQRLLKLLDEISSTLEDNGDQENDRVRE
                     LILQWNEIACREHDFHEFRDFHAYTSKDDFIISAQRKAKYIEDFQYIESIELVNVIAQ
                     AEGTEPDIHYAVDLLDKNFPDGDASDLIFWPNYWFQDENMLHIELTPEETVGYLMARS
                     GRTLQGAPEIELRYPYYN"
     gene            639804..640679
                     /locus_tag="YPTB_RS03070"
                     /old_locus_tag="YPTB0541"
     CDS             639804..640679
                     /locus_tag="YPTB_RS03070"
                     /old_locus_tag="YPTB0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_011191658.1"
                     /db_xref="GI:499505018"
                     /translation="MTIKLISQLTALVSEPNSIHHVYFAKSLRAAPLLAQQVNFPRME
                     LIIEGSQAMIWDRLYDDFHHKDEYIMHRGDILFIPSGGWNIPQWEQPVITLSILFGKQ
                     SLGFSLLSWDGESVVHKEMESVLRRGPRVGAYILQALNEMSLMQREQTTVQLIVRSLI
                     SHCIDLLRNQVKTPSRSQTLFESIREYIERNYSEPLTRESVAHVFHISPNYLSHLFRN
                     VGNIGFNESVNSARLENAKILLKFYEMKIKEVANVCGFIDSNYFCRLFRKETELTPSE
                     YRQQYRSNMMERDVI"
     gene            complement(640672..641016)
                     /locus_tag="YPTB_RS03075"
                     /old_locus_tag="YPTB0542"
     CDS             complement(640672..641016)
                     /locus_tag="YPTB_RS03075"
                     /old_locus_tag="YPTB0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209180.1"
                     /note="FrwD with FrwB, FrwC and PtsA forms a PEP-dependent
                     sugar phosphotransferase system permease which may
                     phosphorylate and transport sugars into the cell;
                     phosphorylated by EIIA; FrwB homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIB"
                     /protein_id="WP_002209180.1"
                     /db_xref="GI:488137972"
                     /translation="MTIKLVAVTACVSGVAHTYMVAERLDKLCLQLKWQLKVETQGAL
                     GVEYSLTEDDILQADAVILINDVAIKEQERFQNCRCVQADIQTFLCHPEKILAATKKV
                     ISSPKTVSIVIK"
     gene            complement(641109..641429)
                     /locus_tag="YPTB_RS03080"
                     /old_locus_tag="YPTB0543"
     CDS             complement(641109..641429)
                     /locus_tag="YPTB_RS03080"
                     /old_locus_tag="YPTB0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209181.1"
                     /note="FrwB with FrwC, FrwD and PtsA forms a PEP-dependent
                     sugar phosphotransferase system (PTS) permease which may
                     phosphorylate and transport sugars into the cell;
                     cytoplasmic protein that interacts with complex EIIA;
                     contains the second phosphorylation site of the PTS;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIB"
                     /protein_id="WP_002209181.1"
                     /db_xref="GI:488137973"
                     /translation="MTNIIAITACPSGVAHTYMAAEALERAARAKGWECKVETQGSIG
                     VENKLTAEDVAAADMVILTKDIGILFEERFAGKVIVRIAVSDAVKRADAIMDKIAAYL
                     EKNT"
     gene            complement(641552..642634)
                     /locus_tag="YPTB_RS03085"
                     /old_locus_tag="YPTB0544"
     CDS             complement(641552..642634)
                     /locus_tag="YPTB_RS03085"
                     /old_locus_tag="YPTB0544"
                     /EC_number="2.7.1.69"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010981381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIC"
                     /protein_id="WP_011191659.1"
                     /db_xref="GI:499505019"
                     /translation="MKELINILKNTRQHLMTGVSYMIPFVVAGGILLALSVMLYGKGA
                     VPEVASDPNLKKLFDIGVVGLTLMVPFLAAYIGYAIADRAALAPAAIGAWVGASFGAG
                     FFGAIIAGLLGGIIVFYLKKISVPKTLRSVMPIFVIPIVGTLLTAGIMMWGLGEPIGI
                     LTANLTQWLQGMQQGSVILLAIIMGLMLAFDMGGPVNKVAYAFMLICVAQGVYTLVAV
                     AAVAIATPPLGMGLATLIGRKYYSVEEREAGKAAMLMGCVGITEGAIPFAAADPLRVI
                     PANMIGSACAAVTAVLFGAQCYAAWGGLIVLPVVDGKLGFVVALFVGMVVTALIANLL
                     KRFTAQKQPGRSSAEGDVDMDFDIKN"
     gene            642999..645539
                     /locus_tag="YPTB_RS03090"
                     /old_locus_tag="YPTB0545"
     CDS             642999..645539
                     /locus_tag="YPTB_RS03090"
                     /old_locus_tag="YPTB0545"
                     /EC_number="2.7.3.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105718.1"
                     /note="Phosphotransferase system, enzyme I; transfers the
                     phosphoryl group from phosphoenolpyruvate (PEP) to the
                     phosphoryl carrier protein HPr; HPr transfers the
                     phosphoryl group to subunit A; subunit IIA transfers a
                     phosphoryl group to subunit IIB; subunit IIB transfers the
                     phosphoryl group to the substrate; part of the
                     phosphoenolpyruvate-dependent sugar phosphotransferase
                     system (PTS), a major carbohydrate active-transport
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIA"
                     /protein_id="WP_011191660.1"
                     /db_xref="GI:499505020"
                     /translation="MTKQVTFICGLPNGVHARPASHIERVCNRFQSRFHWYNPRSGIV
                     GDGKSVLSLIATNILLGDECQVTIEGEDEQAAFERLSIFIEHELPHADPILPKREESA
                     EWEPLPASLAHLHPTLLRARSVSPGTACGKLLSLIRADLNALGDLPVAQGIEREQQML
                     ADGVAQLGKAWESLLVANSSTTENNSTTENNSTTRAIREVHRSLLRDGTFRQRLLSHI
                     VAGESCATAIVATAAYFSQQLALAANTYLRERELDIRDVSFQLLQQIYGEQRFPSQQA
                     LSEDSLCIADELTPSQFLALDKRYLKGLLLGRGGSTSHTVILARSFNIPTLVGVDATA
                     LQPYLNQSLQIDGELGLVVCLLDEPVRRYYRQEQWLHDQLREQQSRYQNMPGRTLDGV
                     RMVVAANITHAVEVEGAFNQGAESIGLFRTEMLYMDRAAAPSEEELYTLYAQALGAAK
                     GKPMIIRTIDIGGDKPVSYLNIPAESNPFLGYRAVRIYHEFLSLFHTQLRAILRASMH
                     GPLKIMIPMISSMEEILWVKDQLAEVKQSLRINHLQFDETVPLGMMLEVPSVMFIIDQ
                     CCEEMDFLSIGSNDLTQYLLAVDRDNAKVSEHYHCLSPALLRALDYAVCEVHRHGKWI
                     GLCGELAAKDSVLPLLVAMGLDEISMSASFIGATKARLAKLDRGECRLLLNRAMACRT
                     SREVEHLLVQYDGEQGDEPLIIPECITLGVDWRSKEEVIKGMVDNLLLAGRCRYPRKL
                     AADVWAREALFSTGLGFGFAIPHAQSEHIEQSTISVAKLAQPVNWGEEDALFVMMLTL
                     KKQASGDQHMRIFSKLARRIMHEGFREALVSAGTAQQIETLLKHELEL"
     gene            complement(645601..646092)
                     /locus_tag="YPTB_RS03095"
                     /old_locus_tag="YPTB0546"
     CDS             complement(645601..646092)
                     /locus_tag="YPTB_RS03095"
                     /old_locus_tag="YPTB0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoprotein/receptor precursor"
                     /protein_id="WP_002209184.1"
                     /db_xref="GI:488137976"
                     /translation="MDNIHRLFLALAFSAPLVTGAAHANSLLDSVKSTAEQYGKSAGS
                     SSSLPSMSSLTNLLNGGDKALSAGTMNNATGILQYCVQNNVLSSDGTTAIKDQLMSKL
                     GISGTEAAKSTDYEEGLGGLLKTSEGKSVNLNDLGTGQITEKIKTKACDLVLKQGKSF
                     LLK"
     gene            complement(646415..646705)
                     /locus_tag="YPTB_RS03100"
                     /old_locus_tag="YPTB0547"
     CDS             complement(646415..646705)
                     /locus_tag="YPTB_RS03100"
                     /old_locus_tag="YPTB0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004716509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autoinducer 2-degrading protein LsrG"
                     /protein_id="WP_002209186.1"
                     /db_xref="GI:488137978"
                     /translation="MHVTLVEINVKEDKVDQFIEVFRANHLGSIREAGNLRFDVLRDE
                     HIPTRFYIYEAYTDEAAVAIHKTTPHYLQCVEQLAPLMTGPRKKTVFIGLMP"
     gene            complement(646769..647644)
                     /locus_tag="YPTB_RS03105"
                     /old_locus_tag="YPTB0548"
     CDS             complement(646769..647644)
                     /locus_tag="YPTB_RS03105"
                     /old_locus_tag="YPTB0548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016605517.1"
                     /note="involved in autoinducer 2 transport and processing;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_011191661.1"
                     /db_xref="GI:499505021"
                     /translation="MADLDDIKDGKDFGIGIPQQNPAFTLKGSGSLDWGMQSRLARIF
                     NPKTNRTVMLAFDHGYFQGPTTGLERIDINIAPLFEYADVLMCTRGILRSVVPAAANR
                     PVVLRASGANSILTDLSNEAVAVAMEDAVRLNACAVAAQVYIGTEHEHQSIKNIIQLI
                     DQGMRYGMPTMAVTGVGKDMVRDQRYFSLASRIAAEMGAQVIKTYYVDSGFERIAAGC
                     PVPIVIAGGKKLPERDALEMCYQAIDQGASGVDMGRNIFQSDAPIAMLKAVHAIVHKN
                     ENAAAAYQLFLHEQN"
     gene            complement(647700..648719)
                     /locus_tag="YPTB_RS03110"
                     /old_locus_tag="YPTB0549"
     CDS             complement(647700..648719)
                     /locus_tag="YPTB_RS03110"
                     /old_locus_tag="YPTB0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66EZ2.1"
                     /note="with lsrACD is involved in the transport of
                     autoinducer 2 into the cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autoinducer 2-binding protein LsrB"
                     /protein_id="WP_011191662.1"
                     /db_xref="GI:499505022"
                     /translation="MRTQRLKKLALVCALGFACITTAQAAERIAFIPKLVGVGFFTSG
                     GKGAVDAGKALGVDVTYDGPTEPSVSGQVQLINNFVNQGYNAIVVSAVSPDGLCPALK
                     RAMQRGVKILTWDSDTKPECRSVYINQGTPNQLGSMLVDMAANQVKKEQAKVAFFYSS
                     PTVTDQNQWVNEAKKKIQQEHPGWEIVTTQFGYNDATKSLQTAEGILKAYGDLDAIIA
                     PDANALPAAAQAAENLKRANVAIVGFSTPNVMRPYVERGTVKEFGLWDVVNQGKISVY
                     VANEMLKKGDLNVGDKIDIPNIGVVEVSPNRVQGYDYEAKGNGIVLLPQRVIFTKENI
                     SKYDF"
     gene            complement(648764..649765)
                     /locus_tag="YPTB_RS03115"
                     /old_locus_tag="YPTB0550"
     CDS             complement(648764..649765)
                     /locus_tag="YPTB_RS03115"
                     /old_locus_tag="YPTB0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66EZ1.1"
                     /note="with IsrABC is involved with autoinducer 2 import;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autoinducer 2 import system permease LsrD"
                     /protein_id="WP_011191663.1"
                     /db_xref="GI:499505023"
                     /translation="MNLYRRYGWELTLAALLVLEILLFGLSNSRMLDINVLLFSTSDF
                     ICIGIVALPLTMVIVSGGIDISFGSTIGLCAIFLGIVFQAGVPMSVAIPLTVLVGALC
                     GLINAGLILYTGVNPLVITLGTLYLFGGSALLLSGLSGATGYEGIGGFPAAFTDFANQ
                     TLFGLPIPLVIFMLCVLLFWLLMHRTHSGRHVFLIGQSSRVARYSALPIARTLCMLYA
                     MTGVASAIAAILLVSYFGSARSDLGASFLMPAITAVVLGGANIYGGSGSILGTALAVL
                     LVGYLQQGLQMIGTPNQISSALSGALLILVVVGRSISLHRHLIYEWLQRRRSRKASA"
     gene            complement(649762..650817)
                     /locus_tag="YPTB_RS03120"
                     /old_locus_tag="YPTB0551"
     CDS             complement(649762..650817)
                     /locus_tag="YPTB_RS03120"
                     /old_locus_tag="YPTB0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66EZ0.1"
                     /note="with LsrADB is involved in the transport of
                     autoindiuce 2; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autoinducer 2 import system permease LsrC"
                     /protein_id="WP_011191664.1"
                     /db_xref="GI:499505024"
                     /translation="MLKFIQNNREGTALLAILTLFALLGIIDRNYFSLQTFTMIFSSA
                     QILILLAIGATLVMLTRNIDVSVGSITGLCAVTVGMALNAGFGLVASCLFALLVGMVA
                     GFFNGILVTWLRIPAIVATLGTLGLYRGLMLLLTGGKWIEGLPADLKSLSTPILFSIS
                     PIGWLTMLLILSMAWLLGNTAFGRSFYATGDNLQGARQLGVRTDSIRIFAFSMNGVMA
                     ALAGIVFASQIGFIPNQTGNGLEMKAIAACVLGGISLLGGTGTIIGAILGAFLLTQID
                     SVLVLLRLPAWWNDFIAGLVLLGVLVFDGRLRCAVERNIRQQKYARFTAQAIISDKKP
                     TVSDNNPAASNKKKAAL"
     gene            complement(650811..652394)
                     /locus_tag="YPTB_RS03125"
                     /old_locus_tag="YPTB0552"
     CDS             complement(650811..652394)
                     /locus_tag="YPTB_RS03125"
                     /old_locus_tag="YPTB0552"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66EY9.1"
                     /note="with LsrCDB is involved in the transport of
                     autoindiuce 2; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autoinducer 2 import ATP-binding protein LsrA"
                     /protein_id="WP_011191665.1"
                     /db_xref="GI:499505025"
                     /translation="MPHTVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLG
                     GNGAGKSTLMKIIAGILPPDTGVIEMNGQPCFNLTPAKAHQLGIYLVPQEPMLFANLS
                     VQENILFRLPKHQADKKKMAQLLKNLGCHLDLSVSAGSLEVADQQLVEIMRGLMRDSR
                     ILILDEPTASLTPAETHRLFSQIRMLLQQGVGVVFISHKLPEIRQLADWVSVMRDGGI
                     ALSGSTADFSTEDMIQAMTPEAQKGALTDSQKLWLELPGNRRAQSRAQSQQPVIHVHD
                     LSGEGFAHISFHVQAGEILGLAGVVGAGRTELAETLYGLRPASTGNVILEEVNITAMK
                     TANRLAAGLVYLPEDRQASGLYLDAPLSWNVCALAHDRQGLWTQPAQEAAVLERYRRA
                     LNIKFSHLEQPVRTLSGGNQQKLLIAKCLEANPLLLIIDEPTRGVDVSARSDIYQLIR
                     SIAEQQVAIIFISSDLEEVVQMADRVLVMHQGEINGALSGAAMNVDTIMHMAFGEHRS
                     VSEPQSGTASSAENKGTSC"
     gene            complement(652504..652710)
                     /locus_tag="YPTB_RS03130"
     CDS             complement(652504..652710)
                     /locus_tag="YPTB_RS03130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002221620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002221620.1"
                     /db_xref="GI:488150412"
                     /translation="MPVDLSYLFIFLICLSFLPAYLFSHCPSVRHRLKPLRNECLILI
                     DNHAISLMIIIEHILIKIFLFIKL"
     gene            652739..653752
                     /locus_tag="YPTB_RS03135"
                     /old_locus_tag="YPTB0553"
     CDS             652739..653752
                     /locus_tag="YPTB_RS03135"
                     /old_locus_tag="YPTB0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191666.1"
                     /note="regulates the transcription of lsr genes; involved
                     in autoinducer 2 uptake, biofilm formation and stress
                     responses; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011191666.1"
                     /db_xref="GI:499505026"
                     /translation="MIKEKPAVKEKPAVKEKPLSSNDEYKYPGNSMSEEELLARVAWF
                     YYHDGLTQGDIGELLGLARLKVSRLLEKGRQSGVIRVQINSRYEGCLELENTLQQHFG
                     LKHIRILPSLASLSISSRLGIGAAHLLMALIQPQQLLAVGFGETTMCALQHLSGFIAS
                     QQVRLVTLSGGVGSYMTGIGQLDAACQVSIIPAPLRASNAHVADTFRQENSVRDVMLA
                     ACAADIAVVGIGSVNQQKEATILRSGYISEGEQLMFSRKGAVGDILGYFIQADGALVP
                     DMQIHQELIGISLADLTTIPTVIGVAGGVEKADVIVAALRGRYVNALVTDEVTARAII
                     NLL"
     gene            653923..655515
                     /locus_tag="YPTB_RS03140"
                     /old_locus_tag="YPTB0554"
     CDS             653923..655515
                     /locus_tag="YPTB_RS03140"
                     /old_locus_tag="YPTB0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1JLP8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autoinducer 2 kinase LsrK"
                     /protein_id="WP_002230543.1"
                     /db_xref="GI:488159335"
                     /translation="MSQLDTTTPSGDYLMALDAGTGSVRAVIFDLNGNQIAAGQAEWL
                     HLPVPDVPGSMEFDLTTNWQLTCQCIRQALHLAKLPASAIRAVAACSMREGIVLYDRS
                     GTPIWACANVDARASREVSELKELHNNGFELEVYQCSGQTLALSAMPRLLWLAHYRPD
                     IYRQAGTLTMISDWLANMLSGELAVDPSNAGTTGMLDLVTRNWQPNLLEMAGLRADIL
                     SPVKETGTLLGHVTAKAAQECGLLAGTPVVMGGGDVQLGCLGLGVVHAGQTAVLGGTF
                     WQQVVNLPQPIIDPNMNTRINPHVIPGMVQAESISFFTGLTMRWFRDAFCAEEKLLAQ
                     RLGIDTYSLLEDMAARVPAGAYGVMPIFSDVMRFKSWYHAAPSFINLSLDPEKCNKAT
                     LFRALEENAAIVSACNLAQIAEFSGVKASSVVFAGGGAKGKLWSQILADVTGVPVKVP
                     VVKEATALGCAIAAGVGVGLYEALDKTGERLVRWEREYIPNTEHKALYQAAKTNWQAV
                     YTDQLGLVDCGLTTSLWKAPGL"
     gene            655861..657024
                     /locus_tag="YPTB_RS03145"
                     /old_locus_tag="YPTB0555"
     CDS             655861..657024
                     /locus_tag="YPTB_RS03145"
                     /old_locus_tag="YPTB0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS core heptosyltransferase"
                     /protein_id="WP_024063089.1"
                     /db_xref="GI:568134602"
                     /translation="MINTSNKTASPAGQLSAPASQTGASHLPEVLRNKEHVARILVIK
                     LRHFGDVLLTTPLLSTLKANYPQAKIDVLLYGGTQDMLRENKAINHAFIVDRGLKHAG
                     LKAQISGEKALFSALKKQHYDLILNLSDQWRAAAYCRLLKPTFSIGFHYPKRDNWLWR
                     YCHSTLVEIPNAAERHTVLNNLDILSPLQLTDIRTDVTMSYGPHDIERAKQLCQQHNI
                     EHYILIQPSARWKFKTWASESFSELINHLTQQGETVLLTGSKDQAELDYIAEIIAGCT
                     QPEKVINLSGQLALPELAVLIDNAKLFIGVDSVAMHMAAALQTPAVVLFGPSNLNQWH
                     PWQAPHTLLWAGNYRTLPHPNEIDTDTTDRYLNAIPVSDVIDAVDSWRVAKGN"
     gene            657072..658298
                     /locus_tag="YPTB_RS03150"
                     /old_locus_tag="YPTB0556"
     CDS             657072..658298
                     /locus_tag="YPTB_RS03150"
                     /old_locus_tag="YPTB0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen biosynthesis protein"
                     /protein_id="WP_011191668.1"
                     /db_xref="GI:499505028"
                     /translation="MTTLSPAIPVNRRSEMLCSIAALLLGISMPTNNQLMSVSLVLII
                     ISLIINRKSLDFKPLLTSPLVYLPAAMFVLLALSLLYQNNSYGPDMVGKYKKLLYILP
                     LALFFMNQPRLIKLFCTGFLVANAVILAGSLAVGVLHIPLSGVDPTNPTIFKLQITQN
                     FFMALAALLWLVLAFQHQGWKRWGYSVLVVAASYSILFLVLGRTGYVALIVGLGVWLF
                     FSLGNRQRLTLVVLGALAFAALIFIPNKATDRIVQGVDEIKVCMAASATDAADACNSS
                     MGQRSAFVVEAARLIKESPILGHGAGGFYYENKEVDYKVNNPHNQYLLETIQSGVIGL
                     FLFLAWVICCYRVIWQQTPALRNVLLAVLTSYMACNFFNSFLLDSSEGHLFMIFVAVL
                     AGYSVSGSGRLQVAKT"
     gene            658664..659932
                     /locus_tag="YPTB_RS03155"
                     /old_locus_tag="YPTB0557"
     CDS             658664..659932
                     /locus_tag="YPTB_RS03155"
                     /old_locus_tag="YPTB0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_011191669.1"
                     /db_xref="GI:499505029"
                     /translation="MIRTKINSGGLDVDFIRDQFPILKKQINGHPLVYLDNASTCQKP
                     QAVIDAITKCYCEYYANAHRGVHTLSQCATTAFEHVREQVRDFLHARSTDEVIFTRGT
                     TEAINLVATSWGKSYLHEGDEVLISALEHHSNLVPWQQICRVTGARLKVLPIEPSGVL
                     QIDSLEHLLSNRTRVLALSHVSNVLGTINPLAAIIQKVRIYDQMQQGKKEKTIVLIDG
                     AQAVPHISINVQELDADFYAFSGHKLYGPSGIGVLYGRNDILRKMLPWQYGGGMVADV
                     SFEQSTFVVPPRCFEAGTANIAGVIGLGAAITWLQNLGIGVIAEHEQILLKYVTDQLS
                     QFSCIRILGQVPLKAAVVAFIIKDIPARNIGLALDKQGIAVQVGRHCAQPLMNFFGLQ
                     ETVRVSFAVYNTLEEIDVFISALHEIINQH"
     gene            659979..661157
                     /locus_tag="YPTB_RS03160"
                     /old_locus_tag="YPTB0558"
     CDS             659979..661157
                     /locus_tag="YPTB_RS03160"
                     /old_locus_tag="YPTB0558"
                     /EC_number="1.3.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_011191670.1"
                     /db_xref="GI:499505030"
                     /translation="MNIDWTGATDIKAQYGCLIEEEINKETQYRDHNSIPIPNEIMRK
                     FANLGLFTYMLPKKFGGKEVGDAIWGRVLEDIGYLSSDTSFPFLISLRMSFISALIVT
                     EKKYFIEEYVSQLVSGSKFGAFAYTENADAFSFTSNAVRQSNGSGYILNGIKQFITGG
                     ATADLFFVFVRSESSDLQVFLVQRCDPGVEVIPRVMHGVHSLGIAQLNLNNVKLDKNR
                     LLVASDGLSFVQRYFLNCRRALLTTLFLGRARAIIEETIHYLQRTIRYDELLAEMQHV
                     QAAIGRMTIALETARAMVYHSLERQARKESDPYWDPISSAAKHYAIEQINMIVLTALK
                     LTGGWGYTEDSGLGRSHRDFSSMLAGADPQEKLEVDLGIRIIHDLQMLKQQKEALEDR
                     "
     gene            661159..661434
                     /locus_tag="YPTB_RS03165"
                     /old_locus_tag="YPTB0559"
     CDS             661159..661434
                     /locus_tag="YPTB_RS03165"
                     /old_locus_tag="YPTB0559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191671.1"
                     /db_xref="GI:499505031"
                     /translation="MKFKLSGNLAKFTNYKKELHIDIESSSTLKKLIDNLIEQYPALK
                     EVIYDKELKVKKGYLFSFNGQKINPNEFNEPIKNNDCIDIFTAIAGG"
     gene            661436..662272
                     /locus_tag="YPTB_RS03170"
                     /old_locus_tag="YPTB0560"
     CDS             661436..662272
                     /locus_tag="YPTB_RS03170"
                     /old_locus_tag="YPTB0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191672.1"
                     /db_xref="GI:499505032"
                     /translation="MSEERTVNTIYPIHTCLFTALQFHGRELLSLGMSNKWLWFENHF
                     NMSFPEFIKKYQQSNVAVAFEIEYIQPFDFFDAKTFDVSISKVRLRQKDSVFEFHHEF
                     TANNIIFARVALYWRILMLSGDDALTAHPGPLGKELIQLFLPEEIDPSRTVRAVSKQL
                     CEIEAEGQLITENYSNFTLFRHQCEVADQWSFVELPTLASAGREQLIISLEDDPENLS
                     STMGIPIKNIVAKLSCPFFLFDEGRVRTRAYLLNNQPVFVHHIFNISRADTLAAVVVE
                     SF"
     gene            662305..663531
                     /locus_tag="YPTB_RS03175"
                     /old_locus_tag="YPTB0561"
     CDS             662305..663531
                     /locus_tag="YPTB_RS03175"
                     /old_locus_tag="YPTB0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein"
                     /protein_id="WP_011191673.1"
                     /db_xref="GI:499505033"
                     /translation="MSKLANDIEFISLSPAEIGLYSRHLLIPSIGVKGQLALKNASVL
                     MVGAGGLGCPVLLYLAAAGVGRIGIIDADHIEISNVHRQILYRVVDKGKNKADVAKFR
                     LQALNPYIEIETYIDRLNVDNAEALISRYDIVVDGTDNFTTKYLINDACYFAGKPLVY
                     GAIMQFEGQVAVFNALDEQGGYGANYRDLYSDPPDAALAPNCAEAGVLGILPGIIGCF
                     QANEVIKLITGLGRSLSERLLIYDALDATTTELHFSACADNPLRDPNRPHVLEEIPAI
                     CNSPVVSDQFVISLDEFNDLMRDHVVIHLIDVREPHERKQVSIGGIHIPLAEIDGVEH
                     EYINDVPIILYCQSGVRSQKAAKILADKLQHAQIFSLKGGISAFLASNLYPELIANLA
                     LCQCIPNKPQDADLST"
     gene            664525..664644
                     /locus_tag="YPTB_RS03180"
     CDS             664525..664644
                     /locus_tag="YPTB_RS03180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002221618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041175487.1"
                     /db_xref="GI:752489467"
                     /translation="MHNIFIGIDSIVAWVSIYQFEFYTFLGERFWRVVFSVAM"
     gene            664671..664904
                     /locus_tag="YPTB_RS03185"
                     /old_locus_tag="YPTB0564"
     CDS             664671..664904
                     /locus_tag="YPTB_RS03185"
                     /old_locus_tag="YPTB0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209198.1"
                     /db_xref="GI:488137990"
                     /translation="MKYIYGVCFLLIVTLTTLFAFQNSGTVNLSLLFTQITLPMSVLI
                     VMIYFLGMFTGGLLITLLRALMRNMTQKTDKKV"
     gene            664956..666038
                     /locus_tag="YPTB_RS03190"
                     /old_locus_tag="YPTB0565"
     CDS             664956..666038
                     /locus_tag="YPTB_RS03190"
                     /old_locus_tag="YPTB0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005159139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_002209199.1"
                     /db_xref="GI:488137991"
                     /translation="MKIKTVVTLLITFLLAACDRTPPETVESVRPVKIFMVEDSGQNG
                     TRYFPARLQAGDETQLSFKRGGQLQELLVREGEQVKKGQKIAMLNDTDLSLRVRDRQS
                     TFNLARDQFNRFNTLQGRSAVSRADLDIRRAEMESAQAALDIARKELSDATIIAPFDG
                     IIANVNVRNHQVMAAGQPVATLSALDTLDVVFSVPERLFTTLDISNRNYKPTVLLNHM
                     PGREFIAEYKEHTTSTTSASQTFQVTLTMKRPADMPLLSGISGRVRINSGNLSGTDHP
                     TIIVPVEAVFNPDHAQLNDARVWVIKNDNDQMHVEERKVQVGQLVENGIQVTSGLADG
                     EQIVAAGTGELRPQQVVRAWVRERGL"
     gene            666038..669124
                     /locus_tag="YPTB_RS03195"
                     /old_locus_tag="YPTB0566"
     CDS             666038..669124
                     /locus_tag="YPTB_RS03195"
                     /old_locus_tag="YPTB0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter AcrB"
                     /protein_id="WP_011191676.1"
                     /db_xref="GI:499505036"
                     /translation="MKLTDNFINNNTRIWLTILLLGIGGIIAYLNIGRLEDPAFTIKT
                     AVVVTRYDGASAQQVEEEVTLPLENAIQELSYVDDVTSISSAGLSQITINIRAQYGAN
                     ELPQIWDELRRKISDNSVRLPPGASAPMVNDDFGDVYGFFFSLTGDGYSNQDLRNFAE
                     QLRRELVLVPGVGKVGIVGILPEEVQVEISRAQMTAAGITPQQLSDLLSRQNVVSDAG
                     QLQVGSESIRLHPTGEFQSVQELGNLLVSQPGSPKSVYLRDIATVTQGFGHSPTNIYR
                     ANGQPALALGISFAPNVNVVNVGNAIKSRLAQLEGERPSGMHINVFYDQSKEVEGAVN
                     GFILNFLLALLIVVVTLLIFMGVRSGVVIAISLALNVLGTLLIMWLFNIELQRVSLGA
                     LIIALSMLVDNAIVVVEGVVVGRQRGDSISTAIGNVVKRSKMPLLGATIIAILAFAPI
                     GLSNDATGEYCKSLFQVLLISLMLSWITALTLTPVFAKWAFQNQKQPEADADKPVKQP
                     YDGWLFRYYRVVLNKLLQHRSITLVLLAALLVASVIGFGHVRQSFFPPSNTPIFFVDI
                     WLPYGTDISYTEDIAAKIEQHIKQQKNVADTMTTIGQGAMRFMLTYNGQRHYPNYAQV
                     MVRTEQLEQIPGLIDEIESYMHDEYPQVDAQIKRIMFGPSNNSSIEARFIGPDPDVLR
                     TLAAQAEQAIIADPMADGARHDWQDRSKMIRPQFSDYLGRELGVDKREVDGTLRMSFG
                     GLPVGLYRDGTRLIPIVLRTPDSERLNAERLNDVMVWSQARQAFIPIDNVVTSFETEW
                     EDPLIMRLDRKRTLTVQTDPTHQGGETSSELLQRIKPGVEAITLPRGYELEWGGDYES
                     TKEAQRGIFISLPIAFLLMFVVTVLMFSSVRNALAIWLTVPLALIGVTFGFLLTGIPF
                     GFMALLGLLSLSGMLIRNGIVLVEEIGLQRQEKPLREAIIDASTARLRPIMLTAFTTV
                     LGLAPLLSDAFFQSMAVVIMFGLGFATVLTLLVLPVIYSSMNPEPKEKIHDEPVSE"
     gene            complement(669160..669353)
                     /locus_tag="YPTB_RS03200"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(669487..669819)
                     /locus_tag="YPTB_RS03205"
                     /old_locus_tag="YPTB0567"
     CDS             complement(669487..669819)
                     /locus_tag="YPTB_RS03205"
                     /old_locus_tag="YPTB0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002215229.1"
                     /db_xref="GI:488144021"
                     /translation="MKCISVPTSQEAMSRLDFDKCIDGDVIDLNITDEQYRSLVELGL
                     IRLMNDLFDICIDEFEDEKIVGVDSLTQARLLIENDFHPSENEAVNLLLSQVNKATEY
                     ETGLFFYF"
     gene            complement(669966..670304)
                     /locus_tag="YPTB_RS03210"
                     /old_locus_tag="YPTB0568"
     CDS             complement(669966..670304)
                     /locus_tag="YPTB_RS03210"
                     /old_locus_tag="YPTB0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032466994.1"
                     /db_xref="GI:694126411"
                     /translation="MLQLVMIRLWIIKDCTGASIAAGLTMRRLNPTSEIGQLETLATL
                     PEKLAERAARAQIFSQNWPSGDLGAAVNKFAGSDPFITVTKSGKQIYTNPTTGVQVVR
                     GFVRELFSPP"
     gene            670620..671705
                     /locus_tag="YPTB_RS03215"
                     /old_locus_tag="YPTB0569"
     CDS             670620..671705
                     /locus_tag="YPTB_RS03215"
                     /old_locus_tag="YPTB0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pectinesterase"
                     /protein_id="WP_002209202.1"
                     /db_xref="GI:488137994"
                     /translation="MPINALSKTLLLGLISFAALGEVSAAQYNAVVSAMAQGDEFSSI
                     NAALQSAPPDSSPFVIFLKKGVYTERLEVNRDNVTLKGEERDTTVIGANTAAGMLNPQ
                     GTKWGTSGSSTVLVNAANFTAENLTIRNDFDFPANQAKAEGDPTKLKDTQAVALLLAE
                     KSDKARFRQVKLEGYQDTLYSKTGSRSYFTDCDISGHVDFIFGSGVTVFDRCNIIARD
                     RRDISPPYGYITAPSTQNTAPYGLIVLNSRLTKEPGVPAKSFALGRPWHPTTAFDDGR
                     YADPAAIGQAVFINTVMDDHIYGWDKMSGKDKQGEKVWFYPQDSRFFEANNQGPGAEI
                     NEGRRQLSAEQLKAFTLPMIFPDWTVQ"
     gene            complement(672246..673418)
                     /locus_tag="YPTB_RS03220"
                     /old_locus_tag="YPTB0570"
     CDS             complement(672246..673418)
                     /locus_tag="YPTB_RS03220"
                     /old_locus_tag="YPTB0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011906423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_011191678.1"
                     /db_xref="GI:499505038"
                     /translation="MQSELNMNSHSYDQLLKSKHRLSLLLFLFLNASSAIFSMLSSSP
                     KTPAVTFPVVMIAVISLSAAAYLIFISKNDAGRNNYVDKSNYVDKSNHVDKNNYANKL
                     NLFSILIGLLWAWQIILKYEYLETNEDNYLLLSLFTIFFISTIALSDNFLAFCLHTAP
                     SAITVILLDDFHNIFRIIFTIMLPLIGFSLHHLMLRRTDNFTRKLVDHLSNEREKFSD
                     LSMIDPLTSLYNRRGLESKLETLLSQSPGNHYVLLLDIDHFKAYNDNYGHTMGDQALV
                     RISAAIRDAVRSRDIVVRYGGEEFLVLLTHVSEEYASQLAERVRQRVLGLDIPHVFNH
                     KVSTTVTLSAGISPLQAYDLAASLKAADEALYRAKRNGRNNIEFAKDELSNVQSSP"
     gene            673667..673999
                     /locus_tag="YPTB_RS03225"
     CDS             673667..673999
                     /locus_tag="YPTB_RS03225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002215232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012413464.1"
                     /db_xref="GI:501381898"
                     /translation="MILVMIIIIIWVGIIMITSTFAAYRSWGITGLLSRGMSSGWGIL
                     LPFTLLPVLGWVDISIGQLRILIVVAMLATVSMLYHVRLRHFLLLPSCLALLGGLVAL
                     MLMHGGVS"
     gene            complement(674169..674255)
                     /locus_tag="YPTB_RS03230"
                     /old_locus_tag="YPTB_RNA_84"
     tRNA            complement(674169..674255)
                     /locus_tag="YPTB_RS03230"
                     /old_locus_tag="YPTB_RNA_84"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(674219..674221),aa:Leu,seq:cag)
     gene            complement(674351..674437)
                     /locus_tag="YPTB_RS03235"
                     /old_locus_tag="YPTB_RNA_83"
     tRNA            complement(674351..674437)
                     /locus_tag="YPTB_RS03235"
                     /old_locus_tag="YPTB_RNA_83"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(674401..674403),aa:Leu,seq:cag)
     gene            complement(674534..674620)
                     /locus_tag="YPTB_RS03240"
                     /old_locus_tag="YPTB_RNA_82"
     tRNA            complement(674534..674620)
                     /locus_tag="YPTB_RS03240"
                     /old_locus_tag="YPTB_RNA_82"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(674584..674586),aa:Leu,seq:cag)
     gene            complement(674877..675920)
                     /locus_tag="YPTB_RS03245"
                     /old_locus_tag="YPTB0572"
     CDS             complement(674877..675920)
                     /locus_tag="YPTB_RS03245"
                     /old_locus_tag="YPTB0572"
                     /EC_number="2.1.1.171"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JJ89.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase C"
                     /protein_id="WP_011191679.1"
                     /db_xref="GI:499505039"
                     /translation="MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRV
                     HTNQYHHWQLLSNTLEENVQFGLLATAETLAACDTLIYYWPKSKQEAQFQLANLLSIL
                     PVGTDIFVVGENRSGVRSAEEMLADFAQLAKIDSARRCGLYHGRLDKQPEFDADAWWE
                     SYQVGSVTVKTLPGVFSRDSLDSGSHLLLSTFNEPFKGSVLDVGCGAGVLASVLAQQS
                     PKIKWTLSDVSAAAIEASRATLAVNNIEAQVIASNVYSDIKGRFEMIISNPPFHDGIQ
                     TSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYPALLDAAFGSHEVLAQNGRFKVYQA
                     TVGRPPRDPKKKR"
     gene            676033..676470
                     /locus_tag="YPTB_RS03250"
                     /old_locus_tag="YPTB0573"
     CDS             676033..676470
                     /locus_tag="YPTB_RS03250"
                     /old_locus_tag="YPTB0573"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191680.1"
                     /note="with the chi subunit binds to single-strand binding
                     (SSB) protein and acts as a bridge between the DnaX clamp
                     loader complex and the SSB; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit psi"
                     /protein_id="WP_011191680.1"
                     /db_xref="GI:499505040"
                     /translation="MASRRDLLLQQLGITQWVLRRPAVLQGEIAIHLPEDTRLLIVAQ
                     QLPEHGDPLLCDVLRSLGLTPHQVYALTPDQVAMLPEDTQCNSWRLGISEPLAVAGAQ
                     LHSPELAGLYQDAGAKRALWQQICHYEADFYPDASRSGHSVPN"
     gene            676415..676858
                     /gene="rimI"
                     /locus_tag="YPTB_RS03255"
                     /old_locus_tag="YPTB0574"
     CDS             676415..676858
                     /gene="rimI"
                     /locus_tag="YPTB_RS03255"
                     /old_locus_tag="YPTB0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002216075.1"
                     /note="alanine acetyltransferase that specifically
                     acetylates ribosomal protein S18; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal-protein-alanine N-acetyltransferase"
                     /protein_id="WP_002216075.1"
                     /db_xref="GI:488144867"
                     /translation="MKQISILTPADLATAYQIEQASHAFPWTEKTFASNQGDRYLNFK
                     LSIGQEMAGFAITQIVLDEATLFNIAIDPQYQRQGYGRLLLEHLIEQLEARNIVTLWL
                     EVRASNARAIALYESLGFNEVSVRRNYYPSANGREDAIMMALPMA"
     gene            677036..678625
                     /gene="prfC"
                     /locus_tag="YPTB_RS03260"
                     /old_locus_tag="YPTB0575"
     CDS             677036..678625
                     /gene="prfC"
                     /locus_tag="YPTB_RS03260"
                     /old_locus_tag="YPTB0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080589.1"
                     /note="stimulates the release of release factors 1 and 2
                     from the ribosome after hydrolysis of the ester bond in
                     peptidyl-tRNA has occurred; GDP/GTP-binding protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="WP_011191681.1"
                     /db_xref="GI:499505041"
                     /translation="MSPSEYALEVAKRRTFAIISHPDAGKTTITEKVLLFGHAIQTAG
                     TVKGRGSSHHAKSDWMEMEKQRGISITTSVMQFPYGGCLVNLLDTPGHEDFSEDTYRT
                     LTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDREIRDPMEVLDEVER
                     ELNIACSPITWPIGCGKSFKGVYHLHKDETYLYQSGKGHTIQEVRIVKGLNNPDLDVA
                     VGEDLAKQFRQELELVQGASHEFDHEAFLSGDLTPVFFGTALGNFGVDHMLDGLVEWA
                     PAPMPRKTDTRVVVASEEKFTGFVFKIQANMDPKHRDRVAFMRVVSGRFEKGMKLRQV
                     RTKKDVVISDALTFMAGDRSHVEEAYAGDIIGLHNHGTIQIGDTFTQGEDMKFTGIPN
                     FAPELFRRIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPLSNNDLIVGAVGVLQFEVVS
                     SRLKSEYNVEAVYESVNVSTARWVECNDVKKFEEFKRKNELNLALDGGDNLSYIAPTM
                     VNLNITQERYPDVIFRKTREH"
     gene            678953..679567
                     /locus_tag="YPTB_RS03265"
                     /old_locus_tag="YPTB0576"
     CDS             678953..679567
                     /locus_tag="YPTB_RS03265"
                     /old_locus_tag="YPTB0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191682.1"
                     /db_xref="GI:499505042"
                     /translation="MKNTQFSRSVMAIVLGSALISGSVLAEDTLLNKAASTVDSTGAK
                     IDSSMKKVDNYMSDSAVTAKVKSALLEEKSLKSTDISVETSNGVVTLSGFLNSQAEIE
                     TAVEIAGNVEGVKSVSDKLHVKDQKSQSVSEYAGDAATTSSVKAKLLADDIVPSRKIK
                     VETTDGVVQLSGDVENKAQSERAESIAKAVNGVKSVKNDLNIKP"
     gene            679734..679895
                     /locus_tag="YPTB_RS03270"
                     /old_locus_tag="YPTB0577"
     CDS             679734..679895
                     /locus_tag="YPTB_RS03270"
                     /old_locus_tag="YPTB0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66EW4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191683.1"
                     /db_xref="GI:499505043"
                     /translation="MFRWGIIFLIIALIAAALGFGGLAGTAAWAAKVVFVVGIILFLI
                     SLFTGRKRL"
     gene            679969..681240
                     /locus_tag="YPTB_RS03275"
                     /old_locus_tag="YPTB0578"
     CDS             679969..681240
                     /locus_tag="YPTB_RS03275"
                     /old_locus_tag="YPTB0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016583114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011191684.1"
                     /db_xref="GI:499505044"
                     /translation="MVGYRIPITLGNIEPLAYKPYQPGKMALVCEGGGQRGIFTAGVL
                     DEFHRARFNPFDLMIGTSAGAQNLSAFICGQPGYARRVITRYTTTANFFNPLRFVRGG
                     NLIDLDWLVDITSQQYPLAFDHAEQYLRQGREFLMCACRSDDFEPTYISPTRENWLTA
                     IKASSAIPGLYRQGVELDGVSYLDGGISDAIPVEEAYRRGAETIVVIRTVPSQAHYTP
                     QWFKRIEQWLSESSLQQLVRIMQQHERSYHRIQQFIEKPPGDVRIFEIFPSKPLASKA
                     LGSGAVALNRDYHLGRRCGRYFLATIGRWLLPRESLGDSDKTSISLSRHIIQPQNIIQ
                     TPNVFQTKNINQLNNTYDYSGSKERFTAVFSTEPSVTLSDLTAPSEVQATAAQINEPL
                     DPTSLTVVDTEQAEANSLPVDITLPPNLTKK"
     gene            681277..682065
                     /locus_tag="YPTB_RS03280"
                     /old_locus_tag="YPTB0579"
     CDS             681277..682065
                     /locus_tag="YPTB_RS03280"
                     /old_locus_tag="YPTB0579"
                     /EC_number="3.1.21.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNAse"
                     /protein_id="WP_011191685.1"
                     /db_xref="GI:499505045"
                     /translation="MPYFIDTHCHFDFPPFTGDEAASLACAAEANVRQLIVPSVKAAY
                     FSRILALADRYPPLFAALGLHPLYIAEHEDADLAALASHLADKSPKLVAIGEIGLDLY
                     MDEPQFPHQLVILNMQLELAKQHDLPVILHSRRSHDPLAAALRKAALPRAGVIHGFAG
                     SLAQAQAFIRLGYYIGVGGTITYKRAQKTRHVMASLPLSSLLLETDAPDMPLASFQGQ
                     ANRPERAANVFAALCELRPEPADEIAAELMCNSQRLFSLPPLRP"
     gene            682594..683871
                     /locus_tag="YPTB_RS03285"
                     /old_locus_tag="YPTB0580"
     CDS             682594..683871
                     /locus_tag="YPTB_RS03285"
                     /old_locus_tag="YPTB0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002220251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside transporter NupC"
                     /protein_id="WP_032466618.1"
                     /db_xref="GI:694126023"
                     /translation="MDMLMSLVGMAVLILIAVLLSSNARAINLRTVIGAFIIQVVIGA
                     LVLYVPVGRRILGGMSEGVANVIAYGNEGISFIFGGLVSDKMFEVFGSGGFVFALRVL
                     PVIVFFSSLIAVLYYLGVMQIVIKVLGGGLQKLLGTSRTESLSATANIFVGQTEAPLV
                     VRPYIATMTQSELFAVMCGGLASVAGSVLAGYAQMGVPLEYLIAASFMAAPGGLLFAK
                     LMVPETEQTHDKVDAIALIAEEDRPANVIDAAASGAASGMQLALNVGAMLLAFIALIA
                     LLNGILGGIGGWFDYPQLSLELILGWVFSPIAYLIGVPWSEAMVAGSFIGQKIIVNEF
                     VAFMNFGQYLQADELVKAAGLQVLSEHTKAIISFALCGFANLSSVAILLGGLGSMAPN
                     RRHDIARFGLKAVAAGTLSNLMSATIAGFFLAL"
     gene            684500..685297
                     /locus_tag="YPTB_RS03290"
                     /old_locus_tag="YPTB0581"
     CDS             684500..685297
                     /locus_tag="YPTB_RS03290"
                     /old_locus_tag="YPTB0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004716349.1"
                     /note="catalyzes the formation of D-glyceraldehyde
                     3-phosphate and acetaldehyde from
                     2-deoxy-D-ribose-5-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribose-phosphate aldolase 2"
                     /protein_id="WP_002216078.1"
                     /db_xref="GI:488144870"
                     /translation="MTDLTACAHLNDYAKRALSLMDLTTLNDDDTDEKVIALCHQAKS
                     PAGNTAAICIYPRFIPVARKALREQGTPEIRIATVTNFPHGNDDVAIALAETRAAIAY
                     GADEVDVVFPYRALMAGNDKIGFELVKTCKEACAAANVLLKVIIETGELKQAHLIRQA
                     SEIAIKAGADFIKTSTGKVPVNATLESADIMIRTIRELGVGETVGFKPAGGVRTAEDA
                     AQFLQLADQLMGEGWADARHFRFGASSLLASLLTTLGHQSNANSSGY"
     gene            685418..686740
                     /locus_tag="YPTB_RS03295"
                     /old_locus_tag="YPTB0582"
     CDS             685418..686740
                     /locus_tag="YPTB_RS03295"
                     /old_locus_tag="YPTB0582"
                     /EC_number="2.4.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004876072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine phosphorylase"
                     /protein_id="WP_011191687.1"
                     /db_xref="GI:499505047"
                     /translation="MFLAQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAM
                     TIYFHDMSMPERVALTMAMRDSGTVLNWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMV
                     AACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFRKIIQNVGVAIIGQTSSL
                     APADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLSA
                     DLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGEYRNPRLLEVT
                     MALCVEMLLSGGLAHDEADARAKLQAVLDNGKAAEVFGRMVAAQKGPVDFVERYDSYL
                     PVATLSKPVFAEQTGIITAMDTRALGMAVVALGGGRRRATDPIDYSVGLTEMARLGTR
                     VDGQQPLAVIHANNEDDWQQAAEAVRAAITLGNNAPEETPVIYRRITE"
     gene            686872..688095
                     /locus_tag="YPTB_RS03300"
                     /old_locus_tag="YPTB0583"
     CDS             686872..688095
                     /locus_tag="YPTB_RS03300"
                     /old_locus_tag="YPTB0583"
                     /EC_number="5.4.2.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66EV8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopentomutase"
                     /protein_id="WP_011191688.1"
                     /db_xref="GI:499505048"
                     /translation="MKRTFIMVLDSFGIGASADAKKFGDEGADTLGHIAEACARGEAN
                     VGRSGPLTLPNLSRLGLGKAAEESTGTFPVGLDKNADIIGAYGYASELSSGKDTPSGH
                     WEIAGVPVLFDWGYFSDVENSFPQELLDKLVKRANLPGYLGNCHSSGTVILDQLGEEH
                     MKTGKPIFYTSADSVFQIACHEETFGLDRLYELCEIAREELTDGGYNIGRVIARPFIG
                     DKPGHFQRTGNRHDLAVEPPAPTMLKKLVDEKGGEVVSIGKIADIYAQVGITQKVKAT
                     GLDALFDATIEEMKKAGDNTIVFTNFVDFDSSYGHRRDVAGYAAALELFDRRLPELMA
                     LVKEDDILILTADHGCDPTWPGTDHTREHIPVLVYGPKVKPGSLGHRETFADIGQTVA
                     AYFGLSPMDYGKNML"
     gene            688220..688939
                     /gene="deoD"
                     /locus_tag="YPTB_RS03305"
                     /old_locus_tag="YPTB0584"
     CDS             688220..688939
                     /gene="deoD"
                     /locus_tag="YPTB_RS03305"
                     /old_locus_tag="YPTB0584"
                     /EC_number="2.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIQ2.1"
                     /note="catalyzes the reversible phosphorolysis of
                     ribonucleosides and 2'- deoxyribonucleosides to the free
                     base and (2'-deoxy)ribose-1- phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine nucleoside phosphorylase"
                     /protein_id="WP_011191689.1"
                     /db_xref="GI:499505049"
                     /translation="MATPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVR
                     GMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLR
                     DVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLF
                     YTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGEQTTAAER
                     QTTFNDMIEIALESVLLGDNA"
     gene            complement(689051..689752)
                     /locus_tag="YPTB_RS03310"
                     /old_locus_tag="YPTB0585"
     CDS             complement(689051..689752)
                     /locus_tag="YPTB_RS03310"
                     /old_locus_tag="YPTB0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIQ1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein Smp"
                     /protein_id="WP_002209218.1"
                     /db_xref="GI:488138010"
                     /translation="MARAKLKFRLHRTAIVLICLALLVLLMQGASYFSLSHQLARSEQ
                     VEELAQTLAKQVAFSLSPIMDSGDDNIDSQKVDAILQQLTQSSRILDASVYQIDGTLV
                     ASAGENVKVRDRLALDGKRPGSYFNHQIVEMIAGNSGPSGFLRMTLDTHVLATESKQV
                     DNTTNLLRLMILVALAVGIILARTLLQGRRSRWQQSPYLLTANIPVKEEDESEDDTPE
                     ALVGQAETDHKPADK"
     gene            689986..690966
                     /gene="serB"
                     /locus_tag="YPTB_RS03315"
                     /old_locus_tag="YPTB0586"
     CDS             689986..690966
                     /gene="serB"
                     /locus_tag="YPTB_RS03315"
                     /old_locus_tag="YPTB0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304614.1"
                     /note="catalyzes the formation of serine from
                     O-phosphoserine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine phosphatase"
                     /protein_id="WP_002209219.1"
                     /db_xref="GI:488138011"
                     /translation="MSNSLTYCDLPSEIYQWPGLPLSLSGDEVMPLDYRAGHTGWLLY
                     GRKLDKQRITDFQRQLGAAMVIVSAWCVEDYQVIRLAGSLTPRIKTLADESGLDVAPL
                     GAIPHLRTPGLLVMDMDSTAIQIECIDEIAKLAGVGDEVAAVTERAMQGELDFSASLR
                     QRVAALKGADANILKQVRDDLPLMPGLVSLVRKLQALDWHVAIASGGFTYYAEYLRDK
                     LRLVHVAANELEIKDGKLTGCVLGPIVDAQYKADTLIKLAEKLNIPLAQTIAIGDGAN
                     DLKMMQVAGLGLAFHAKPKVYAKAKVAIRHGDLLSVLCILTGSLKHESGK"
     gene            691085..692467
                     /locus_tag="YPTB_RS03320"
                     /old_locus_tag="YPTB0587"
     CDS             691085..692467
                     /locus_tag="YPTB_RS03320"
                     /old_locus_tag="YPTB0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209220.1"
                     /note="Sms; stabilizes the strand-invasion intermediate
                     during the DNA repair; involved in recombination of donor
                     DNA and plays an important role in DNA damage repair after
                     exposure to mutagenic agents; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_002209220.1"
                     /db_xref="GI:488138012"
                     /translation="MAKAPKRAFVCNECGADYPRWQGQCSACNAWNTITEVRLAAVAS
                     SSRNDRFVGYAGDAGVSRVQKLSDISLEELPRFSTGFLEFDRVLGGGVVPGSAILIGG
                     NPGAGKSTLLLQTLCKLSENMKTLYVTGEESLQQVAMRAHRLGLPTAGLNMLSETSIE
                     QICLIAEQEQPRLMVIDSIQVMHMADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMV
                     GHVTKDGSLAGPKVLEHCIDCSVMLDGDGDSRFRTLRSHKNRFGAVNELGVFAMTEQG
                     LREVSNPSAIFLSRGDEVTAGSSVMVVWEGTRPLLVEIQALVDHSMMSNPRRVAVGLE
                     QNRLAILLAVLHRHGGLQMSDQDVFVNVVGGVKVTETSADLALLMSLVSSLRDRPLPQ
                     DLVVFGEVGLAGEIRPVPSGQERISEAAKHGFKRAIVPYANMPKKPLPNMQVFGVKKL
                     ADALAVLEDL"
     gene            692626..693897
                     /locus_tag="YPTB_RS03325"
                     /old_locus_tag="YPTB0588"
     CDS             692626..693897
                     /locus_tag="YPTB_RS03325"
                     /old_locus_tag="YPTB0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105707.1"
                     /note="catalyzes the formation of NAD(+) from nicotinamide
                     ribonucleotide; catalyzes the formation of nicotinamide
                     mononucleotide from nicotinamide riboside; also has a
                     regulatory function; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinamide-nucleotide adenylyltransferase"
                     /protein_id="WP_002209221.1"
                     /db_xref="GI:488138013"
                     /translation="MLQFDYLKTAIKQKGCTLQQVAEASGMTKGYLSQLLNDKIKSPS
                     AQKLEALHRFLGLEFPRREKKVGVVFGKFYPLHTGHIYLIQRACSQVDELHVILCHDE
                     PRDRELFENSSMSQQPTVSDRLRWLLQTFKYQKNIHIHSFDEHGIEPYPHGWDVWSRG
                     VKAFMNEKGIVPSFIYSSESQDAPRYREQLGIETILIDPQRSFMNISGRQIRRDPFRY
                     WDYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGREYVFSHLGGDE
                     MALQYSDYDKIALGQAQYVDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALI
                     DEYRFDLVILLENNTPWVADGLRSLGSDRDRKSFQNLLEQMLRDNNIEYVHVESADYD
                     ARFLRCVELVQQLLAADPQRLARPSVLTDAR"
     gene            694054..695184
                     /locus_tag="YPTB_RS03330"
                     /old_locus_tag="YPTB0589"
     CDS             694054..695184
                     /locus_tag="YPTB_RS03330"
                     /old_locus_tag="YPTB0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002218755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein Fic"
                     /protein_id="WP_011191690.1"
                     /db_xref="GI:499505050"
                     /translation="MGENIWVWQQKKWPNFYWDEALIQPQLRHARFKLGQLLGENRTN
                     TSAENATKTLDILLANIIASSKIENEPLNIRSVRSSLAKRLGMILEDNYPTSDRTDGL
                     AAMMLDAINECKADLTLERLYQWHEWLFPNDLWSLTPMKAGQLRGQEPMQVVSGRIGK
                     ETVHFEAPPQAILFDEIEQFISWFNLSRSDSFLDPLLRAAIVHFWFVTLHPFEDGNGR
                     ITRALTDMALSQADSQSIHLYAMSVAILDNREAYYAILEQGQRGNLDITPWLLWFIAT
                     LEQSLDQASKGIEHTLAKTSFWLKHNGSGLSPEQVKVLNRLLDGGENGFSAGINASQY
                     QKVAKVSKATATRHLADLLARECIEKLPGGGRNTRYQVKYPD"
     gene            complement(695345..697012)
                     /locus_tag="YPTB_RS03335"
                     /old_locus_tag="YPTB0590"
     CDS             complement(695345..697012)
                     /locus_tag="YPTB_RS03335"
                     /old_locus_tag="YPTB0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016255814.1"
                     /note="ChvD; in Agrobacterium tumefaciens, mutations in
                     both Walker boxes were found to affect virulence; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter ATP-binding protein"
                     /protein_id="WP_011191691.1"
                     /db_xref="GI:499505051"
                     /translation="MAQYVYTMHRVGKVVPPKRHILKNISLSFFPGAKIGVLGLNGSG
                     KSTLLRIMAGLDTEIEGEARPQPGIKIGYLPQEPKLNLEQTVRESVEEAVGEVKRALT
                     RLDEVYALYADPDADFDKLAKEQGELEAIIQSHDGHNLDNQLERAADALRLPPWDAKI
                     ANLSGGERRRVAICRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHD
                     RYFLDNVAGWILELDRGEGIPWEGNYSSWLEQKNARLAQEASSEAARRKSIEKELEWV
                     RQNPKGRQAKGKARLARFEELNSVEYQKRNETSELFIPPGPRLGDKVLEVEHLSKSYG
                     DRLLIDDLTFALPKGAIVGIIGPNGAGKSTLFRMLSGQEQPDSGTISLGDTVQLASVD
                     QFRDNMDDSKTVWEEVSGGQDIMKIGNFELPSRAYVGRFNFKGVDQGKRIGELSGGER
                     GRIHLAKLLQVGGNMLLLDEPTNDLDIETLRALENALLEFPGCAMVISHDRWFLDRIA
                     THIIDYQDEGKVEFFEGNFTEYEEWKKRTLGAEALEPHRIKYKKMTK"
     gene            complement(697195..697701)
                     /locus_tag="YPTB_RS03340"
                     /old_locus_tag="YPTB0591"
     CDS             complement(697195..697701)
                     /locus_tag="YPTB_RS03340"
                     /old_locus_tag="YPTB0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein OmpA"
                     /protein_id="WP_011191692.1"
                     /db_xref="GI:499505052"
                     /translation="MQKMQNKRLIQRIWVSFLAMGFMLLVGCQAKPQGLTPDQITALQ
                     EQGFKLTDNGWEFGLANKVLFDSDVKKLNSEGMQTVQKIGRILSDVGIKHMRVDGHTD
                     SVGKDDYNQQLSYQRALAVADTLATVGIPKSNIDVRGRGKLEPVADNRTSKGRAENRR
                     VAIIITAS"
     gene            complement(697707..699008)
                     /locus_tag="YPTB_RS03345"
                     /old_locus_tag="YPTB0592"
     CDS             complement(697707..699008)
                     /locus_tag="YPTB_RS03345"
                     /old_locus_tag="YPTB0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_002209224.1"
                     /db_xref="GI:488138016"
                     /translation="MNTIKNQSMKPKKNHNSAEKLPTLAGVLRRIHLSVAIVSVVTAC
                     IFLTVAALFALRVYVDHNLHLIARAISYTTEAAVVFGDNVEANELLALIASNEEVAEA
                     KIIDKHNRQIAYWALPDDGPIHHMEQIVARWILPAPVVLPMFHAGDEIGKIVIVGHGG
                     SLLRFLLQGLAGMLACLTVSTLVALFLSRRMLLGIVGSLKRITEVAHNVSRHRSFGQR
                     VPSAKVAELNELSNDFNGLLEELEVWQKHLTQENDSLAYRAAHDSLTGLANRTFFEGR
                     LSRTLNDCQPGEHTAVLFLDGDHFKDVNDNYGHAAGDLVLTTIAVRIRALLRETDLVA
                     RLGGDEFAVLLTPIHNLDDVLTIADHIIDSMALPIILAEGCEITVSLSIGIAVYPDHA
                     QTPEKLLQRADEAMYQAKKNFRSGKRIFAYQPNTTNTESLG"
     gene            complement(699005..699628)
                     /locus_tag="YPTB_RS03350"
                     /old_locus_tag="YPTB0593"
     CDS             complement(699005..699628)
                     /locus_tag="YPTB_RS03350"
                     /old_locus_tag="YPTB0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209225.1"
                     /db_xref="GI:488138017"
                     /translation="MTTATCATNRVSDEHHEPPHRRIVRSRWWGVYLFLLSLLVAVPT
                     PLLAASNINADILRERSDAAARMVLGIISYSRWPVAPPVIRLCVISPTDYAEMLFNPA
                     LMETTHPVQTQRYSLPNNSLNSKCDVVYLGHIELQQRQQLSIQLNGTPILTISEDYNE
                     CTFGSVFCLLLNDKQVSFKVNMDALARGGVRIHPSVLQLARKKANAR"
     gene            complement(700003..702729)
                     /locus_tag="YPTB_RS03355"
                     /old_locus_tag="YPTB0594"
     CDS             complement(700003..702729)
                     /locus_tag="YPTB_RS03355"
                     /old_locus_tag="YPTB0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonate dehydratase"
                     /protein_id="WP_011191693.1"
                     /db_xref="GI:499505053"
                     /translation="MQNSSNPKSASPPPEGKAWYQLTVEESLQHLNSREEGLSQKEAQ
                     ERLAQYGPNALPARKTKHPLLQFLAHFNDVLIYILLAAALVKGLMGHSVDTIIILCVA
                     VINALIGFIQENKAEKSLKSIQNMLSSKAVVIRDGKAQTIDAQNLVPGDIVTLRPGDK
                     IPADLRLLEAHNLQIEEAILTGESTVVEKQIGVIENESVIGDRKNLLFSGTTISAGTA
                     KGVVIASGGDTELGHINQMMATVESTRTPLLQQMDRLGKAIFILILVMMAILFVFAFI
                     LRDLPVDELLLALISLAVASVPEGLPAIISIILSLGVQAMARNRAIIRKLPTVETLGA
                     MTVVCSDKTGTLTMNEMTVKAVILADHCYRVEGESYEPVGNIYPEGREQQAELDTNKA
                     LKTFITAVNLCNDSQIQQNEQGHWTITGGPTEGALKVLAAKSGIKLDHVTQHGKIPFD
                     SAYKYMATSHQVQSDNSIFLTGAPDVLFTFCQQELTDSGVAPFRRDYWEAEMARYAKQ
                     GLRMVAAAFRPTDQPVNELDHKDIQQGMVFVGIAGMMDPPRPEAIDAIATCQQAGIRV
                     KMITGDHQETAMAIGAMLGIGNGTDSITGSQLEHMDDQQLAEAAVRYDIFARTSPEHK
                     LRLVKALQEKGEIVGMTGDGVNDAPALKQADVGIAMGIKGTEVTKEAADMVLSDDNFA
                     TIASAVEEGRRVYDNLKKTILFVLPTNLAQGLLIIFAILAGAVIPLTPLQILWMNMAT
                     STTLSFGLAFEPAEKGIMRRKPRDPSRHVLDGHAIWRIGFVGTLIACSAFALEAYLEP
                     RGYSTEFIRTVLMQTLVTAQWIYMFNCRVMDRFPLNKEVFVNKGLWLVSGVLVLLQLA
                     IIYLPFMNTAFGTAPLPAYYWGITLLVAIAIFIIVEIEKWVIGRFKGMNNPV"
     gene            703299..705218
                     /locus_tag="YPTB_RS03360"
                     /old_locus_tag="YPTB0595"
     CDS             703299..705218
                     /locus_tag="YPTB_RS03360"
                     /old_locus_tag="YPTB0595"
                     /EC_number="3.2.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209227.1"
                     /note="catalyzes the cleavage of the glycosidic bonds
                     between N-acetylmuramic acid and N-acetylglucosamine
                     residues in peptidoglycan; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein transglycosylase"
                     /protein_id="WP_011191694.1"
                     /db_xref="GI:499505054"
                     /translation="MGKWRYLAIGVCLMATSGVTFADSLDAQRQRYQQVKLAWDSNQM
                     DTVAQLMPTLRDYPLYPYLEYRQLTQDLSQVSTAQVKDFLNRHPTLPPAKSLPSRFVN
                     ELARREDWRGLLTFSPTAPKPVAARCNYYYAKWATGEQSVAWEGASEIWLNGQSLPGS
                     CDKLFSVWQQAGHQTPLATLARMKLALKEGNASLVSYLLKQLPADYQTMGTALAKLQS
                     DPSSVESFARTVGPTDFTRSATTIAFTRLARQDVENARLMIPSLVRLQKMSDSEKLEL
                     EEAVAWRLMGNDATYEQAKWRDQVALRSHSTSLLERRIRMSLGSGDRQGLATWLARLP
                     AEAQDKDEWRYWRASLLLEQGKKAEGEAILRSLTKERGFYPMVAAQKLNIPYPIKVQV
                     AAKPDVSLAQRPEIARVRELMYWNMDNQARAEWSYLVASRSKAEQEALARYAFDQKWA
                     DLSVQATIVAKLWDHLEERFPMAWTKEFRQFTEDKGITPSYAMAIARQESAWNPKAQS
                     PVGATGLMQVMPRTAEHTVKRNNIAGYLNSSQLLDPVTNIEIGTYYLEEVYQQFGRNR
                     ILSSAAYNAGPSRVNTWLGNSGGQVDAVAFIESIPFSETRGYVKNVLAYDAFYRHFMN
                     RPAKVLSDAEWQRRY"
     gene            705474..705866
                     /locus_tag="YPTB_RS03365"
                     /old_locus_tag="YPTB0596"
     CDS             705474..705866
                     /locus_tag="YPTB_RS03365"
                     /old_locus_tag="YPTB0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Trp operon repressor"
                     /protein_id="WP_002209228.1"
                     /db_xref="GI:488138020"
                     /translation="MTKQFLTDEKQVSDSLNRQTAGNPYSAADPALSAEDNQHWLSFV
                     ALLQNAITQDLHLPLLQLMLTPDERTALGTRVRIIEELMRGELSQRELKSQLGAGIAT
                     ITRGSNSLKTAPPQLKSWLEAQLLANKR"
     gene            complement(705863..706405)
                     /gene="yjjX"
                     /locus_tag="YPTB_RS03370"
                     /old_locus_tag="YPTB0597"
     CDS             complement(705863..706405)
                     /gene="yjjX"
                     /locus_tag="YPTB_RS03370"
                     /old_locus_tag="YPTB0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7FMF9.1"
                     /note="pyrophosphatase; has activity against dUTP and
                     dITP; the crystal structure of the Vibrio protein showed
                     similarity to Methanococcus janaschii Mj0226; in Vibrio
                     cholerae this gene is part of the Mba operon that is
                     involved in regulation and maintenance of biofilms; in
                     Escherichia coli overexpression of this gene leads to
                     resistance to an HMP analog; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="non-canonical purine NTP phosphatase"
                     /protein_id="WP_011191695.1"
                     /db_xref="GI:499505055"
                     /translation="MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQ
                     PIGSTETRIGARQRVKNARQVRPEADFWVGIEAGIEDNMTFAWMVIEHLQARGESRSA
                     SLMLPDIILQGIRQGRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALLL
                     ALVPFHNEIYQRPSPSKPAI"
     gene            706515..707162
                     /locus_tag="YPTB_RS03375"
                     /old_locus_tag="YPTB0598"
     CDS             706515..707162
                     /locus_tag="YPTB_RS03375"
                     /old_locus_tag="YPTB0598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002357076.1"
                     /note="catalyzes reactions involving the transfer of
                     phospho groups between the three carbon atoms of
                     phosphoglycerate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase GpmB"
                     /protein_id="WP_002209230.1"
                     /db_xref="GI:488138022"
                     /translation="MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVR
                     NQGITHIISSDLGRTQQTAKIIADACGLTMVTDPRLRELNMGVLENRPIDSLTPEEEQ
                     WRKQMVNGTEGARIPEGESMTELGRRMHAALDSCLELPAGSKPLLVSHGMALGCLLST
                     LLGLPAHAERRLRLRNCSLSRVDYQESPWLASGWVIESAGDTAHLDMPALDELQR"
     gene            complement(707159..708025)
                     /locus_tag="YPTB_RS03380"
                     /old_locus_tag="YPTB0599"
     CDS             complement(707159..708025)
                     /locus_tag="YPTB_RS03380"
                     /old_locus_tag="YPTB0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080567.1"
                     /note="AraC family; binds to the right arm of the
                     replication origin oriC; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RobA family efflux pump transcriptional
                     activator"
                     /protein_id="WP_002209231.1"
                     /db_xref="GI:488138023"
                     /translation="MDQASIIRDLLSWLESHLDQPLALDNVAAKAGYSKWHLQRMFKD
                     VTGNAIGAYIRARRLSKAAVALRLTSRPILDIALQYRFDSQQTFTRAFKKQFAQTPAL
                     YRRAEDWHSSGICPPIRLGTYTLPQPEFITLPEQHLVGITQSYSCTLEQISTHRAELR
                     LHFWQQYLGDADQLPPVLYGLHHSRPNPEKDDEQEIFYTTAIEPQHIPCNVPEGQPVI
                     LQGGEYVQFSYDGPLDGLQNFILTLYGTILPQLALIRRRGYDIERFYPQGRPKDGPPA
                     TLKCDYFIPIRR"
     gene            708251..708718
                     /locus_tag="YPTB_RS03385"
                     /old_locus_tag="YPTB0600"
     CDS             708251..708718
                     /locus_tag="YPTB_RS03385"
                     /old_locus_tag="YPTB0600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209232.1"
                     /db_xref="GI:488138024"
                     /translation="MKKSWIFLGCLLSLGAITAQAEEIGSVDTVFKLLGPDHKIVIEA
                     FDDPDVKNVTCYISRAKTGGIKGGLGLAEDTADAAISCQQVGPIELSDKIKNKKSEGA
                     VVFQKRTSLVFKKLQVVRFYDPKRNSLVYLTYSDRIVDGSPKNAISAVPIMPW"
     gene            complement(708892..709608)
                     /locus_tag="YPTB_RS03390"
                     /old_locus_tag="YPTB0601"
     CDS             complement(708892..709608)
                     /locus_tag="YPTB_RS03390"
                     /old_locus_tag="YPTB0601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002209234.1"
                     /db_xref="GI:488138026"
                     /translation="MQTPHILIVEDEIVTRNTLKSIFEAEGYVVYEANDGAEMHHILS
                     ENDINLVIMDINLPGKNGLLLARELREQASVALMFLTGRDNEVDKILGLEIGADDYIT
                     KPFNPRELTIRARNLLSRTMNLSSVGEERRLVESYKFNGWELDINSRSLVSPTGEHYK
                     LPRSEFRAMLHFCENPGKIQSRGELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDT
                     PEIIATIHGEGYRFCGDLEE"
     gene            710712..713171
                     /gene="thrA"
                     /locus_tag="YPTB_RS03395"
                     /old_locus_tag="YPTB0602"
     CDS             710712..713171
                     /gene="thrA"
                     /locus_tag="YPTB_RS03395"
                     /old_locus_tag="YPTB0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016256353.1"
                     /note="multifunctional homotetrameric enzyme that
                     catalyzes the phosphorylation of aspartate to form
                     aspartyl-4-phosphate as well as conversion of aspartate
                     semialdehyde to homoserine; functions in a number of amino
                     acid biosynthetic pathways; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aspartokinase I/homoserine
                     dehydrogenase I"
                     /protein_id="WP_002209237.1"
                     /db_xref="GI:488138029"
                     /translation="MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKIT
                     NHLVAMIDKMVAGQDISPNISDAERIFAELLRGLADTQPGFDYDRLKALVGHEFAQLK
                     HLLHGISLLGQCPDSINASIICRGEKLSIAIMEALFQAKGYHVTVINPVEKLLAQGHY
                     LESTVDITESTRRIGASGIPSDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACL
                     RADCCEIWTDVDGVYTCDPRTVPDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIARF
                     QIPCLIKNTSNPQAPGTLIGGESIDEDSPVKGITNLNNMAMINVSGPGMKGMVGMAAR
                     VFAVMSRSGISVVLITQSSSEYSISFCVPQGELLRARRALEDEFYLELKDGVLDPLDV
                     MEHLAIISVVGDGMRTLRGISARFFSALARANINIIAIAQGSSERSISVVVNNDAVTT
                     GVRVCHQMLFNTDQVIEVFVIGVGGVGGALIEQIYRQQPWLKQRHIDLRVCGIANSKA
                     MLTNVHGIALDNWRQELAEVQEPFNLSRLIRLVKEYHLLNPVIVDCTSSQAVADQYAD
                     FLTDGFHVVTPNKKANTSSMNYYRQMRAAATKSCRKFLYDTNVGAGLPVIENLQNLLN
                     AGDELMRFTGILSGSLSFIFGKLDEGMSLSEATRQAKALGYTEPDPRDDLSGMDVARK
                     LLILAREAGYKLELADIEVESVLPASFDASGDVDTFLARLPSLDAEFTRLVANAAEQG
                     KVLRYVGVIEDGRCKVRMEAVDGNDPLYKVKNGENALAFYTRYYQPIPLVLRGYGAGN
                     DVTAAGVFADLLRTLSWKLGV"
     gene            713174..714103
                     /locus_tag="YPTB_RS03400"
                     /old_locus_tag="YPTB0603"
     CDS             713174..714103
                     /locus_tag="YPTB_RS03400"
                     /old_locus_tag="YPTB0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016256354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="WP_002209238.1"
                     /db_xref="GI:488138030"
                     /translation="MVKIYAPASIGNVSVGFDVLGAAVSPIDGTLLGDCVSVTAAERF
                     SLHNEGRFVSKLPDDPKQNIVYQCWERFCQEMGKEIPVAMVLEKNMPIGSGLGSSACS
                     VVAGLMAMNEFCGQPLDKVTLLGMMGELEGRVSGSIHFDNVAPCYLGGMQLILEQEGY
                     ISQDVPGFSDWLWVMAYPGIKVSTAEARAILPAQYRRQDCITHGRNLAGFIHACHTQQ
                     PDLAAKMMKDVIAEPYRTQLLPGFAAARQAAQDIGALACGISGSGPTLFAVCNDQATA
                     QRMAGWLQNHYLQNDEGFVHICRLDTAGARLLG"
     gene            714107..715396
                     /locus_tag="YPTB_RS03405"
                     /old_locus_tag="YPTB0604"
     CDS             714107..715396
                     /locus_tag="YPTB_RS03405"
                     /old_locus_tag="YPTB0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012229127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="WP_002209239.1"
                     /db_xref="GI:488138031"
                     /translation="MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEID
                     KLLDLDFVTRSSRILSAFIGSEIAPDVLTKRVQAAFEFPAPVAQVENDIAVLELFHGP
                     TLAFKDFGARFMAQMLAEVAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRG
                     KISPLQEKLFCTLGGNIHTVAIDGDFDACQALVKQAFDDEELKTALSLNSANSINISR
                     LLAQICYYFEAVAQLPQEARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNAN
                     DTVPRFLVNGQWQPKPTVATLSNAMDVSQPNNWPRVEELYRRKIWQLKDLGHGAVSDK
                     TTKDTMRELAGLGYISEPHAAIAYRVLRDQLQDGEFGLFIGTAHPAKFKESVEAILGQ
                     ELPLPKPLAVRAQLPLLSHDLPADFAQMRAFLMALPK"
     gene            complement(716213..716989)
                     /locus_tag="YPTB_RS03410"
                     /old_locus_tag="YPTB0605"
     CDS             complement(716213..716989)
                     /locus_tag="YPTB_RS03410"
                     /old_locus_tag="YPTB0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIN3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002209240.1"
                     /db_xref="GI:488138032"
                     /translation="MLIIISPAKTLDYQSPLATTKFSQPEMLDKSQALIEICRELTPA
                     QISSLMGISDKLAGLNAARFSEWQPDFTPANARQAILAFKGDVYTGMQAESFSEADFD
                     FAQQHLRMLSGLYGLLRPLDLMQPYRLEMGTKLANPRGKDLYAFWGDQITEKLNQALE
                     LQGDNILINLASDEYFKAVKPAKLSGSLIKPVFLDEKNGKYKIISFYAKKARGLMSRF
                     IIQNKLTKPEQLVDFNLEGYEFDAGLSAKNELVFKRAEQH"
     gene            717504..718457
                     /locus_tag="YPTB_RS03415"
                     /old_locus_tag="YPTB0606"
     CDS             717504..718457
                     /locus_tag="YPTB_RS03415"
                     /old_locus_tag="YPTB0606"
                     /EC_number="2.2.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004702728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transaldolase"
                     /protein_id="WP_011191696.1"
                     /db_xref="GI:499505056"
                     /translation="MTDKLTSLRQITTVVADTGDIAAMKLYQPQDATTNPSIILNAAQ
                     IPEYRKLIDEAIAWAREQSSDHAQQIIDATDKLAVNIGLEILKLIPGRISTEVDARLS
                     YDTVASVTKAKRLIKLYNEAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFS
                     FAQARACAEAGVFLISPFVGRILDWYKANGDQKEFAPSEDPGVVSVTEIYQYYKKHGY
                     KTVVMGASFRNLGEIIELAGCDRLTIAPSLLKELAESEGPVERKLAYTGEIQAKPAPL
                     TEAEFYWQHNQDPMAVDKLADGIRKFAIDQGKLEKMISDLL"
     gene            718745..719332
                     /gene="mogA"
                     /locus_tag="YPTB_RS03420"
                     /old_locus_tag="YPTB0607"
     CDS             718745..719332
                     /gene="mogA"
                     /locus_tag="YPTB_RS03420"
                     /old_locus_tag="YPTB0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002209243.1"
                     /note="forms a trimer; related to eukaryotic protein
                     gephyrin; functions during molybdenum cofactor
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein MogA"
                     /protein_id="WP_002209243.1"
                     /db_xref="GI:488138035"
                     /translation="MNILRIGLVSVSDRASSGIYQDKGIPALEEWLTSALTTPFEVET
                     RLIPDEQSLIEQTLCELVDEMGCHLVLTTGGTGPARRDVTPDATLAIADRQMPGFGEQ
                     MRQISLHYVPTAILSRQVGVIRKQALIINLPGQPKSIKETLEGVKDAQSNVVVAGIFA
                     SVPYCIQLLDGPYIETNTDVVVAFRPKSAIIDIKD"
     gene            719460..720839
                     /locus_tag="YPTB_RS03425"
                     /old_locus_tag="YPTB0608"
     CDS             719460..720839
                     /locus_tag="YPTB_RS03425"
                     /old_locus_tag="YPTB0608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011191697.1"
                     /db_xref="GI:499505057"
                     /translation="MSQDHNSSQVGSSQIDSSQHHVDQQHNHNRRLNKQDYKTLTLAA
                     LGGALEFYDFIIFVFFAAVIGDLFFPVDMPEWLRQVQTFGIFAAGYLARPLGGIIMAH
                     FGDLVGRKKMFTLSILLMALPTLAIGMLPTYATIGITAPLLLLLMRVLQGAAIGGEVP
                     GAWVFVAEHVPRKRIGIACGTLTAGLTAGILLGSLVATVMNTTLGHQAILEGGWRIPF
                     FLGGIFGLFAMYLRRWLQETPIFKEMQARKTLAEELPLKSVVVNHKKEVVVSMLLTWL
                     LSAGIVVVILMTPTYLQKQFNVLPELALQANSLAIIALVIGCVVAGLAIDRFGASKTF
                     IVGSLMLAMSTWSFYHTNLTNPAQLFPHYMLAGFCVGIVGAVPYVMVRAFPAEVRFTG
                     ISFSYNVAYAIFGGLTPILVTLWMKSSAMAPAYYMLVLSLVGLLLGIYLRNDINSEVK
                     VQMPKRVMN"
     gene            complement(720917..723373)
                     /locus_tag="YPTB_RS03430"
                     /old_locus_tag="YPTB0609"
     CDS             complement(720917..723373)
                     /locus_tag="YPTB_RS03430"
                     /old_locus_tag="YPTB0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191698.1"
                     /db_xref="GI:499505058"
                     /translation="MKKTNKLLISIVSAISFSAYSNDINDINDAKVCFYELENFSGES
                     FCAYEGESQSTINSNFDNKIKSISIPPGMVITLYDGIDFSGKEKKLKNDVNLKEMKSF
                     GLYNKINSYHIDPAVCFYTEDNFQGDSTCLAASQHIDLYSDAEGFADSNRTVLPINND
                     SIQSIKVPLGMMTTIYKNDHFNAPFFELTENINLETLKTLAMDNQLTSLKASEKKGLH
                     CNQKCIILEKHEIDLPESFGEYWHDSRLVNKQVILSFNSQGNGINDDYQINLTNGPNI
                     SILKNEIIFSDYNMETKFSFDRIDTLDKLSFILQLEKDIAQVQYIQTLDDQLIDLSPI
                     ISFKWQHTIGDTPTLTITNKNTDKPLILNKSIITADTGDQNWEKRDIENTSQIICAFT
                     PFLNLYNYIVQGTCRQLDGIIFRADQYFNSNTKGKTLHIAGKSFPLKPGSLTEVSTDG
                     RHKNKMMLTYIDNINNNQSLSLPAVAKTCMVSIHSLLSTRQTRQVRPPCIDWTLEIMT
                     DFTLLFGGSLRTWNTEYFGRIIQSIITTGSTGVAVENTEVEKRLSHAVKKAIMSQSID
                     STLDHIKTAFDYAQLNYFDYSLFYVSEDTPSQVEQLPLGIYELLLSSFIYRPIPPTII
                     ENSERVEQHELAFEIEILPSPFPEDARLSDTEIEHAQELRQKISETIAQWGQQYQGAH
                     TNDDVDKEINSDENAALSKLLHAGHIVTGIIHRRLILNRPGEIYVVAKLRGEIIAIVL
                     ADRFNNRDEVELVASATLPDYVLSPDNEGTVRGAGTAAVYELARYLQQQGAKTLFSET
                     ISQPSARVKQKVGFTFKSEF"
     gene            complement(723664..724275)
                     /locus_tag="YPTB_RS03435"
                     /old_locus_tag="YPTB0610"
     CDS             complement(723664..724275)
                     /locus_tag="YPTB_RS03435"
                     /old_locus_tag="YPTB0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191699.1"
                     /db_xref="GI:499505059"
                     /translation="MNTIKLANPGPLGLMGFGMTTVLLNLHNAGFFPLSSVILSMGIF
                     YGGLAQILAGLLEYKKGNTFAATAFTSYGAFWLSLVGLLMLPKMGLAEATDAQFLGVY
                     LGLWGIFTLFMFIGTLPANRALQFVFGSLTILFALLAVGNFTDNHALLMFAGFEGIIC
                     GASAIYLAMAEVLNEQYGRTILPIGEPLPIGKPSQTLETQAVM"
     gene            724649..726559
                     /gene="dnaK"
                     /locus_tag="YPTB_RS03440"
                     /old_locus_tag="YPTB0611"
     CDS             724649..726559
                     /gene="dnaK"
                     /locus_tag="YPTB_RS03440"
                     /old_locus_tag="YPTB0611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017493689.1"
                     /note="heat shock protein 70; assists in folding of
                     nascent polypeptide chains; refolding of misfolded
                     proteins; utilizes ATPase activity to help fold;
                     co-chaperones are DnaJ and GrpE; multiple copies in some
                     bacteria; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaK"
                     /protein_id="WP_002209248.1"
                     /db_xref="GI:488138040"
                     /translation="MGKIIGIDLGTTNSCVAIMDGTKARVLENSEGDRTTPSIIAYTQ
                     DGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEAQRDKDIMPYKIIAADNGDAW
                     LEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRI
                     AGLEVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEV
                     LATNGDTHLGGEDFDSRLINYLVEEFKKDQGMDLRTDPLAMQRLKEAAEKAKIELSSA
                     QQTDVNLPYITADGSGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDI
                     QDVILVGGQTRMPMVQKKVADFFGKEPRKDVNPDEAVAIGAAVQGGVLSGEVKDVLLL
                     DVTPLSLGIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAQD
                     NKSLGQFNLDGIQPAPRGMAQIEVTFDIDADGILHVSAKDKNTGREQKITIKASSGLN
                     EEEIQKMVRDAEANAEADRKFEELVQTRNQADHLIHGTRKQLEEAGDKLPAEDKTAIE
                     EAMKGLEAALKGEDKAEIEAKTQALVQVSGKLLEMAQQQQAAAGGDAGDTSAKKEDDV
                     VDAEFEEVKDKK"
     gene            726671..727810
                     /locus_tag="YPTB_RS03445"
                     /old_locus_tag="YPTB0612"
     CDS             726671..727810
                     /locus_tag="YPTB_RS03445"
                     /old_locus_tag="YPTB0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004721115.1"
                     /note="chaperone Hsp40; co-chaperone with DnaK;
                     Participates actively in the response to hyperosmotic and
                     heat shock by preventing the aggregation of
                     stress-denatured proteins and by disaggregating proteins,
                     also in an autonomous, dnaK-independent fashion; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_002209249.1"
                     /db_xref="GI:488138041"
                     /translation="MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAE
                     EKFKEAKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGFGGGGGGADFSDIFGDVFG
                     DIFGGGRRQQRASRGSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSS
                     PVTCPTCHGAGQVQMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVK
                     IPAGVDTGDRIRLSGEGEAGEHGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAM
                     AALGGEIEVPTLDGRVKLKIPAETQTGKMFRMRGKGVKSVRGGSQGDLLCRVVVETPV
                     SLSEKQKQLLRELEESFVGAAGEKNSPRAKSFLDGVKKFFDDLTR"
     gene            728053..729237
                     /gene="nhaA"
                     /locus_tag="YPTB_RS03450"
                     /old_locus_tag="YPTB0613"
     CDS             728053..729237
                     /gene="nhaA"
                     /locus_tag="YPTB_RS03450"
                     /old_locus_tag="YPTB0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1C0J7.1"
                     /note="exports sodium by using the electrochemical proton
                     gradient to allow protons into the cell; functions in
                     adaptation to high salinity and alkaline pH; activity
                     increases at higher pH; downregulated at acidic pH;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter NhaA"
                     /protein_id="WP_011191700.1"
                     /db_xref="GI:499505060"
                     /translation="MTNIIRQFLRQEAAGGLILIIAAAIALLMANSALQGVYQSFLDI
                     PVSIKIASLDISKPLLLWINDGLMAVFFLMVGLEVKRELMEGSLAGRDKAVFPAIAAL
                     GGMLAPALIYLLFNGADEVTRQGWAIPAATDIAFALGVMALLGNRVPTGLKVFLLALA
                     IIDDLGVIIIIALFYTQQVSLQSLGIAAAAIALLAYMNWRGVGKTSAYLLVGLVLWVC
                     ILKSGVHATLAGVIVGFMIPLHTQDQRSPSESLEHGLHPWVAYLILPLFAFANAGVSL
                     QGVSLSGLTSLLPMGIATGLFIGKPLGIFTFSWLAVKLGIAKLPDAINFKQIFAVSVL
                     CGIGFTMSIFIASLAFEGTDIALTTYSKLGILLGSTTAAVVGYSLLRLVLPARRKAVN
                     VR"
     gene            729367..730266
                     /gene="nhaR"
                     /locus_tag="YPTB_RS03455"
                     /old_locus_tag="YPTB0614"
     CDS             729367..730266
                     /gene="nhaR"
                     /locus_tag="YPTB_RS03455"
                     /old_locus_tag="YPTB0614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002220713.1"
                     /note="Na+/H+ antiporter regulatory protein; activates the
                     genes nhaA and osmC; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002220713.1"
                     /db_xref="GI:488149505"
                     /translation="MRMSHINFNHLYYFWQVCKEGSVVGAAEALFLTPQTITGQIKAL
                     EGRLGGKLFKRRGRGLVPSELGQLVFRYADKMFMLSQEMLDIVNYRKESHLLFDVGVA
                     DALSKRLVSQVLETAVVEHEKIHLRCFESTHEMLLEQLSQHKLDMILSDCPVDSSQQE
                     GLFSVKLGECSVSFYCRQPVPDLPFPASLQQKRLLIPGRRSMLGRKLLNWINSKGLKV
                     EVLGEFDDAALMNAFAVYHDAIFVAPTIYAADTYANDSEIIEIGRLDNVQEEYYVIFA
                     ERMIQHPAVQRVCNKDFSALFNC"
     gene            complement(730397..730660)
                     /gene="rpsT"
                     /locus_tag="YPTB_RS03460"
                     /old_locus_tag="YPTB0615"
     CDS             complement(730397..730660)
                     /gene="rpsT"
                     /locus_tag="YPTB_RS03460"
                     /old_locus_tag="YPTB0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080555.1"
                     /note="binds directly to the 16S rRNA and is involved in
                     post-translational inhibition of arginine and ornithine
                     decarboxylase; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_002220715.1"
                     /db_xref="GI:488149507"
                     /translation="MANIKSAKKRAVQSEKRRKHNASRRSMVRTFIKKVYAAIAAGDK
                     DAAQKAFNEMQPIVDRQSCKGLIHKNKAARHKSNLVAQINAMQ"
     gene            complement(730682..730858)
                     /locus_tag="YPTB_RS03465"
     CDS             complement(730682..730858)
                     /locus_tag="YPTB_RS03465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002228113.1"
                     /db_xref="GI:488156905"
                     /translation="MKLWNFLSKDCIPQREAGKIPLHHNVASAARTNGAYLHKSIDKR
                     RLKGHIPRPLNCPQ"
     gene            731075..732013
                     /locus_tag="YPTB_RS03470"
                     /old_locus_tag="YPTB0616"
     CDS             731075..732013
                     /locus_tag="YPTB_RS03470"
                     /old_locus_tag="YPTB0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005166981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein RibF"
                     /protein_id="WP_002210510.1"
                     /db_xref="GI:488139302"
                     /translation="MELIRGIHNIRARHHGCVLTIGNFDGVHRGHQALLEQLKREGQR
                     LGLPVMVMIFEPQPLELFAADKAPARLTRLRDKAKYLAQAGVDYLLCVKFDPRFAANT
                     AQAFVAQLLVEKLGVKFLTVGDDFRFGAGRQGDFQLLQQAGAEFGFDVISTDSFCDGG
                     LRISSTAIRQALHDDDLVLAETLLGHPYSISGRVVHGDELGRTIGFPTANLPLKRLVA
                     PVKGVYAVDVYGLGSTPLYGVANIGTRPTVAGVRQQLEVHLLDVTMDLYGCHIDVVLR
                     AKLRNEQRFASLEALKQQIANDVVTARTFFGLKTPV"
     gene            732045..734861
                     /gene="ileS"
                     /locus_tag="YPTB_RS03475"
                     /old_locus_tag="YPTB0617"
     CDS             732045..734861
                     /gene="ileS"
                     /locus_tag="YPTB_RS03475"
                     /old_locus_tag="YPTB0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIM0.1"
                     /note="IleRS; catalyzes the formation of
                     isoleucyl-tRNA(Ile) from isoleucine and tRNA(Ile); since
                     isoleucine and other amino acids such as valine are
                     similar, there are additional editing function in this
                     enzyme; one is involved in hydrolysis of activated
                     valine-AMP and the other is involved in deacylation of
                     mischarged Val-tRNA(Ile); there are two active sites, one
                     for aminoacylation and one for editing; class-I
                     aminoacyl-tRNA synthetase family type 1 subfamily; some
                     organisms carry two different copies of this enzyme;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase"
                     /protein_id="WP_002210509.1"
                     /db_xref="GI:488139301"
                     /translation="MSDYKNTLNLPETGFPMRGDLAKREPDMLKRWYEQDLYGIIRAA
                     KKGKKTFILHDGPPYANGNIHIGHSVNKILKDIIVKSKGMAGYDSPYIPGWDCHGLPI
                     ELKVEQLIGKPGEKVSAAEFRTACRKYAAEQVEGQKKDFIRLGVLGDWDHPYLTMDFK
                     TEANIIRALSKIIDNGHLHKGAKPVHWCTDCGSSLAEAEVEYYDKTSQSIDVRFNAVD
                     TATVAAKFGVSAVNGPISLVIWTTTPWTLPANRAISLNAEYLYQLVQVEGECLILAAD
                     LVESVMKRAGITQWAVLGSCTGSDLELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHT
                     APGHGPDDFVIGQKYGLEVANPVGPNGCYLAGTYPTLDGLFVFKANDVVVELLREKGA
                     LLHVEKLLHSYPCCWRHKTPIIFRATPQWFISMDQKGLRKQSLQEIKGVQWIPDWGQA
                     RIETMVANRPDWCISRQRTWGVPMSLFVHKETEQLHPRSIELMEEVAKRVEQDGIQAW
                     WDLDPAEILGADAADYVKVPDTLDVWFDSGSTHSSVVDVRPEFGGHSPDMYLEGSDQH
                     RGWFMSSLMIATAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTISPQDVMNKLGGDI
                     LRLWVASTDYTGEIAVSDEILKRSADSYRRIRNTARFLLANLNGFDPAQHQVKPEEMV
                     VVDRWAVGRAQAAQAEIMEAYENYDFHLVVQRLMQFCSVEMGSFYLDIIKDRQYTAKG
                     DGIARRSCQTALFHIAEALVRWMAPIMSFTADEIWNHLPGERQQYVFTEEWYDGLFGL
                     AGNESMNDTFWAELLKVRGEVNKVLEQARSDKRIGGSLEAAVTLYAEPELAARLNSLQ
                     DELRFVLLTSAAKVAAYADAGNDAQQSELIAGLKITFNKADGEKCPRCWHYTQDVGLV
                     AEHAELCGRCVTNVAGDGEERKFA"
     gene            734861..735370
                     /gene="lspA"
                     /locus_tag="YPTB_RS03480"
                     /old_locus_tag="YPTB0618"
     CDS             734861..735370
                     /gene="lspA"
                     /locus_tag="YPTB_RS03480"
                     /old_locus_tag="YPTB0618"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIL9.1"
                     /note="lipoprotein signal peptidase; integral membrane
                     protein that removes signal peptides from prolipoproteins
                     during lipoprotein biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase"
                     /protein_id="WP_002210508.1"
                     /db_xref="GI:488139300"
                     /translation="MNKPICSTGLRWLWLAVVVVILDISSKQWVMAHFALYESVPLIP
                     FFNLTYAQNFGAAFSFLADKSGWQRWFFAGIAIGISVVLMVMMYRSTAKQRLINCAYA
                     LIIGGALGNLYDRLVHGAVNDFLDFYINNWHFPTFNLADVAICIGAALVIFEGFLSPV
                     EKNAVNNDE"
     gene            735438..735896
                     /locus_tag="YPTB_RS03485"
                     /old_locus_tag="YPTB0619"
     CDS             735438..735896
                     /locus_tag="YPTB_RS03485"
                     /old_locus_tag="YPTB0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105693.1"
                     /note="rotamase; accelerates isomerization of the peptidyl
                     prolyl bond, involved in the folding of proteases; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_002228112.1"
                     /db_xref="GI:488156904"
                     /translation="MQNNGAVLVHFTLKLEDGSTAESTRTHGKPALFRLGDNSLSDAL
                     EQQLLGLTVGDKHAFTLRPEDAFGVENPDLIQYFTPRDFAETGVPDAGTIMLFSSRDG
                     SEMPGVVREVAEESITVDFNHPLAGHSVSFELEILEIDPQQEVVYADIAG"
     gene            735877..736830
                     /gene="ispH"
                     /locus_tag="YPTB_RS03490"
                     /old_locus_tag="YPTB0620"
                     /gene_synonym="lytB"
     CDS             735877..736830
                     /gene="ispH"
                     /locus_tag="YPTB_RS03490"
                     /old_locus_tag="YPTB0620"
                     /gene_synonym="lytB"
                     /EC_number="1.17.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005166985.1"
                     /note="catalyzes the conversion of
                     1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into
                     isopentenyl diphosphate (IPP) and dimethylallyl
                     diphosphate (DMAPP); functions in the nonmevalonate
                     isoprenoid biosynthesis pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="WP_011191701.1"
                     /db_xref="GI:499505061"
                     /translation="MQILLANPRGFCAGVDRAISIVERAIEMYGAPIYVRHEVVHNRY
                     VVESLCERGAIFIEEISEVPDGSILIFSAHGVSQAVRAEARSRNLTMLFDATCPLVTK
                     VHMEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPNGGMYLVESPDDVWQLNVKDEN
                     NLCFMTQTTLSVDDTSAVIDALNTRFPKIVGPRKDDICYATTNRQEAVRNLANDADIV
                     LVVGSKNSSNSNRLAELVQRMGKPAYLIDSAADIQEFWLQGAQCIGVTAGASAPDILV
                     QQVIARLKDLGAGESIELSGREENIVFEVPKELRVEVKQID"
     gene            737060..737518
                     /locus_tag="YPTB_RS03495"
                     /old_locus_tag="YPTB0621"
     CDS             737060..737518
                     /locus_tag="YPTB_RS03495"
                     /old_locus_tag="YPTB0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001204112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002213775.1"
                     /db_xref="GI:488142567"
                     /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKL
                     CEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRN
                     REFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
     gene            738009..738830
                     /locus_tag="YPTB_RS03500"
                     /old_locus_tag="YPTB0622"
     CDS             738009..738830
                     /locus_tag="YPTB_RS03500"
                     /old_locus_tag="YPTB0622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002423150.1"
                     /note="catalyzes the reduction of 2,3-dihydrodipicolinate
                     to 2,3,4,5-tetrahydrodipicolinate in lysine and
                     diaminopimelate biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-tetrahydrodipicolinate reductase"
                     /protein_id="WP_002210504.1"
                     /db_xref="GI:488139296"
                     /translation="MTDSTIRIAIVGAGGRMGRQLIQAVTQMEGVVLGAAIERKGSTL
                     VGSDAGELAGVGLLNVIVGDDLSQLTDNFDVLIDFTRPEGTLEHLAICRQHRKAMVIG
                     TTGFDEAGKAAISEAAADIGIVFAANFSVGVNVVLKLLEKAAKVMGDYTDIEIIEAHH
                     RHKVDAPSGTALAMGEAIADAMGRSLKDCAVYSREGYTGERKPGTIGFATVRAGDIVG
                     EHTAMFADIGERVEITHKATSRMTFAHGAVKSAIWLGKHDNGLFDMRDVLNLNEL"
     gene            739303..740478
                     /locus_tag="YPTB_RS03505"
                     /old_locus_tag="YPTB0623"
     CDS             739303..740478
                     /locus_tag="YPTB_RS03505"
                     /old_locus_tag="YPTB0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIL5.1"
                     /note="catalyzes production of carbamoyl phosphate from
                     bicarbonate and glutamine in pyrimidine and arginine
                     biosynthesis pathways; forms an octamer composed of four
                     CarAB dimers; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl-phosphate synthase small chain"
                     /protein_id="WP_002224759.1"
                     /db_xref="GI:488153551"
                     /translation="MIKSALLVLEDGTQFHGRAIGAEGTAVGEVVFNTSMTGYQEILT
                     DPSYSRQIVTLTYPHIGNVGTNASDEESSAVHAQGLVIRDLPLIASNYRNEEGLSEYL
                     KRHNIVAIADIDTRKLTRLLREKGAQNGCIIVGELSDAALALEKAKAFPGLKGMDLAK
                     EVTTKEMYQWLQGSWTLEGDLPAAKQPEDLPFHVVAYDYGVKRNILRMLVDRGCRLTV
                     VPAQTPAEDVLKLNPDGIFLSNGPGDPEPCDYAITAIKRFLETDIPVFGICLGHQLLA
                     LASGAKTVKMKFGHHGGNHPVKDLDASCVMITAQNHGFAVDETSLPSNLRTTHVSLFD
                     GSLQGLHRTDKAAFSFQGHPEASPGPHDAAPLFDHFIELIEAYRASSVSLNCSNSHK"
     gene            740494..743727
                     /gene="carB"
                     /locus_tag="YPTB_RS03510"
                     /old_locus_tag="YPTB0624"
     CDS             740494..743727
                     /gene="carB"
                     /locus_tag="YPTB_RS03510"
                     /old_locus_tag="YPTB0624"
                     /EC_number="6.3.5.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIL4.3"
                     /note="four CarB-CarA dimers form the carbamoyl phosphate
                     synthetase holoenzyme that catalyzes the production of
                     carbamoyl phosphate; CarB is responsible for the
                     amidotransferase activity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl phosphate synthase large subunit"
                     /protein_id="WP_011191702.1"
                     /db_xref="GI:499505062"
                     /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRV
                     ILVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALEL
                     ERQGVLAEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHNMEEALAVAA
                     DVGFPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTKELLIDESLIGWKEYEM
                     EVVRDKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIG
                     VETGGSNVQFSVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDE
                     LMNDITGGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQ
                     ESLQKALRGLEVGATGFDPKVSLDDPEALTKIRRELKEAGAERIWYIADAFRAGMSVD
                     GVFNLTNVDRWFLVQIEELVRLEESVAELGINGLTAEFMRHLKRKGFADARLAKLVGA
                     AESEVRKLRYKYGLHPVYKRVDTCAAEFSTDTAYMYSTYEEECESNPTSDRPKVMVLG
                     GGPNRIGQGIEFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFESVTLE
                     DVLEIVRIEKPQGVIVQYGGQTPLKLARELEAAGVPIIGTSPDAIDRAEDRERFQQAV
                     NRLGLKQPANATVATIEQAVEKATGLGYPLVVRPSYVLGGRAMEIVYDEIDLRRYFQN
                     AVSVSNDAPVLLDRFLDDAVEVDVDAICDGERVLIGGIMEHIEQAGVHSGDSACSLPA
                     YTLSKEIQDVMRQQVEKLAFELCVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKA
                     TGMPLAKIAARVMVGQSLAEQGMLEEIIPPYYSVKEVVLPFNKFPGVDPILGPEMRST
                     GEVMGVGRTFAEAFSKAMLGSQSGMKKSGRALLSVREGDKHRVVDLAAKLLKQGFELD
                     ATHGTAVVLGEAGINPRLVNKVHEGRPHIQDRIKNGEYTYIVNTTAGRQAIEDSKLIR
                     RSALQYKVHYDTTLNGGFATAMALNADPTDQVISVQEMHAKIKNMKA"
     gene            complement(743953..744567)
                     /locus_tag="YPTB_RS03515"
                     /old_locus_tag="YPTB0625"
     CDS             complement(743953..744567)
                     /locus_tag="YPTB_RS03515"
                     /old_locus_tag="YPTB0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_011191703.1"
                     /db_xref="GI:499505063"
                     /translation="MLETSLFVATLATLGMISPGPDFFLVIKNAARYRRTAAMMTALG
                     VILGVATHMSYCVAGLAVVITTTPWLFNLLKYAGACYLIWIGIQALLSRGESKFSIDN
                     TAQYPISLKAAFLQGYLCNLLNPKATLFFLAVFTQILQINSGIGEKLWYASIIWILSA
                     IWWPVLVILIQSAPVRRGLAKTQKVVDKVLGGLLIGLGIKVALG"
     gene            744882..745682
                     /locus_tag="YPTB_RS03520"
                     /old_locus_tag="YPTB0626"
     CDS             744882..745682
                     /locus_tag="YPTB_RS03520"
                     /old_locus_tag="YPTB0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191704.1"
                     /db_xref="GI:499505064"
                     /translation="MSLENVINSDVPHHQQRDITRLCIKCALLLLQHGAESMLVEQLS
                     ARLGMALGMDSVESSISANAVVLTTISQGNCLTSTRKNTDRGINMQVVTEVQHIVILA
                     EHRLLDAKDVEKRFENIKPLRYPRWLVVIMVALSCGCFSKLNGGGWDAFSISFVASGL
                     AMFVRQSLTARHMNPLINFCITAFVATSASGLLMRLPFFEQASSVAMAASVLLLVPGF
                     PLINAVADMFKGHVNTGLARWAMASLLTLSTCIGVVFAMALWGLRGWA"
     gene            745679..746143
                     /locus_tag="YPTB_RS03525"
                     /old_locus_tag="YPTB0627"
     CDS             745679..746143
                     /locus_tag="YPTB_RS03525"
                     /old_locus_tag="YPTB0627"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66ER4.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032466075.1"
                     /db_xref="GI:694125480"
                     /translation="MSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHG
                     SRMLMIHFGMNIELASLVASIMIGVIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTA
                     MISVVEISHLGYSEALMSTMVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV"
     gene            746293..746775
                     /gene="folA"
                     /locus_tag="YPTB_RS03530"
                     /old_locus_tag="YPTB0628"
     CDS             746293..746775
                     /gene="folA"
                     /locus_tag="YPTB_RS03530"
                     /old_locus_tag="YPTB0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005270605.1"
                     /note="catalyzes the reduction of dihydrofolate to
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="WP_002210497.1"
                     /db_xref="GI:488139289"
                     /translation="MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMG
                     RKTFESIGRPLPGRLNIVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYK
                     QFLDRANRMYLTHIDAEVGGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR
                     "
     gene            747266..747486
                     /locus_tag="YPTB_RS03535"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            747614..748078
                     /locus_tag="YPTB_RS03540"
                     /old_locus_tag="YPTB0630"
     CDS             747614..748078
                     /locus_tag="YPTB_RS03540"
                     /old_locus_tag="YPTB0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191707.1"
                     /db_xref="GI:499505067"
                     /translation="MKKSMLFLSLILSAPYIMANELSSCPNKSEISYQQGVYTTPDGK
                     WLGVSVGVENSGDVRHFLYVKYIPYNAFNMDIGRLNNCTYALASGSVDMYFYDERALA
                     LEGVFVSLMGHMFWEKTTTSGKESYICTASSVNDCTFTRLDDDVVDDYKNRQ"
     gene            complement(748168..749037)
                     /gene="apaH"
                     /locus_tag="YPTB_RS03545"
                     /old_locus_tag="YPTB0631"
     CDS             complement(748168..749037)
                     /gene="apaH"
                     /locus_tag="YPTB_RS03545"
                     /old_locus_tag="YPTB0631"
                     /EC_number="3.6.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1JKY5.1"
                     /note="hydrolyzes P(1),P(4)-bis(5'-adenosyl)
                     tetraphosphate to form 2 ADP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bis(5'-nucleosyl)-tetraphosphatase symmetrical"
                     /protein_id="WP_011191708.1"
                     /db_xref="GI:499505068"
                     /translation="MSTYLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPA
                     SLDVLRYVRSLGPAVRMVLGNHDLHLLAVYAGISRNKPKDRITPLLDAPDADELINWL
                     RRQPVLQVDDQLKLIMAHAGITPQWDIETAKMCAREVEAVLSSDSYPLFLDAMYGDMP
                     NNWSPELTGLARLRFSTNALTRMRFCFPNGQLDMICKDTPENAPAPLKPWFDLPRLVD
                     PEYSIIFGHWASLEGKGVPEGIYGLDTGCCWGGDLTLLRWEDKRYFTQRAFKAEAEIN
                     NNNGFAAGEEVQH"
     gene            complement(749054..749431)
                     /gene="apaG"
                     /locus_tag="YPTB_RS03550"
                     /old_locus_tag="YPTB0632"
     CDS             complement(749054..749431)
                     /gene="apaG"
                     /locus_tag="YPTB_RS03550"
                     /old_locus_tag="YPTB0632"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66EQ9.1"
                     /note="protein associated with Co2+ and Mg2+ efflux;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein ApaG"
                     /protein_id="WP_011191709.1"
                     /db_xref="GI:499505069"
                     /translation="MIEQPRICVQVQSIYVETQSIPEEERFVFAYTVTVRNLGRSNVQ
                     LLGRYWLITNSNGRQTEVQGEGVIGEQPLILPGNEFQYTSGAVLETPLGTMEGHYEMI
                     DHLGQAFRTVIPVFRLAIPALIH"
     gene            complement(749445..750263)
                     /gene="ksgA"
                     /locus_tag="YPTB_RS03555"
                     /old_locus_tag="YPTB0633"
     CDS             complement(749445..750263)
                     /gene="ksgA"
                     /locus_tag="YPTB_RS03555"
                     /old_locus_tag="YPTB0633"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66EQ8.1"
                     /note="in Escherichia coli this enzyme catalyzes the
                     transfer of a total of four methyl groups from
                     S-adenosyl-l-methionine (S-AdoMet) to two adjacent
                     adenosine bases A1518 and A1519 in 16S rRNA; mutations in
                     ksgA causes resistance to the translation initiation
                     inhibitor kasugamycin; members of this protein family have
                     secondary functions; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase A"
                     /protein_id="WP_011191710.1"
                     /db_xref="GI:499505070"
                     /translation="MNNRVHQGHFARKRFGQNFLNDQFVIDSIVSAIHPVPGEAVVEI
                     GPGLGALTEPVAARMDHMTVIELDRDLAARLASHPQLKDKLTIHQQDAMKVNFSELSE
                     QAGQPLRVFGNLPYNISTPLMFHLFSYTDAIRDMHFMLQKEVVNRLVAGPNSKAYGRL
                     TVMAQYYCNVIPVLEVPPTAFTPAPKVDSAVVRLIPHVQMPHPVGDVRMLSRITTQAF
                     NQRRKTVRNSLGDLFTSEQLIELGIDPILRAENISVAQYCKLANWLSAQSTPQK"
     gene            complement(750256..751251)
                     /gene="pdxA"
                     /locus_tag="YPTB_RS03560"
                     /old_locus_tag="YPTB0634"
     CDS             complement(750256..751251)
                     /gene="pdxA"
                     /locus_tag="YPTB_RS03560"
                     /old_locus_tag="YPTB0634"
                     /EC_number="1.1.1.262"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q3V7Q4.1"
                     /note="catalyzes oxidation of
                     4-(phosphohydroxy)-L-threonine into
                     2-amino-3-oxo-4-(phosphohydroxy)butyric acid which
                     decarboxylates to form
                     1-amino-3-(phosphohydroxy)propan-2-one
                     (3-amino-2-oxopropyl phosphate); Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="WP_011191711.1"
                     /db_xref="GI:499505071"
                     /translation="MHNHNNRLVITPGEPAGVGPDLAIALAQQDWPVELVVCADPALL
                     LARASQLNLPLQLREYQADQPAIAQQAGSLTILPVKTAVNVVPGKLDVGNSHYVVETL
                     AKACDGAISGEFAALVTGPVQKSIINDAGIPFIGHTEFFADRSHCQRVVMMLATEELR
                     VALATTHLPLLAVPGAITQASLHEVITILDNDLKTKFGITQPQIYVCGLNPHAGEGGH
                     MGHEEIDTIIPALNTLRQQGINLIGPLPADTLFQPKYLQHADAVLAMYHDQGLPVLKY
                     QGFGRAVNITLGLPFIRTSVDHGTALELAATGTADVGSFITALNLAIKMINNSNE"
     gene            complement(751235..752539)
                     /locus_tag="YPTB_RS03565"
                     /old_locus_tag="YPTB0635"
     CDS             complement(751235..752539)
                     /locus_tag="YPTB_RS03565"
                     /old_locus_tag="YPTB0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002357095.1"
                     /note="Chaperone involved in the folding of
                     extracytoplasmic proteins, especially OmpA, OmpF and LamB;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone SurA"
                     /protein_id="WP_002210488.1"
                     /db_xref="GI:488139280"
                     /translation="MKNWRTLILGLVICANTAFAAPQEVDKVAAVVDNGVVLQSDIDG
                     LLQSVKMNAQQSGQQVPDDSTLRHQILERLIMDNIQLQMAKKMGITITDQALDKAIAD
                     IAAQNRMTLAQMRSRLAADGLSYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESL
                     AKQMGNQVSGDTELNLSHILIPLPENPTQQQVDQAEDLANKLVADIKGGADFGKLAIA
                     NSADSQALKGGQMGWGKLQELPSLFAERLQSAHKGEIVGPIRSGVGFHILKVNDMRGA
                     DQTISVTEVNARHILLKPSPMMTDEQARAKLEAAAAEIKSGKTSFATIAKEISQDPGS
                     AMQGGELGWASPDIYDPAFRDALMKLKKGEISAPVHSSFGWHLIQLVDTRQVDKTDAA
                     QKERAYRMLFNRKFAEEAQTWMQEQRAAAYVKILDGSNAQPQ"
     gene            complement(752607..754949)
                     /locus_tag="YPTB_RS03570"
                     /old_locus_tag="YPTB0636"
     CDS             complement(752607..754949)
                     /locus_tag="YPTB_RS03570"
                     /old_locus_tag="YPTB0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016674007.1"
                     /note="is involved in outer membrane permeability; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS-assembly protein LptD"
                     /protein_id="WP_011191712.1"
                     /db_xref="GI:499505072"
                     /translation="MKKRFPTLLATLIWTALYSQHTLADLAEQCMLGVPTYDQPLVTG
                     DPNQLPVRINADKTEANYPDNALFTGNVIVQQGNSTLTANQVELTQVQKPGEVIPLRT
                     VTATGDVNYDDPQIKLKGPKGWSNLNTKDTDIDKGKYQMVGRQGRGDADLMKLRDQSR
                     YTILKNGTFTSCLPGDNSWSVVGSEVIHDREEQVVEVWNARFKIGKVPVFYSPYMQLP
                     VGDKRRSGFLIPNAKFTSNNGFEFLLPYYWNIAPNFDATITPHYMERRGLQWQNEFRY
                     LLAPGSGTMALDWLPNDRIYTGPDGTDKNATRWLYYWGHSGVMDQVWRFNINYTRVSD
                     PAYFTDLTSQYGSTTDGYATQIFTAGYANENWNATLSSKQFQVFTAAGNSNAYRAQPQ
                     LDMNYYKNDVGPFDMHVYGQAAKFTSVNPTNPEASRFHIEPTVNLPLSNSWGSINTEA
                     KLLATHYQQDIPASFADNASNPKLKDSVNRVLPQFKVDGKVVFDRSMDWATGFTQTLE
                     PRAQYLYVPYRNQDDIYIYDTTLMQSDYSGLFRDRTYSGLDRIASANQVSTGLTSRIY
                     DDARVERFNVSVGQIYYFSRSRTGNTEAIDNSNDTGSLVWAGDTFWRINDQLGLKGGA
                     QYDTRLGSLTLGNAIMEYRRDADRMIQLNYRYASPKYIQAAVPKVYNPDYQQGISQVG
                     TTASWPIADRWAIVGAYYYDTKAKQPASQLVGLQYNTCCWAVNLGYERKITGWNAQGQ
                     TSKYDNKIGFNIELRGLSGGHSLGTAQMLNSGILPYQSAF"
     gene            755134..755967
                     /gene="djlA"
                     /locus_tag="YPTB_RS03575"
                     /old_locus_tag="YPTB0637"
     CDS             755134..755967
                     /gene="djlA"
                     /locus_tag="YPTB_RS03575"
                     /old_locus_tag="YPTB0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304596.1"
                     /note="functions as a co-chaperone with DnaK; involved in
                     regulation of colanic acid capsule; inner membrane
                     protein; dimerized via transmembrane domain; J-like domain
                     is cytoplasmic and can functionally substitute for DnaJ;
                     stimulates synthesis of colanic acid mucoid capsule
                     through the RcsB/C signal transduction system; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dnaJ-like protein DjlA"
                     /protein_id="WP_011191713.1"
                     /db_xref="GI:499505073"
                     /translation="MRYWGKLLGLVLGVMYAPGVVGALLGLLVGHMVDRALGAKRRGF
                     FADQQTRQSLFFRTTFQVMGHLTKAKGRVTEVDIQLASQLMDRMQLHGAARTAAQQAF
                     REGKESHFPLRKTLQEFRRVCFGRFDLIRIFLEIQLQAAFADGSLHPNERQVLYVIAE
                     ELGISRGQFDQFLRMFDGGRQFGGHGGWQGQQGGYSQSGYQRAPQGPTLEDACKVLGV
                     NSSDDSVAIKRAYRKLMGEHHPDKLVAKGLPPEMMEMAKQKAQEIQAAYDLIKREKGF
                     K"
     gene            complement(756284..756904)
                     /locus_tag="YPTB_RS03580"
                     /old_locus_tag="YPTB0638"
     CDS             complement(756284..756904)
                     /locus_tag="YPTB_RS03580"
                     /old_locus_tag="YPTB0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8ZIK1.1"
                     /note="catalyzes the synthesis of pseudouridine from
                     uracil-746 in 23S ribosomal RNA and from uracil-32 in the
                     anticodon stem and loop of transfer RNAs; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal large subunit pseudouridine synthase
                     A"
                     /protein_id="WP_002210485.1"
                     /db_xref="GI:488139277"
                     /translation="MIVLYQDKHIMVVNKPSGLLSVPGRAPENKDSVMTRVQNDFPTA
                     ESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKTYIARVWGHLAQDEGLIDLPL
                     ICDWPNRPKQKVCYETGKSAQTEYQVISRDDDGSTRVKLSPITGRSHQLRVHMLAMGH
                     PILGDGFYAHPEAKAMASRLQLHAQQLCITHPEFGTPMHFKCEAEF"
     gene            complement(758127..758870)
                     /locus_tag="YPTB_RS03585"
                     /old_locus_tag="YPTB0639"
     CDS             complement(758127..758870)
                     /locus_tag="YPTB_RS03585"
                     /old_locus_tag="YPTB0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002214747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002214747.1"
                     /db_xref="GI:488143539"
                     /translation="MRKKLYNDFAWECLRRNPQYISDWELFMKNTLTNGGGIPDDSEL
                     IQSELDLNAEKKWGVMKYIDPYNSDPTNVFWSLKLSNRSVRVKLSNTGNVKGGYTWGD
                     MSNLPGVKHQRLLMHDNTLCVKIFSQNGYFQLFIESADALKDDSNLYIYIPLNLESDV
                     FAKNIELLQSIVNHKIEVECKEEQYLGLLKTIDDRKQGFSHRDIASEIFGKELVKNEW
                     SADSWVRAKIRYRIKKANALINYGYLNFL"
     gene            759227..760213
                     /locus_tag="YPTB_RS03590"
                     /old_locus_tag="YPTB0640"
     CDS             759227..760213
                     /locus_tag="YPTB_RS03590"
                     /old_locus_tag="YPTB0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002214745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002214745.1"
                     /db_xref="GI:488143537"
                     /translation="MSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQI
                     NWHHISEQANKLLEQCFDLRVMLWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYP
                     QSEEPPLNSGHAAALGWLSTAQCIAELKTARLTEEHPYILQDLITTEALPNGQERYFV
                     TSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQSTESYQLHCEQLRIFLK
                     NNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDRILEY
                     FQHYEPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR"
     gene            760224..760784
                     /locus_tag="YPTB_RS03595"
                     /old_locus_tag="YPTB0641"
     CDS             760224..760784
                     /locus_tag="YPTB_RS03595"
                     /old_locus_tag="YPTB0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002210481.1"
                     /db_xref="GI:488139273"
                     /translation="MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMA
                     DLSGHRAKPLPAVEDRKFLTFDQDNFDARMRAIKPRLKFYVDNTLSEDNELLDIELDF
                     ESMDDFSPGSLARRIPQMEKLLEARTHLAELITYMDGKTSAEEVVKQLLEQPDFLQNL
                     ATDAQGTISKLSQDDDVLVEDDDGEK"
     gene            760793..762295
                     /locus_tag="YPTB_RS03600"
                     /old_locus_tag="YPTB0642"
     CDS             760793..762295
                     /locus_tag="YPTB_RS03600"
                     /old_locus_tag="YPTB0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein EvpB"
                     /protein_id="WP_002210480.1"
                     /db_xref="GI:488139272"
                     /translation="MQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAI
                     GTLAAYANKGQVKVNRDVVLTIESLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSY
                     LVDNTDANETLKIRVLNISQDELGKTLRRYRGSAWDQSPIFKQVYEHEYGQFGGEPFG
                     CMIGDYEFDHSPQSVALLTELAKVAAAAHCPFITSSSPSIMQMNNWRELGNPRDIGKI
                     FTTPEYAPWRRLRESNDSRYLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDF
                     TWANAAYAMGVNINRAFNEYGWCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTEL
                     AISDRRENELSNAGFLPLVYRKNSDFAAFIGSCTLHAPANYDDPDATANARLSARLPY
                     IFATCRFAHYLKCIVRDKIGSFRSRDDMQLWLNDWVMNYVDGDPSISTEATKAKRPLA
                     AAEVQVEDVEDDPGFYRAHFYLRPHYQLEGMTVSLRLVSKLPSNKESEKK"
     gene            762458..762976
                     /locus_tag="YPTB_RS03605"
                     /old_locus_tag="YPTB0643"
     CDS             762458..762976
                     /locus_tag="YPTB_RS03605"
                     /old_locus_tag="YPTB0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_002210479.1"
                     /db_xref="GI:488139271"
                     /translation="MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGL
                     GGGGGSGKVEMKDFEFRMVSNKASPKLFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVT
                     FSNCLVSSFKTVGNMPLGKGDAVFTDTVLPTDAISLNFARIEVEYKEQQPDGSMGAVI
                     KAGYDLKLNSRI"
     gene            763050..763493
                     /locus_tag="YPTB_RS03610"
                     /old_locus_tag="YPTB0644"
     CDS             763050..763493
                     /locus_tag="YPTB_RS03610"
                     /old_locus_tag="YPTB0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysozyme"
                     /protein_id="WP_002210478.1"
                     /db_xref="GI:488139270"
                     /translation="MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSAR
                     LKLKKYPHCEASVLNYGLPSLSQQVPVITDLLELARHIQRIIATFESRLDPRSIKVVP
                     LINKGETWVLAILFDIHARCNLPGEEHLVNLRIALDYSYGMVRVL"
     gene            763526..765370
                     /locus_tag="YPTB_RS03615"
                     /old_locus_tag="YPTB0645"
     CDS             763526..765370
                     /locus_tag="YPTB_RS03615"
                     /old_locus_tag="YPTB0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein TssF"
                     /protein_id="WP_011191714.1"
                     /db_xref="GI:499505074"
                     /translation="MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLD
                     PFVERLLEGTAFLSSRIQQRLNNEHPEFALQMLGRLAPLWYTPLPSIATIAMVPDLTS
                     PQWHSRVVLPKGSRVTLSDSSLNNRLANFSTGRTLKIQPLVIENAECASTPPAYLPLS
                     VASQLQAGQAHLRLRLTTQGVASLSELDFAPMNLTLAGGIIQSNQLITTLLNNTLHIV
                     LWANTDGKPLVKVLTKEHLRQGGLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLE
                     LHGLNDFLQQGDGIHTFEVLFVLDQRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVL
                     INGEHTEYPVIVDPLNPRLYEVHHVLGVNGLLSEGGSVQFSSLHGHARFDDDDKVAGY
                     SIRRRRDFTDKNHQKNSPLPHDSLFIALSPGTSGIDIDHVKSLSIEAMVCERHLIPSQ
                     LQHPEFKLEIALPVGQIEMLRHPAKPQGVPNIDQAWRALQLIANNPLRYALPDVTDCS
                     PLLKDWLSIFCQHEEASQHKRITSLTHASVAHNFERHTAPGPIAWSRGVEATLDFNSS
                     HHSDKGAFLFARILHHALSEYCELGQTLRLHMQVDGETFAKWGPVNYG"
     gene            765363..766346
                     /locus_tag="YPTB_RS03620"
                     /old_locus_tag="YPTB0646"
     CDS             765363..766346
                     /locus_tag="YPTB_RS03620"
                     /old_locus_tag="YPTB0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_002210476.1"
                     /db_xref="GI:488139268"
                     /translation="MASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDR
                     SHLRLRIIQPADMGFAPREVSDIRQTLNTHQHLAEITIFCRHFGLFAPYGPLPIHVTE
                     HARNEALAKRNQAFEHFAGILSQRMAILHYRSWAQMHVAVGHDRASANPFMNHVRQIA
                     GLTPQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEILSLYFSVPIRVEARKGLWIDDS
                     RNIESQRMGRLGNTRIGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRINTLVQICHD
                     FVRHRMVLDVQLIIQTSPNMACRLGGGTLSRHSWLKPGSALSIQPIYRTVT"
     gene            766364..768952
                     /locus_tag="YPTB_RS03625"
                     /old_locus_tag="YPTB0647"
     CDS             766364..768952
                     /locus_tag="YPTB_RS03625"
                     /old_locus_tag="YPTB0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_002210475.1"
                     /db_xref="GI:488139267"
                     /translation="MYQRERLFNRLGTFAYKTFVEATRLCRSYRHEYVELEHWLKILM
                     DQQRGDIPALLTHYGLSQTVISTQLDRIIQHMPVTKASVQDLSSRLESVVEGGLVLSQ
                     LMASPSPIRTSHILLALLQDTQHQRWLYRLCDEFKKLPVPQVAEEYEGLLVNSIEQTS
                     EVQRGDALVTETDSSSSKEAHAALNKWCNDLTQQARDGEIDPVIGREAELRQVIDILL
                     RRRQNNPILVGEAGVGKTAVVEALARKLASGDVPPLLQGARLLSLDLGRMQAGASMRG
                     EFESRLKSLIDGISQSDTPVILFCDEAHTLVGAGGQAGTGDAVNLLKPMLARGALRMI
                     AATTWSEYKQFIEPDAALTRRFQRVLIGEPNESTAVDMLRAIAPHFAQHHNVTIRDGA
                     IHAAVRLSLRNLPSRQLPDKAISLLDTACARVALSQYAQPQAIEQLSAQLDVLKTEHQ
                     YLVREKQLGEAVDQRLDDVQTQIQAFEHELTALQSRHLHEQQLVREVLPEGEGSGMMT
                     ENARWGELMALQEASPLVYPWVDEQSIAAVLSDWTGIPSGKMLQDDIECVLNLEQRLG
                     DHIFGQRNAIKEISQAIRIARAGIQSQERPLGIFLLAGSTGTGKTETANVLVETLYGG
                     AHNLITFNMSEFQEAHTLSTLKGAPPGYVGYGKGGKLTEAVRRKPYSVILLDEFDKAH
                     ADIQDAFYQVFDKGWMEDAEGRRVSFRQCFILLTCNQGAEEIEQAYLTANDIKPGALK
                     PLVYDALLRRFAPALLARVNIIPYIPLDQDALAQIASHHLARLQTRLWDEIGATLVTE
                     GDIPGWIASRVCSHPNHGRAVEELLRQTLLPAVGNEVLKRRHEAEPLREIRLIVEETE
                     LSIEFA"
     gene            769056..771404
                     /locus_tag="YPTB_RS03630"
                     /old_locus_tag="YPTB0648"
     CDS             769056..771404
                     /locus_tag="YPTB_RS03630"
                     /old_locus_tag="YPTB0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
                     /protein_id="WP_011191715.1"
                     /db_xref="GI:499505075"
                     /translation="MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADL
                     DLVSLLGEIIKVRIELPDSAGYRTFFTYVIAGADEGQRQDKFVYSLELSTWTWFLMQN
                     RNCRIFQDLNIIDIIEQVFSKYNFADYRFDIVGNYRLREYCVQFAETDFDFVNRLMED
                     EGVWYYFEHNEDKHTLVMTDQQQFPVLEGHYAELSFLPDSEEMRAIREGIQRIQRSQR
                     IHSSEIVLRDFDFLNPRNTLQTHIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLR
                     LEAIQSNGQLLSGESNATGLVPGRSFALVQHPDNNRNRGFKLISCDYSFVQDGPDSAS
                     QGRNVACKFKALNDDVVYRPQCVTPPPKVPGVQSATVVGARESEVHTDKFARIRVHFH
                     WDRYKTTEDDSSCWIRVVQAWAGKGWGVLAMPRVGQEVLVNYVDGDLDRPMVTGIVYN
                     GENPPPYRLPDHINYSGFVSRSLRFGQPQHASQLTFDDNRGNERIMLHAERDLQRTVE
                     RNSATAVGQDKYDTVERTATEWINNHISYKDFSFSVTGMSVSATGISVSTTGTSLSVT
                     GMSTSVTGVSVGFTLIDTSFTGVSTSFTGVGTSFTGASNSLTGVSNSMTGCSSSFTGT
                     SNSMTGSSHSMTGMSTSITGHSMSQTGSSSSITGDSTSFTGSSVSSTGSSVSTTGVST
                     STTGSSTSTTGCSVSTTGSSTSTTGNSVSMTGNSTSTTGCSISTTGSSIGTVGSSIST
                     TGSSVSTTGSSISTTGLSVSYTGAQYSDVGVDLKTVGMQSKN"
     gene            771417..773636
                     /locus_tag="YPTB_RS03635"
                     /old_locus_tag="YPTB0649"
     CDS             771417..773636
                     /locus_tag="YPTB_RS03635"
                     /old_locus_tag="YPTB0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191716.1"
                     /db_xref="GI:499505076"
                     /translation="MRIIRPQQLVVLKSSYQIGHESHMGISVVAGCYLSKPEHMVTES
                     QIWQAWKAAPLSFRMLDSAEPKPFAEFLLAGHAGIGEEVTSLSAEVSVGSLTRRWCIE
                     GESNKTGLVIKPFLRMSMDHTQSWGGKGCKENPLGRGYNDERKPTIMSLGLDGSAIVR
                     SPLASPSPVPHDFQLRKVHINEVASTMTDPQYLETFYPGLPPQIDRRYFQMAPPGQWL
                     KKSAWPDSVPFKLIGFRPDNEEISGAFPAVSARAFVWDNPSAPPSEVTLLRKTLWLLP
                     DNDMGLMVFTGSVPLTHLFDEPIDTLLVGLDDSHSLRELEYYQQVYKSRSVEGAASFE
                     FLKDPELMPEGMPLNVIRDLADHPDSLRYSASAMSEAESERFYQDVQDAIDRQEQQKS
                     EEQETLGDLNVPAAGKEEAGTQWLESKEDTATNVTFLGTDFSGMTLDNKQFRYCMFTG
                     CHFDKATFKDCTFEHCQFTQSDFENSRWNNVHLSGCLFKQAEWQKAAFTHCKWEKSTF
                     EYGVFKHAQFTDNALDNCLINHSDFSLGTFDHCTLNGCFFSETHCDQTQFNQVIITSC
                     IFEKCDGPKACFTESTIEKTSFISSSWVGVRLSHCYLNSLTTGLNTNLSESHFEQCSL
                     NKMGFLKVNLQSSTFINCSMLESCCDKADFSQATLIACDMTAVRLKDANLVHSHWQNT
                     SLQQSMFYNADLRDATFQRCNLAGANLAMISQNMDTRFEHCLTEKTHWIPRRYTVPA"
     gene            773662..774765
                     /locus_tag="YPTB_RS03640"
                     /old_locus_tag="YPTB0650"
     CDS             773662..774765
                     /locus_tag="YPTB_RS03640"
                     /old_locus_tag="YPTB0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002214739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002214739.1"
                     /db_xref="GI:488143531"
                     /translation="MTPSDTPIMPPDSPRRIIGRHFTQRQLQQLTLSEVYFIQCTFTD
                     ISFAEIAVRNIHFESCHFTHLRLDGGRVENCSFRFCKFNDVSAQGVSILNTSCIEVQW
                     QGCYLTGCLIERWLLTSCQLDDAQLQDIQLNYWTVQDTPMTHLTMSDSKMQDSSWHGC
                     TIQQSVWKNSELIRQVMGSCVLKECQYQAIQSDTVVWSQCQLEQVDFRHQPLENSNFH
                     KSTLTQCGFSDANLAAALFSEATLEGCDFNMAQLAAAQFVDATLRDCNFDTADLQNAS
                     LLRANLTRCHLTQVNLTKADLRSCMLSESSLQASKLSKTRIHGAQIPTLDTPLQMPDP
                     LLSQIDNWYGHHQPGPKNNPKFPSIPSGASRYV"
     gene            774758..775375
                     /locus_tag="YPTB_RS03645"
                     /old_locus_tag="YPTB0651"
     CDS             774758..775375
                     /locus_tag="YPTB_RS03645"
                     /old_locus_tag="YPTB0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002210473.1"
                     /db_xref="GI:488139265"
                     /translation="MSRLTTLLKPKNSLPGYLSYSPRTPLPAVSAPPQVITAKVIRPG
                     NASVSLLGYETLPVTTASSCLFQPENGDLVSAVIDQQQIYITAILYRTSPDAPLVMNS
                     GEVPLHLVTTALEIHSPDRVEIHTRHFSLLTRTTLWVAKTMHQVADSLFVRAKQASRE
                     VENTDDVHARHISQLADQSLMINSRIGSLNASAVLKIDGGQVHMG"
     gene            775381..775746
                     /locus_tag="YPTB_RS03650"
                     /old_locus_tag="YPTB0652"
     CDS             775381..775746
                     /locus_tag="YPTB_RS03650"
                     /old_locus_tag="YPTB0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002214737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_002214737.1"
                     /db_xref="GI:488143529"
                     /translation="MTAANTRAGGISFIGSDPMIPISAPNTAPNANGIPNVSNYFCCG
                     GNEQNLNTIRPATIDGGSVMGAASGTHSAKMDPMQGSGKYFIQGSPATRLGDMSMTNN
                     YNAPSTQIAPSQTKYFVNA"
     gene            775739..776230
                     /locus_tag="YPTB_RS03655"
                     /old_locus_tag="YPTB0653"
     CDS             775739..776230
                     /locus_tag="YPTB_RS03655"
                     /old_locus_tag="YPTB0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012304592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191717.1"
                     /db_xref="GI:499505077"
                     /translation="MRSLFRVLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVA
                     APLINPGPNGQAQPLKVCIIELNKEGWSPPGLYQGTLCSGISVGGEVVSVTEYILAPT
                     EVRQYSRDVPFEQERWWAIAAEFQEMSNGKSLLMLKSDARADFNRVVLVDGKALSLKA
                     STK"
     gene            776350..777705
                     /locus_tag="YPTB_RS03660"
                     /old_locus_tag="YPTB0654"
     CDS             776350..777705
                     /locus_tag="YPTB_RS03660"
                     /old_locus_tag="YPTB0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_002210470.1"
                     /db_xref="GI:488139262"
                     /translation="MLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWG
                     FHSLSINQGLLDQGKIALNQASGVFPDGTPFHMAGDEPLPLPFDPGENCQGSVVCLSV
                     LMDIPGNTYIDLKKSNQGSRFVALDAEVQDRNHGVAAEGTPLIATLQLGQLQSKLTLR
                     ASVSDAESMLPVAYIKERTRDGRLILDDNFLPPMLDFRAIGWIDNAVTELLGLIVQRL
                     ESVYRPDVTLSVGGLSELLELLLLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLLGR
                     LSTIPGGEKPWSRQDLLYTHHEPHNGYFSLFAALRRALSLVIEAPAVALPFIERGDNI
                     YLCQNDSQLRLEKLIFTVSSKLPSETIRTYFPAQTKLGPVEKIVQLIDLQLPGARMIP
                     MSSPPRYIPYYPNSVYFEVDHDDPMYKEMMSGSAIALSIVGDFPELRFEVWGLRQGRL
                     G"
     gene            777702..779312
                     /locus_tag="YPTB_RS03665"
                     /old_locus_tag="YPTB0655"
     CDS             777702..779312
                     /locus_tag="YPTB_RS03665"
                     /old_locus_tag="YPTB0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191718.1"
                     /db_xref="GI:499505078"
                     /translation="MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIV
                     PRSGSSSTSQAENYKEDLADQAASGNNMARTSAPPVTLYQQQPNANDSYPNGNNNNPN
                     GDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRS
                     WPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSY
                     NQSLLVEFHRDAWGGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGA
                     VLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVT
                     AWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIF
                     TSDGAFRTGEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLK
                     LSAARASVVADKLRESTQINETHQREISAIGRGESDPLADNATEEGRKRNRRVDILWK
                     IGQRDADKAMKQFLENPTPEVQGTNTQQ"
     gene            779321..782815
                     /locus_tag="YPTB_RS03670"
                     /old_locus_tag="YPTB0656"
     CDS             779321..782815
                     /locus_tag="YPTB_RS03670"
                     /old_locus_tag="YPTB0656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002228281.1"
                     /db_xref="GI:488157073"
                     /translation="MIRRMLILIIALVLCYIVWWIGPLIAIGPYFPLGGVWVRKIIIA
                     LILFWALWPFVAIFFSWIFRYARAPLPKRKKKTVQLDRVSARFHDAMLTLQHADLSSQ
                     KTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIVYESSEKFLLSEQYGLAQTTDIG
                     PTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQKLFSMIRKYRRYPGVDGIVLC
                     LDVSVLLNSSVTERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLM
                     NDELLAGGLGISMTHNEKGQNNFVADEERYRELLTRVSRYVLEILHDSPNMEMRHQLL
                     LFTESLGALQKPLFGLFEQIFPATPIGYTGCLRQFWFGSTQNLTSWEALYYPSSTSTF
                     ESRPAGQMYFPALSQAITERGVLHATGPMPLRNRLLNIGKYVFVVLVLCILLLMLSAR
                     YFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYEQLGYINTHYLESSPPLLT
                     PYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDTLKVYLMLG
                     QPDHRSQEALVQWFMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKVKLNDEL
                     IRESRIKAMKTPIHIRVINRIHDAPLPARIEDLSLADAAGPSVTLMLRRKSPSTVTDL
                     AIPAFYTRASYHDVVNPQLQEASEAMINEEAWVLSDGKASVSQVSLLAAAQKLSDEAR
                     KYYLMEYANQWDAFFNDIRVRPINGLDDAALLARQLSDPSSPLANLVRFSTREITLTT
                     DNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTPEKAVEDRFELLRRLGY
                     ALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQPEPVR
                     SIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFN
                     RMFGRSGAMQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFENSAQIRDTFFD
                     ASGKMAMSMIIRPISLTPSILEAVLDVDGQIINYSHGSNQPVKVDWPGPKGGVYIRLT
                     FKTQDGNVETVSFNGPWAIFRMYDVSNPRPLGVNSRELMMVMDNVSGVFKIELSSTMK
                     DYPLWSKALAQFSCPKNL"
     gene            782837..783190
                     /locus_tag="YPTB_RS03675"
                     /old_locus_tag="YPTB0657"
     CDS             782837..783190
                     /locus_tag="YPTB_RS03675"
                     /old_locus_tag="YPTB0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002210468.1"
                     /db_xref="GI:488139260"
                     /translation="MLDPKNIQNVLKSSTDLGQQSQSDLQKPFVKGMQNMEMSGADAA
                     RSIMQSVNQSCETMMSDMNKILGGLQDNVDAHQKMQSEERPKDFERAMSDLRSTLSNG
                     FPEEMKSMFDKLPKM"
     gene            complement(783446..786352)
                     /locus_tag="YPTB_RS03680"
                     /old_locus_tag="YPTB0658"
     CDS             complement(783446..786352)
                     /locus_tag="YPTB_RS03680"
                     /old_locus_tag="YPTB0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080535.1"
                     /note="transcription regulator that activates
                     transcription by stimulating RNA polymerase (RNAP)
                     recycling in case of stress conditions such as supercoiled
                     DNA or high salt concentrations. Probably acts by
                     releasing the RNAP, when it is trapped or immobilized on
                     tightly supercoiled DNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase-associated protein RapA"
                     /protein_id="WP_011191719.1"
                     /db_xref="GI:499505079"
                     /translation="MPFTLGQRWISDTESELGLGTVVAIDVRMITLLFPATGENRLYA
                     RNDSPITRVMFNPSDTITHHEGWQLKVEEVTQENGLITYIGTRLDTEETGVAMREVLL
                     DSKLTFSKPQDRLFAGQIDRMDRFALRFRARKYQSEQFRLPWSGLRGIRASLIPHQLH
                     IAYEVGQRHAPRVLLADEVGLGKTIEAGMIIHQQLLAGRAERVLIVVPESLQHQWLVE
                     MLRRFNLRFSLFDDSRYSEALLDSSNPFDTEQMVICSLDFVRRNKQRLEQLADASWDL
                     LVVDEAHHLAWSEEAPSREYQVIEQLAEHIPGVLLLTATPEQLGQQSHFARLRLLDPD
                     RFHDYEEFVNEQQKYRPIADAVTLLLGGERLTDDKLNLLGELIDEQDIEPLLKAANSQ
                     SEDSEAARQELVTMLMDRHGTSRVLFRNTRNGVKGFPHRVLHQIKLPLPTQYQTAIKV
                     SGIMGAKKTLDARAKDMLYPEQIYQEFEGENATWWNFDPRVEWLLNYLVANRGEKVLV
                     ICAQAATALQLEQVLREREAIRAAVFHEGLSLIERDRAAAYFASEEDGAQVLLCSEIG
                     SEGRNFQFACQLVMFDLPFNPDLLEQRIGRLDRIGQNREIQIMVPYLEDTAQAILVRW
                     YHEGLDAFEHTCPTGRTIYDSSYQELISYLATPSEQEGLDEFIHTCRQQHEGLKLQLE
                     QGRDRLLEMHSNGGEHGQELAQSIAEQDNDINLVSFALNLFDIVGINQEDRSDNLIVL
                     TPSDHMLVPDFPGLPPDGCTVTFDREQALSREDAQFVSWEHPIIRNGLDLILSGDTGS
                     CAVSLLKNKALPVGTLLAELVYVVEAQAPKHLQLTRFLPPTPVRMLMDRNGTNLAAQV
                     EFESFNRQLNAVNRHTSSKLVNAVQQEVHTMLQQAEALVEAQAQALIETAKREADDKL
                     STELARLEALKAVNPNIRDDEIEALEHNRKMVLENLNQAGWRLDAIRLVVVTHQ"
     gene            complement(786813..789182)
                     /locus_tag="YPTB_RS03685"
                     /old_locus_tag="YPTB0659"
     CDS             complement(786813..789182)
                     /locus_tag="YPTB_RS03685"
                     /old_locus_tag="YPTB0659"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105679.1"
                     /note="Has polymerase, DNA-binding and 3'-5' exonuclease
                     activities. In Aeropyrum pernix this protein is sensitive
                     to aphidicolin and stable at 95#C; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="WP_011191720.1"
                     /db_xref="GI:499505080"
                     /translation="MGQTRQGFLLTRHWRDTPAGTEVEFWLATDEGPQHVRLPPQPSV
                     AFIPAEQQQRAETVLRAERHWQLRPLALTDFHQRPVLGLYCTQHRQLIRLEKRLRESG
                     VNVYEGDIRPPERFLMERFITAPVWFSGQENDHGPLLNTQLKPADDYRPTLKLVSLDI
                     ETSEHGELYCIGLEGCGQRQVYMLGPPNGETTGTPLDFNLEYVASRPLLLEKLNQWLA
                     VHDPDAIIGWNLVQFDLRVLQKHADRYQIPLRFGRGGNLLEWREHGFKQGHFFASAAG
                     RLIIDGIEALKSATWNFPSFSLESVSQTLLGEGKASDSPYQRMDEINQRFAHDKPALA
                     RYNLKDCELVTRIFAKTELLSFLLERSTVTGLAADRSGGSVAAFTHLYLPRMHRIGYV
                     APNLGELPEEHSPGGFVMDSQPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVAGMQQP
                     DIQHSVPGFRGAWFSREKHCLPAIVNQIWQGREAAKRQQNKPLSQALKIIMNAFYGVL
                     GSSGCRFFDPRLASSITLRGHEIMRQTRELIEAQGYQVIYGDTDSTFVWLKSAHSDEQ
                     ATRIGNELVQLVNQWWQNHIQQNFNLPCALELEFEIHYRRFLMPTIRGAEQGSKKRYA
                     GLISTPTGDQMVYKGLETVRTDWTPLAQQFQRELYLRIFQQQPYQDYVRDYVARTLNG
                     ELDEQLVYRKRLRRRLDDYQRNVPPHARAARLADEFNRKLGRPLQYQNGGWISYVMTT
                     AGPEPLETRQSPIDYDHYLTRQLQPVADAILPFTQDDFTTLITGQMGLF"
     gene            789378..790145
                     /locus_tag="YPTB_RS03690"
                     /old_locus_tag="YPTB0660"
     CDS             789378..790145
                     /locus_tag="YPTB_RS03690"
                     /old_locus_tag="YPTB0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002210465.1"
                     /db_xref="GI:488139257"
                     /translation="MEAYLLHLLTQSLAFTLFIVMLVTFLESLALVGMLLPGTVMMTS
                     VGALIGSGEVDFYFAWVAATLGCLLGDWISYFIGRRFKAPLHNWSFLQKHKSLLNKTE
                     HALHNHSMATVLLGRFIGPTRPIVPMVAGMLNLPTAKFALPSVIGGLTWPPIYLFPGI
                     LAGVAIDIPPSSNSFMFKCLLFVVVVLIWLSLWLSWRWWRFGKRSPDRLSVWLPLARL
                     RWVTLLTIAAAIASFIWLHMQPLMPIYRHLLWKVLAG"
     gene            complement(790214..790924)
                     /gene="thiQ"
                     /locus_tag="YPTB_RS03695"
                     /old_locus_tag="YPTB0661"
     CDS             complement(790214..790924)
                     /gene="thiQ"
                     /locus_tag="YPTB_RS03695"
                     /old_locus_tag="YPTB0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1C1Y5.1"
                     /note="with TbpA and ThiP is part of the thiamine and TPP
                     transport system; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine import ATP-binding protein ThiQ"
                     /protein_id="WP_011191721.1"
                     /db_xref="GI:499505081"
                     /translation="MLKLEKITYLYDHLPMCFDLHIQPGERVAILGPSGAGKSTLLSL
                     IAGFLAPTSGHMLLNNQDHTASPPAQRPVSMLFQENNLFAHLTVEQNIGLGLHPGLKL
                     SGEQRLLLQHIAQQVGLESCLDRLPAQLSGGQRQRAALARCLVRSQPILLLDEPFSAL
                     DPALRNEMLQLVDQVCINRQLTLLMVSHNLDDAARIAQRTLLIVEGRIDYDGPTQALV
                     DGSAAKASVLGIKSAVIS"
     gene            complement(790911..792518)
                     /gene="thiP"
                     /locus_tag="YPTB_RS03700"
                     /old_locus_tag="YPTB0662"
                     /gene_synonym="sfuB"
     CDS             complement(790911..792518)
                     /gene="thiP"
                     /locus_tag="YPTB_RS03700"
                     /old_locus_tag="YPTB0662"
                     /gene_synonym="sfuB"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002214276.1"
                     /note="permease; with TbpA and ThiQ functions in transport
                     of thiamine and thiamine pyrophosphate into the cell;
                     repressed in presence of exogenous thiamine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine transporter membrane protein"
                     /protein_id="WP_011191722.1"
                     /db_xref="GI:499505082"
                     /translation="MAIRRQPLIAPWLWPGLLAAGLIVAVALLAFAAIWHHAPTADWQ
                     SVWHDRYLWHVIRFTFWQAFLSALLSVIPAIFLARALYRRNFPGRQFMLRLCAMTLVL
                     PVLVALFGILTVYGRQGWLAHLFDWLGVDYRFSPYGLQGILLAHIFFNLPLATRLLLQ
                     SLEGIAVEQRQLAAQLGMNGWQHFRWVEWPYLRRQILPTAALIFMLCFASFATVLSLG
                     GGPQATTIELAIYQALSYDYDLGRAALLALIQLGCCLGLVVLSQRLNSVLTVGNTHGQ
                     IWRNPQDSGWARLGDTLLICSALLLMVPPLLAVVIDGSNKTILTVLQQPALWQAFFTS
                     VTIAIGAGLLCVTLTMMLLWSSRELKLRQRAAYGQALEVSGMVILAMPGIVLATGFFL
                     LLNDTLGLPQSPYGLVILTNALMAVPYALKVLDNPMRDLAERYTPLCLSLDIRGWHRL
                     RYIELRALKRPLAQALAFASVLSIGDFGVVALFGNEHFRTLPFYLYQQIGSYRSNDGA
                     VTALLLLLLCFLLFTLIERLPSRHAKA"
     gene            complement(792494..793540)
                     /gene="tbpA"
                     /locus_tag="YPTB_RS03705"
                     /old_locus_tag="YPTB0663"
     CDS             complement(792494..793540)
                     /gene="tbpA"
                     /locus_tag="YPTB_RS03705"
                     /old_locus_tag="YPTB0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002210462.1"
                     /note="part of the thiamine and TPP transport system
                     tbpA-thiPQ; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_002210462.1"
                     /db_xref="GI:488139254"
                     /translation="MLTTASDTFATFMFKECKVFKHIISCLLLISATSALAAEKPTLT
                     VYTYDSFAADWGPGPAIKQAFEAECDCQLKFVALEDGVSLLNRLRMEGKNSQADVILG
                     LDNNLVQAAEQTGLFTPSQVDTRNLTLPEPWQNKTFVPYDYGYFAFVYNKEKLKNPPK
                     SLHELISSKEPWKVIYQDPRTSTPGLGLMLWMQKVYGDQAPQAWQQLAQKTVTVTKGW
                     SEAYGLFLKGEADLVLSYTTSPAYHLIAEKNNNYAAADFSEGHYLQVEVAGQLAASKQ
                     PELAQRFMQFIVTPAFQNHIPTGNWMYPVIKMDLPAGFETLAVPQTALQFDAKDVADN
                     RSKWIQAWQSAVSR"
     gene            794132..795634
                     /locus_tag="YPTB_RS03710"
                     /old_locus_tag="YPTB0664"
     CDS             794132..795634
                     /locus_tag="YPTB_RS03710"
                     /old_locus_tag="YPTB0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191723.1"
                     /db_xref="GI:499505083"
                     /translation="MKTFYQFRDEQKKKLEEHVFYDLISTDKIEFNNKLMFMPAMVHF
                     IMNFRDMNKWVIRFETPDTRFKSVINGGTIEDETHSRLFLEDWRKLHIDDKLKWNSSD
                     IIYWLFISSEMECFRKYGIDFMRLCIDDESDPILRYAHSESGETCGNVFFSRISPIAD
                     RIAENLNISLRYFGTFHLNLENGHVWESEGVFENIVLEQDANEKVRSLSQRMFDIFHG
                     IHNAFYNYTSNYILTQSYPKFPEMLTIGNNEYPQYPDLFLITGNNHSNDIIQHINNYL
                     EQISKHPFYEWLKSTSINPLIKLKSFIPLWIVDIMGYRDINRYVFPYERIESESERLI
                     TEYALLLSEHSYLFYNDWKSLQLDEMLRWTASDTLDFIFLNADMDTHRENLVKFSLCG
                     LKNSEPLTRFWFMMILELSGKSFFSYVGNVAKLAEKEYNISLPYLSGKHSSVKELNVF
                     NELYTHFISQELNQEQKIKIKEIADMVLTALLKNLDISYKYAVNNLFAAR"
     gene            complement(<795882..>796001)
                     /locus_tag="YPTB_RS03715"
     CDS             complement(<795882..>796001)
                     /locus_tag="YPTB_RS03715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012228785.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_032467004.1"
                     /db_xref="GI:694126421"
                     /translation="VRELAQRVLQHGDALMTIAQQLEQKGIEKGIQLGRQEGKL"
     gene            complement(<796003..796447)
                     /locus_tag="YPTB_RS03720"
                     /old_locus_tag="YPTB0666"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(796557..798218)
                     /locus_tag="YPTB_RS03725"
                     /old_locus_tag="YPTB0667"
     CDS             complement(796557..798218)
                     /locus_tag="YPTB_RS03725"
                     /old_locus_tag="YPTB0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66EM6.1"
                     /note="activates sgrS under glucose-phosphate stress
                     conditions; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011191725.1"
                     /db_xref="GI:499505085"
                     /translation="MSTSRLQQQFIRLWQRYNGQSTETTLQALAEVLNCSRRHVRSLL
                     GKMQHAGWLDWQAEAGRGKRSQLIFLRSGLALQQQRAEELLEQDHIDQLVQLVGDKKA
                     VRQMLLSQLGRSFRQGKHILRVLYYRPLENLLPGTALRRSETHMVRQIFNGLTRINEE
                     NGELEPDLSHHWQAITPLHWRFYLRPAIHFHHGRELEMSDVISSLTRLIPQPLFSHIA
                     EVRSPTPYVIDVYLHSPDHWLPWLLGSVHAMILPQEWETQPDFHRQPIGTGPYSVIRN
                     HHSQLKIQAFDNYFGFRALIDEVNIWVLPELSEELVYSGVQLQADDTGKNELESRLEE
                     GCYFLLFDQRSPQACTPEIRRWLCELITPIALLSHADPFYQRYWSPAYGMLPRWHHNR
                     LTTQEPKPEGLNELTLTFYSEHSEFDAISQTLTQLLAAQGVTLKIQVLDYTRWYQGDA
                     QSDIWLGSANFYLPLEFSLFATLYEMPLLQHCLSEELHQDIESWRNNTLLMADWSQRL
                     VSQHQFHPLFHHWLELYGQHSMRGVRMNTLGWFDFKSAWFTPPEA"
     gene            798580..798753
                     /locus_tag="YPTB_RS03730"
     CDS             798580..798753
                     /locus_tag="YPTB_RS03730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002214268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041175438.1"
                     /db_xref="GI:752489418"
                     /translation="MLAVRTHPNHLLVVDLKIISLIGIMSLIRVSPCGPAQALFKIVE
                     PICRLLAAYLQRQ"
     gene            798864..800045
                     /locus_tag="YPTB_RS03735"
                     /old_locus_tag="YPTB0668"
     CDS             798864..800045
                     /locus_tag="YPTB_RS03735"
                     /old_locus_tag="YPTB0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002224086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011191726.1"
                     /db_xref="GI:499505086"
                     /translation="MRSARAFSRRINPVFLAFFVVAFLSGIAGALQAPTLSLFLSTEL
                     KVRPLWVGLFYTVNAIAGITVSFLLAKRSDLGGDRRKLILICYLMAVGNCLLFAFNRD
                     YLTLITLGVLMASVANTAMPQIFALAREYADNSAREVVMFSSIMRAQLSLAWVIGPPL
                     SFMLALNYGFTLMFSIAAGIFVISALVVWFILPSVKQPEPVADAPVVAQGSLFADKNV
                     LLLFIASMLMWTCNTMYIIDMPLYITANLGLPERLAGLLMGTAAGLEIPIMLLAGYSV
                     RRFGKRKIMLFAVMAGVLFYTGLVLFKFKTALMILQIFNAIFIGIVAGIGMLYFQDLM
                     PGRAGAATTLFTNSISSGVILAGVLQGVLTETWGHNAVYVAAMVLVILALIICAKVRE
                     A"
     gene            complement(800323..800925)
                     /gene="leuD"
                     /locus_tag="YPTB_RS03740"
                     /old_locus_tag="YPTB0669"
     CDS             complement(800323..800925)
                     /gene="leuD"
                     /locus_tag="YPTB_RS03740"
                     /old_locus_tag="YPTB0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7FM87.1"
                     /note="catalyzes the isomerization between
                     2-isopropylmalate and 3-isopropylmalate in leucine
                     biosynthesis; forms a heterodimer of LeuC/D; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="WP_002210456.1"
                     /db_xref="GI:488139248"
                     /translation="MAKFIQHIGLVAPLDAANVDTDAIIPKQFLQKVTRTGFGQHLFN
                     DWRFLDDAGKVPNPDFVLNLPRYQGATILLARENFGCGSSREHAPWALTDFGFKVVIA
                     PSFADIFYGNAFNNQLLPVTLSEADIDTLFQLVKENEGIEFVVDLEQQTVNAGGKSYA
                     FEIDPFRRHCMINGLDSIGLTLQHEHNISAYEKQQPEFLR"
     gene            complement(800940..802370)
                     /locus_tag="YPTB_RS03745"
                     /old_locus_tag="YPTB0670"
     CDS             complement(800940..802370)
                     /locus_tag="YPTB_RS03745"
                     /old_locus_tag="YPTB0670"
                     /EC_number="4.2.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q66EM3.1"
                     /note="dehydratase component, catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="WP_011191727.1"
                     /db_xref="GI:499505087"
                     /translation="MGTTSSQSKTLYQKLYDAHIVHEAPNETPLLYIDRHLVHEVTSP
                     QAFDGLRAMGRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCAEFGVS
                     LYDLNHPFQGIVHVIGPEQGMTLPGMTIVCGDSHTATHGAFGSLAFGIGTSEVEHVLA
                     TQTLKQGRAKTMRIEVNGTVGAGITAKDIVLAIIGKTGSAGGTGHVVEFCGSAIEALS
                     MEGRMTLCNMAIEMGAKAGLVAPDDTTFAYLKGRQFAPTGEQWEQGVAYWRTLKSDAD
                     AQFDTIVTLDAADIAPQVTWGTNPGQVIAVNQIIPAPESFSDPVERASAEKALAYMDL
                     RPGIKLTEVAIDKVFIGSCTNSRIEDLRAAAAIAQGRKVAKGVQAIVVPGSGPVKAQA
                     EAEGLDKIFIAAGFEWRLPGCSMCLAMNNDRLEPGERCASTSNRNFEGRQGRGGRTHL
                     VSPAMAAAAAVSGHFADVRELSAATH"
     gene            complement(802372..803463)
                     /locus_tag="YPTB_RS03750"
                     /old_locus_tag="YPTB0671"
     CDS             complement(802372..803463)
                     /locus_tag="YPTB_RS03750"
                     /old_locus_tag="YPTB0671"
                     /EC_number="1.1.1.85"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002228105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="WP_011191728.1"
                     /db_xref="GI:499505088"
                     /translation="MTKTYHIAVLPGDGIGPEVMAQASKVLDAVRQRFGLKISTSVYD
                     VGGAAIDRHGSPLPAATVAGCEQADAILFGSVGGPKWEHLPPAEQPERGALLPLRKHF
                     KLFSNLRPARLYQGLEDFCPLRSDIAARGFDILCVRELTGGIYFGQPKGREGQGMHER
                     AFDTEVYHRFEIERIARIAFESARKRRSKVTSIDKANVLQSSILWREVVNGIAADYPD
                     VALSHMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQG
                     FGLYEPAGGSAPDIAGKNIANPIAQILSLILLLRFSLGKDDAADAIERAINQALEQGY
                     RTADLAGDGHAIGTHEMGDIIAKFVVEGV"
     gene            complement(803466..805028)
                     /locus_tag="YPTB_RS03755"
                     /old_locus_tag="YPTB0672"
     CDS             complement(803466..805028)
                     /locus_tag="YPTB_RS03755"
                     /old_locus_tag="YPTB0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005156896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="WP_002210453.1"
                     /db_xref="GI:488139245"
                     /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDIME
                     VGFPVSSPGDFESVRTIAQQVKNSRVCALARCVDKDIDVAAEALRIAEAFRIHVFLAT
                     STLHIESKLKRSFDDVLAMAVHSVKRARNYTDDVEFSCEDAGRTPIDNLCRVVEAAIT
                     AGATTINIPDTVGYTTPYQFGGIITDLYERVPNIDKAIISVHCHDDLGMSVANSITAV
                     QAGARQVEGTINGLGERAGNCSLEEVIMAIKVRHEMLGVHTNINHQEIYRTSQLVSKI
                     CNMPIPGNKAIVGSNAFAHSSGIHQDGVLKNRENYEIMTPESIGLKEVQLNLTSRSGR
                     AAVKHRMEEMGYQDKDYNLDSLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEYYR
                     LDYFSVQSGSSVMATASVKLVCGEEIKSEAATGNGPVDAVYQAINRITDYPIELVKYQ
                     LSAKGQGKDALGQVDIVVDHKGRRFHGVGLATDIVESSAKALVHVLNNIWRAHQVEKE
                     KQRLQQNNQEMV"
     gene            complement(805375..805566)
                     /locus_tag="YPTB_RS03760"
     CDS             complement(805375..805566)
                     /locus_tag="YPTB_RS03760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012413476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012413476.1"
                     /db_xref="GI:501381910"
                     /translation="MDQFILYISTLPLSLSLTHKKIESNRQNNQHSCWVGRQAAAEKH
                     GKHNNPDNGNYAKQLKNHE"
     gene            806244..807200
                     /gene="leuO"
                     /locus_tag="YPTB_RS03765"
                     /old_locus_tag="YPTB0673"
     CDS             806244..807200
                     /gene="leuO"
                     /locus_tag="YPTB_RS03765"
                     /old_locus_tag="YPTB0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002216434.1"
                     /note="activator for leuABCD operon; member of LysR family
                     of transcriptional activators; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine transcriptional activator"
                     /protein_id="WP_002216434.1"
                     /db_xref="GI:488145226"
                     /translation="MSEYNLVTDSQATKKESIDVHLRSVDLNLLTVFDAVMQMQNVTR
                     AAQSLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARARQLFGPVRQALQLVQNE
                     LPGAGFEAKNSERLFNLSICSPLDVRLAAQIVQRVKQSAPNVQLVIKSYLNDNIEHQL
                     RYQETEFVIGYTEFDRPDFHRIPLFKDELVLAVSKDHPRINDSITENQLLSESHAVVS
                     LDKKGSFSEPYYDSTTSTQSIAYESTDMNSVLNIVSQTYFVAIAPRWLVKTYSEALNL
                     KLISLPWENTSRACYLTWHESTDRDKGHQWMKALLGQFSSPV"
     gene            807550..807756
                     /locus_tag="YPTB_RS03770"
     CDS             807550..807756
                     /locus_tag="YPTB_RS03770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002216435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002216435.1"
                     /db_xref="GI:488145227"
                     /translation="MTETPANLSSSPLCFSSKPYLLYGILFAIAHRVSRLREKKVNTC