GenomeNet

Database: RefSeq
Entry: NC_006670
LinkDB: NC_006670
Original site: NC_006670 
LOCUS       NC_006670            2300533 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 1,
            complete sequence.
ACCESSION   NC_006670
VERSION     NC_006670.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 2300533)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 2300533)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2300533)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 2300533)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017341.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2300533
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="1"
                     /note="MAT-alpha"
     gene            4839..6236
                     /locus_tag="CNA00010"
                     /db_xref="GeneID:3253454"
     mRNA            join(4839..5178,5241..5377,5453..5560,5646..5768,
                     5871..6078,6141..6236)
                     /locus_tag="CNA00010"
                     /product="expressed protein"
                     /transcript_id="XM_024656125.1"
                     /db_xref="GeneID:3253454"
     CDS             join(4914..5178,5241..5377,5453..5560,5646..5768,
                     5871..6059)
                     /locus_tag="CNA00010"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512088.1"
                     /db_xref="GeneID:3253454"
                     /translation="MKTYPLALDLWDSGSSVIIRSATGTRIASFPLDFISRGGDNSWS
                     YVLYVIGQLIIPESSRTGIIKDEHGRVLEPNESPSAGVFFFSQVADPDPQLAQTDVSF
                     SSGPEYFSSIKAPNPEGSISTRSDSKRSSVNQSRFYISLIARDGTCVVSGAHWESCTA
                     SHIVPASRPDIYDCFYGDGGGLPMFRPSAGLLLRDDLHHAFDRLMFSFYQKDGVLYVH
                     CFSMAFQGASEYHGKAIPPNWFRAASRDLPDPVLVEWHYSQCLKARIRGFSVDML"
     gene            complement(6342..8374)
                     /locus_tag="CNA00020"
                     /db_xref="GeneID:3253645"
     mRNA            complement(join(6342..6730,6792..7128,7437..7501,
                     7562..7678,7748..7804,8103..8374))
                     /locus_tag="CNA00020"
                     /product="expressed protein"
                     /transcript_id="XM_566435.2"
                     /db_xref="GeneID:3253645"
     CDS             complement(join(6520..6730,6792..7128,7437..7501,
                     7562..7678,7748..7804,8103..8278))
                     /locus_tag="CNA00020"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566435.1"
                     /db_xref="GeneID:3253645"
                     /translation="MSPAIPPFDSLPIDKSGPPYNAWGLYGSEDELGRLHLITQEAVK
                     RGRDTITEGISINLNLPMNFFPAHPSRKRLERQIVCSGHSNDDELSFNTQSSTQWDGL
                     KHYPYQHFPEEGQYRFYNGMTLEEASDSSITKLGIHNFAQKPITSCAHLLDIPLYLSR
                     HSLPPLSPFSASSTISLDILIACAEESKVNIQPGDILIVRTGFTDELLKLSEETRDQL
                     RKREVNGSCGVAHGKEILKWHWEKGIAAVVADCPSYEAWPSQQLTAHQVFISGWGLPI
                     GELFDLAELAKKCEEIRRWTFFFTSMPLNVIGGIASPPNAQAIL"
     gene            9003..12963
                     /locus_tag="CNA00030"
                     /db_xref="GeneID:3253928"
     mRNA            join(9003..10557,10662..11183,11270..11936,11995..12174,
                     12324..12963)
                     /locus_tag="CNA00030"
                     /product="cation transporter, putative"
                     /transcript_id="XM_566436.2"
                     /db_xref="GeneID:3253928"
     CDS             join(9208..10557,10662..11183,11270..11936,11995..12174,
                     12324..12574)
                     /locus_tag="CNA00030"
                     /codon_start=1
                     /product="cation transporter, putative"
                     /protein_id="XP_566436.1"
                     /db_xref="GeneID:3253928"
                     /translation="MPNSSTQTVVAIDYAQTPSRHLHSDTHQIPNSRPSPILTHHTPA
                     RIAQPEFAELLTPLKFRRRKLQPRPDQQPTSLPLVAGPSRLGYYTLEGDLYRGSAYDP
                     TQPPPANATAQVDDDAISLETGSTTSSTSNWSWGSGNFDRAMAVIGRVGEALGVRRGS
                     AGSSSSDSSAGSSDMESLKSQATAPRKGRKRRGSFMSGLSRQASRGGAEGVKAKHKRE
                     QLPKRRQFTLLVPPPALPSGDVDIGIPSTIDPHVFAETEKLPGDRKGDKNYPPDRVIT
                     TPSLPTVLDKIQSVRLSSGYSGIPSSVGNTPPQTPGAFPSSPTPNFASRVPVRRGGSA
                     PGRSRKSAGFVNPPVPLLPQTQSRLQCRSQSAASSRTATQSRLHTLRGAAESLSPIRP
                     KSVSDLLGLKFDAESMKEGTALMESKVGLELKGKSKSKGCWWLDVSCPTWEDLREIGE
                     LLSLHPLTLEDVLQQDPREKLERFDKLGYYFLVIRALDENYFKYTPGSSISSPSVQSG
                     NSNGKGGDTQTPKSTPSEKELIDEKEGLSQGMDDRSGNNRNEDGNEQRQDIEGLEYKK
                     SERRRRGWGMGRAQGKMTGKMGEKVEIIEDRPGKEGLEGVGVGAVNVYLVVFADGIIS
                     FHFDDISKHTNRVLDRVLTLANPDHGADWIAHGLLDSIVDAFFPIIRYVDGAIDDIDS
                     LTIDPTTDPKKTTAYLGLGLGNVMAGTDEDGSERFKQGGLGNGNEGKRDGLWRTPDHS
                     ATQHISVRKRLRASFPHFYPPPRVLRTFTYLRLFLLPTSSAVKRKHDQAPKTVFGRST
                     MLKNMTDMRKLVTGLTRLLSAKGTVIGRLRKRAKEEGGTVEAYIGDVEDHILLLQNSL
                     YHYEYILSHCQPAYLSHLNVSYAFTKGRTDQAILALSVVAISILPMQFITGLFSINVH
                     VPHNGWIHCPTDTLCEPDGSMSPFNYFAAIVIGIALVACCMVSVIRWWRWDARKKFGR
                     LRGIELPNAWDGFWGWE"
     gene            complement(14271..15995)
                     /locus_tag="CNA00040"
                     /db_xref="GeneID:3253494"
     mRNA            complement(join(14271..14537,14599..14647,14705..14949,
                     15008..15078,15125..15131,15182..15290,15339..15995))
                     /locus_tag="CNA00040"
                     /product="calcium-binding protein, putative"
                     /transcript_id="XM_024656126.1"
                     /db_xref="GeneID:3253494"
     CDS             complement(join(14508..14537,14599..14647,14705..14949,
                     15008..15078,15125..15131,15182..15290,15339..15931))
                     /locus_tag="CNA00040"
                     /codon_start=1
                     /product="calcium-binding protein, putative"
                     /protein_id="XP_024511806.1"
                     /db_xref="GeneID:3253494"
                     /translation="MPQYISAPNPYGSVSAEARRRYEERYAKKRAEEAAKARAEAEAA
                     NQPEQPLQPVQQQQSPAPPPTLQPGYNQQYTNGSSQQHPGHPHQPQQAYSGPQHLHQN
                     YARTPQQVTQNDPSVQPQAYHLAQSSTPPQQQQQQQWNNPTPQAQGLALGHPSQSQLP
                     FQQQQPEQHPQQQQQWQQAHQHSVSPPASAEDQELQNMFRQFDSSQSGQLHAYDLQRL
                     LAKDARMEAREDAVKMLMNIFDTDRSGSINFQEFEGLYRYIQDWHGIFRRFDRDNSGL
                     IDRLELSNALQGFGFSLPPELVAKLVKRFTPPSTLGQTVAARPGISFDRFLLACVTVK
                     HYTEAFRRLDPENTGFITVAYNDYMDIVLDAPS"
     gene            16160..>20462
                     /locus_tag="CNA00050"
                     /db_xref="GeneID:3253550"
     mRNA            join(16160..16485,16526..16655,16709..16970,17009..17166,
                     17205..17405,17444..18135,18186..18336,18409..18534,
                     18594..18723,18775..19000,19079..19184,19242..19351,
                     19407..20126,20196..>20462)
                     /locus_tag="CNA00050"
                     /product="cell cycle arrest in response to
                     pheromone-related protein, putative"
                     /transcript_id="XM_024656127.1"
                     /db_xref="GeneID:3253550"
     CDS             join(16255..16485,16526..16655,16709..16970,17009..17166,
                     17205..17405,17444..18135,18186..18336,18409..18534,
                     18594..18723,18775..19000,19079..19184,19242..19351,
                     19407..20126,20196..20462)
                     /locus_tag="CNA00050"
                     /codon_start=1
                     /product="cell cycle arrest in response to
                     pheromone-related protein, putative"
                     /protein_id="XP_024511807.1"
                     /db_xref="GeneID:3253550"
                     /translation="MASSKPVFGGMFDMMRRGNAQQQETAPPTPVGQGQPTVVTRPRA
                     PTMIMKRDGQEDGLLSGLPGGTFRSPMQEKKQKTPQYDFRYDDTDTLMNELEEFYPYV
                     EMADIARNPEKFKGSFNGDWTEAPLSSRKAYIEVQLEQFESPNQHTRRLAQGRLLYLL
                     QGCFEETTSPEMQLHWVIENAKAVRAVDGVATIVYGLRDAARRYSISADDKPAPGSLP
                     AGTVPAQVDPYDDHSAELMDLLAMLYFIVEVLRTDDTFGDELMAMSPPLPLALFQMVS
                     TLRDKIPKGYPVKKVLLLLWKTLLACLGGMKEVQQAMALSREQAGLDPNTKYFTKASP
                     IDIASWHRDTATKYPTFAPPRCSAHPIPSEKLAESTRPIPPRPNYHSTEMPPAPPRPQ
                     PQPSAPATNNPSLPMPGTPAPSPPPSPAPPKKKQQFQTDPSRPFVFPYSRSSAAVPSS
                     LVPFAISEADKLYHQHEYVSLGLLQMWQVREDYIREERGLGKSGLIGFTNGYDGEEEE
                     DAEEVEAMMREWKYEQEEMDCEERGDREGVKKAREKRMAAKRLRRVDIIHKNTLPILH
                     SCVIALLKLLLATVTSPSTGGGVNLQNANMPPGLHSPTQEMPPSDKPNAPPPTQEEID
                     IARHREITSKAVSAILILLLKWFKASHVLKFHLLTQLLFDSNCLLLLLKMFGLTDISQ
                     VVTAHNEVESLNFFNYCYLECGRQRPNDAADLRPSRHPSGPLPENAELSNDYSWRNFF
                     STINFLKVLQKVTKHRSHRTYVMSSYKSWQILKRMLKVNQPMLQLQVLKLIKSQMPWC
                     GRKWRQAAGNMKVITSIYLNCRPELRDDWLAGTDQDTELEDAVPQDTALRTLVQFYNL
                     RHYIPPAPLSPDVSHRRTSSFNPLYEDPVLQTQHPQFGHRARSDSTSGTSSESDVFPP
                     RKSSSNNPASLPYNPDEMIEFWLHEYEDVLVEVFGVEGGNEVLDEFGLSSEIAGLSFT
                     SKSPSGVSDGEDIQTPGPGNTDSRAWNRLSEIMRRGDEEEISDSESVVSVGELGSAAR
                     LGGQGADAVNDEEGISEDGEGLEESVPEGEKSRVGMGKGRRRSGAGENTWEHISPTLA
                     LLPRTPAERRRSSSSSTGSPLRPVVPTVNSTINLGSLEGPDEVFEDEEIDTRGPMPIK
                     MDTKDHEEREGGAVDEVEYTYGE"
     gene            complement(18733..22794)
                     /locus_tag="CNA00060"
                     /db_xref="GeneID:3254020"
     mRNA            complement(join(18733..20106,20175..20531,20585..20944,
                     21003..21483,21547..21799,21849..22077,22129..22215,
                     22266..22459,22517..22794))
                     /locus_tag="CNA00060"
                     /product="methionine-tRNA ligase, putative"
                     /transcript_id="XM_024656128.1"
                     /db_xref="GeneID:3254020"
     CDS             complement(join(20633..20944,21003..21483,21547..21799,
                     21849..22077,22129..22215,22266..22459,22517..22709))
                     /locus_tag="CNA00060"
                     /codon_start=1
                     /product="methionine-tRNA ligase, putative"
                     /protein_id="XP_024511808.1"
                     /db_xref="GeneID:3254020"
                     /translation="MVLRHLTRLSPCLRVSKSFAPISMRYSSSVPSNTPTTPSLFTPE
                     GDPANAKPFYVTTPIFYVNASPHVGHLHSLLLTDVLARFSRLRHPQRKVVFATGTDEH
                     GLKIQQAAKANGVGEQEFCDDVSQRFRKLAKLANASNTDFIRTTELRHVKAVEQFWNT
                     LVASGDIYKGTHSGWYSISDESFYAVSQVTKSPEDGKMIAIETGNEVIWEEETNWKFR
                     LGRHKKVLEKWLSQPESVHPNTVRLDLLRQLSSLEDLSVSRPSSRVKWAIPVPGDPEQ
                     SIYVWVDALINYITVLGYPDWEGKGESVGWPADVHVVGKDIIKFHALHWPSLLHSASL
                     PAPKRIIAHAHWTMSHTKMSKSRGNVVDPISAMTQWGEDGVRWYLMRVGGGLVDDADY
                     NPAEVEVHYRLLADQVGNLLSRISGAKVLKKAEREFDWGNEKTRDRGEDRDEELDGMM
                     ARMREEFEGKMEVFGVSQACAGVMDVVMATNKLFTSLAPWSPSTPSSVPALTYAYHAL
                     RLSAILLQPIIPAKAGEALDRLGVPAEERSWVDAEWPPSEEKVLRTEKMVERLKEASK
                     KWKGKGHLFPLPGKDA"
     gene            22943..>24309
                     /locus_tag="CNA00070"
                     /db_xref="GeneID:3253998"
     mRNA            join(22943..23186,23239..23321,23375..23464,23606..23661,
                     23727..24211,24269..>24309)
                     /locus_tag="CNA00070"
                     /product="proteolysis and peptidolysis-related protein,
                     putative"
                     /transcript_id="XM_566440.2"
                     /db_xref="GeneID:3253998"
     CDS             join(22985..23186,23239..23321,23375..23464,23606..23661,
                     23727..24211,24269..24309)
                     /locus_tag="CNA00070"
                     /codon_start=1
                     /product="proteolysis and peptidolysis-related protein,
                     putative"
                     /protein_id="XP_566440.1"
                     /db_xref="GeneID:3253998"
                     /translation="MNRQGAEAFAKLAQQLNRARMQASGGGGGGGRGGGQMPGGFKGF
                     MAGSGAIGTLVVGAIALNYSLFNVDGGHRAIKYSRLQGVKADIYPEGTHLVLPWFEHP
                     VIYDVRAKPRNIASLTGTKDLQMVNITCRVLSRPSVNDLPTIYRELGTDYDERVLPSI
                     VNEVLKSVVAQFNASQLITQREMVSRLVRENLTRRARRFNLILDDVSITHVAFSPEFT
                     HAVEAKQVAQQIAQRAAFLVDQAIQEKQSIIVKAQGEARSAELIGEAVKTNKGFLQLR
                     KLEAAREIAGTLAQSGNRVMLDAKSLLLDVTEDEVLNATLRK"
     gene            26489..27914
                     /locus_tag="CNA00075"
                     /db_xref="GeneID:36392649"
     mRNA            join(26489..26546,26647..27032,27094..27232,27296..27366,
                     27431..27914)
                     /locus_tag="CNA00075"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656038.1"
                     /db_xref="GeneID:36392649"
     CDS             join(26531..26546,26647..27032,27094..27232,27296..27366,
                     27431..27457)
                     /locus_tag="CNA00075"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514110.1"
                     /db_xref="GeneID:36392649"
                     /translation="MSGCYSTMLGAILTLNEWEQEEHIPKSWDHLENPPDVRFLSSRL
                     DPAVFRRMTMPDTFIFAAQHVLSRHKDKFEGKWWDLWCVIHPLASEDDPTEHLVLPAG
                     APIDLQDLSSRFNLEGERLNAELLTMLTARNEATAVPTQLSETTQANLDSTLTDFTSS
                     ITTTEYNGEGAPSISRYSDQSILGSPPDLVQDSKKHAATSSVRQRRQPTFCS"
     gene            28039..29480
                     /locus_tag="CNA00080"
                     /db_xref="GeneID:3253721"
     mRNA            join(28039..28891,28972..29480)
                     /locus_tag="CNA00080"
                     /product="expressed protein"
                     /transcript_id="XM_567247.2"
                     /db_xref="GeneID:3253721"
     CDS             join(28562..28891,28972..29277)
                     /locus_tag="CNA00080"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567247.1"
                     /db_xref="GeneID:3253721"
                     /translation="MLNPRSLRFDTRQIDYTHHHHDYDYTLPKSTLISLIIGVGTFAV
                     TSILVVFSLRIYLRRRSLRRAQAMSGSGEDLREIMREYLDEGVKGNEGTKPEMWEVEM
                     KYEDEITQPLTLREPTSTRPHLAQPDISKAISIFIAFPAPYSSGPDDLPEIVLGTAIF
                     HQSTLSSTISRFSENEKTLSRNTSEEGSYVVKDKNTEKDGTNVVVQALEYV"
     gene            29947..31102
                     /locus_tag="CNA00090"
                     /db_xref="GeneID:3254004"
     mRNA            join(29947..30174,30262..30289,30383..30455,30665..31102)
                     /locus_tag="CNA00090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656129.1"
                     /db_xref="GeneID:3254004"
     CDS             join(30054..30174,30262..30289,30383..30455,30665..30697)
                     /locus_tag="CNA00090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511809.1"
                     /db_xref="GeneID:3254004"
                     /translation="MASTILPLELVDRCIGSPIWVLMKNEREFTGTLMGFDDYVNMVL
                     KDVKEYEVTASGITETDLGDTLLNGNNIAMLIPGGKGPKA"
     gene            complement(31136..34454)
                     /locus_tag="CNA00100"
                     /db_xref="GeneID:3254003"
     mRNA            complement(join(31136..32790,32884..32991,33102..33161,
                     33258..33340,33423..34454))
                     /locus_tag="CNA00100"
                     /product="expressed protein"
                     /transcript_id="XM_024656130.1"
                     /db_xref="GeneID:3254003"
     CDS             complement(join(31375..32790,32884..32991,33102..33161,
                     33258..33340,33423..34233))
                     /locus_tag="CNA00100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512089.1"
                     /db_xref="GeneID:3254003"
                     /translation="MRCDVCCVLWPMGWSSSWVCTNVCVSITTLSHAILVSTAMATLT
                     PGVSPTSCLAISSPRPPLSPISPDPSTIISPKYRAAKHKISMREVQPNYRRADGYGQG
                     HHHRKYQDQQRVDELDPDGVPAKADDEPRVCPVRTSPSPSPSPPSRPRSPLPSPSLKV
                     QVRPIRALPRLSDPTVQALGIPVSNYVFAPNPLGFQFNHSDLSRFRNGAHGRCGVDVD
                     VDMDVDDDGGGEEGDGKPMTMSEAVWRRWEQVGELAKGAGELFRYAYDRDGNDYRPDM
                     THVQAIRLVIAASPRKMMTLAQIYQAIEERWPWHKAAGSTWKNSIRHNLSLNDCFINA
                     ERPTHEGGSGKGGYWTVNDKLTGKTARKLKRSLRSELENEMENDAIEVDGRAGGLSHR
                     HPYPQPNAHATYFPSSFSPTHPHPHYPHSQTHNINDMYTTETLWDPPARPVRSVKRYR
                     LSQPPLPPSGSGAVSASYQPYFQLYPHSRPHQHPHEHELPHERRHEHTLERARPILAN
                     EYTRSPSPSLYTHFPEYKRDPHLRLGISLSVPTFAHMQSHSRGALPHAPELMDQERDG
                     DEQRDREQRVRDSVTPFGVRVFAQERERGKEREEQRPISLVDLRQLDPSSSCPASVPS
                     APSSALSNFTSAPTSVSAPFPESATVLISTSTANKNKSSSEWTSHHTRTARVGTGRFW
                     KWDLFGRSSGSAGGERERERKKEDEREREWEGEQRGYYHPYPTPKTSGEIEREADYND
                     HEHYDHTQNHVHTQNHVHTQNHVHTQNQNQKAKYVSRDIPFSLWTPPGQGAGQMGGRE
                     KGEDRDELQRAADGVELLALAAAKIQG"
     gene            35826..38610
                     /locus_tag="CNA00110"
                     /db_xref="GeneID:3253976"
     mRNA            join(35826..36922,36974..37507,37572..37627,37684..38020,
                     38069..38217,38266..38610)
                     /locus_tag="CNA00110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567248.2"
                     /db_xref="GeneID:3253976"
     CDS             join(35862..36922,36974..37507,37572..37627,37684..38020,
                     38069..38217,38266..38540)
                     /locus_tag="CNA00110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567248.1"
                     /db_xref="GeneID:3253976"
                     /translation="MAGYDARYGNPLDPMSGGRPSPPETSQQDAYEYSKHGSSSGYLG
                     QLPLGADSAQAETASALRTLFGEGADVQALQEPPNQINTLAEGAAVAETGGVLGGDTT
                     RSDNEALAIDPSLSEQAAPAPKDSTETPDDRSRSPSSGNHHHHHPAVKRKATSRAGML
                     ARGGACEFCKRRKLKCSAELPACANCVKSGKECVYAQKKQRSRVKVLEDRLQELEKRL
                     EQGQAGAASASGGDSGAHAASSVYTAPSLGSGGGSELTVEQTLVHNVDPSLLPPSEYD
                     EAFILHDFDSFADMRKQETQLEPDLMTLADAAAADTPAAAAAETNDPWAKMSPEEIVK
                     EIIKVATGGKGEGERIISHLVQTYMNSTVNTWHPLVIPPMDLVSRVSRTTPDPIHPTL
                     LLSLIPALLPLSPIQSLRHPAIPLLLLPHARAHSVQAITQSDPRVLDTIIAGVSRAYS
                     FFNEAKNIDGWVDCVAATSLVRAAGLTKQGGVGERFVPEDRVPAERLAKRRREAGLRA
                     LMHKGAIVPPPESWYQFGQRVNLFWTSYICDRAAAIGWGWPSSYNDEDITTPWPKDDY
                     KSVQALLDDTTIHTFLSPLAPAPAPATPDSDLCAQAKSITLLYHAQRLLDSPPELSTP
                     EKTHRLLGLTEGYMESLEKMRGPRMRAGKLSSVWMILYTTIAVLHSKDGFDKCDPDGA
                     DQVSITRVVAAADKVLELVSAVQNTGDTHLSSCDVISSVLFLHLARLMIQYTNRLRLR
                     VQDSALVSTLRAKTESFKRALIDQGERLVFAQVAAQMLENYHVGAEWKAGEWERADGG
                     DWRGV"
     gene            complement(38569..39057)
                     /locus_tag="CNA00120"
                     /db_xref="GeneID:3253809"
     mRNA            complement(join(38569..38691,38736..38817,38864..39057))
                     /locus_tag="CNA00120"
                     /product="chaperone, putative"
                     /transcript_id="XM_024656131.1"
                     /db_xref="GeneID:3253809"
     CDS             complement(join(38666..38691,38736..38817,38864..39025))
                     /locus_tag="CNA00120"
                     /codon_start=1
                     /product="chaperone, putative"
                     /protein_id="XP_024512020.1"
                     /db_xref="GeneID:3253809"
                     /translation="MDFSQFNGAEQAHMSKVIEKKQMQDFMRLYSGLVEKCFNACAQD
                     FTSKALTTNETTCVQNCTDKFLKHSERVGARFAEHNAEQMQGAGQ"
     gene            39158..43081
                     /locus_tag="CNA00130"
                     /db_xref="GeneID:3253994"
     mRNA            join(39158..39919,39967..40051,40112..40542,40602..40740,
                     40807..40935,40989..41137,41197..41393,41466..41629,
                     41698..42298,42369..42537,42588..43081)
                     /locus_tag="CNA00130"
                     /product="expressed protein"
                     /transcript_id="XM_024656132.1"
                     /db_xref="GeneID:3253994"
     CDS             join(39176..39919,39967..40051,40112..40542,40602..40740,
                     40807..40935,40989..41137,41197..41393,41466..41629,
                     41698..42298,42369..42537,42588..42770)
                     /locus_tag="CNA00130"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511810.1"
                     /db_xref="GeneID:3253994"
                     /translation="MFKSLPQAIGLPFLSPAEDAQLKFKSSPAGIQRLAGPERIPPAD
                     TAYWAQWYSLFPSPHDVPPIVRPPDLRHALQHNPANLATLTTHLAHRLFTLVPDPRFP
                     PAPDLCAHALSCLRVLGTVLAVVYEAEGDTPGDSFAATHLWARQKAPASSHSDTQFTL
                     ADSDDDDAELDAGARAFKATLGHPPAPASPISDPLTQPPDDTPRPQQPDEYLPSLAER
                     LFSCAIDLLFCAGFTLPQSVNGEDEDDKINYVIWEKGVGSTIRIGSSPELDRNKTEVL
                     RFLLILLSSPLYTPPSALHTTPNPPLFTLTHTLERRLVLSLLCSFLNTSLTRDPSSSA
                     GGGIGIVGGLGKLGGFGGLGLRGGEERKALVRVCMAVLLVALDYKMEARVGPAGALEG
                     GYAGTVMRGTGMGEGKEENAFRYFLSKLHRKEDFTFILDGILATLAEYHTSLTNGYLP
                     GGVGVGKKDIGCLLQTYILLWRLVDLNKRFKAHLLEQPGKTVDLVVYILVTCLELKDD
                     PAQNGLLRLLSYLLQTLSANEPFGKSLNQTIRIPVPARWGVTGSAVDFMIVSIYSIAT
                     TPGLNPLFPALTISIANISPYITNIGVQASARLLGLFKAFSAPNFLLGDEGHPRLVYY
                     LLETFNSVLYYQLNANPNLVYAILRSHNDFQTLATFTLMSGLRDIKRRKFLRAAAAEK
                     NGRPGSAATTNPSSTNSLFTRLGGGGGGGGRDNGITSDAEMIAEKAALLGLEPEEEDD
                     VHLSGSQSQGQGEGQGQGQGHASTPSEGDVPSLSTTPTPTPNTTTATATPDYASNPPP
                     PSRSMSEKARGKMRATESTTSLATTNTHPGGGGGGGGGGGGGQEERVEDDEEEEELMK
                     IAAAGVGPNGYVPTQEWVSSWQKGLPLDPVLVAISELLPKIRETQPLVGAPSEKVFNI
                     LKDVELADVLPPAPPITPRRFQWSPASCIWLTSLLWGDIYVAGLTSIGSWKDTQVRLF
                     GIKQAPVRGRGAQVGRVLKMMGVV"
     gene            complement(42985..45210)
                     /locus_tag="CNA00140"
                     /db_xref="GeneID:3253834"
     mRNA            complement(join(42985..44401,44490..44716,44784..45210))
                     /locus_tag="CNA00140"
                     /product="adenosylmethionine decarboxylase, putative"
                     /transcript_id="XM_566443.2"
                     /db_xref="GeneID:3253834"
     CDS             complement(join(43545..44401,44490..44716,44784..45082))
                     /locus_tag="CNA00140"
                     /codon_start=1
                     /product="adenosylmethionine decarboxylase, putative"
                     /protein_id="XP_566443.1"
                     /db_xref="GeneID:3253834"
                     /translation="MTAELTPSIEEQALTSPGPFEGPEKLLEVWFAPSIEELPSAEEV
                     EGKVAGGLNARPAKENGEWQGLRKVPREVWEEMLDIVKCKVLSMVEGDDLDAYLLSES
                     SLFVAPHVLILKTCGTTLNLLGLYRIIEIAREYCGFNNVWRCFYSRKSFFFPERQQGP
                     HRDWRDEVQFLDSVFGTAGAAYTVGPMNRDHWLLYLTTPNSQPILPSDPKPCTLSLPA
                     PSPSSSIPTFSSSSTVTYQDTTLEILMTHLSPSARAPFFHDSDSFSSPSTTPGHVLGE
                     AISHKLGIDALFSKDETTLDSFGFDPCGYSANAVIGSGLPVSGKGGKEGGGYFTIHVT
                     PEEGWSYASFECNVPLPFSSSSSPGALAKRPDLQTLIRNVVNIFQPSRLSITLFVSTP
                     PSSSGPGSSEAEVKAWNSFGTDLLGNEFVRKDRIGYEFDGYDLVFACFEKKGWVESQL
                     ALGSETKKSL"
     gene            complement(45276..46793)
                     /locus_tag="CNA00150"
                     /db_xref="GeneID:3253729"
     mRNA            complement(join(45276..45995,46151..46793))
                     /locus_tag="CNA00150"
                     /product="holocytochrome-c synthase, putative"
                     /transcript_id="XM_566444.2"
                     /db_xref="GeneID:3253729"
     CDS             complement(join(45806..45995,46151..46776))
                     /locus_tag="CNA00150"
                     /codon_start=1
                     /product="holocytochrome-c synthase, putative"
                     /protein_id="XP_566444.1"
                     /db_xref="GeneID:3253729"
                     /translation="MWPFSSSAAPSTAPAQAQQHPSAAASADQCPVDHTTRQAWLANN
                     PSTPHPFHPPTSEGSSSSASAGLSQSRVISSIPRGSTPSSPSPAPPASASASASAAAG
                     PSSGPSSFTADAGSGHAQPQQDANGNWVYPSEQQFFNAMLRKKHNPHPQDMRTIVPIH
                     NAVNEKAWEEILKWECHWPSERCGGPRLVSFVGRPKERTPKAWVKTALGYTPPFDRHD
                     WIVDRCGTHVRYVIDFYTGRQTEGPGKMAFYLDVRPAVDDWEGIKTRVKGWWS"
     gene            complement(46995..48617)
                     /locus_tag="CNA00160"
                     /db_xref="GeneID:3253756"
     mRNA            complement(join(46995..47255,47320..47519,47589..48303,
                     48391..48424,48468..48617))
                     /locus_tag="CNA00160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656039.1"
                     /db_xref="GeneID:3253756"
     mRNA            complement(join(46995..47255,47320..47519,47589..48424,
                     48468..48617))
                     /locus_tag="CNA00160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656133.1"
                     /db_xref="GeneID:3253756"
     CDS             complement(join(47087..47255,47320..47519,47589..48303,
                     48391..48407))
                     /locus_tag="CNA00160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514111.1"
                     /db_xref="GeneID:3253756"
                     /translation="MYKKHKRMAFAELISTMLTRTPQPPPSTNTHARATQPRSSKIFN
                     TPDSDIVPSILYVDSSSTSSSHPTRGRTYSRTYEWYEAYQAEREKRRGSKGSTKSTSS
                     GGSARGRRSDELEVVDPQTISLHHTLPSVEDEIKISSAPILYLPPLLSPLPEHGHEHD
                     HNHDNHHDYEHSQVEVREVIGLDDSRQTLSESNEQVDPLRDFTTRLPHIDPASLALHQ
                     TLHHFKPLSNAYASLPYDKAFNWSSLNLPKSTEREWYCVVFRSRRKPESANLSLYKAD
                     REAHEEAVKNGGLIMYWYGVPDETGLNLATCIWQSRRHAIKAISGPKHISAMKQTKGA
                     YETYSLERWVLSTEVGNREVKLRKWEGGEVGW"
     CDS             complement(join(47087..47255,47320..47519,47589..48299))
                     /locus_tag="CNA00160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511811.1"
                     /db_xref="GeneID:3253756"
                     /translation="MAFAELISTMLTRTPQPPPSTNTHARATQPRSSKIFNTPDSDIV
                     PSILYVDSSSTSSSHPTRGRTYSRTYEWYEAYQAEREKRRGSKGSTKSTSSGGSARGR
                     RSDELEVVDPQTISLHHTLPSVEDEIKISSAPILYLPPLLSPLPEHGHEHDHNHDNHH
                     DYEHSQVEVREVIGLDDSRQTLSESNEQVDPLRDFTTRLPHIDPASLALHQTLHHFKP
                     LSNAYASLPYDKAFNWSSLNLPKSTEREWYCVVFRSRRKPESANLSLYKADREAHEEA
                     VKNGGLIMYWYGVPDETGLNLATCIWQSRRHAIKAISGPKHISAMKQTKGAYETYSLE
                     RWVLSTEVGNREVKLRKWEGGEVGW"
     gene            50135..54254
                     /locus_tag="CNA00170"
                     /db_xref="GeneID:3253713"
     mRNA            join(50135..50304,50482..51090,51238..52229,52283..54254)
                     /locus_tag="CNA00170"
                     /product="expressed protein"
                     /transcript_id="XM_566446.1"
                     /db_xref="GeneID:3253713"
     mRNA            join(50135..50304,50482..51090,51238..52229,52283..53314,
                     53392..54254)
                     /locus_tag="CNA00170"
                     /product="expressed protein"
                     /transcript_id="XM_566447.1"
                     /db_xref="GeneID:3253713"
     mRNA            join(50135..50304,50482..51090,51238..51557,51618..52229,
                     52283..54254)
                     /locus_tag="CNA00170"
                     /product="expressed protein"
                     /transcript_id="XM_024656040.1"
                     /db_xref="GeneID:3253713"
     CDS             join(50923..51090,51238..52229,52283..53314,53392..53449)
                     /locus_tag="CNA00170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566447.1"
                     /db_xref="GeneID:3253713"
                     /translation="MPYMYERPVGQQIKQRREEEARGRTEMELFKLLNGEQAGEVATF
                     GNEAPADGMEVDNALYGGHQPSSINDRLLPAGFDTTNYSSNADWMYDAEARAAAEYSK
                     QVAAQQAAIGTQQSKAYLFEREFPDPVNYHAQRSVWSPPRAEVPTWSNYEPAYRAPAV
                     PARYVQLPERPITPHDTYRYPASHAEHIYVAPPAPVEPSADAINGAFAFWYAQQVIHL
                     LIVPGQFRAGTGGASDEEWGPAGREKDSYMRVGVLPPDYSRNWGRMGMTTPPSAPLAH
                     QLSARRPEYEVRDPWNVAWAHSVKPTATFVSFILDMIQRMTISPSALVAGIWFLAGLG
                     LHEGDGVKGTKLRQFLREQVSCEPEAVEKRVAMLGLILAGKWLDDNSFLTKSWTEVTS
                     VPISQIDAMERLALADFNFSLYVPVPSWVDHVNKLFTALDLKRHRDEVDSIIHPILDR
                     MAKEAHEVELTDPAAHAVQTYSKPVIDCRSSSDEIPAAADQATSRDWVSFASSYAHDQ
                     KLANSRWSARGSEDDVELERAERNVEMLLNDEDMDEVEQEVLEQDEDEEEFLEYDGAK
                     KWLPTASEMRRSTSGTDAREQKAFALQAPRQDSRVQVSAPTQVPVTSFVRARSTTPTA
                     SQTFAGRPRAHGDWNAPTAANKRWHHAHNPFGFPVYLDPSCCQKIERKRTPINRHSSS
                     YRPGYPSYAHTAVGAQIEPGMSIMREPASAVSEFGFMGGGGASMCGPKRSRRFDAAHP
                     YSSFAAAGH"
     CDS             join(50923..51090,51238..52229,52283..53339)
                     /locus_tag="CNA00170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566446.1"
                     /db_xref="GeneID:3253713"
                     /translation="MPYMYERPVGQQIKQRREEEARGRTEMELFKLLNGEQAGEVATF
                     GNEAPADGMEVDNALYGGHQPSSINDRLLPAGFDTTNYSSNADWMYDAEARAAAEYSK
                     QVAAQQAAIGTQQSKAYLFEREFPDPVNYHAQRSVWSPPRAEVPTWSNYEPAYRAPAV
                     PARYVQLPERPITPHDTYRYPASHAEHIYVAPPAPVEPSADAINGAFAFWYAQQVIHL
                     LIVPGQFRAGTGGASDEEWGPAGREKDSYMRVGVLPPDYSRNWGRMGMTTPPSAPLAH
                     QLSARRPEYEVRDPWNVAWAHSVKPTATFVSFILDMIQRMTISPSALVAGIWFLAGLG
                     LHEGDGVKGTKLRQFLREQVSCEPEAVEKRVAMLGLILAGKWLDDNSFLTKSWTEVTS
                     VPISQIDAMERLALADFNFSLYVPVPSWVDHVNKLFTALDLKRHRDEVDSIIHPILDR
                     MAKEAHEVELTDPAAHAVQTYSKPVIDCRSSSDEIPAAADQATSRDWVSFASSYAHDQ
                     KLANSRWSARGSEDDVELERAERNVEMLLNDEDMDEVEQEVLEQDEDEEEFLEYDGAK
                     KWLPTASEMRRSTSGTDAREQKAFALQAPRQDSRVQVSAPTQVPVTSFVRARSTTPTA
                     SQTFAGRPRAHGDWNAPTAANKRWHHAHNPFGFPVYLDPSCCQKIERKRTPINRHSSS
                     YRPGYPSYAHTAVGAQIEPGMSIMREPASAVSEFGFMGGGGASMCGPKRWATAARW"
     CDS             join(50923..51090,51238..51557,51618..52229,52283..53339)
                     /locus_tag="CNA00170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514112.1"
                     /db_xref="GeneID:3253713"
                     /translation="MPYMYERPVGQQIKQRREEEARGRTEMELFKLLNGEQAGEVATF
                     GNEAPADGMEVDNALYGGHQPSSINDRLLPAGFDTTNYSSNADWMYDAEARAAAEYSK
                     QVAAQQAAIGTQQSKAYLFEREFPDPVNYHAQRSVWSPPRAEVPTWSNYEPAYRAPAV
                     PARHAEHIYVAPPAPVEPSADAINGAFAFWYAQQVIHLLIVPGQFRAGTGGASDEEWG
                     PAGREKDSYMRVGVLPPDYSRNWGRMGMTTPPSAPLAHQLSARRPEYEVRDPWNVAWA
                     HSVKPTATFVSFILDMIQRMTISPSALVAGIWFLAGLGLHEGDGVKGTKLRQFLREQV
                     SCEPEAVEKRVAMLGLILAGKWLDDNSFLTKSWTEVTSVPISQIDAMERLALADFNFS
                     LYVPVPSWVDHVNKLFTALDLKRHRDEVDSIIHPILDRMAKEAHEVELTDPAAHAVQT
                     YSKPVIDCRSSSDEIPAAADQATSRDWVSFASSYAHDQKLANSRWSARGSEDDVELER
                     AERNVEMLLNDEDMDEVEQEVLEQDEDEEEFLEYDGAKKWLPTASEMRRSTSGTDARE
                     QKAFALQAPRQDSRVQVSAPTQVPVTSFVRARSTTPTASQTFAGRPRAHGDWNAPTAA
                     NKRWHHAHNPFGFPVYLDPSCCQKIERKRTPINRHSSSYRPGYPSYAHTAVGAQIEPG
                     MSIMREPASAVSEFGFMGGGGASMCGPKRWATAARW"
     gene            complement(54488..57404)
                     /locus_tag="CNA00180"
                     /db_xref="GeneID:3253522"
     mRNA            complement(join(54488..54792,54857..54923,54995..55064,
                     55163..55256,55316..55393,55463..55591,55646..55951,
                     56007..56348,56395..56644,56697..57090,57166..57404))
                     /locus_tag="CNA00180"
                     /product="calcium ion transporter, putative"
                     /transcript_id="XM_566450.2"
                     /db_xref="GeneID:3253522"
     mRNA            complement(join(54488..54792,54857..54923,54995..55064,
                     55163..55256,55316..55393,55463..55591,55646..55951,
                     56007..56348,56395..56644,56697..57404))
                     /locus_tag="CNA00180"
                     /product="calcium ion transporter, putative"
                     /transcript_id="XM_566449.2"
                     /db_xref="GeneID:3253522"
     CDS             complement(join(54736..54792,54857..54923,54995..55064,
                     55163..55256,55316..55393,55463..55591,55646..55951,
                     56007..56348,56395..56644,56697..57090,57166..57178))
                     /locus_tag="CNA00180"
                     /codon_start=1
                     /product="calcium ion transporter, putative"
                     /protein_id="XP_566450.1"
                     /db_xref="GeneID:3253522"
                     /translation="MFHQNTQEDPPVSDSPLSSPKLPEYDPQSSSTTPIVSSNLPTDT
                     ANTASAGPRRRQQPSRQVTLDARPPSAARRGTTESARTQHSRAGSRRTSNSLDPNPGL
                     IRRVTTVLFTPPKKIGKAPTYWGSIKAAITSTWLNILLVFIPIGWALYLAKHSGGKDS
                     ISDTAVFCCTFIAIIPLAGLLGFATEEAALRLGQTLGGLLNATLGNAVELIVAILALI
                     KCELQVVQSSLVGSILSNILLVLGMCFFAGGVRFAEQAIKSTAAQLNASLLLIAVIAV
                     LIPSAFHFSISSSTSNTDASELANGEGADLLSMSHAVSILLLILYLGYLLFQMWTHAT
                     YYVDDAVTGSTQYPEAITNVSEKLKFRNFHRRKHDEEEGYSTATTVSEATVPPSARPG
                     GGEVPATHGPGTVASETGNRVEHESEEEEEEEETPQMNVVCTIALMVIDTVLVGVTAE
                     FLVDSINGMVESNPSLSAEWVGLILLPIVGNAAEHFTAVSVSVKDKLDLSISVAVGSS
                     IQIALFVIPVIELLAWTIGKPMTLLFDPYESIVLFLSVLIVNQTLADGRSNWMEGMVL
                     MMLYIIIAVSFWYYPGSTTATLLGCQDSSSVTG"
     CDS             complement(join(54736..54792,54857..54923,54995..55064,
                     55163..55256,55316..55393,55463..55591,55646..55951,
                     56007..56348,56395..56644,56697..57124))
                     /locus_tag="CNA00180"
                     /codon_start=1
                     /product="calcium ion transporter, putative"
                     /protein_id="XP_566449.1"
                     /db_xref="GeneID:3253522"
                     /translation="MSLPRRVSFPPDTQEDPPVSDSPLSSPKLPEYDPQSSSTTPIVS
                     SNLPTDTANTASAGPRRRQQPSRQVTLDARPPSAARRGTTESARTQHSRAGSRRTSNS
                     LDPNPGLIRRVTTVLFTPPKKIGKAPTYWGSIKAAITSTWLNILLVFIPIGWALYLAK
                     HSGGKDSISDTAVFCCTFIAIIPLAGLLGFATEEAALRLGQTLGGLLNATLGNAVELI
                     VAILALIKCELQVVQSSLVGSILSNILLVLGMCFFAGGVRFAEQAIKSTAAQLNASLL
                     LIAVIAVLIPSAFHFSISSSTSNTDASELANGEGADLLSMSHAVSILLLILYLGYLLF
                     QMWTHATYYVDDAVTGSTQYPEAITNVSEKLKFRNFHRRKHDEEEGYSTATTVSEATV
                     PPSARPGGGEVPATHGPGTVASETGNRVEHESEEEEEEEETPQMNVVCTIALMVIDTV
                     LVGVTAEFLVDSINGMVESNPSLSAEWVGLILLPIVGNAAEHFTAVSVSVKDKLDLSI
                     SVAVGSSIQIALFVIPVIELLAWTIGKPMTLLFDPYESIVLFLSVLIVNQTLADGRSN
                     WMEGMVLMMLYIIIAVSFWYYPGSTTATLLGCQDSSSVTG"
     gene            complement(57717..59788)
                     /locus_tag="CNA00190"
                     /db_xref="GeneID:3253540"
     mRNA            complement(join(57717..57851,57906..57959,58013..58383,
                     58448..58903,58964..59220,59286..59479,59673..59788))
                     /locus_tag="CNA00190"
                     /product="aminotransferase, putative"
                     /transcript_id="XM_566451.1"
                     /db_xref="GeneID:3253540"
     CDS             complement(join(57786..57851,57906..57959,58013..58383,
                     58448..58903,58964..59220,59286..59464))
                     /locus_tag="CNA00190"
                     /codon_start=1
                     /product="aminotransferase, putative"
                     /protein_id="XP_566451.1"
                     /db_xref="GeneID:3253540"
                     /translation="MPRISVPAFAKTVSSRLNFTSTRTLLYTRRMSTTPNAVIPQAKR
                     MFDGATHKLDVWSIFTPANVPADCINLGQGFMNWAPPDWIRAESHESMDHDIMSNHYS
                     HPRGRPRLLKAISKHYSPQFENIVARGKDLTNEEILVTSGANCGMFAALTAHCEPGDE
                     VICIEPYFDQYFASIHFQGAKPVFVPLHPPTGKGIKHGGDWTLNIDEFAAAFTPKTKA
                     VIINTPHNPVGKVFTKEELEQIAKVCIEKNVLVLADEVYDCMVYDGNKHFRIATLPGM
                     WERTLTVGSGGKSFACTGWRVGWLIGPPQLTAATLAAHSRIVFCTNSPMQEAVAIGLE
                     KAAEHKFFEEQVAAYEERRDILCSYFDQIGLSYTKPEGSYFLLVDISPVKVPEGYPIV
                     ETCKGRGKDFEFCWWLCQELKVVGIPPSEFYSEEHVNIGERFARFAFCKDPELLHAAG
                     KRLLKLKEYL"
     gene            60460..63456
                     /locus_tag="CNA00200"
                     /db_xref="GeneID:3253542"
     mRNA            join(60460..60849,60908..61342,61393..62031,62082..62197,
                     62245..62275,62331..62601,62662..62950,63014..63456)
                     /locus_tag="CNA00200"
                     /product="transcriptional activator, putative"
                     /transcript_id="XM_024656134.1"
                     /db_xref="GeneID:3253542"
     CDS             join(60562..60849,60908..61342,61393..62031,62082..62197,
                     62245..62275,62331..62601,62662..62950,63014..63152)
                     /locus_tag="CNA00200"
                     /codon_start=1
                     /product="transcriptional activator, putative"
                     /protein_id="XP_024511812.1"
                     /db_xref="GeneID:3253542"
                     /translation="MSPQQRASSPDVLASPVTPGNVSTSTTNANSAATSSNNGAPQAV
                     SGSPANGNQTLSPGRKRRKVTRSRLGCLTCRKRRKLCDMAKPVCQACTRLKIQCSWPS
                     ESASKPPRSSSQRQSQTPAVSESPFVPPTDLDNMTHSISPYMSYGPTSTILPHSYTPS
                     QASAPSTAAAGPLSASNTLEDFTRIFGHIEEDRAGLQMNERNVRPYAIYSASAVPEVG
                     LPPELNTEAEVMDWLNGSCSLDESMLQLWAADCLAVPTTQTFNAFDSLNNLLQPTPPS
                     QDHVDASHPAPSHGPSDPQPPQPISRPESGRQSPSHFHSPSRRSDRGTPTSQPQTALL
                     HYFHDSLARLVSCTGDASSNAFEAFTKLSNMAAGQGSAGQGLHLSILAWAARHAVNRG
                     LVKYEAASEKFSSQSATLVNNRMRDLFDGDGNERRSGAMPNHEKNREYMTLLASNLML
                     MQFKICRGDVWGFDTVVRHLTVLVPFVFRTEKDFQAESMHHQFFENVLYHDVLGSFIL
                     NRAPMVPSSLVSHYCSFNLEALNTLTGASLPLFSTMHRLAALVRQRRGRRGKGWSDED
                     LFDALQRAMELEKDLTDEKKRLDALLIAKPHVKPHRYLHEAFRLTCLIQLHHDVLCEP
                     PSSLHIRLLVRQSLSLLETMIDQSLPGLCSAHWVIFQTALCCVAGGQDKAELDDRETV
                     ERIYDDILHEYGFLNVERSRKIVHEVWARNQDGQLHMDWLDLLEEYDWEIFVV"
     gene            complement(64202..66562)
                     /locus_tag="CNA00210"
                     /db_xref="GeneID:3253506"
     mRNA            complement(join(64202..64539,64596..64698,64753..64921,
                     64982..65118,65191..65286,65340..65524,65598..65700,
                     65760..65909,65959..66133,66198..66562))
                     /locus_tag="CNA00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_566456.2"
                     /db_xref="GeneID:3253506"
     CDS             complement(join(64305..64539,64596..64698,64753..64921,
                     64982..65118,65191..65286,65340..65524,65598..65700,
                     65760..65909,65959..66133,66198..66329))
                     /locus_tag="CNA00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566456.1"
                     /db_xref="GeneID:3253506"
                     /translation="MTDISQYQDNKDYSGHFENDDVGTIEVPIRDQYEPAFIRKTTRK
                     LDFTLLPILTLMYLCSSLDKSNLGNAKTLGMINDIGGDTTGDKYALLNALYYVSYAPF
                     MVPLALLGKRTRMAKLLSICAICWGISATCFAAVRNFSGAYACRFLIGLGEAGFVPLI
                     QVYLSRFYTRRQLGTRVGIWLAMAPMGGFFNGIIAYGVAFIKSPHLESWQILFLIEGG
                     ATFLIAIIAFIMLPEDIVRCRWLSQRQKDYLVYERSLSMAPESNEVNWKHVKGTFIRW
                     QQIVPVFMNMCQQITGALFSAFLPTFLSENGFEGANAQIATLAPYGSAAVCMIIASMI
                     SDRYRNRGWPTQFGWWLSIIAFGIYLGAPYTNRSARIAALILGETGHYIATPLIVTWT
                     ANNAGSESRRAVAVPLAVSCAQAVAVGSGYLFPAKDKPAYQMGSAVVLGLSIAGSLFT
                     FLYQGLIWRENKKRDKAEGGPPASDFVAETNVYADDAPGFRYMP"
     gene            66867..68238
                     /locus_tag="CNA00220"
                     /db_xref="GeneID:3253507"
     mRNA            join(66867..67303,67361..67401,67457..67569,67629..68046,
                     68096..68238)
                     /locus_tag="CNA00220"
                     /product="D-3-phosphoglycerate dehydrogenase, putative"
                     /transcript_id="XM_024656135.1"
                     /db_xref="GeneID:3253507"
     CDS             join(66911..67303,67361..67401,67457..67569,67629..68046,
                     68096..68204)
                     /locus_tag="CNA00220"
                     /codon_start=1
                     /product="D-3-phosphoglycerate dehydrogenase, putative"
                     /protein_id="XP_024511813.1"
                     /db_xref="GeneID:3253507"
                     /translation="MAISPSTKGQNGILNGVANGHHINGTNGTCGAHVKPRVFALDPL
                     HSEALTLAEKHFDLVLPGHEGENQWQEEAQGLLVRGSYVTAEDLERATSMKGGKLKYI
                     SKQGTGVDKIDIVNAKKLGIPVMNTPGVNAQAVAELAFGMMLSLARQTPSIDRKIRKG
                     ASVTKLDGWKGQMLYGKTLGVIGGGNIGLLVAKMFAGAFSGKIVLYDPYLKSLDTWHS
                     AIPNASIHKVSEIDELLTTSDIVTIHVPLTPSTENMISAPQFKTMKPTAILINTARGG
                     IINEEDLSQALLNEEIFAAGLDAFTVEPPSLERYPDLCASERVLMLPHIGAACESVQQ
                     ATCLAMVQNLVNAFEGKVENRVY"
     gene            68527..69847
                     /locus_tag="CNA00225"
                     /db_xref="GeneID:36392650"
     mRNA            join(68527..68657,68716..68927,68995..69103,69164..69300,
                     69356..69443,69495..69847)
                     /locus_tag="CNA00225"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656041.1"
                     /db_xref="GeneID:36392650"
     CDS             join(68558..68657,68716..68927,68995..69103,69164..69300,
                     69356..69443,69495..69784)
                     /locus_tag="CNA00225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514113.1"
                     /db_xref="GeneID:36392650"
                     /translation="MSNFYPPPRLVTARAFSSVPTTLWSTKTTDWLPGSGVPPEIFLE
                     GPTTDAQGNLFVVDVPYGRILRCELKSREWEVLADSDGEPNGLALNDEGQLIVADYKN
                     GLMKCDPKTGKIDPVLLRRNMERFKGLNDVIVARNGDIYFTDQGQTGMTDQTGLVYRL
                     SPNGKLDTLLWNGISPNGLVLNPEETVMYVAMTRDNSVWRLPLHSDGTTTKTGKFFTS
                     FGIAGPDGLTVDEEGNLFICHPSLLSIFVVTKHGIPLARIVPPEGHGTSVTNCIFGST
                     EEDRNRLYFTDSTIGRICYVDWHCKGVTPLRASAR"
     gene            complement(69840..73057)
                     /locus_tag="CNA00230"
                     /db_xref="GeneID:3253942"
     mRNA            complement(join(69840..70346,70411..70563,70624..71032,
                     71092..71170,71231..71357,71404..71512,71568..71590,
                     71641..71712,71787..72604,72658..72755,72834..73057))
                     /locus_tag="CNA00230"
                     /product="expressed protein"
                     /transcript_id="XM_024656136.1"
                     /db_xref="GeneID:3253942"
     CDS             complement(join(69925..70346,70411..70563,70624..71032,
                     71092..71170,71231..71357,71404..71512,71568..71590,
                     71641..71712,71787..72604,72658..72755,72834..72968))
                     /locus_tag="CNA00230"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511814.1"
                     /db_xref="GeneID:3253942"
                     /translation="MSPQRGHPAHDAQTSRSSSRRSGATRVRRGANGSACDQCRKRKI
                     RCTGETPACARCIRLNKECRYAEGSSSAIAQTASYLEELQNQIRDLEARRSALRSLSP
                     LNTARETVLPSDGGHHIDDARVHQHDQSYNRNHYQHAMSMNISHVESQERYRPTADMS
                     NRSAELTRQTTTSSPTVSWDHHEPLRTQTHVPTSYSTTHSQNQHIDSTLNRGSQPTSP
                     PLTTAQPTTTLDSDGPSPRYEAISTTYPKPHDRPLPSNDQILLDLPTDLGVVSILEQS
                     SSTQIPLSSRITSLIRINRDILPPAENVWFLIAHFEDFISAAFPIFHIPTLRVWVDNV
                     CFKGEPVEAEIACSVLLVLAVSATSLARGSPCEYLKNRAASLWEYGQKFLPPVFLPPI
                     DEQRGLLRVQVMLIRLQYVLYNPNAGNVWGLSGAAVRASVDLGLHHESRLRGNSRTAI
                     ETDIRRRVFWIAYSCDRDLGMALGRPPAIQDEWVTAEFPSDLDDSLITIDGLLPGPPS
                     PAKQTAIHLFRIRKLQSSIIFRLYASGQTVRNPTNEWLTDIQHLIEEWNDQKPRGRGF
                     CSDEWLLLCYHQTTTLLHRPCPGNPTPSRDSLGKVLQGSSATMRLYKEVYRNGRISFG
                     WLSMYHLFISGVTYLNSLWQGYRNGWRLVPSYIDALLDMQVCTSVMEGLAALTPGTVS
                     IRNTWEAVSERMIRQLSSHAPWDLLSRPSSPNGPNNHSSHIDSSIPLSDSSETWQAAR
                     GEGANSAMSMPNDNSGGSGTLGGGGNAMNGLMGMENPFDPFLLHPLGELSNDDWARAV
                     ASVFGPMDSTAELPFN"
     gene            73171..74308
                     /locus_tag="CNA00240"
                     /db_xref="GeneID:3253508"
     mRNA            join(73171..73541,73590..73741,73789..74308)
                     /locus_tag="CNA00240"
                     /product="aldolase, putative"
                     /transcript_id="XM_566459.2"
                     /db_xref="GeneID:3253508"
     CDS             join(73395..73541,73590..73741,73789..74293)
                     /locus_tag="CNA00240"
                     /codon_start=1
                     /product="aldolase, putative"
                     /protein_id="XP_566459.1"
                     /db_xref="GeneID:3253508"
                     /translation="MSTITNGITVHVPRHRLRNGLEAGKPMIGCFSSLPSAWTARIVA
                     SCGWDYVIIDCEHGNHDDSDMHDTVNVIASENVSPIVRLRAGEYGLIKRALDCGAHGI
                     MVPMVNTPEDARNIVKWSKFPPMGVRGQGSSFSAMASGLTTHQYVSLANKTILTIVQI
                     ETPEAVSNAEKIASIEGVDALFIGPNDLALSLLGYVPARWDEPEFLDALEKVRLAAKK
                     YGKYVGILARNGAHAKELSEKWKLVGLGSDVRALQTAMKATVAASRSEA"
     gene            75585..76906
                     /locus_tag="CNA00250"
                     /db_xref="GeneID:3253943"
     mRNA            join(75585..75638,75798..75944,76237..76356,76410..76503,
                     76556..76732,76784..76906)
                     /locus_tag="CNA00250"
                     /product="60s ribosomal protein l9, putative"
                     /transcript_id="XM_024656137.1"
                     /db_xref="GeneID:3253943"
     CDS             join(75804..75944,76237..76356,76410..76503,76556..76732,
                     76784..76827)
                     /locus_tag="CNA00250"
                     /codon_start=1
                     /product="60s ribosomal protein l9, putative"
                     /protein_id="XP_024511815.1"
                     /db_xref="GeneID:3253943"
                     /translation="MKDISSIESLVVPEGVTVAIKARTVTVEGPRGKLTKNVGHIQMD
                     IQLVKTPKDSKVVFTVWHGARKHVACLRTVKSLVENMIIGVTKGFLYKMRLVYAHFPI
                     NALPSDDGSALQIRNFLGEKFVRDCPMLEGVKVSLSDVKDEIIIQGNDIEKVSQSAAS
                     ITDKCRVKDKDIRKFLDGVYISERTVVVKDE"
     gene            78361..83367
                     /locus_tag="CNA00260"
                     /db_xref="GeneID:3253794"
     mRNA            join(78361..78984,79056..79312,79368..79494,79640..79695,
                     80020..80083,80310..80735,80790..80956,81008..81104,
                     81156..81834,81894..81971,82026..82203,82268..83367)
                     /locus_tag="CNA00260"
                     /product="expressed protein"
                     /transcript_id="XM_024656138.1"
                     /db_xref="GeneID:3253794"
     CDS             join(81028..81104,81156..81834,81894..81971,82026..82203,
                     82268..82734)
                     /locus_tag="CNA00260"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512019.1"
                     /db_xref="GeneID:3253794"
                     /translation="MSNQKEHQYWEVTAPAIEAQSSSQTELSPVGPQGVDYSPSQSLP
                     QVPDSTPPPSGSHTSSGISSTYSSMMLPPLRMTHDPRNLVPSPLSSGHPQMYSLRPPP
                     PNSSPNQIQAEFYYSYSMPYPPRPPAYSGHMPAHSGSSSNGPPEIFTPVSAHTNSYRF
                     SYPGQGTIQPYLFSPWQGQDRQLPGAPGSNFGTSERKGSPDSSTTTGERWDRPSPNQV
                     GAASPLTERSTSVDEKDCKGISYTADAEVKQTPQMKRQCFNCTNRNPPSWRKSVLHPG
                     KILCNKCGIFERTHHRPRPPQNDDQKLRKASTLSNSIHRREAPPPLQNARTEHSSASP
                     RSPFSGPQSTPMSTSLTYPPMYGSPDPLQASGGYFRRSATHQPTLGSPERSPFSHSMI
                     SPNLSSSAEDPNAMSGTASRHYGYQHSVSSPYAHAYASRRRYAPTARGMVSSPSMTPG
                     AFSGAMGPVMTPISGQSQLGSQTPAAGEERQPQQGQEDNDSA"
     gene            complement(83175..84928)
                     /locus_tag="CNA00270"
                     /db_xref="GeneID:3253509"
     mRNA            complement(join(83175..83753,83829..83861,83942..83943,
                     84015..84059,84113..84405,84484..84714,84762..84796,
                     84842..84928))
                     /locus_tag="CNA00270"
                     /product="sec14 cytosolic factor, putative"
                     /transcript_id="XM_024656139.1"
                     /db_xref="GeneID:3253509"
     CDS             complement(join(83529..83753,83829..83861,83942..83943,
                     84015..84059,84113..84405,84484..84714,84762..84796,
                     84842..84847))
                     /locus_tag="CNA00270"
                     /codon_start=1
                     /product="sec14 cytosolic factor, putative"
                     /protein_id="XP_024511816.1"
                     /db_xref="GeneID:3253509"
                     /translation="MSAYDPLSGHPGHLSEAQETALKEFRQELTTEELIPADWEALVQ
                     RIGYNRFDDQTLLRFLRARKFDLPKAKLMWANNEKWRKQFGADEIAANGFDYPEQSQV
                     VKYYPQFYHKTDNDGRPVYIEQLGKLDINKLYAITTQDRQLKRLVSEYEKFLRDRLPA
                     SSKMTGHLVETSCTILDLYNAGISTFYKVKDYVRAASAVGQNNYPEVMGHMFIINAPY
                     LFSTVWSLIKPWLDEATVRKIHILGKNYKPELLQYIPAESLPADLGGTCKCPVGCEMS
                     DAGPWNVSTTTAV"
     gene            complement(89520..91165)
                     /locus_tag="CNA00280"
                     /db_xref="GeneID:3253945"
     mRNA            complement(join(89520..89703,89767..89939,89988..90369,
                     90420..90476,90533..90619,90675..90769,90820..90928,
                     90983..91165))
                     /locus_tag="CNA00280"
                     /product="alcohol dehydrogenase, putative"
                     /transcript_id="XM_566462.1"
                     /db_xref="GeneID:3253945"
     CDS             complement(join(89620..89703,89767..89939,89988..90369,
                     90420..90476,90533..90619,90675..90769,90820..90928,
                     90983..91093))
                     /locus_tag="CNA00280"
                     /codon_start=1
                     /product="alcohol dehydrogenase, putative"
                     /protein_id="XP_566462.1"
                     /db_xref="GeneID:3253945"
                     /translation="MSSPKTMKRYVLVHRNDLSGITFEQGAPLPQIKKSTEILINIKA
                     LSLNARDLQIATNQYPAPHPIPDGIVPVSDASGEIAAVGDDVTDFKVGDRVTPIIFQG
                     HHQDEDVTLDSMNRGIGGARNGVAAEYFVCDQSEAVKIPKSFSHQDASTLAIAYATAW
                     SSLYSHHPRLQSGDTVLCLGTGGVSLCAAQIALISGAKVIVTSSSQSKLDRVVDLLKP
                     LVKGNFADTIHTIDYSRIDKWDEEVRRITEGKGANFVIEIGGRGTIGKSIRSTRRGGL
                     VAVSGYLSTYKDIPKEILEEDLAQTILYSGSYVRGVFVCNREDEKRMISALEVGNVKP
                     VIDKVFDFENLKEAYQYMADGKHFGKICVTV"
     gene            94106..99392
                     /locus_tag="CNA00290"
                     /db_xref="GeneID:3253946"
     mRNA            join(94106..94501,94576..94908,96208..96651,96706..98190,
                     98249..99392)
                     /locus_tag="CNA00290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566463.2"
                     /db_xref="GeneID:3253946"
     CDS             join(96258..96651,96706..98190,98249..98817)
                     /locus_tag="CNA00290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566463.1"
                     /db_xref="GeneID:3253946"
                     /translation="MVSVEQYRSQRTSYYPPPHSPTYVSPTSTASPVSGAPIFTFPFQ
                     QPDISSPVGKMARRPSRADPMVRTEDDMYEEDDGYGELGQRHPLRRGKEDMREEIEAR
                     PGHEVNLTRIRERGEGMSLPGIKTLLGVKEHPSGSSSLYHSPSLPSLETNSPTTSPSS
                     ARTSRFSSFTSSTVPELSAPGWWAPEFERSPFHAVPSRSDSFSSAQLHIVDEHDQKRR
                     RSDVPPLRDVEESARLRWQAQSRNASFPSSSPHSSGRTTPTSWSSMRNRLHPPISSSP
                     SVATVMGRGSISSTSGAMSPPITRRASPSSRNPSLVGGQLSRHFADLSATDSQRGSIS
                     GAAGPPERRISVQAPSSTTPIDLDRAPILPPLISPENERPSMPSASFSLPSIRRSSST
                     SSDCLRRHSNTQPTTPDTTGQPEVRRSSLTEIIMARSGDHIAMKEGRYAFSTEERHGS
                     LGMEKRAETALGLAPIPLQSKTSVQSLAGTSSDTPAWNPQGRRESTESISSATAHLAI
                     NSEAERERTASLRGRKRSADMRDDSEPRADPSLVGVGVSVNVGAGDPGLRGMEVLAES
                     ARRIAAAEEEQKAKNVEEEEVEEAQEKDEVPEKTGGPKYTCTYCVKTFSRPSSLKIHT
                     YSHTGERPYICNEAGCGRRFSVQSNLKRHAKVHQVGPLGVSAPEPSVPPTKASKQPTH
                     PSKPNEHSSPHPPPLHHHQSHHRMAQPLPPPVMSGPMPPPGGYPFFPPSYPPLSMNAM
                     PGPPPPGSTPGMAPPPGYYIDGRYAVAPPPPTNGMPHGGYVQYDMPVPTHDGKDESGR
                     DNGKGKEKSRKSNSKEE"
     gene            99512..101925
                     /locus_tag="CNA00300"
                     /db_xref="GeneID:3253947"
     mRNA            join(99512..99776,99873..100112,100167..100244,
                     100294..100665,100713..100885,100940..101066,
                     101121..101134,101181..101598,101657..101925)
                     /locus_tag="CNA00300"
                     /product="sterol 14-demethylase, putative"
                     /transcript_id="XM_566464.1"
                     /db_xref="GeneID:3253947"
     CDS             join(99621..99776,99873..100112,100167..100244,
                     100294..100665,100713..100885,100940..101066,
                     101121..101134,101181..101598,101657..101731)
                     /locus_tag="CNA00300"
                     /codon_start=1
                     /product="sterol 14-demethylase, putative"
                     /protein_id="XP_566464.1"
                     /db_xref="GeneID:3253947"
                     /translation="MSAIIPQVQQLLGQVAQFFPPWFAALPTSLKVAIAVVGIPALII
                     GLNVFQQLCLPRRKDLPPVVFHYIPWFGSAAYYGEDPYKFLFECRDKYGDLFTFILMG
                     RRITVALGPKGNNLSLGGKISQVSAEEAYTHLTTPVFGKGVVYDCPNEMLMQQKKFIK
                     SGLTTESLQSYPPMITSECEDFFTKEVGISPQKPSATLDLLKAMSELIILTASRTLQG
                     KEVRESLNGQFAKYYEDLDGGFTPLNFMFPNLPLPSYKRRDEAQKAMSDFYLKIMENR
                     RKGESDHEHDMIENLQSCKYRNGVPLSDRDIAHIMIALLMAGQHTSSATSSWTLLHLA
                     DRPDVVEALYQEQKQKLGNPDGTFRDYRYEDLKELPIMDSIIRETLRMHAPIHSIYRK
                     VLSDIPVPPSLSAPSENGQYIIPKGHYIMAAPGVSQMDPRIWQDAKVWNPARWHDEKG
                     FAAAAMVQYTKAEQVDYGFGSVSKGTESPYQPFGAGRHRCVGEQFAYTQLSTIFTYVV
                     RNFTLKLAVPKFPETNYRTMIVQPNNPLVTFTLRNAEVKQEV"
     gene            complement(101895..104228)
                     /locus_tag="CNA00310"
                     /db_xref="GeneID:3253823"
     mRNA            complement(join(101895..102295,102471..102771,
                     102889..103279,103355..103591,103656..103860,
                     103935..104105,104161..104228))
                     /locus_tag="CNA00310"
                     /product="expressed protein"
                     /transcript_id="XM_024656042.1"
                     /db_xref="GeneID:3253823"
     mRNA            complement(join(101895..102295,102471..102771,
                     102889..103279,103355..103591,103656..103860,
                     103935..104228))
                     /locus_tag="CNA00310"
                     /product="expressed protein"
                     /transcript_id="XM_024656140.1"
                     /db_xref="GeneID:3253823"
     CDS             complement(join(102039..102295,102471..102771,
                     102889..103279,103355..103591,103656..103860,
                     103935..104181))
                     /locus_tag="CNA00310"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512021.1"
                     /db_xref="GeneID:3253823"
                     /translation="MGPFPPKVRNICISQTIHQSFQRRTVTAMSARPPSFASNFPTST
                     AEPSAYFKWPGITWDSTKAVREVLEENNRGYDIYESRRFAHNHFPHSVFSRYAFGAPP
                     KLIHDCWNHDKTHLVSLDPAGPDRKDVDETKVPKRITREDWGNHLGNKGCYAPYLVFF
                     HDEIARLGPQGVLEEYIFSPQANWEIFTDPSSKDQGPPNMFNRLLAGAIHPFIHIGFG
                     LEFNDRVVLAEGLAEAAVHPDVIVNLVIPPSHIQPLFTTSSPRPSSSPSLLSIYTSLI
                     SSPILTPQPYDPKSMVNDQLKSSVNGPKAQELRAIVDRWSLSDEEVADGPNGWQKKFE
                     EIAVFATLLACATGRKGKEIRVDFFLMHALTSSIFLPAYLSRLPPSFRRALLRRYILE
                     AFHTALARGRPSIDPELIMSYDLYPTINTEGSEDALKKLVKEDKALGKGEKEERNAWL
                     SLVESAMVYPDSHVIKSIRSLAHYASLLGNSPPGGLPGTYKEEGRGVDKEEAVKGMSK
                     LDGSVFLRAAGAIMTTMAPGGEGAWDRSQLGYDEAWE"
     CDS             complement(join(102039..102295,102471..102771,
                     102889..103279,103355..103591,103656..103860,
                     103935..104097))
                     /locus_tag="CNA00310"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514114.1"
                     /db_xref="GeneID:3253823"
                     /translation="MSARPPSFASNFPTSTAEPSAYFKWPGITWDSTKAVREVLEENN
                     RGYDIYESRRFAHNHFPHSVFSRYAFGAPPKLIHDCWNHDKTHLVSLDPAGPDRKDVD
                     ETKVPKRITREDWGNHLGNKGCYAPYLVFFHDEIARLGPQGVLEEYIFSPQANWEIFT
                     DPSSKDQGPPNMFNRLLAGAIHPFIHIGFGLEFNDRVVLAEGLAEAAVHPDVIVNLVI
                     PPSHIQPLFTTSSPRPSSSPSLLSIYTSLISSPILTPQPYDPKSMVNDQLKSSVNGPK
                     AQELRAIVDRWSLSDEEVADGPNGWQKKFEEIAVFATLLACATGRKGKEIRVDFFLMH
                     ALTSSIFLPAYLSRLPPSFRRALLRRYILEAFHTALARGRPSIDPELIMSYDLYPTIN
                     TEGSEDALKKLVKEDKALGKGEKEERNAWLSLVESAMVYPDSHVIKSIRSLAHYASLL
                     GNSPPGGLPGTYKEEGRGVDKEEAVKGMSKLDGSVFLRAAGAIMTTMAPGGEGAWDRS
                     QLGYDEAWE"
     gene            complement(104530..106919)
                     /locus_tag="CNA00320"
                     /db_xref="GeneID:3253790"
     mRNA            complement(join(104530..105664,105737..106919))
                     /locus_tag="CNA00320"
                     /product="expressed protein"
                     /transcript_id="XM_567084.2"
                     /db_xref="GeneID:3253790"
     CDS             complement(join(104898..105664,105737..106913))
                     /locus_tag="CNA00320"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567084.1"
                     /db_xref="GeneID:3253790"
                     /translation="MAVTSTFSSSDTLHTISLLPLATFLKSLTSAENIARLQDVLVKY
                     RSPESWERVDERMISSGDLPPPGYTSKPKDDLSDEYIDDIKARNQSQDRKPDRGEDED
                     ENEVLEEGMEWDHDHDILYPSPPKRYIQEIRIDLRTLHPRAIFALESWRRETLGMEQL
                     VMESMESKAFAAGLDAGAGEKNEGGYFSLGVSSSPKPVQLRSLDIWFRGDREGSESTS
                     TDERSSIEVESIPIRAKAEPFMDGLSISGSAKRARVLKTYGSSKRLSSSSLSHPDFAT
                     RFASLSPILATSSSPLLSPTPSEAEKGKTEDRESVSGERLEAVSASKAVSEQRSLSKK
                     RKRGRPRKKAERPGRPVQTSAQLGEEISATKSDGVEEEEEDKSFIEHDAGEEKEGTSR
                     GPSSRSLRSRMLIASTSKTPDIFEGEEELESFPSEDEPEMKKQRRIYRRKEKGVNGEE
                     RPKKRGRPRKRPFVLASPPPANMFLPVNRPAKGTFANPIKISTPALPINNGPTAATFA
                     SLKPKSTFDSRNASPIPYLYAATLPRISGNPTLPFGSTSSTSSSSSPRPQRPKRKNAS
                     GVLQAAEFESDSELTELSEMSELEPRPQSQFQSHSRSGSGSWPHSQSQSKFRASASAS
                     ASSKHKYKFQFDGVLLPSFSRHV"
     gene            107100..110956
                     /locus_tag="CNA00330"
                     /db_xref="GeneID:3253510"
     mRNA            join(107100..107211,107268..108181,108236..109185,
                     109244..109365,109419..110361,110420..110557,
                     110616..110956)
                     /locus_tag="CNA00330"
                     /product="glutamate-cysteine ligase, putative"
                     /transcript_id="XM_566465.2"
                     /db_xref="GeneID:3253510"
     CDS             join(107173..107211,107268..108181,108236..109185,
                     109244..109365,109419..110361,110420..110557,
                     110616..110857)
                     /locus_tag="CNA00330"
                     /codon_start=1
                     /product="translation elongation factor 2, putative"
                     /protein_id="XP_566465.1"
                     /db_xref="GeneID:3253510"
                     /translation="MSNIFAVPLQNTRNVTIVAHVDHGKTSFADSLLSSNNIISSRMA
                     GKLRFLDSREDEQERGITMESSAVSLRFDMTRLSPDGTSSIQQCICNVIDTPGHVDFA
                     SEVSTASRLCDGALVLVDVWEGVATQTIAVLRQAWMDKLKPLLVINKMDRLITELKLS
                     PSEAYHHISQLIEQVNAVMGSFYASERMEDDLRWREEREKRLAARKEQQGEDLDDDEE
                     YEEKEDEDIYFAPDRGNVLFASAIDGWAFRLGKFARLYAEKLKIKEGNLRRVLWGDWY
                     LDPKTKRVVGRKKLAGRNLKPMFVQFVLENIWRVYDTVLNEYNPDAVQKIVTALNIRI
                     TPRDLRSKDTRNLLNLIMQQWLPLSTATFQSIIEVIPPPPSAQAIRLPYMLHPEKAKA
                     AAASGGLKAENELERGLYECDQGEGAEVVAYVSKMFAVRKGDLPEYKPKEMTAEEMRA
                     RGREERERRAALVAERQAKGEGLDGQPLPEDLAKPLESLSLENIQPATSEKPAVDDSD
                     SEVLLGFSRIFSSTLHRGTSLLAILPKFDSSLPPSHPHNIKHTVPIIASDLYMMMGRE
                     LVSVDSVPAGHVCAIGGLNRAVPRSATLWAPDAKGVEEGFGKEALVNLAGVGVGANAI
                     VRVALEPENPSDMPKLIRGLRILNQADPCAEYFVQESGEHVIITAGELHLERCLKDLR
                     ERFAKCPIQQSAPIVPFRETAVKAPDMAPPKTTGAPRGTINGTVINGLVKFRLRAMPL
                     PEGVETFLLSQQGAISKMLVRERDGKEGEEETDVQEGAEGQSGEGEVPEGQQEARQLS
                     PEEFWTELERLLNKAGGDWAGAADRVWSFGPKRVGANLLLDPVGTKHLRLRRREQLFT
                     QARAQGQSADDALLSTDHAVAADQLASLSSITSSDNEAARAELRLLRDYESSIETGFQ
                     LSTFQGPLCAEPVVGMAWVVESVELDRQGMESEQGKGQVVGGALISAVRDACRQGLLD
                     WSPRIKLAMYTCDIQASTDVLGKVYGVIARRRGRIVSEEMKEGTSFFTIRAMLPVVES
                     FGFADEIRTRTSGAASPQLIFSGYETLDLDPFWVPTTQEELEDLGEKADKANVAKAYV
                     DGVRKRKGMFVERKIVEFAEKQRTLKK"
     gene            complement(110962..112420)
                     /locus_tag="CNA00340"
                     /db_xref="GeneID:3253495"
     mRNA            complement(join(110962..111688,111748..111899,
                     111978..112420))
                     /locus_tag="CNA00340"
                     /product="expressed protein"
                     /transcript_id="XM_566466.1"
                     /db_xref="GeneID:3253495"
     CDS             complement(join(110998..111688,111748..111899,
                     111978..112388))
                     /locus_tag="CNA00340"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566466.1"
                     /db_xref="GeneID:3253495"
                     /translation="MSDPLNAASLLGLLPTLLPQGTTSPLPLSTDAIAALVHAIHTAL
                     QFRLISPAPQPVDDNSKLEQPRSGGDNDDAMSEVTAVEQEDNSQPPIGRLAEGWNSRG
                     EDSYSFQYRHDQSAMNFRVRVGKMGNRVQIDAMAEDGEPHNLSVVRSELVDSGLFPIP
                     SSATASSASNQESPDASATAVGFKSMNDVKTFVEKYSRDVISRLLPGLSIPGYSQVSG
                     SDPRGPPPAGAPQGSEPSPARPSVPRTGDPLLDNINNINPSGRNPASLGHRDLDPLAS
                     LRPPGSFNPNRDGGGMLMDFNHPMFDSRRGRGLGDPDLDGPGGSVQPPGSRWDPVGPS
                     PDGVGGGGIFPGVGGNPLGGVGRGDRDRWGDEMPPPGEFGPDLGRFGGGNGIGGPLGG
                     GRGGGRFGGGGGFGGGGGFGGNMYM"
     gene            112605..114217
                     /locus_tag="CNA00350"
                     /db_xref="GeneID:3253496"
     mRNA            join(112605..112679,112740..112765,112827..112955,
                     113038..113138,113193..113801,113862..114217)
                     /locus_tag="CNA00350"
                     /product="proteasome regulatory subunit 12, putative"
                     /transcript_id="XM_566467.2"
                     /db_xref="GeneID:3253496"
     CDS             join(112656..112679,112740..112765,112827..112955,
                     113038..113138,113193..113801,113862..114025)
                     /locus_tag="CNA00350"
                     /codon_start=1
                     /product="proteasome regulatory subunit 12, putative"
                     /protein_id="XP_566467.1"
                     /db_xref="GeneID:3253496"
                     /translation="MPGLTTAQVTELSGVNVVIHPLVLLSVVDHAARVPLSKNKRVLG
                     VLLGQDNGTSINVANSFAIPFEEDERDPKTFFLDLDYVEEMWRMFRKVNAKERPIGFY
                     HTGPRLRSSDLEITELFKRFCPRPVMVIVDVRTSGGRGDTGIPTDAYFAVEEIKDDGT
                     ATQRTFTHVSTSIEAEEAEEIGVEHLLRDISSSSSAPSSSLLTTQSLSTRVASQLQSL
                     RGLHARLHEIGEYLEAVRSGKMPINHQVVYQLQEIIGLLPQLGGDVELGKAFRMGVND
                     QSLVVFLSSMIRTVLALHDLIENRIQNAQQDIEDAKSPAEKANEARAEAAGIKAEDVA
                     KAKKDAEEEEKEKKKK"
     gene            complement(114123..116531)
                     /locus_tag="CNA00360"
                     /db_xref="GeneID:3253792"
     mRNA            complement(join(114123..114273,114330..114421,
                     114476..114500,114563..114646,114711..115002,
                     115059..115151,115232..115677,115735..115805,
                     116021..116214,116273..116531))
                     /locus_tag="CNA00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_567085.2"
                     /db_xref="GeneID:3253792"
     CDS             complement(join(114255..114273,114330..114421,
                     114476..114500,114563..114646,114711..115002,
                     115059..115151,115232..115677,115735..115805,
                     116021..116214,116273..116345))
                     /locus_tag="CNA00360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567085.1"
                     /db_xref="GeneID:3253792"
                     /translation="MSRFKISGALWDSIHHYSSFPQTGVSLQQMIHFGHNPTPGTLLK
                     ASQFLSEELPIRLSHRVVELNALPDGLAKMPSINKVKEWYAQSFEELVTFPKPRFKPE
                     LEGILNVPNSDRTKLAFPSSTPNPSLDPLMDEGPVGSGLLVERHNQGNGNGNGNGNIS
                     GNGNGNGNGNGQRLRIPMERRYYSPPPATLVYPPEVHEYNERFTHLLENIKKRHDPTV
                     TTVAQGVLEWKRKRKTGRIGVPIQEWLDRFYMSRIGIRFLIGQHVALNTLQPHPDYVG
                     IICTRANVHDICHEAIENARYVCEEHYGLFKGPPIQLLCPKDLTFPYVPGHLSHICFE
                     LLKNSLRAVVERFGVENEEAFPPIKVVVVEGREDITIKISDEGGGIPRSAIPMIWTYL
                     YTTMSDEGLEATIEQSDFKAPMAGFGYGLPLARLYARFFGGDLRLISMDGYGTDVYIS
                     LNKLSSSCEPLQ"
     gene            complement(116724..119627)
                     /locus_tag="CNA00370"
                     /db_xref="GeneID:3254017"
     mRNA            complement(join(116724..117017,117078..117192,
                     117251..117634,117689..117761,117812..118124,
                     118183..118460,118523..118602,118666..119039,
                     119351..119497,119568..119627))
                     /locus_tag="CNA00370"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_024656141.1"
                     /db_xref="GeneID:3254017"
     CDS             complement(join(116872..117017,117078..117192,
                     117251..117634,117689..117761,117812..118124,
                     118183..118460,118523..118602,118666..118899))
                     /locus_tag="CNA00370"
                     /codon_start=1
                     /product="hexose transport-related protein, putative"
                     /protein_id="XP_024511817.1"
                     /db_xref="GeneID:3254017"
                     /translation="MEDKTAPAVHSLEPVGSHSSFDKKEVHVELETTQKQGEATFYET
                     ISASPLNPWSKTSFQLYGILLVAALNATASGFDGSIFSSINAMSQYSEYFHHEELGSS
                     TGIIFMIYTIGNMIGSLFTGPICDHFGRRAGMGSGAIIIMAAAIILTAAKNDSYLLGG
                     RFLLGFGISIGTSSAPTYALELAPPQWRARIVGFYNTFFYAGSILSTGVAYASNKSSG
                     ELAFRLPLGLQLIPPTCILAGLAFVPESPRWLTARGKTDQAAEILAKYHGGGDINHPV
                     VQMELREFEEGIQVKKAQSWWNYYDLVDTHNQRWRFLMMACMSFFAQLSGNSVLTYYL
                     PSMYTKLGITSTDRRLLLTFANSIVSCTGAVFGSATNDMIGRRTKLWVGSIVLACLFA
                     AVTGFSSQFEGGADNVDAPMSNAGVAFIFLFGCAYSFVYTPLTATYCAEVLANHTRAK
                     GMGVHVIMSNCANLYNTYVTAIALEAIGWKYYLVFVALNLVYAAVWFILGVETRGRTL
                     EELNSVFDAKWPPKEALKKATLVKAEGRLEQL"
     gene            119468..121393
                     /locus_tag="CNA00380"
                     /db_xref="GeneID:3253497"
     mRNA            join(119468..119618,119684..120139,120215..120274,
                     120335..120474,120536..120811,120872..121032,
                     121117..121393)
                     /locus_tag="CNA00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656142.1"
                     /db_xref="GeneID:3253497"
     CDS             join(119952..120139,120215..120274,120335..120474,
                     120536..120811,120872..121032,121117..121269)
                     /locus_tag="CNA00380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511818.1"
                     /db_xref="GeneID:3253497"
                     /translation="MTRPAFLNDLERDGYVVVPGIVPESSCDEFISEAWEWLESFPYG
                     FKRDDRSTWTTEHLPYSTTGGLYNRYSVNHEAFVWKIRTDPGIRKIFEQIWDTDDLIV
                     SFDGMNASLPINDQTGRTDIKPTAPWPHIDQNPRNVNRFELYQGIANLAANGPSDGGL
                     CVLKGSHKIHQEYFDSMGGFKPDQDVGVLENGYNYKLEDTEWYKNKGCEEVKICAGKG
                     DLILWDSRTIHWNASPIGDQTRFVTYVCYCPRNSMSPAELAKKVEVFKGRKGTTHFPY
                     LNRIPVERPGYYNALPRRPDGTLDPANRTRPRKEPEETPAVLNAVGIRA"
     gene            complement(121315..122743)
                     /locus_tag="CNA00390"
                     /db_xref="GeneID:3253498"
     mRNA            complement(join(121315..121745,121799..121917,
                     121967..122043,122100..122191,122247..122359,
                     122413..122743))
                     /locus_tag="CNA00390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656143.1"
                     /db_xref="GeneID:3253498"
     CDS             complement(join(121386..121745,121799..121917,
                     121967..122043,122100..122191,122247..122359,
                     122413..122557))
                     /locus_tag="CNA00390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511819.1"
                     /db_xref="GeneID:3253498"
                     /translation="MSTTADQETQVITADGMATPVGKSSIGKGRIAVDMDDVLCQTNA
                     TIVRMHNELFGLDPPLTLDDFENYLYWMNRGWGNPEETVSMVSKLYQNGLYMRAPPVP
                     GAKEALQKLKDMGYCLIIITARSESQREGTEEWIMEYLPDIFDEIHFTGAFQDLEPTK
                     EEHEGHAARKAIVSHKKRSKAEIIHNTSSLFLIDDSAENAYDIATSCYTHPHATKVLL
                     FGAYPWNAVVRSPESTLPIEKMTYVAKKEKGLLGESEKLRNEKIQKGWLPEGVVRVSG
                     WKEVVKWVEAFDKNGGAGGNRIKTA"
     gene            complement(122982..129542)
                     /locus_tag="CNA00400"
                     /db_xref="GeneID:3253499"
     mRNA            complement(join(122982..124075,124130..126166,
                     126216..128042,128105..128486,128634..128797,
                     128886..128959,129015..129159,129223..129542))
                     /locus_tag="CNA00400"
                     /product="histone deacetylation-related protein, putative"
                     /transcript_id="XM_024656144.1"
                     /db_xref="GeneID:3253499"
     CDS             complement(join(123083..124075,124130..126166,
                     126216..128042,128105..128239))
                     /locus_tag="CNA00400"
                     /codon_start=1
                     /product="histone deacetylation-related protein, putative"
                     /protein_id="XP_024511820.1"
                     /db_xref="GeneID:3253499"
                     /translation="MYPDAGPSRPAPYPAKPLVGTTGRSPRSGPSRRDDFERDRDREG
                     YSATTRPYPIPPWSSRLPPRQPVRPYQSGPSIGSRPRSFSPSPPRRSYDRDWERDRDR
                     ERARDRERDWERDRDRSYDVRDRLALDPGWRSGTSIAGDLDNQPPRRPGGFSSVPSRG
                     PDREGWGREDRRWIGDRRDDRDRYEPSPRGPPRPITSSMPHSYPSERPRSPPSAPRGP
                     RSVTAQPLASPYPSRIPPGPKSQGAPMWNDRDRESGPRRTSGPNGLPSLNLAAAQSLS
                     AQPSPTISKFSPTTTYIPNAPNSARGSNSPIDSRRTRDVERPQSLPPGSIVPSLPPVN
                     TEIEPKPAPESQDLEEGEVVSPVQTARNPSWNYPEERRRAWTPPRDRDREHWERERER
                     EREWLRERDRGRVDRDLDRRRPSPALSSWSNKRTEESRQVRPRRSPSNPPRDPIRPIS
                     PVQRSKQPTHVPVEDGELRLSEAAITSDKRIEELKRDPERTDHPATPSVPPPPSLPDA
                     DDGMPDSTPVKEEKEASPVEHPAINPVRDTTTETGYSALPVQPTADTLNDVTMKSPVI
                     ETVDAQANGMLQETITTDIIMTSHDTKDVSMDPASPLGPPPLENGSEVSVERQTSPIL
                     DAVAPSQLTSPSLPKAEKVIESVDANMANNGAVPEPTEPFSGKQTDTVPQLSPHSTIA
                     ERRSVKLPPNIPLNRKESFPRKDSMLSGQSTDVENDVELRTAVSEIDTLVLEDGEEQD
                     ELGAEKARELNLIASVKAAQARHVHLQEFPILAWNMAAAPEESSRVTVMDDEGRERML
                     KEFTRPLKREEAIRAKFVRFVVAHEKVKTKNTITRLKDSYLSINKKWKDHCSFLDELM
                     KERGPPPPELYAMPGAIHPVVTPGAVAPTTPAVEEIFNSRSNRRRGLGGDIVATDAEF
                     EEILAGLADNALKDPNLRASKTAAVIPDMIVGQERNLQYDNDNDLVTDPLSFYDNIGV
                     AEPIWTSEERAIFVKRYLAYPKQFGRIADGIPNKTAGECVLYYYRTKKEMDYKGMLAH
                     KRGGGKRKLALKKGAKSSALMQDLTRAKPTVSKDDAAVATPAKGREQSVVLPAGGKRG
                     RGEGGGPGRKKRVSQSVAVPQTPTPQNEEEEEGHMDSASTSRAGSEVPSVSSTKAKMR
                     MTVKTAKRPRVSSIPELSTPTQNPPAQPDTTALTPATEVPEHPSLTNTTELAAAALAS
                     LADVATSAAQAELLPPVRRAGKRRKIAGEPGPIVDPNAPPAITVAGAPEKEKPARRSA
                     TNSYWSVEERRKVKELVVLHGMDAKLIAAQLKGKSERQVGNFLEGHRTELEALEGVTG
                     TTGVVEETKVQTSTPLESQAHQQIDAPVQARPEMYNKPRQSGGRTIYDAFPSFMSSQD
                     RYEPRLGMFPSSNPVSTPTPASHASHIAQSAPKSAQGSNSPVRPIFRAGGMRISALLN
                     DEPPTEAGEQGEIGVVPDSIDTASDVTIDERELDVVTGPSPRSLPAASDIPAGYPSYE
                     QRHDERHSAHASQSPSLPHMSHSPNAWNGTRPEASPIYGHAPAVPAPTLAHRGSWESH
                     PPPGHICTSSTTRFETLPPIRSQPATYDRSPLAHGHIGPLTPHGHDREQFHQQQPQAH
                     DGSQREWDERKYEKTEGFQSATLPPLRNMEHEGGAQGGTGDGVADDRNGDQER"
     gene            128832..129625
                     /locus_tag="CNA00410"
                     /db_xref="GeneID:3253466"
     mRNA            join(128832..128967,129029..129170,129269..129502,
                     129567..129625)
                     /locus_tag="CNA00410"
                     /product="expressed protein"
                     /transcript_id="XM_024656145.1"
                     /db_xref="GeneID:3253466"
     CDS             join(128929..128967,129029..129170,129269..129372)
                     /locus_tag="CNA00410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512086.1"
                     /db_xref="GeneID:3253466"
                     /translation="MTNLFEGLYHTVQGIFQSIFAVFQSFFNVVYAFVHGVVSLVWNV
                     LESIAEFVGASVHFVISNILIIGLIALGVVLYNDRNKRGTLGNDLKKKAQ"
     gene            129721..131335
                     /locus_tag="CNA00420"
                     /db_xref="GeneID:3253732"
     mRNA            join(129721..129935,130008..130248,130306..130393,
                     130459..130515,130566..131100,131192..131335)
                     /locus_tag="CNA00420"
                     /product="expressed protein"
                     /transcript_id="XM_567079.2"
                     /db_xref="GeneID:3253732"
     CDS             join(129882..129935,130008..130248,130306..130393,
                     130459..130515,130566..130656)
                     /locus_tag="CNA00420"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567079.1"
                     /db_xref="GeneID:3253732"
                     /translation="MPPVVSSVVWFAQNAQYIIAFVLGATTLVFSCLAYLILRWVILP
                     NPFLGLFSPKSHPKRKPTKAKGKTTNLKKTTSRSKVTRNSSPGLVDSAFTMMGTGLLI
                     CSIASAVICAYSLTSQGCEALRHFGLIEWLPWKTGLRCYRSRWDWVGEFLGELLLTLL
                     HKSEYGTAAIKTIENM"
     gene            complement(130685..131844)
                     /locus_tag="CNA00430"
                     /db_xref="GeneID:3253934"
     mRNA            complement(join(130685..131173,131255..131324,
                     131396..131844))
                     /locus_tag="CNA00430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566472.2"
                     /db_xref="GeneID:3253934"
     CDS             complement(join(130842..131173,131255..131324,
                     131396..131710))
                     /locus_tag="CNA00430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566472.1"
                     /db_xref="GeneID:3253934"
                     /translation="MPRSADDPIVQAEQNFYNSSMYNAMGAAQMSFQPINRIHQHLCG
                     LHIYAHDTKRGVKAHHFCTHLRHDLHQCVIYDSDQPDARLIGIEYLIPEDAFIALPTD
                     EKKYWHSHRYEVDSGMLMLGTKSLVPNAVSDIAERPAMLELHRMYGKTTHTWQFDLHP
                     DLPLGPPQLMMAYTDDSQVDRQLLKERDEALGVSTEAKRKVRKGYLKKEDLERPPAEG
                     ADPCWNGKLGQWEYVEKEKE"
     gene            132051..133461
                     /locus_tag="CNA00450"
                     /pseudo
                     /db_xref="GeneID:3253500"
     mRNA            join(132051..132816,132871..133036,133093..133461)
                     /locus_tag="CNA00450"
                     /pseudo
                     /db_xref="GeneID:3253500"
     gene            complement(132063..132917)
                     /locus_tag="CNA00440"
                     /pseudo
                     /db_xref="GeneID:3253672"
     gene            133655..135951
                     /locus_tag="CNA00460"
                     /db_xref="GeneID:3253501"
     mRNA            join(133655..133799,133858..134341,134396..135951)
                     /locus_tag="CNA00460"
                     /product="expressed protein"
                     /transcript_id="XM_566474.1"
                     /db_xref="GeneID:3253501"
     CDS             join(133771..133799,133858..134341,134396..135907)
                     /locus_tag="CNA00460"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566474.1"
                     /db_xref="GeneID:3253501"
                     /translation="METAPLTLKVLHISPLTLIPTSNPDASASIPPIPLPPPPPPAGF
                     NFSPTPNYPPPFGSIPLGSKLDLRVGLENVHRQRYGVHGVRMMVEVQSASGRVRLGEA
                     IHGQISDTSSEQPLQEGQESQLPELKFGEMVELGVESEMKDLGLGVVIVSVAWETLDG
                     RKTFQRFFKFNIITPLGIKTRVQIPSHPNSTLSLSLREQTYLEVFMQNTSLESMLISG
                     ISLEPVEGLKVNKIGGSEMDGEELIVGGTRQYLFVVDSSPSNDDEGAKQGKSIFPPTY
                     PAGAVLPLGRLLVEWISGPYHTPGKLLTSMLNRRAPAPRLPSITQPHPTPTRTLSAAP
                     PTPSKGPTALDTGSGTLATPRRGLSPNPDSIPSPRHRPLPSPSPKWAFDLTLNGSRKV
                     PLQSEWYLTLNLAVRSAAPIQDSSEEQAVPTLPRLGIQYLTPVEPPLVDGAQSETDHS
                     RQSQQGNPQMMLSPPSRTSTPASPALSSAGRPLSPFTTTSTASTSIAGISGISRSTTP
                     LRAELKSAVGSMIGPNPFTSAFFKKIQTAPDDDQEEKESRASFPPIASVVPNPDYKPS
                     ASLDKSAGPVQIYHIGSSLIFPDFPPLTPKFENLGLQPLSAGGSEKKERESEKVAKKY
                     WETSVQWQWKFVGFEEGLGVLGGARVLISEGEDEGVIGREWECLGDVTVS"
     gene            complement(136220..137816)
                     /locus_tag="CNA00470"
                     /db_xref="GeneID:3253502"
     mRNA            complement(join(136220..136830,136887..137027,
                     137080..137164,137218..137438,137576..137816))
                     /locus_tag="CNA00470"
                     /product="fructose-bisphosphatase, putative"
                     /transcript_id="XM_566475.1"
                     /db_xref="GeneID:3253502"
     CDS             complement(join(136372..136830,136887..137027,
                     137080..137164,137218..137438,137576..137722))
                     /locus_tag="CNA00470"
                     /codon_start=1
                     /product="fructose-bisphosphatase, putative"
                     /protein_id="XP_566475.1"
                     /db_xref="GeneID:3253502"
                     /translation="MAAPQATLGADLEPPATDLITLTRHILSQQYALGESATGDLTML
                     LIAIQVTSKYIASNVRKARLINLVGLAGASNVQGEDQKKLDVLSNDIMVNALSASGKC
                     SVMVSEEVDEAIIVSGIKGTYCVVFDPLDGSSNIDAGVNVGTIFGVYKVQEGSRGTVE
                     DVLRPGREMVAAGYTMYGSSCNLVLSTGNGVDGFTLDESLGEFILTHPAIKIPSRGKI
                     YSFNEGNSLHFYPPTNDYLNSIKYPENGKPYSARYIGSMVADVHRTLLYGGIFGYPDD
                     KKSKDGKLRMLYEAFPMSFLTEQAGGVATTGSQRILDIVPTSIHGRCPVFLGSKEDVE
                     DLKKFYVNYKDDSRKW"
     gene            complement(138008..140770)
                     /locus_tag="CNA00480"
                     /db_xref="GeneID:3253935"
     mRNA            complement(join(138008..138178,138462..138642,
                     138701..138838,138898..139083,139171..139291,
                     139353..139694,139767..139834,139897..140027,
                     140093..140293,140358..140382,140453..140498,
                     140586..140611,140674..140770))
                     /locus_tag="CNA00480"
                     /product="T-complex protein 1 epsilon subunit, putative"
                     /transcript_id="XM_566476.2"
                     /db_xref="GeneID:3253935"
     CDS             complement(join(138048..138178,138462..138642,
                     138701..138838,138898..139083,139171..139291,
                     139353..139694,139767..139834,139897..140027,
                     140093..140293,140358..140382,140453..140498,
                     140586..140611,140674..140724))
                     /locus_tag="CNA00480"
                     /codon_start=1
                     /product="T-complex protein 1 epsilon subunit, putative"
                     /protein_id="XP_566476.1"
                     /db_xref="GeneID:3253935"
                     /translation="MSVDQINPGQAVYAQDENGRPFIIVREQGRKVRTHGLEAIRSHI
                     LAARSVTNIIKTSLGPRGLDKILISPDGEITVTNDGATILGQMEVEHQIAKLLVEVSK
                     SQDDEIGDGTTGVVVLAGALLSSALSLLDRGIHPIRIADGYEKACEIAVAELDRVADT
                     IEFSKDDVSNLMKTAKTSLGSKIVSIAHDKFASIAVEAVLSVADLERRDVDFELIKVD
                     GKVGGSLEDTSLVKGVVIDKDMSHPQMPSVVRDAKIAILTCPFEPPRPKTKHKLDIES
                     VEEYKKLREYEKEKFLDMIKKVKDTGANLVICQWGFDDEANHLLMQNELPAVRWVGGP
                     EIELIAIATNGRIVPRFEDLTADKLGHAGVVRELTFGTTRDKMLVIEECANSRAVTVF
                     VRGSNKMIIDEAKRALHDAICVARNLVRDNRVVYGGGAAEICASVAVSKRADEIPTIE
                     QYAMRAFANALDAIPLALAENSGLSPIDTLADVKSRQVTEGNPRLGIDCLGRAENDMK
                     KQHVYDPLISKRQQFLLATQVVRMILRVDDVIDASAFGDE"
     gene            140963..142003
                     /locus_tag="CNA00485"
                     /db_xref="GeneID:36392651"
     mRNA            join(140963..141122,141207..141607,141674..142003)
                     /locus_tag="CNA00485"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656043.1"
                     /db_xref="GeneID:36392651"
     CDS             join(141003..141122,141207..141607,141674..141944)
                     /locus_tag="CNA00485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514115.1"
                     /db_xref="GeneID:36392651"
                     /translation="MSTPAAVTQPQSASKEPHRMRITAGGSIRHYVAFALASLRDDPA
                     TPVVLHTLPSSSSSPSSSSSSSSTNAPKKDNDKIKPQPKSKSPLPACLITAPRLISVV
                     ELIKREYISELRAAKASCRGDVRSKGKGIWQYTESGLWEPATEAGVNAVTQRTETEGI
                     DGGALRRVLAGRTKPKMSHSPYLQITLSARPLEGLEREGATCQYMPVKKNQRGKKGSA
                     KKNGDGEQNEGSRQGAEDSESVESRGTKRKGEAEDREGKKRRTDE"
     gene            complement(141965..143609)
                     /locus_tag="CNA00490"
                     /db_xref="GeneID:3253503"
     mRNA            complement(join(141965..142495,142549..142749,
                     142818..143189,143263..143346,143395..143400,
                     143462..143609))
                     /locus_tag="CNA00490"
                     /product="chaperone regulator, putative"
                     /transcript_id="XM_024656146.1"
                     /db_xref="GeneID:3253503"
     CDS             complement(join(142052..142495,142549..142749,
                     142818..143189,143263..143346,143395..143400,
                     143462..143566))
                     /locus_tag="CNA00490"
                     /codon_start=1
                     /product="chaperone regulator, putative"
                     /protein_id="XP_024511821.1"
                     /db_xref="GeneID:3253503"
                     /translation="MVADTTYYDLLEVAVDATETEIKKAYKKKAMQHHPDKPQNPDDP
                     NSHETFQRIGQAYETLSNPNDRATYDQYGADGPPRGGMPSDMDMDDLFSAMFGGGFDD
                     FGGGMGGGFFDPSGGRGGGRRKPAKGRDTTVPYDITLEEAFKGKKVVMSIERDRVCGG
                     CKGSGARPGVAPKECSKCSGKGVVFTDRMLGPGLVGKVKSPCPECNGEGVKLRDKEKC
                     KKCKGQKVVKEKKRIEFMIDPGTEDGERIALRGEGDEAPDIPPGDVIFLIRHLPHPSF
                     RAQPHSPGSLTILLSIRLSEALLGFSRVLFIHLDGKGVHVTSKKGERIIQPGSVWVIK
                     GEGLPIRGKGKRGDMYVRFDVEFPTTDWAKGVEVDGGESTKVELPGRKPDLGLSPEQI
                     VVRELSDKPVN"
     gene            143821..145711
                     /locus_tag="CNA00510"
                     /db_xref="GeneID:3253504"
     mRNA            join(143821..143900,143954..144436,144493..145029,
                     145083..145209,145260..145402,145471..145711)
                     /locus_tag="CNA00510"
                     /product="citrate synthase, putative"
                     /transcript_id="XM_566478.1"
                     /db_xref="GeneID:3253504"
     CDS             join(143862..143900,143954..144436,144493..145029,
                     145083..145209,145260..145402,145471..145536)
                     /locus_tag="CNA00510"
                     /codon_start=1
                     /product="citrate synthase, putative"
                     /protein_id="XP_566478.1"
                     /db_xref="GeneID:3253504"
                     /translation="MSFIASRNALRSQLRPSLARSFATTPAAYAQSLKDRMAELIPQE
                     IENVKATRAAHGAKSLGDVTVDMAYGGMRGIKGLIWEGSVLDPNEGIRFRGLTIPECQ
                     QKLPTAPGGSEPLPEALFWLLLTGEVPTDEQVKGLSQEWAARAAIPKFVEELIDRCPN
                     TLHPMTQFAIAVNALNHDSAFAKAYSNGVHKKEYWKTTFDDSMDLIAKLPNIAGRIFR
                     NVFGDGKLPPIDPSKDYSANLATLLGFGDNADFVELMRLYITIHSDHEGGNVSAHTGH
                     LVGSALSDPFLAFGASLNGLAGPLHGLANQEVLRWVQKMRSQIGEDASDEKVAEYVWS
                     TLKSGQVVPGYGHAVLRKTDPRYTAQREFALKHLPEDPLFKLVGQIYKIVPNILLEAG
                     KAKNPWPNVDAHSGVLLTYYGLHQQDFYTVLFGVSRAFGVVSQLIWDRALGMPLERPK
                     SYSTEAIKKMFEGK"
     gene            complement(143963..146366)
                     /locus_tag="CNA00500"
                     /pseudo
                     /db_xref="GeneID:3253686"
     gene            complement(146866..149723)
                     /locus_tag="CNA00520"
                     /db_xref="GeneID:3253520"
     mRNA            complement(join(146866..146985,147040..147099,
                     147163..147663,147716..148221,148274..149410,
                     149482..149723))
                     /locus_tag="CNA00520"
                     /product="peptide-binding protein, putative"
                     /transcript_id="XM_024656147.1"
                     /db_xref="GeneID:3253520"
     CDS             complement(join(146917..146985,147040..147099,
                     147163..147663,147716..148221,148274..149410,
                     149482..149689))
                     /locus_tag="CNA00520"
                     /codon_start=1
                     /product="peptide-binding protein, putative"
                     /protein_id="XP_024511822.1"
                     /db_xref="GeneID:3253520"
                     /translation="MSGVPPGPPPGRPPVANVPYIPQPGAPAAPPFRPPAAPGFGFPP
                     GPPPGMPFSVGGFPHPLPPGWSEHRAPDGITPYYYNAQTRESTYIRPTFPPFPPGTTP
                     PTGSPAPGAVTPGGTGAAEEKTKKKKKEKPKDKVPIPGTGWMRITTTEGNVFYFEKEN
                     KRSEWTVPDEIKDAVAQLEEEERKKKEEKDKEEQEKIEQERIEKLKELERIRAEIDAE
                     RKKKEEAEKERKRKQREDGEDDAPEEKKAKVGGQEQEEEDVVGPEGEEDEEAWMKAVA
                     AEFAEKDAQTKKDLEEQDEKTKKEEAEAAKKVFAVPEKVNVSVEEGRALFKALLIEKD
                     ISPFAPWDQSLPLFINDPRYVLLSSMKDRREVYEEYCREVGRAKRLKKGSAAEEKKAE
                     PEKEYKALLDKEVTSTRTRWDDFRKKWKKDRRFYAFGRDDHQREKAFKQHLRDLGERK
                     RAAAQKAEEDFNTLLKESTNITSSSQWSSVKRSISSDPRYDAVGSSSLREDLFNNYIR
                     ALSSTSNPAKSNPEEQSIKEKEEAAARRLAERKAGQSAQPSESKEDAAARKLAERKAK
                     SEASLREREAKVREEKERVEREMHKSKMGAGREEAEALFRSLLVDSVKEPNVTLDEAQ
                     SYLSSDPRWNHPSLSARDKQRLFAAHSERLFSKRSNALHSLFESKTPALNTSYDDVYP
                     QIIDDPLVKRLGLQGEALEDRWRSWRRKKEHDARIEFDQMLRENSFVEFWSKMRKKTM
                     DEKALEVQEQDEYDEGEGMGEGGAADLTQLAKQIDLGEIKAVLRRDKRYTVFDHMPDE
                     REKWLRDYLENVEAASGSKTIHNVGLDR"
     gene            complement(150778..152846)
                     /locus_tag="CNA00530"
                     /db_xref="GeneID:3253487"
     mRNA            complement(join(150778..151034,151100..151892,
                     151946..152082,152155..152414,152486..152638,
                     152709..152846))
                     /locus_tag="CNA00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_566480.2"
                     /db_xref="GeneID:3253487"
     CDS             complement(join(150897..151034,151100..151892,
                     151946..152082,152155..152414,152486..152638,
                     152709..152820))
                     /locus_tag="CNA00530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566480.1"
                     /db_xref="GeneID:3253487"
                     /translation="MANQPEKLADAQNKDAGEKVQETEEKTVVEAVPTVEEEILNNIA
                     LIGRAVTTIEPRFTIRVLRTLTSLRKKLTKNALKTVLDDAFPKGSKTGQTLIASPIFS
                     SLPESAPAATEQQSDAMEIDSSIPAAEGTTAPTPKKKFVPPIYSATGDLLPEGIVYLR
                     LLLILANLDAGRVVEAGDFAMETADLISSWNRRTMDQLAGKIWFYVARAYELQGRLAE
                     LQPQFMAIRQTAALRKDETLEVTVLNLLLRSYLANSQYEQAEKLVSKTQFHGAANQAQ
                     TVRWLFYTGRLRAIQLNYAEARNYLQTAIRRAPKDEVAPGFVQLIHKYFIIVVLLTGV
                     IPDRALFRKPVLKQALAPYFQIVQAVRIGDVAGFQKAFQTHEATFFADSTHFLISRLR
                     HFVIKTALRTITLAYSRISLADVCIKLHLDSEEDTEYIVAKAIKDGVIDATIDPQGGW
                     MQSKVAKDLYETDEPAKQFQKRVQYCTQVYNESVRAMRYPPDAHRKELDSAAESRERD
                     REIAQLIQESDEPDDMDDMGDL"
     gene            153018..154595
                     /locus_tag="CNA00540"
                     /db_xref="GeneID:3253486"
     mRNA            join(153018..153468,153610..153758,153929..154050,
                     154206..154595)
                     /locus_tag="CNA00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656148.1"
                     /db_xref="GeneID:3253486"
     CDS             join(153345..153468,153610..153758,153929..154050,
                     154206..154290)
                     /locus_tag="CNA00540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511823.1"
                     /db_xref="GeneID:3253486"
                     /translation="MARTVTSPSRGGGRSSIGEGSRKTKNTARKSTGGKAPRHSGVQR
                     NPPPDPKSPAGPKKKHRFRPGTVALREIRHYQKSTDLLIAKLPFSRVVREVAMNVGSD
                     EVGEYRWQSSAIMALQEAAEAFLVHLFEDANLCAIHAKRVTIMQKDLQLARRIRGRY"
     gene            complement(154609..155802)
                     /locus_tag="CNA00550"
                     /db_xref="GeneID:3253902"
     mRNA            complement(join(154609..154829,154954..155099,
                     155201..155340,155435..155488,155575..155802))
                     /locus_tag="CNA00550"
                     /product="COPII-coated vesicle protein, putative"
                     /transcript_id="XM_566482.1"
                     /db_xref="GeneID:3253902"
     CDS             complement(join(154705..154829,154954..155099,
                     155201..155340,155435..155488,155575..155694))
                     /locus_tag="CNA00550"
                     /codon_start=1
                     /product="COPII-coated vesicle protein, putative"
                     /protein_id="XP_566482.1"
                     /db_xref="GeneID:3253902"
                     /translation="MLFRTLIPFLLALPLAFAHRIDIEAGEKECFYEVLAPQDRVTVT
                     YEVGGGGHLDIDFYVTDPQGKVIHTKNKQPQGSWSITTSQEGRFTFCFSNEMSSYTTK
                     TLSFNVHGQLYMGDDEQIAPVEQEVRDLSAGLQLVKDEQAYLVVRERVHRNTCESTNS
                     RVKWWSIAQIVILLGVCGWNIHYLKSWFEVKRVL"
     gene            156020..157681
                     /locus_tag="CNA00560"
                     /db_xref="GeneID:3253485"
     mRNA            join(156020..156050,156179..156230,156430..156524,
                     156663..156814,156893..157021,157115..157233,
                     157351..157681)
                     /locus_tag="CNA00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656149.1"
                     /db_xref="GeneID:3253485"
     CDS             join(156198..156230,156430..156524,156663..156814,
                     156893..157021,157115..157233,157351..157539)
                     /locus_tag="CNA00560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511824.1"
                     /db_xref="GeneID:3253485"
                     /translation="MAEPTETVNTGEEHDPQFEPVIRLTEQVEAKTFEEDEEPLFKMR
                     AKLFRFHKDTTEWKERGTGDVRLLKHKQSGKVRLVMRRDKTLKVCANHILSPDMKLSP
                     NVGSDRSWVYNVAADYAEGEASAETLAIRFGNSENANLFKQAFEDAQAHNASLSGAAP
                     KEEDESAAVAKPEAAAESAAPEAEAKKEEASTLEESKPEEPATGAEAETKVADAPAAT
                     EIKEEGIREADEAAAEKKDE"
     gene            complement(157802..162332)
                     /locus_tag="CNA00570"
                     /db_xref="GeneID:3253899"
     mRNA            complement(join(157802..159969,160021..161201,
                     161242..162069,162135..162332))
                     /locus_tag="CNA00570"
                     /product="DNA-binding protein cre-1, putative"
                     /transcript_id="XM_024656150.1"
                     /db_xref="GeneID:3253899"
     CDS             complement(join(158119..159969,160021..161201,
                     161242..162064))
                     /locus_tag="CNA00570"
                     /codon_start=1
                     /product="membrane protein, putative"
                     /protein_id="XP_024511825.1"
                     /db_xref="GeneID:3253899"
                     /translation="MPLLLLLFLLIAGLYVQATPLQPTFSSCLFAHSPVAASENLLNV
                     TQVFATLVPGNEATELGLTGDGHDVLRLDLVGVTGAELAGYDNSTNKLATLFTDTHAA
                     TARVYSSTTWLCNSLFPAALPEPYYPYNTTYCPLPAGDFAINISIPLYRSYALTTLHT
                     QVRIVDTSLEAASLTCLNIHVSPYDDSGWYYLLFRYWLVALVAGFWLVSWGARFVTGW
                     IVGSGVAEYGQKELAGARLMAGGSNNREATMRKWGTMIISGLSGERLSVSGGLLRFVT
                     PGVKDILFHIQYASMLGMIAVNWPEFSYPIFAQGAWGNLVWNTTLVQGSNPTSKRVSI
                     YPDNYTVPSQFSTQMTDPLYPLYLDADAFDPVLDLHNSPDGMESFATAVGLRPQDLFG
                     TCLAIFLCITAAVIFLSLLLWFLHGLSEYILTKEHKQNSPAAKRTTLGSSPRGSLGGK
                     EALDPQTSSSEGLGVLPTQSGFFSHKSSSPSLLRRIWLRFRPRGEAGAFHAAALYGNL
                     IRLILVFHLPVTIFSMYQLCLGGRASIVSRVFAAFSFAFISVLIPAYILYRVYNTPTG
                     KLYDATRTLLSIGPMYTVYVEKKQMFRVFSLTASLIAGIVVGAGQKSGIAQTIILIVV
                     ELAMLIIPGVWYPWGEGASMGAPNAFLTALRLVSVVLAMLLSRTISMPGTAADWITYA
                     ILIIQAIIFVFFLLMLLTKIIEGSIRLFGGVHFDESTHPLDGGIFAAIMDLDCLNPVR
                     GGKAAERRRRKRDSRQLHKNVYAAGTLSTQMMLDRHSQGVPRQTVSEGSTPMLYPVGY
                     QPPLGPPPVDRRSSDDRSDERPSGSGNIMDAWRPVSGPGYVPPGAYAPTVTSPTSPPP
                     GSLFDNVQSGPSRGFSVVRGGRSNYQNPYDIQNLNAGSDTSTPIMTMPVPTIRVSQVG
                     QRPMSPPHSRQKSSSAIIELSTPPIQTVGLPRTTYPPSPSTSQGIRPNNEGMRPPVLA
                     IPKRRSLNDLKNENDPSPTSQYSESERQKKKGRRNAGWFHRNEARAQDSESEESDDEP
                     GPSRRKARKAALLTSGMREPEPFEDISKFEQPSGWKKVLGIGKKGLDDLAAQERDENK
                     ARKAALATESGSLFAGVEAPKPSPKKKGFVVTRRSGDRPGVTPISPASPESQAGTSFK
                     VKRMGQPTPTPTRVESPAQPESAHASPISPMSPAPLAGLATGSVVGPGKKKSFQVIRP
                     ATKSSVASPTGNGGSTGFVVNRRSPQSTPLENTSTPSPPPPEQGGYAPSLFVPINQPD
                     ESEGLAKDPRRSSESQQRYHAL"
     gene            162682..163946
                     /locus_tag="CNA00580"
                     /db_xref="GeneID:3253449"
     mRNA            join(162682..162913,163016..163049,163292..163379,
                     163452..163466,163624..163870,163917..163946)
                     /locus_tag="CNA00580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656151.1"
                     /db_xref="GeneID:3253449"
     CDS             join(162851..162913,163016..163049,163292..163379,
                     163452..163466,163624..163636)
                     /locus_tag="CNA00580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512090.1"
                     /db_xref="GeneID:3253449"
                     /translation="MSERLTEFAEIPRQFVKEGTLFVNRCTKPSAEEYKQLCRAVAIG
                     FGVMGVIGYLVKLIHIPINNILVGGA"
     gene            167188..171227
                     /locus_tag="CNA00590"
                     /db_xref="GeneID:3253743"
     mRNA            join(167188..167709,167790..167935,168803..169564,
                     169624..169783,169839..170559,170619..171227)
                     /locus_tag="CNA00590"
                     /product="specific RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_024656152.1"
                     /db_xref="GeneID:3253743"
     CDS             join(167864..167935,168803..169564,169624..169783,
                     169839..170559,170619..170718)
                     /locus_tag="CNA00590"
                     /codon_start=1
                     /product="specific RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_024512022.1"
                     /db_xref="GeneID:3253743"
                     /translation="MSSIHHQVSATYEGRTGEGRTDVSPYPQQQHYPTSAQPSFQPPP
                     PISPPSSSPFAFAPPPLGTTLPPGGTSRPPLVSHHSDPPPVAQPISYSFMKQQQQLPP
                     PAPHHGSYPYVTSIPMSYRSYSGDSDRNSPQSLNGRAPAPSNPSTHSASISAQSSPLP
                     SNFQYQRQMLPGPYEAPVGQTLPDLNRSATYPQGYYNPGYASALSTEMPRSLSYPSGY
                     SQPYSYIPPLPSPTSFHPAIPGYSSLTRHHTLGTGPSYAFSSRQPVQDRPFKCDECLQ
                     SFNRNHDLKRHKRIHLSVKPFGCEKCGKTFSRKDALRRHWLVKGCRGSEGATAPIVPL
                     YPLSSTSSQPPALSPSTPTSLEQLKGNPITGSSSSSRSSTTLPPLSSLPQRQSADQSQ
                     IILTPREPSGLTLAQAAAPVAQISIKTVDPAVGNIDVGSGSGSAGSMGEGFAPEYFDS
                     VVPVKSASGTSTDARSNVSPFSSTCTSPPESIQPQPYRKSTLTLASDGTGPSPSSSYN
                     DTISFAPSSLGAEGKPVFITPFTPTAQSFAMQQQGTNVSQTSSEAATMERQASSDKMP
                     ETWQRWHRPSFPFPAPPGISFAFDPASPLEGTDPSYAQ"
     gene            171331..172762
                     /locus_tag="CNA00600"
                     /db_xref="GeneID:3253703"
     mRNA            171331..172762
                     /locus_tag="CNA00600"
                     /product="expressed protein"
                     /transcript_id="XM_567080.2"
                     /db_xref="GeneID:3253703"
     CDS             171452..172408
                     /locus_tag="CNA00600"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567080.2"
                     /db_xref="GeneID:3253703"
                     /translation="MSSSSSSSDSPSSHSSSDSPSFERSSIDISNLDTFLSSSITSPY
                     IQETYPPTDPSVVSAVSSVLKGSSFDISVPREVSAALSERSSAVEREVREIGSGKERD
                     NGERVGKWMRERAKRLGEMVESWVSSGATFAPFSSDRSSGYFSGSHNDRLSTATSIPS
                     PGTCASTSSYISSTPRSTTATAATTATTTASVELSSASRRRLATTTAANLKSSPPTID
                     PSTVRKIISYIRSANSNSNPPLNEEHWWTAYHALRSPSAFGTHGVPIPLSEKLARMRA
                     LRWEDVESDVGYERARAKMFLGDERLAGSHLEGWGGSTFGVA"
     gene            173968..176206
                     /locus_tag="CNA00610"
                     /db_xref="GeneID:3254016"
     mRNA            join(173968..174329,174575..175046,175098..176206)
                     /locus_tag="CNA00610"
                     /product="expressed protein"
                     /transcript_id="XM_024656153.1"
                     /db_xref="GeneID:3254016"
     CDS             join(174306..174329,174575..175046,175098..175933)
                     /locus_tag="CNA00610"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511826.1"
                     /db_xref="GeneID:3254016"
                     /translation="MQSEVWTTSYSTEIFDMSAPPPVPARSRLRDAAPPKIDTSRDAR
                     DASSRLNAGNHNDNASTPATPSTPDLRVPTMPTSSSSPLSPYYRKASLQVDSVNPPTT
                     PRLNSPSTPSFTIGPSSLASPSSGPLSSFGRKRQSKVMEKDPRDPYKVKDGALKKKAS
                     SGIYTPPTFPGPSGHHLPLPQQSTSTLYTPSHSHILDAPGQSAGLGLGPMSPSQSSST
                     RSSASDHSDSTAPPRTPISPTNRFGKTFSSNVRRLSSMAALSGMTSPSREREEERERE
                     EQRMKGRGSEGASIAGSGSWNWSDGRSRKGSAHSHSYSHTFSYYPSGTPSLESGSSCD
                     PHSSLEHYANPQPLVASPASVSALTPVPPPTPTPAHFYTPSSPSSPPSTASLGIHYSV
                     EEEPGDGVEGAENKVPRPSPRTKGRRKPVPRLLEDEDRNLVDRMDGLHVGL"
     gene            177738..179733
                     /locus_tag="CNA00620"
                     /db_xref="GeneID:3253483"
     mRNA            join(177738..177926,177988..178022,178079..178087,
                     178156..178178,178231..178271,178329..178410,
                     178464..178542,178604..178742,178801..179025,
                     179103..179362,179435..179733)
                     /locus_tag="CNA00620"
                     /product="disulfide-isomerase precursor, putative"
                     /transcript_id="XM_566486.2"
                     /db_xref="GeneID:3253483"
     CDS             join(177828..177926,177988..178022,178079..178087,
                     178156..178178,178231..178271,178329..178410,
                     178464..178542,178604..178742,178801..179025,
                     179103..179362,179435..179678)
                     /locus_tag="CNA00620"
                     /codon_start=1
                     /product="disulfide-isomerase precursor, putative"
                     /protein_id="XP_566486.1"
                     /db_xref="GeneID:3253483"
                     /translation="MRLSISISAALLAFTSLVSASNVVDLDSTNFDQIVGQDKGALVE
                     FFAPWCGHCKNLAPTYERLADAFPTDKVVIAKTDADGVGRELGSRFGVSGFPTLKWFP
                     AGSLEPIPYSGARDLETLAAFVTKQSGVKSNIKPPPPPAYTELDASNFDEIALNESKN
                     VLVAFTAPWCGHCKNMKPAYEKVAKVFSSEPDVVIALMDADEAENKPVAQRYGVSSFP
                     TIKFFPKGSKEPVAYDSGRTAEQFVNWINEKSGTHRSVSGLLSETAGRVLTLDTLASE
                     FFSANVPERSEIVKKAQEAVTTVDEKSKATANYYIKAMERITAKGEEWLTKEQARLAN
                     LLASPSLAPTKLDELKVKINILSAFAAQKAGEAYDSAEEVLEDAWDSAKQIPIQAKDG
                     LDQFADAVEEKAKRVRSDL"
     gene            complement(179702..183177)
                     /locus_tag="CNA00630"
                     /db_xref="GeneID:3253482"
     mRNA            complement(join(179702..180418,180474..181102,
                     181155..181420,181480..182113,182166..182331,
                     182381..182615,182665..183177))
                     /locus_tag="CNA00630"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /transcript_id="XM_024656154.1"
                     /db_xref="GeneID:3253482"
     CDS             complement(join(180147..180418,180474..181102,
                     181155..181420,181480..182113,182166..182331,
                     182381..182615,182665..183042))
                     /locus_tag="CNA00630"
                     /codon_start=1
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /protein_id="XP_024511827.1"
                     /db_xref="GeneID:3253482"
                     /translation="MNRAVQRSQLFNPAGQQTRSQYDPQNPGVQHRGPAGPAPQQQYQ
                     QYQQYQQPQQQGQPQQQQQQQQQQLSQQGPQSTNGTADGASGSGSTPGQEMNLASVLH
                     YLQSEWRRWERDRNEWEIERAEMRARIALLEGQRRSAENLKVDLLRRVKMLEFALRQE
                     RTKRVGAGGKLNSVPPTRLAALQDEDRLSTGDKEGSGSEGSQEDILEKPTKVNGVHSA
                     AVGKSSTIMSRSQPAEANQWKSIGVAPRDPKARARSREYLKQCLQEISYLTSPGALNP
                     LPPYPPVDPSALPQPDVSHDPNHPEVDLYERPRKELSEEPVPPLHTRKRNDEAAETKE
                     TAGSTSASEDDQVNGEKDKPIPSIPTPALPPGSSSSFPTSQPMEKSVSPSPLAFHRPG
                     LDPALLPPSDNSGPPSSPSPRTVSLPDISATKSEDEPRSPGAGKDSDEPGKQLLTAIY
                     RPDSKTAWREELKAANEEAEKAKEERARKVPDQAEDDRLTTLSLNTEEEEIKADDSVD
                     KIWVSKRSLKSHLDIVRAIAFAHGPGIMLATGGDDCTVKVWSVDSASIISHRHTAQEI
                     EPIMTLRGHTAAITSVAISNALSIIFSASLDSTIRLWQLPAHNHDPYATYNPSVAVQT
                     LEGHTESVWDICLLPPQEVSPAGKEGIEGRLVSASSDGSVKLWERSGSSPSASNWKLE
                     KSFSSFGEGVIPTCLAVFNLDFGKVLVGTSDGKARLWDVDAGEEVRLFGEEGQGVDSQ
                     VNAILSHPTLPAIVTAHEDGYLRFYDAKSSSTTPTHTVLAHPAPITSLALSPSSPTCI
                     LTSSVDCTVRLWDLTKKTSIQELAGHRGRADEGVCAVASHPELPVIGSAGADGVVRLW
                     GLA"
     gene            183964..186752
                     /locus_tag="CNA00640"
                     /db_xref="GeneID:3253742"
     mRNA            join(183964..184487,184543..184609,184666..184744,
                     184804..184821,184876..184948,185009..185175,
                     185226..185357,185413..185601,185663..185740,
                     185804..185810,185879..185889,185950..186051,
                     186113..186178,186235..186274,186333..186396,
                     186452..186752)
                     /locus_tag="CNA00640"
                     /product="integral to plasma membrane protein, putative"
                     /transcript_id="XM_567082.2"
                     /db_xref="GeneID:3253742"
     CDS             join(184054..184487,184543..184609,184666..184744,
                     184804..184821,184876..184948,185009..185175,
                     185226..185357,185413..185601,185663..185740,
                     185804..185810,185879..185889,185950..186051,
                     186113..186178,186235..186274,186333..186396,
                     186452..186580)
                     /locus_tag="CNA00640"
                     /codon_start=1
                     /product="integral to plasma membrane protein, putative"
                     /protein_id="XP_567082.1"
                     /db_xref="GeneID:3253742"
                     /translation="MSAQEFYQGGNQRGYQQQQFPPPPGGPPQDQNGGKQEYVPPQGQ
                     PPNYNMKPSQPYASTNPETGGQPVYQDTAPFSQANEKTGERMNPRKRVNDIIPLILFI
                     AAVVGFAVVSGIAIHGFVQVNGLGGGMGDSSIGRTGSSITLDYHTVYLLLVVVALGLV
                     IASLYLAALRAFTKIILEVTLALTVILNIGICIYYFIIQYWSGAIIFLIIALVSVFFY
                     WGMRKRIPLAKLLLQTTIDVTKHHPSVYVVVFIGLIIQAAVSVWYTFTCIAIYVKWTP
                     GSAACSDGGCSSSKVAGLVFYATFSYLWLSQVIGNVILCTLAGGVFGGWYYYGPRTPG
                     GGVPKRASLLAFVRASTLSLGSIAFGSLLVTILELLRLILQLFRQYEAGQGDMIGSIL
                     ICIAQCCIGCIQWMVEYFNKYAYIEIALYGKSYIPAAKDTWRLLKDRGIDALVNDSLV
                     GTALMWGAYINGFLCAVLGYFYLRFTHPAYNSDGQYSAPVILFSFLIGLNESFTVGSA
                     IDAGVSTIFVGLGEDPMVLAERSPGLFEMIRQVYPRVVQGVPH"
     gene            complement(186915..187690)
                     /locus_tag="CNA00650"
                     /db_xref="GeneID:3253481"
     mRNA            complement(join(186915..187221,187288..187442,
                     187528..187690))
                     /locus_tag="CNA00650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566488.2"
                     /db_xref="GeneID:3253481"
     CDS             complement(join(186981..187221,187288..187442,
                     187528..187605))
                     /locus_tag="CNA00650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566488.1"
                     /db_xref="GeneID:3253481"
                     /translation="MSPQEQNNEPSQMTGQLNSASGLVQQAIGNVVPESMGASSWIQS
                     GHKLQKEGQNEVDAAKAQKAGAATVDSGIGKVKSVFGYVTGDQEKQTEGNTQAEKAQW
                     DYKQATSDSIAAIPIPSVEGAKGKLESVVGMAAEDPEKQKEGNVRAEKAAWKDGV"
     gene            187871..190324
                     /locus_tag="CNA00660"
                     /db_xref="GeneID:3253763"
     mRNA            join(187871..188270,188324..188402,188460..188466,
                     188527..188564,188618..188689,188746..188764,
                     188814..188957,189005..189045,189093..189254,
                     189314..189406,189462..189684,189738..190324)
                     /locus_tag="CNA00660"
                     /product="A/G-specific adenine DNA glycosylase, putative"
                     /transcript_id="XM_024656155.1"
                     /db_xref="GeneID:3253763"
     CDS             join(187960..188270,188324..188402,188460..188466,
                     188527..188564,188618..188689,188746..188764,
                     188814..188957,189005..189045,189093..189254,
                     189314..189406,189462..189684,189738..190270)
                     /locus_tag="CNA00660"
                     /codon_start=1
                     /product="A/G-specific adenine DNA glycosylase, putative"
                     /protein_id="XP_024512023.1"
                     /db_xref="GeneID:3253763"
                     /translation="MRPDSSSPSIYSVSDSDSSDYAPSVSETKRSSIKRKRAAPASTK
                     SRTKTTIVKQARGKGKAVDNIEDIENLGATVSRRHGMDYHSVDKIVDEKESLLEWFEC
                     VREKRGMPWRKKYDPSLSFEEKGQRAYEIWVSEVMLQQTQVTTVIAYWQRWMERWPTI
                     SDLAKADVEEVNAAWRGLGYYRRARSLLAGAKTVMGNSKYNGRLPDDPAVLEKEIDGV
                     GRYTAGAICSMAYGVRTPIVDGNIHRLLTRLLAVHAPQTGPATIKFLWRVADELIKHL
                     PSGDKHNNVVGDWNQALMELGSQVCKPANPECGVCPLKKACKGYAELSNSPSQPSTTK
                     SDCKLCAPIPCDIETDRIPTVMVFPMKKEKKASRVEEETVCIVQWRGDGDQRRWLFTK
                     RPEKGLLAGLFEPPTTPVSAGLSSSERLGASLEALSDYIEITEGEAEGLQKSSRDVGN
                     IPHIFSHINMTYHIHLLTLTSPGNEPPSVKPKAPRPAVWLNEEEVEKANVGTGVKKVW
                     AEIYGSWGSFEESEAGAILAKKQKRTNNKLTKPKPVVANRNEKIVKKVMMPPMPTTRK
                     NVVDAVE"
     gene            191738..194834
                     /locus_tag="CNA00670"
                     /db_xref="GeneID:3253894"
     mRNA            join(191738..191846,191923..192315,192364..192449,
                     192499..192812,192872..194834)
                     /locus_tag="CNA00670"
                     /product="sulfate transporter, putative"
                     /transcript_id="XM_024656156.1"
                     /db_xref="GeneID:3253894"
     CDS             join(192013..192315,192364..192449,192499..192812,
                     192872..194676)
                     /locus_tag="CNA00670"
                     /codon_start=1
                     /product="sulfate transporter, putative"
                     /protein_id="XP_024511828.1"
                     /db_xref="GeneID:3253894"
                     /translation="MGLIKSSLGNSNKGKFVDCSTPPLHNSSFIRIQEDSSSTAAART
                     STQEDLHASMSPDIKPSFRPEVVKSKIKHYFGYTETTPETVSVFDWARSQTPALGPGI
                     KAYILSLFPFIQWVPRYNLTWLFGDLVAGITVGMVLVPQSLSYAKIAELEPQYGLYSS
                     FIGVLTYAFFATSKDVSIGPVAVMSLETGNIILSVQDKYGDLYSKPVIATALAFICGF
                     IVLGIGLLRIGWLVEFIPQPAVSGFMTGSALNIAAGQFPAVFGLSKKFDTRAATYKVI
                     INTLKYLPQASLDTAFGMTALAALYGIKWGFTWLGKRYPRYGRITFFCQSLRHAFVII
                     IWTIISWRVNVHAASPRISLVGNVPSGLQHVGRPFIDSQLLSAIGPHIPVATIILLLE
                     HISIAKSFGRLNGYKINPNQELIAIGVNNTIGTLFSAYPSTGSFSRSALKSKAGVRTP
                     AAGLATGVVVIVALYAVAPAFYWIPNAALSALIIHAVADLVASPKHSYSFWRVAPIEY
                     VIFVGAVLWSVFYTIESGIYWSLATSVVLLLLRIARPKGHFLGRVRIKPEAGNTLEHI
                     RDVYVPLDEESSGEDVKVENPPAGVIIYRFEESFLYPNASYINDRLIEQAKKVTRRGG
                     DYSKVAAGDRPWNDPGPSKKNAAAVIEADMVKPVLKAVILDFAAVANLDTTGVQNLID
                     TKTEMEKWADGPVEFHFCGILSPWIRRALVAGGFGQGRAKEGAALEVAPAVIENLENA
                     ASPGMERERYNEHEVSFIHEVGQASNSTSAGTSFSEEEKRIGSGATTPSPQLDGVNER
                     RPSGVSTKTVPLLDRSTPFFHFDLADALNSLNLPENE"
     gene            195300..199896
                     /locus_tag="CNA00680"
                     /db_xref="GeneID:3253476"
     mRNA            join(195300..195827,195886..197009,197055..197130,
                     197178..197526,197577..197669,197731..197869,
                     197920..198018,198069..198201,198252..198451,
                     198501..198825,198880..199043,199094..199564,
                     199621..199896)
                     /locus_tag="CNA00680"
                     /product="vacuole protein, putative"
                     /transcript_id="XM_566492.2"
                     /db_xref="GeneID:3253476"
     CDS             join(195523..195827,195886..197009,197055..197130,
                     197178..197526,197577..197669,197731..197869,
                     197920..198018,198069..198201,198252..198451,
                     198501..198825,198880..199043,199094..199564,
                     199621..199676)
                     /locus_tag="CNA00680"
                     /codon_start=1
                     /product="vacuole protein, putative"
                     /protein_id="XP_566492.1"
                     /db_xref="GeneID:3253476"
                     /translation="MPARDPNASPHVPSTFPNRPVSPINSQHPNTLSPNASGFSVRTV
                     QSNNGVLSLPSPDHQQPHGYFTQALRRVSGTGGHNLPRMEAPASAGQDVPAERNGWDD
                     TSFHIQAGSTTSQAIRDSTARLASVSFSTRPRAFSSASQGDSSYSHSALSSRHASVNH
                     GPTHSVATSATEHRPIYPSHLNPAISKPGPTPVLEDDERDEVSPSKGLQALPASPFTG
                     AKSGLSMMLERDKEERRVRGLTEAASLRSKRSGSSIGKLASDEEESGERTPMPRRSSL
                     VDDILEVPTTEGNARMSHAGSSSSLRRFLANEVNEEELGQAPDERSLLLGDGRERKKR
                     SWAGEALSNIEGWKNNLLKVTPKDVVEGIILEPIRTLPSVILGLLLNVLDGVSYGMIL
                     FPATPIFVDFGSLGVSMFFVSCIVSQLVFSLGGSIFPGGNGSMMIEAVPFFHILINTF
                     EQVCGDDDKAIIATTMVAFAFSSILTGLVFFALGAFKLGSLIGYFPRHILVGCIGGVG
                     VFLIETGLEVSRGLKEEGFEYNLATLKLFFESGHAIALWTIPLALAILLRVITHFWHH
                     QLIFPAYFFIIPVIFYIVIAIGRWDLQHLRKMGWVFDVGTNTQAWWKFYTLFDFRKTN
                     WEAFWAAMPTQLALVFFGILHVPLNVPALGVSLSEDNVKLDRELVAHGASNMLAGLTG
                     TVPNYLTYVNTVLFYRVGGGSRLSGLMLAMGTAAIMMIGPAVIASLPVMVVGALIFVL
                     GIDLLMEAVWDTRHRVNKMEYITIWAIAIGMTVFDFVIGLLFGIILACIFFVVQSSRR
                     RAIRAVFNGATARSTVRRPKWQRSFIQQVGSQTYVMKLQGFLFFGTITTVEDEIRKLL
                     DLAKWQHNPIRFLIIDFALVHGLDFSSAEAFVRVQRLLAAKDVLLIMCGAKSDGLVGT
                     ALQGVGLWADREGTRVEVFESLNDALEWTENVYLTAFLENQQLMDCETTTKVMDFPKI
                     AKPPFSLSESFQNSPRRSHLVKAGGDTIFQTSYASKDDDEPSTPPPEEPLAQPIPVLL
                     QTFGAYSASSVSSISTSFCKSLAPYFTKSSIMPGDTLWMQGDPADGMYIIEVGCLRAT
                     YAYNDTTNLVQETMVAGTMAGDMSALSETTRNCSVVAERESVLWKLSQERLDQMVKEQ
                     PEVAQAFIKMVLKAVAEEQDVLSSHLIAVLS"
     gene            202164..204336
                     /locus_tag="CNA00690"
                     /db_xref="GeneID:3253473"
     mRNA            join(202164..202733,202784..203853,203898..203941,
                     204084..204336)
                     /locus_tag="CNA00690"
                     /product="expressed protein"
                     /transcript_id="XM_024656157.1"
                     /db_xref="GeneID:3253473"
     CDS             join(202638..202733,202784..203446)
                     /locus_tag="CNA00690"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511829.1"
                     /db_xref="GeneID:3253473"
                     /translation="MATVTATMDDLIASLSGNMHVSQEGYDLKALHEFLAQNLPLSFP
                     SPTAYAYPVAPRPPPLSRKPSSLPSYTHPSPTPTSLPLPYTQAPHPPVSYERPQSSQT
                     PAQRPALPRRASSFGTVPHSYAPAASNYQAPEPSYAAFESDAFAPFWQGAVEETGRED
                     PWARIRGAPTGDFGFAAAQEQPQITDGGGKHEYQWGLQLGGCGQSQRKVMAAQSNEDV
                     GMDMDEDEDMEDNELVESMMECGDEDDTWRRDKW"
     gene            complement(204280..206381)
                     /locus_tag="CNA00700"
                     /db_xref="GeneID:3253472"
     mRNA            complement(join(204280..205180,205261..205911,
                     205972..206060,206109..206381))
                     /locus_tag="CNA00700"
                     /product="expressed protein"
                     /transcript_id="XM_024656044.1"
                     /db_xref="GeneID:3253472"
     mRNA            complement(join(204280..205180,205239..205911,
                     205972..206060,206109..206381))
                     /locus_tag="CNA00700"
                     /product="expressed protein"
                     /transcript_id="XM_024656158.1"
                     /db_xref="GeneID:3253472"
     CDS             complement(join(204530..205180,205239..205911,
                     205972..206060,206109..206174))
                     /locus_tag="CNA00700"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511830.1"
                     /db_xref="GeneID:3253472"
                     /translation="MSSASSASGGGLSALVQAYKNNSEAGAQAAVSQSSDQSFGSQTL
                     SQLDKSVRSAFEPGAALVQISFMRSCPDHLVYTNGHIEPVTDPMKRAWVFKNREAFLA
                     NRVIHSLDDQSVLMSDEDYEAVRKLVSAAMVDTGEQASRVIQDYSKALESLEEARRRQ
                     LATSQDSKFALDLSKQPYSMRRQTKPSWPRDDASRAFCSWAWRQVHEEHSRVPGTTVS
                     LSLENSDLDLAPFTTDNGRRLRSRLQESAKLYWNAREIEDECFNSSAMPLKYVHLQSH
                     GYKEDDDSVRFQRTDHHLMHLWRSDVLLTSLATGRSLTADETWSLIPLSLYQDFIQHQ
                     SKSRTNFNERKITRKKPTSFLALNDPEWRSWFQEMVTISHGKKRFLTMSELPTSGHES
                     LFNAVRDIRAGKGKRFIRSRYGEESEPLTIQKYLEDIDPLQRFMDVNKSLVSSSLTDD
                     EVVSRLPPKAYHRWKEISGANEGLSIKEMIRDSYKVERELRE"
     CDS             complement(join(205096..205180,205261..205911,
                     205972..206060,206109..206174))
                     /locus_tag="CNA00700"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514116.1"
                     /db_xref="GeneID:3253472"
                     /translation="MSSASSASGGGLSALVQAYKNNSEAGAQAAVSQSSDQSFGSQTL
                     SQLDKSVRSAFEPGAALVQISFMRSCPDHLVYTNGHIEPVTDPMKRAWVFKNREAFLA
                     NRVIHSLDDQSVLMSDEDYEAVRKLVSAAMVDTGEQASRVIQDYSKALESLEEARRRQ
                     LATSQDSKFALDLSKQPYSMRRQTKPSWPRDDASRAFCSWAWRQVHEEHSRVPGTTVS
                     LSLENSDLDLAPFTTDNGRRLRSRLQESAKLYWNAREIEDECFNSSAMPLKDTRRTTI
                     LFVSNGPITTLCIFGAAMCC"
     gene            complement(206616..210019)
                     /locus_tag="CNA00710"
                     /db_xref="GeneID:3253470"
     mRNA            complement(join(206616..206812,206874..207139,
                     207198..207835,207887..208965,209021..209107,
                     209156..209426,209482..209724,209779..209819,
                     209874..210019))
                     /locus_tag="CNA00710"
                     /product="pre-mRNA splicing factor prp1, putative"
                     /transcript_id="XM_024656159.1"
                     /db_xref="GeneID:3253470"
     CDS             complement(join(206669..206812,206874..207139,
                     207198..207835,207887..208965,209021..209107,
                     209156..209426,209482..209724,209779..209819,
                     209874..209933))
                     /locus_tag="CNA00710"
                     /codon_start=1
                     /product="pre-mRNA splicing factor prp1, putative"
                     /protein_id="XP_024511831.1"
                     /db_xref="GeneID:3253470"
                     /translation="MSNVGTVKHIPKEVRYNFLNMAAPASYVAGLGRGASGFTTRSDI
                     GPARAGPSAEVVAEAQARRGEEEIPDPDAFQDPDDERNLFAGTVYEADDEEADRVWDS
                     VDARMDARRKARRDAAEAKAAAEERARNPKLQTQFADLKRSLSSLNDADWDAIPEAGN
                     LTGKRRKANLRLEENQNGRSYNVSDTVIADAVKRNAMVGELDPAEAGIGIDGTETDLV
                     SIGNARDRVLSLQLDQATRDASNGSSTSIDPKGYMTALNSQIVQTDAQIGDIKQARQL
                     LQNLIQSNPKHAPGWIAAASLEVHAKKMVAARKIIAEGCEKCPKNEDVWFHAAELNTP
                     ENAKVILGRAIQHVPQSVKIWLKAASLETDINAKKRVLRKALEFVPNSVGLWKETVNL
                     EDDPEDARVLLTRAVEVIPNSVELWLTLARLETPENAKQVLNSARKRIPTSHEIWIAA
                     GRLAEQSPSAVAVKPEVKMEDEAEYEAEQRKKLAQQVNKLMAGAVNSLRKNQVILSRE
                     QWLQEAEKCEQDGSPLTAQAIVKATIAQDVEEEDRRSVWIEDAERATKGGFYEVARAC
                     YAVTLEAFPNTPSVWRKAAEFEKAHGTPDAVQEILAQGSQHCPHAEVLWLMAAKEKWV
                     GGDIPGAQAILAEAFKQNEDSESIFLAAAKLAAETGEMEAAIQILEKAKAQADTERVW
                     MKSAVLLRQLGKLDEALSTLEVAIKKFASFDKLHMIRGQIYESRNEVALARNAYAQGC
                     RSCPKSIPLWILSARLEEKAGVTIKARALLEKARLHNPKNDELWAESIKIEERTGSPQ
                     QAKSVLARAMQECPASPLLWSMAIFMETPQQRKGRSVDAIKKAGEHPAVILAVARNFW
                     SERKIEKTRQWMANAITADEDWGDAWGYWLKFERQHGEKERQEAVVEKCIAASPRHGP
                     VWQSVSKDLANVGKSTKEILELVADKLE"
     gene            210135..211342
                     /locus_tag="CNA00720"
                     /db_xref="GeneID:3253480"
     mRNA            join(210135..210250,210305..210652,210703..211342)
                     /locus_tag="CNA00720"
                     /product="nucleotide binding protein, putative"
                     /transcript_id="XM_566489.2"
                     /db_xref="GeneID:3253480"
     CDS             join(210172..210250,210305..210652,210703..211271)
                     /locus_tag="CNA00720"
                     /codon_start=1
                     /product="nucleotide binding protein, putative"
                     /protein_id="XP_566489.1"
                     /db_xref="GeneID:3253480"
                     /translation="MADIIETPVSRRLSTVKNIIIVLSGKGGVGKSSSSVQLALSLLA
                     QSPTNRVGLIDLDITGPSLPRMVGLDTPTATVHQSSAGWVPVYVDQGRRLGVMSIGFL
                     LKDRGDSVVWRGPKKDGMIRQFLSEVRWGDLDYLVIDTPPGTSDEHISLLTHLHPLFT
                     PTMSNATTPTSILISTPQTTALNDTLKSLSFTRKLSLPVMGLVENMAGYVCPCCGEIS
                     DTFGKGGGEAMAHKEGVGFLGRVPIDTVLVSLLDAVSKGEVLGEGAVEHTSDEAAEGQ
                     TNGSTEHFPLLDKYLETTSSKVWKDITQKLVDKIEQHKSDIRARLESSSETLAIA"
     gene            complement(211382..214618)
                     /locus_tag="CNA00730"
                     /db_xref="GeneID:3253897"
     mRNA            complement(join(211382..211561,211613..214065,
                     214119..214618))
                     /locus_tag="CNA00730"
                     /product="plasma membrane protein, putative"
                     /transcript_id="XM_566491.2"
                     /db_xref="GeneID:3253897"
     CDS             complement(join(211496..211561,211613..214065,
                     214119..214530))
                     /locus_tag="CNA00730"
                     /codon_start=1
                     /product="protein complex assembly-related protein,
                     putative"
                     /protein_id="XP_566491.1"
                     /db_xref="GeneID:3253897"
                     /translation="MAASYRGSEEPSPEIPSTQFIPEANDADNLYEAVEIMDERGAPV
                     DGEYLIKWSGTDEYGRPWKPSWEKKSGCTDALIMEWKEKKRRHPTIVGKEGEKLKKLE
                     KQERAPKTKKRKRKSEITVKREPGVTPVKKSRTSVGKVAARSTASVDSPASTSKAGRK
                     SRVSLASISAGTLSESPAPVAGPSRSRSSVNDHEDVSEDSEGSTHATRRGGMTRFRSR
                     ESQIEPNSPEVQRSRAPLLKSLSAKATSPPKSDQRPKKSVTTLSGPKSRESPSQSSLQ
                     RTVIPSHLLSPNSRARNGDKSPLFLPNSSLESNDTVEPSHTIGSAVTSQIEAIERFSS
                     PPFMRHELLARGQEEVRRLAEGGRSGVYRAGDSDDEELQVIAKPPNKGKGRANENIDD
                     DEEVVEADNILSSPNFNLNEFPSSKRPASVARGPSPYGQHPAVVDLENAKKKVTLLEG
                     ELTYSEKARKKAEERPKDFIDPAELSKAKKDIERLKAELKDAQDARISAEDLLAHSGN
                     DEATKISKLREQINGLRERLMAVQAEKGDLEEKLKENPGSKELAEVQKELDEQLKEKK
                     GLELEKESFKLLLSSLNDDLDAVKKELQISNAQNAKLEKKVNDSDSAELVKLRKEIED
                     LRAKLGSVTMEKEELKHQLMNHPDTAELAKVREQVKDFNSVINQALFEKKKLEEYLAN
                     HPDTAALADARSELKSLSSQLEEAKQSLSSSDAEVELLRERIASAERSHKNLVEDNAF
                     MRKQYDEASNRAVAEVQQANLLRDQIKHLTGQLKFGLKQREIFNATVAAQRNDETRKL
                     RAQVKVLLDQSRRTDDDIRHKAQFYKKYKAEYDNIVRTASEQSDKIERLEERVETLVD
                     KLETLRAVKMGAFDVDESEHEEGNRRKTVSPIRFHTPDEGPTAARLPFPDTSADGNVF
                     NVPVQQEAQANGPVIKEGGEGYVCKWRVGDETCQVVCDTVEEIHTHAIAHQRAELEAK
                     GIII"
     gene            215405..218722
                     /locus_tag="CNA00740"
                     /db_xref="GeneID:3253474"
     mRNA            join(215405..215726,215824..215898,215951..216083,
                     216134..216553,216785..216966,217019..217258,
                     217308..217365,217417..218722)
                     /locus_tag="CNA00740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566493.2"
                     /db_xref="GeneID:3253474"
     CDS             join(215432..215726,215824..215898,215951..216083,
                     216134..216553,216785..216966,217019..217258,
                     217308..217365,217417..218590)
                     /locus_tag="CNA00740"
                     /codon_start=1
                     /product="glutamine-tRNA ligase, putative"
                     /protein_id="XP_566493.1"
                     /db_xref="GeneID:3253474"
                     /translation="MPPKFDPNSPENAPLIQLFQSLGLASNSATELVRQPKSGKAFKS
                     LIDEYGLTNNKYDEKQAGALVKLSSVSAKLGSEQKDFLVQKIVKGDVKTPDQVTAAVK
                     FAEKNPDLKANEEAFDKECGVGINITLADLPELLKSYITSLPSPPEGWNSLGPILGGI
                     KGGASDLRWANATEVKSTLESIFVSLFGTKEAAAAAAAAKPKAKAPKAAEKPVKPVST
                     TAAVATKSSSATPAIPTNIFEEGFLSEFHKVGENPQSDPKLKEEHLAWTKGQVYTRFP
                     PEPNGYLHIGHVKAIMVDFGYAKYHGGRTYLRYDDTNPEAEEGRYFQSILETVRWLGF
                     EPWKITYSSDNFDRLYELAVELIRRGKGYVCTCDAEKIKEDRGMGKGNPIPCVHRDRP
                     IEESLHEFERMKNGEYKEKEACMRMKMDLNSGNPYMWDTVAYRVKKAPHHRTGDKWKI
                     YPTYDFTHCLCDSIENITHSLCTIEFIPARESYEWLCDALSVYKARQYEFARLNLQGT
                     FLSKRKIAKLVQNGHVKDWDDPRLYTIIALRRRGIPPGALLSFVSELGVTNIPSTTEI
                     QKFESCVRGYLESSAPRLMMVLNPIKIIIDNVPDDYRVQVEVPLHPKIPAMGTVQTIF
                     TKEVYIDADDFREVDSPDYFRLAPGKSVGLFKAPYPVTCTSFTKDPVTGRVTEVHCTL
                     AGEGFKKPKAYIQWVNAPEAVKIDEVRYFKKLFKSDPPPADYEADVDPDSLEVYSNAV
                     IEPAFYELAKKQISDARKDSEERTKKAVEQAAKPDTSSAPVEGSAAAQHKDEEPVATA
                     EQLVGNENIRFQGMRLAYFTLDRESKLGCLEKEDVKGRSEGDKIILNRIVSLKEDAGK
                     SA"
     gene            complement(218705..219795)
                     /locus_tag="CNA00750"
                     /db_xref="GeneID:3253892"
     mRNA            complement(join(218705..218974,219023..219290,
                     219353..219427,219542..219641,219692..219697,
                     219751..219795))
                     /locus_tag="CNA00750"
                     /product="histone binding protein, putative"
                     /transcript_id="XM_024656160.1"
                     /db_xref="GeneID:3253892"
     CDS             complement(join(218800..218974,219023..219290,
                     219353..219427,219542..219641,219692..219697,
                     219751..219753))
                     /locus_tag="CNA00750"
                     /codon_start=1
                     /product="histone binding protein, putative"
                     /protein_id="XP_024511832.1"
                     /db_xref="GeneID:3253892"
                     /translation="MSIVNIRNIELLNNPAKFDDPYNFRIKFEAIAPLVEDLDWRLIY
                     VGSASSEEFDQELDNCSVGPIPAGINAFDFSAPAPAHHLLPSVEPDEILGVTVIIITA
                     SYREKEFVRVGYYVNTYYEDEELKENPPSVVQWDKLHRNVLIEKPKVTRFQNNWDSAP
                     QLNTFDGQQPAAELPPSGGNPELFNAPLPPPVQRATAAGGMDVDQPMA"
     gene            219997..222388
                     /locus_tag="CNA00760"
                     /db_xref="GeneID:3253468"
     mRNA            join(219997..220499,220550..221319,221375..221549,
                     221601..221818,221867..222388)
                     /locus_tag="CNA00760"
                     /product="tRNA (guanine-N2-)-methyltransferase, putative"
                     /transcript_id="XM_566499.2"
                     /db_xref="GeneID:3253468"
     CDS             join(220020..220499,220550..221319,221375..221549,
                     221601..221818,221867..222290)
                     /locus_tag="CNA00760"
                     /codon_start=1
                     /product="tRNA (guanine-N2-)-methyltransferase, putative"
                     /protein_id="XP_566499.2"
                     /db_xref="GeneID:3253468"
                     /translation="MPRPSFGSRQFIATATRISSRKMTTQPRYTVPLKEPHPDNHSLH
                     TESTTTIFLPNEGAFLNPVQHYNRDMSVAVIRAWNEMRKEELEEKWRIRLERRGGKPR
                     PKKKKNKKATEGEAKAVTIDAEEEKAEKEGTMEVEGNALAEVKEGEEPVAGPSNGAGV
                     SKFRAPSINILEALAATGLRSIRYAKEIPNVKYVLANDLSPSACEAMRRNVEFNGVGM
                     DYEAPVKEEQEPKAEVVEMPRDEANEEIKEGGAVEHVEKKQEVQPEVKDEVGRRPGCR
                     GRVKINEGDACAFMYNHRSAVGPSARVDVVDLDPYGTAAPFLDAAIGCISDGGLLAIT
                     CTDLAVLAGQQYPEKCYSNYGGTNVHAEYTHEAALRLVMHSLASVAARYGRYITPLLS
                     FSIDFYVRLFVRIDTRPEQVKHLASQTGVVFTCQYCQTAVNQPFGKVISKETAKGKEM
                     TAFKTVAGPTAGNGSACEECGGTMHLGGPLWLGPLQDNEFAKRVIKEIESTEKEYKTY
                     NRMLGMLTLASQELPHPWFFTANRIAKSVHAPSLPMNKILSALLNAGYKISRSHCSPG
                     AVKTDAPRSFIYDIMREEAKENPVRMDKIAEGSPARKILAKPITHTIDFTPHPDASLE
                     RQGKETFYQVNPLPNWGPAPRAKSLGEKRKAEVDAENGEGDAVVGGEGVKRIKVVVEE
                     EEMMNA"
     gene            complement(222721..225077)
                     /locus_tag="CNA00770"
                     /db_xref="GeneID:3253465"
     mRNA            complement(join(222721..224637,224694..225077))
                     /locus_tag="CNA00770"
                     /product="expressed protein"
                     /transcript_id="XM_566501.2"
                     /db_xref="GeneID:3253465"
     CDS             complement(join(222853..224637,224694..224954))
                     /locus_tag="CNA00770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566501.1"
                     /db_xref="GeneID:3253465"
                     /translation="MALFPSTRSLIFPQFETYRLRSLDPSTDLSFSPLPQPGATQSRM
                     GYNQQHLSFKEVRSRIGWDHLSVSGRRGVYIDKVWGVVGFVIQDDLTPTFVKLADLPE
                     PISISEQQSEFPSVLPLSSTQWAISTGNGSIYILQSSSPESENFTGEIIARYDLHVDG
                     QSGVEPAPFLLRAHHDLSDSDVRLLLTRSLHPNQGKVGYKSVQSTQFQLLEISLNPSV
                     RNGVDSQPGKLEVKWALQGKDLPVWCAWQEDGWLILGEEEFREKVDESGQEETEDEKS
                     KREREEKIARLGLGASLPADESALVNDKKDESMEVDEARGNPYSWTQDAEYLHLTIPV
                     PDSVSRAVINIGFTSTNFSFTLSQTPSDLSPQLMELLSKPTRQLWTSIDVDASTWTFD
                     SSKHIIEVDLKKIDENTRWPSVFFPAEDDDDAYEEVPETLSASTLAAVRETFNTIKTR
                     GPDEPEMMHPAMPALLREEMDFDLDDGEDFGEGSGAYGELGGGNRVGRDVLVGYVEAG
                     SGKASWSKSTNSVLSVPINGSDGNSIIVKQAVDGLVFRPTTDLSKKPWTHISTNPALA
                     FVISSKHDLRFVRHLITSPTSHDPTSPSAFKKPKIDPEPVQSTVLAFDSGSSSAGQGN
                     VYIYYPATSKTNAQQGVLSISGGERGALLGVGCVKVDGKDVVVALCENELVVLKGVL"
     gene            complement(225482..227010)
                     /locus_tag="CNA00780"
                     /db_xref="GeneID:3253464"
     mRNA            complement(join(225482..225654,225714..225934,
                     225997..226007,226060..226163,226226..226293,
                     226348..226435,226495..226600,226695..226798,
                     226939..227010))
                     /locus_tag="CNA00780"
                     /product="prohibitin PHB1, putative"
                     /transcript_id="XM_566503.1"
                     /db_xref="GeneID:3253464"
     CDS             complement(join(225566..225654,225714..225934,
                     225997..226007,226060..226163,226226..226293,
                     226348..226435,226495..226600,226695..226798,
                     226939..226972))
                     /locus_tag="CNA00780"
                     /codon_start=1
                     /product="prohibitin PHB1, putative"
                     /protein_id="XP_566503.1"
                     /db_xref="GeneID:3253464"
                     /translation="MAAAQRISRLIVPLAIGATVVQSALYDVPGGYRAVLFDRFSGVR
                     PDATGEGTHFLIPWLQRAILYDVRIKPRNISTTTGSKDMQMVSLTLRVMSRPDIEHLS
                     KIYQSLGLDYDERVLPSIGNEVLKATVAQFDASELITNREIVSARIRDDLLNRAKEFN
                     ILLEDVSITHMTFGKEFTSAVEQKQIAQQDAERAKFVVEKAEQERQASVIRAEGQAEA
                     ANTISKALSKAGDAFIQFKKIETSREIANTLSQNKNVSYVPAANGNMLLQVPSQQQ"
     gene            complement(227195..228676)
                     /locus_tag="CNA00790"
                     /db_xref="GeneID:3253462"
     mRNA            complement(join(227195..227516,227569..227781,
                     227835..227912,227973..228165,228243..228344,
                     228394..228676))
                     /locus_tag="CNA00790"
                     /product="exosome complex exonuclease rrp4, putative"
                     /transcript_id="XM_566505.2"
                     /db_xref="GeneID:3253462"
     CDS             complement(join(227301..227516,227569..227781,
                     227835..227912,227973..228165,228243..228344,
                     228394..228587))
                     /locus_tag="CNA00790"
                     /codon_start=1
                     /product="exosome complex exonuclease rrp4, putative"
                     /protein_id="XP_566505.1"
                     /db_xref="GeneID:3253462"
                     /translation="MFSVKAVAPSISQAFTEIVPSTHRKHQAELDAMDLDEDEFGGAG
                     PSKRSIVSPGEVITSSKEYMRGHGTYVEESNVVSSVAGTIERVNKLISVRPLRSRYTP
                     EVGDLVIGRIVEVGAQRWRVDANGRQDAVLMLSSVNLPGGVQRRKIESDALKMREFLA
                     EGDLLVAEVQAFFGDGAMSLHTRSLKYGKLRNGFLLTVPPQLIRRLKSHFYHIPPPCG
                     PTGVDVILGLNGYVWVSNGTSQARREGGEGFDSEGVYSNQNDEIPPQGREAISLVANI
                     IKALASEGVPLTETLIGESYAWAEKNVPSGSGPFDSETERKMLNEIVGLEFLEFA"
     gene            228857..231217
                     /locus_tag="CNA00800"
                     /db_xref="GeneID:3253884"
     mRNA            join(228857..228995,229057..229097,229167..229252,
                     229304..229419,229473..229567,229636..229649,
                     229701..229718,229779..229787,229839..230338,
                     230393..230836,230888..231217)
                     /locus_tag="CNA00800"
                     /product="expressed protein"
                     /transcript_id="XM_566507.1"
                     /db_xref="GeneID:3253884"
     CDS             join(228949..228995,229057..229097,229167..229252,
                     229304..229419,229473..229567,229636..229649,
                     229701..229718,229779..229787,229839..230338,
                     230393..230732)
                     /locus_tag="CNA00800"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566507.1"
                     /db_xref="GeneID:3253884"
                     /translation="MAKEPRDLLLLVWVHGFKGNDVTFETFPGRICHLLRATHPSLRV
                     ESRVFPMYQTRGELLAATLAFVDWLTELVVNLENDHGQGGGAGKAKVVLMGHSMGGLL
                     CADTVRDIAANTREGDPMWPRVVGIIAFDTPYLGLHPHTFKHHLTQAASYFDQARSIA
                     STIGMVSPTSFGLGFGNSGKKTESTTSEAGFSKPQPSASTKGKKKETTTTVSDMSTSA
                     EQQAATSKSFWSSLSSVPSPSSKTLYGLGAAALGAAALGTAYYRREDFITGWRWGYDH
                     MTFVKNLWDEDGSRKRLEAIDALVREQNVLYRNYYTHLPVEPPVHLVGRTFAILPPAS
                     HPLFPLWRPATNSLAKDEVSAHMGMFNPKTNDGFYDLGLAVVKEIGERIESEGVGRKE
                     GLEERMDEDGEGVWRIEKDKDGKEIWVEA"
     gene            complement(231631..233980)
                     /locus_tag="CNA00810"
                     /pseudo
                     /db_xref="GeneID:3253847"
     gene            231837..234071
                     /locus_tag="CNA00820"
                     /db_xref="GeneID:3253460"
     mRNA            join(231837..232147,232205..232685,232740..232976,
                     233026..233352,233410..234071)
                     /locus_tag="CNA00820"
                     /product="conserved expressed protein"
                     /transcript_id="XM_566509.2"
                     /db_xref="GeneID:3253460"
     CDS             join(232095..232147,232205..232685,232740..232976,
                     233026..233352,233410..233955)
                     /locus_tag="CNA00820"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_566509.1"
                     /db_xref="GeneID:3253460"
                     /translation="MSGITNKLENKVDKTFFSGGPGTTGREPFEDSTTSGTTGTHSSN
                     TTNPATSLHGGITHDENVRSGMGATGTPDRTTGSTGSYTGTGVGNENIPAPHSSSTGT
                     NVPGTHTGGGAPIGAQGTSFGQTGEQRGVGGVTAGGVTGSGNPTHAGYGSGATTGLDS
                     SRHGQGIGSGTDKHSSTGYGAHESSFAPPISSTTGSGAKVADYGTGSHTSSHHTGAAA
                     TGAAAAGTGAAAYGHHENKHAGSGHTGSHSHDTSGNHGVGTTDSYGSGLPSALDNKQS
                     VGAGARDSRDRTGHLEEGSALYERSTDQGPVTGGAANTDKFDTDKPRNTSGLTGHGTG
                     KTHNYDGTSSRTAPHSGTEDPYKQQSGGAAGIFATSDKDFTSNTDRLGKGAYHDDQGL
                     FKDNTSGPGGRSALTGREGNYEKNPISGVESAGQKHHTGATSGAGTGATGGAAYEAEK
                     AENKLAGSHSTTGAYDTPTSSHGIAGRDGTTATTGQSGYGTGDRTGTYNETGTTGTHS
                     SSTGESGTAIGGHDTDTGRTTEGTHEKKGIIEKIKEAIH"
     gene            234939..235789
                     /locus_tag="CNA00830"
                     /db_xref="GeneID:3253459"
     mRNA            join(234939..235089,235173..235302,235385..235789)
                     /locus_tag="CNA00830"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_566510.2"
                     /db_xref="GeneID:3253459"
     CDS             join(235007..235089,235173..235302,235385..235525)
                     /locus_tag="CNA00830"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_566510.1"
                     /db_xref="GeneID:3253459"
                     /translation="MSAPLGNAAAQQTTSKFQAFLNHPAGPKTIFFWAPIAKWGLVLA
                     GVKDLSRPAEKLSVSQNVALAATGFIWVRYSFVITPVNYSLAAVNFFVGSTGVAQLYR
                     VWDYRRKNPGAVSSA"
     gene            complement(235743..238683)
                     /locus_tag="CNA00840"
                     /db_xref="GeneID:3253883"
     mRNA            complement(join(235743..236085,236146..236297,
                     236350..236413,236474..236680,236739..236766,
                     236828..236920,236980..237210,237265..237581,
                     237645..238154,238232..238683))
                     /locus_tag="CNA00840"
                     /product="conserved expressed protein"
                     /transcript_id="XM_024656161.1"
                     /db_xref="GeneID:3253883"
     CDS             complement(join(235852..236085,236146..236297,
                     236350..236413,236474..236680,236739..236766,
                     236828..236920,236980..237210,237265..237581,
                     237645..238154,238232..238630))
                     /locus_tag="CNA00840"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_024511834.1"
                     /db_xref="GeneID:3253883"
                     /translation="MSNSPTAEPIPPAPPAAQQPVEAHEIPVPDAPSTTIPTAPLDNP
                     EAQTQAPTASIDPNKPSKESAPTALPTNPATHPEEQKEAIKEEHPQVIKREVEKTKAE
                     ERDLKGEKPQGTVVAGLEDDRLWAMLRRFDVQITHVLHPARNLPAAEPDLRPSTLPNL
                     PSHTDVLRSNLERCIAAVGPSSLRGARELQRLMSWSPEERWRTGTYCVVYFTAWIFGY
                     AVAAIMIFLSILVCFPRTRRFLFPPVPPAPFTPPSATDPTNQKGDESLLGNIDGKTVH
                     RTKAEQAEEQAFEATSILKAFTTRLLFDGKKKGKEAGNSNVGEKEEEPESSSSEDEAA
                     VETAPVDGKPQGLESADIVIGGEKITPAEPLNDKEKKKLAQREAKRKRDEMVSKMTKL
                     SEDGLGTVADSIERFANALSPPGPYPDNFARFKIAGAFLIPPAFLLTFVPAWVFGRLA
                     TLGFGVGMWGQPLIIKGINKFVEVVPNWQELLDMRNSILSRVPTDTQLTLHLLRVTEA
                     LGKPLPRPPPPPLSGTPKEAIKDTTPAAVTADDDAEVLEAAQEGATAEVAAKTKHKTK
                     SHITGVFKSAGKHMAGFRGDVKVDGARKQIGDKVDKVLFRGNIKDDGNIDSYPAKLNG
                     TSGHIIIDSREEGISMPTISFVPVSGTKAHFVRPVDDIVEIKKSHVSMPRMALGWASG
                     ADVEGLGLTIRFKSGVQQAKEFAAGPDAPKDDGETMHFRRVGRREGLFTRLISIGRQR
                     WEVL"
     gene            239200..240716
                     /locus_tag="CNA00850"
                     /db_xref="GeneID:3253458"
     mRNA            join(239200..239361,239419..239620,239674..239960,
                     240022..240337,240388..240716)
                     /locus_tag="CNA00850"
                     /product="expressed protein"
                     /transcript_id="XM_566512.1"
                     /db_xref="GeneID:3253458"
     CDS             join(239289..239361,239419..239620,239674..239960,
                     240022..240337,240388..240589)
                     /locus_tag="CNA00850"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_566512.1"
                     /db_xref="GeneID:3253458"
                     /translation="MVAPTYDALKLPAHVKTILVTGAGGFVGQQLVKLLLELHPTVKL
                     ITTDIVQPPSHGVTDTNRLKSVKADLGKQEEIDGLLKGETIGGVFALHGIMSGGAEAN
                     FPLGYAVNVDSNLNLLKSMYNHSLSLPADAPRPLYVFVSSLAVYGGPKCKPTDYVVPK
                     DTPIIPGSSYGVQKTIVELYVYDYGRKGYLDTRSVRLPTVAIRPGAPSSAASSFISGL
                     IREPLQGMEAICPIAESIDDPALDNMPFWCSRTKTVVRNIAYAMCMPESNFKEGEGRS
                     INIPGIKISPRQIIDALIEHGGKDKFNLIKFQKDQAVINICKTWAGEYDNSDFLAMGF
                     EADDPKTGFALAVQDFKDELTASQK"
     gene            complement(<240740..244567)
                     /locus_tag="CNA00860"
                     /db_xref="GeneID:3253457"
     mRNA            complement(join(<240740..241497,241554..242114,
                     242173..242459,242544..242780,242835..244104,
                     244153..244567))
                     /locus_tag="CNA00860"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_566513.2"
                     /db_xref="GeneID:3253457"
     CDS             complement(join(240740..241497,241554..242114,
                     242173..242459,242544..242780,242835..244104,
                     244153..244534))
                     /locus_tag="CNA00860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566513.2"
                     /db_xref="GeneID:3253457"
                     /translation="MPRSPTPSGHQGSPTLKQILKAADILLKPPKALPSNPPELLPRL
                     RACSKALPKEWRRIIPEWSEDDEMDHVGDNDGSDISEERKKKRRDELVFVVGKRCFAM
                     AKAMQSWLEKEFWPKEQRDGLEDKDFLLGTADLRLIRLMLSHTTFSYLLPLTVQYAES
                     LPIIPAETANALAQVLEATLKLLKVATPPAPDAGPSSRMPTSPTAITQSLLSSHLIPV
                     FLSTLILAYTPSIPAEHYGLLRMAFLQALMSLTPGHAISSLVNVLKLLVQGRRENAKV
                     NGWVREWPKYPEGIINGLLTAQVRRPGGVRGLMENVLGDTARTDDVTSIEGKRLDHIF
                     NVLVRIPRQVTPEIYYPWLLSELFSMIPLDESSSHHPVAYVNTACYCIQRLWRSNPSI
                     GEWLKNKLHSPWYPKSLFAPADGPAIEVTSWLAIQRSVQNIRLLLIHNPASPDFVEFL
                     VGSILPPLFSLHTFLFFSSQAPNPVLIRPVGSLDASRSRSLADDVSFILTSWGKTVEK
                     DVGVIGLWSLVDAGKGWKPDENGVVPEFFWERQGDGVRLMSGSQGIPDITPEIVFPSL
                     NRDELDPDAIAQRIRDQTEAMPDPTLLCKLIKDINRPDIACQVILRALHLWRIKSPME
                     KEPSVEAMLHLQLTMKLMTHLGSELFTEPEQLLEWVELTLSGQADCLEDDLIDEEAEE
                     TNQKPLITEVGGEKGKGKKDDDVPPDGNRGLIELACRLLAAEEVKKALSEKDLAILHP
                     ILAHLEVISELSPSSSIRLATREAMLILLSIQASANSSAPTDSKKSSKEAFDKALELI
                     KDKAVPVRAHGLNMLKDLVYQPYYDSSLTPVILNTFMSSIEDDDSFVYLCALKGLNGM
                     VDALGGEVFEKLMDSYAGMAKELRRLNDADEVDKMLRLAEAVDQVIERTGDALGLYAD
                     KIIPVLMSIFPDTSLSTAIRSSALSLLTTCAKVSYISLLPWSTDLTNSAIDLIQIESV
                     AVSPFRPGAIQTVEGPPQPSWKGDKKPRNVQLIEDEQPEQEDEEEERKVPDPWIEDTD
                     PLAYDDSKHPALRRAAIAFLNWVFSVITFKIMSDHSECTGLEAGEILYKEHPAPDTDA
                     DLQEGGIPPGLLERAETVLGYVKSTDEDEVARGHAESAERMLGMLKASIMIRSGGAVE
                     GSGLEDLSESLEKLKVDV"
     gene            244888..246685
                     /locus_tag="CNA00870"
                     /db_xref="GeneID:3253881"
     mRNA            join(244888..245713,245776..246685)
                     /locus_tag="CNA00870"
                     /product="expressed protein"
                     /transcript_id="XM_566514.2"
                     /db_xref="GeneID:3253881"
     CDS             join(244949..245713,245776..246576)
                     /locus_tag="CNA00870"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566514.1"
                     /db_xref="GeneID:3253881"
                     /translation="MPHRPSPKPPSSLPSPSRPQESQIEVLYNTAVQSFVRRDHVKTQ
                     ATLARLLESLKKKRIGPYRTWYKLDGAKPDNENSEAAANDDWMVKTLKLLISSTASLY
                     ADPPNNTTALPELLVSMLPPKSPKEILSYLQHRCMSAYYSKGATAHLLPPQLVSTLIL
                     ASLKLSPQRSALDFAHSMTESWIASLPDSLILSISPTSSYRPKDPIERKRVESAREGY
                     LKVVELFIGEVLSREEEWEMARGFLEGEVVMSSKKKETLYKHLRTLESKASLPSLAPS
                     PSSSLILPSSSDSLSIEEEKESKIRSRLSRSSSTSSSSSSSSEATARPGTSQNGGLLG
                     TGLALGQRMEQLRQIRKAGKDRGEESPRPGSIASQASGSGISESTYRLVHSNFRRNSS
                     SRRGNDVPTSRPDNLHHILQSLLGRLPTSLSTTLQSLSPVVLTVITIPLPLLIIFTII
                     RLRRSRFARQQTTVVGGARGGSRNTVLQVQHRLQRVRTQQRGWWDWVLWYLRWWLAKF
                     AGVWKLGTTITYV"
     gene            complement(246684..249421)
                     /locus_tag="CNA00880"
                     /db_xref="GeneID:3253456"
     mRNA            complement(join(246684..247028,247100..247436,
                     247497..247587,247644..247804,247861..248067,
                     248116..248226,248277..248669,248733..248791,
                     249152..249421))
                     /locus_tag="CNA00880"
                     /product="ITR1, putative"
                     /transcript_id="XM_566515.2"
                     /db_xref="GeneID:3253456"
     CDS             complement(join(246911..247028,247100..247436,
                     247497..247587,247644..247804,247861..248067,
                     248116..248226,248277..248669,248733..248791,
                     249152..249378))
                     /locus_tag="CNA00880"
                     /codon_start=1
                     /product="ITR1, putative"
                     /protein_id="XP_566515.1"
                     /db_xref="GeneID:3253456"
                     /translation="MSAGPAQPNIYAPIRTSHSGYPSPTHSGSSTPASLEFSDGRLPE
                     SNVERDMSKVAERVALLGEVDDGAVIVEGEDKITKFVWTLVLAAAISGLLFGYDTAAI
                     SGMLVIIKDDLGTILSSWQKEAITSATTLGALLGGLAAGCISDFTGRRLVIVFANVAF
                     IGGSICQAACHTVAVMIAGRFIVGLGVGLASCIVPLYIGELAPTMIRGRLVTINCVAI
                     TLGQVVAYAIGASFQNAHNGWRWIVGLGAMPSFVQLASIGFLPESPRILLLRSDVAGA
                     RAITAKIYPLAKVEQVDRKVEIMKAAVDQSIEYNANSTWFERLKSLVMVGTNRRALII
                     GCGLQAAQQLCGFNTLMYYSATIFAMLGFKNATAVGLIVATVNVLFTLVALKIVDPVG
                     RRRTMLFTLPIMTLALVLAAIFFYYLTLSTNGILIEDHDYPRSLSIPVLLSMLLYVAG
                     YATGLGNIPWQQGELFRLEVRGIGTSICTAVNWSCNMLIASTFLSLMDAATPSGAFGI
                     YAGFCVIGWLFCWMLYPETSGLSLEEVYFVFEEGFGIEKSQQLRKQKLEESAKLKAIF
                     E"
     gene            250461..251820
                     /locus_tag="CNA00890"
                     /db_xref="GeneID:3253455"
     mRNA            join(250461..250656,250706..250847,250898..250969,
                     251026..251443,251507..251820)
                     /locus_tag="CNA00890"
                     /product="palmitoyl-protein thioesterase, putative"
                     /transcript_id="XM_566516.2"
                     /db_xref="GeneID:3253455"
     CDS             join(250535..250656,250706..250847,250898..250969,
                     251026..251443,251507..251739)
                     /locus_tag="CNA00890"
                     /codon_start=1
                     /product="palmitoyl-protein thioesterase, putative"
                     /protein_id="XP_566516.1"
                     /db_xref="GeneID:3253455"
                     /translation="MRLRFTFTLALLFSNWTLAAPASDQLVLSNSNAKPRPLVIWHGL
                     GDTALSTGIENFINMTQTIHPGIFVHSVQIPEGGRPDDERKAGFWGNAGEQGEEGCEQ
                     IKRIPELAEGFDGIGFSQGGLLLRHYIQYCNGPPVHNLITFGTPHYGISALIPCPTPP
                     TLSCLLAARAARAGIYRPWAQDHLVQAAYFRDTERLDEFYEVNEFLRDLNGERPFAER
                     NSIEEINRRKGKRGEGKGLKGLDNLVAIIFDEDRTVSPAQSSHFATYAPNNKTEIIPL
                     HEQPLYKEDWIGLKGLDEKGGLRLEHCPGEHMDLGGKRGCGESMVRKWVGWV"
     gene            complement(251782..254743)
                     /locus_tag="CNA00900"
                     /db_xref="GeneID:3253453"
     mRNA            complement(join(251782..252541,252599..252900,
                     252968..253136,253187..254280,254336..254558,
                     254612..254743))
                     /locus_tag="CNA00900"
                     /product="ATP dependent DNA helicase, putative"
                     /transcript_id="XM_566517.2"
                     /db_xref="GeneID:3253453"
     CDS             complement(join(251858..252541,252599..252900,
                     252968..253136,253187..254280,254336..254558,
                     254612..254710))
                     /locus_tag="CNA00900"
                     /codon_start=1
                     /product="ATP dependent DNA helicase, putative"
                     /protein_id="XP_566517.2"
                     /db_xref="GeneID:3253453"
                     /translation="MADQQLSQGNLPVFIDDLIADRTRQFVEFLDDETQAAYNYRESI
                     KRMLDDEQVRLIVDINHIRSYERSYADGLLLQPMEYVPALDAALMQLVQSLHNPTKHK
                     IEDKQFYVGLIGSFGQQHCNPRTLRSHQIGKMVSLEGIVTRCSLVRPKMLRSVHWSPR
                     TQKFHARTYNDSTIIAPSANLTGTTTVIPKDDGDGHPLLMEYGLSTFRDYQTIGIQEM
                     PERAPAGQLPRSIEVVLADDLVDCCKPGDRIQLVGVYKSSGGGAGARGFITSIIANNI
                     ILLSSKQGGGIAQTPLTDTDIRNINTQARRKNVFQLLSQSLAPSIFGHDYIKKAVLLL
                     LLGGEEKNLDNGGHIRGDINILMVGDPSTAKSQMLRFVLNTAPLAIATTGRGSSGVGL
                     TAAVTTDKDTGERRLEAGAMVLADRGVVCIDEFDKMSEIDRVAIHEVMEQQTVTIAKA
                     GIHTSLNARCSVVAAANPIYGQYDVHKDPHRNIALPDSLLSRFDLLFVVTDDTDEQRD
                     RMISEHVLRMHRYIQPGAEEGAPPIENLEQNLDVGGDAVESRISETPVFEKFNPLLHS
                     GVTTTSGRGANKKKEVLSIAFVKKYIQYAKSRIHPVLTKGAADWIVNVYSSLRNDDMA
                     ANQKRTSPLTARTLETLIRLSTAHAKSRLSTRVDERDAMAAEEILRFALFKEVVRPER
                     RKRRKINHAGQSVEVDSDEDEEGEEELQAGVERMSMNGDVGVTESQRERAREKNRRVE
                     RQAAGPVPEDDEDFEMREAEESLALQEAPRSPPTAPEVAVELSNERLDLFRSKLSHVF
                     EESLDDNGAIEFVELMPKINEGMAEGEVFSVGEMKQALVRMDEKSEVMFGEDQTIYKI
                     "
     gene            254915..257137
                     /locus_tag="CNA00910"
                     /db_xref="GeneID:3253452"
     mRNA            join(254915..254966,255015..255194,255241..255648,
                     255697..256006,256056..256787,256839..256900,
                     256964..257137)
                     /locus_tag="CNA00910"
                     /product="chaperone, putative"
                     /transcript_id="XM_566518.2"
                     /db_xref="GeneID:3253452"
     CDS             join(254958..254966,255015..255194,255241..255648,
                     255697..256006,256056..256787,256839..256900,
                     256964..257017)
                     /locus_tag="CNA00910"
                     /codon_start=1
                     /product="chaperone, putative"
                     /protein_id="XP_566518.1"
                     /db_xref="GeneID:3253452"
                     /translation="MSDAVALKAEANKAFAAKDYTTAAKLYSDAIALDPSNHVLYSNR
                     SATKAGLKDYEGALEDAEKTIELDPSFSKGYARKGAALHGLRRFPDAVMAYESGLQAE
                     PNNAACVKGLSEVKRAMDTDSSSPFAPGGDMGLGKIFSDPSMISKLENHPKTSALMKD
                     ATFRANMLQLQASGGRNMSTLMGDPRTLTALGVLMGIDIDAMERPEGSNEYPPSSSSA
                     PEPTPAPAPKAEEPKKQPAPVPEPEAEPMEVEEDEEAKAKKEAEEFKAQGNTSYKARK
                     FDEAIEFYSKAWDLYPKDVTFLTNLSAVYFEQGEYQKCIETCEKAVEEGRDLRADYKV
                     FAKAYGRIGSSYSKLGDLAQAIKFFQKSLTEHRTPDILTKLREAEKAKAEADRQAYID
                     PEKAEKAREEGNEAFKKGDFAGAQKHYSEAIKRLPTDPRAYNNRAACYTKLLALPEAL
                     KDAETAISIDPTFIKAYIRKALVQEGMKEYTAALETLQKATEADVEKKHTRELETNMM
                     KVMNEIQQQRSSETEEETYARAMRDPEVAEIMNDPIMRQILSDAQQNPRALNDHMKNP
                     MIAQKIQKLINAGIIRTR"
     gene            complement(257479..258572)
                     /locus_tag="CNA00920"
                     /db_xref="GeneID:3253451"
     mRNA            complement(join(257479..258163,258210..258344,
                     258397..258422,258467..258572))
                     /locus_tag="CNA00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_566519.2"
                     /db_xref="GeneID:3253451"
     CDS             complement(join(257594..258163,258210..258344,
                     258397..258422,258467..258539))
                     /locus_tag="CNA00920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566519.1"
                     /db_xref="GeneID:3253451"
                     /translation="MRINFSPQRAAIFTSFLGLLDIKLGAEIILLFGLINKVAGLYGL
                     ITIFVGGSFAQLLYYAYSVGTLFAFLWGLRVVKSESSAPTLLLSHLYALDHLIVSLFH
                     YIFYLHYWYTVPHDGRRTINSQAQQDLINLALSRGEISEPTDEGGQGADDLRMALAGE
                     IWERERGFAVWTLVAGWILKIYFILVLYSYAAHLASSTYHTLPLTARGKATKLAHPDP
                     GQGASSPRIPGESEDDIELRRAEQAARDGPSKKGKGKRTEGDDEDFSWE"
     gene            complement(258825..260533)
                     /locus_tag="CNA00930"
                     /db_xref="GeneID:3253874"
     mRNA            complement(join(258825..259241,259311..259716,
                     259793..259912,260002..260257,260314..260379,
                     260430..260533))
                     /locus_tag="CNA00930"
                     /product="pelota, putative"
                     /transcript_id="XM_566520.2"
                     /db_xref="GeneID:3253874"
     CDS             complement(join(258881..259241,259311..259716,
                     259793..259912,260002..260257,260314..260379,
                     260430..260468))
                     /locus_tag="CNA00930"
                     /codon_start=1
                     /product="pelota, putative"
                     /protein_id="XP_566520.1"
                     /db_xref="GeneID:3253874"
                     /translation="MKLINKHIEKDGSGYVTLRPEDDEDMWHVYNLISEGDRVRAMAV
                     RRVQTVSSTGSSDSYRVRTNLTLEVTKTTFSPAASSSQGNGQGEKKEPTASLQISGKV
                     VEENEFVKMGAYHTLDLEANRDFRLTKETGWDSVALERIQESTQEGRGAEVGAIVCGE
                     GTAALCLLSEHMTVIRQRIDMPVPRKRKGGTSGHDKAVENFLSTVYQAILRLIPFQTL
                     KAIVIASPGFTRDALYEYIFQQATLQSNKPLLASRSKWIKVHSTTSHVHGLVEALKAP
                     EVAKMLAGAKFAKEGLGLDKFHKMLATDELRAWYGPEHVALAVDRGAVGTLLISDDLF
                     RSSDPATRTHYVKMVESVRAVGGEVLIFSSMHESGQQLNMLTGIAAILTYPLDIEVVE
                     MEEKEEKERIEREKAEKELAEES"
     gene            260668..261708
                     /locus_tag="CNA00940"
                     /db_xref="GeneID:3253872"
     mRNA            join(260668..260836,260902..260969,261095..261279,
                     261341..261708)
                     /locus_tag="CNA00940"
                     /product="expressed protein"
                     /transcript_id="XM_566521.2"
                     /db_xref="GeneID:3253872"
     CDS             join(260704..260836,260902..260969,261095..261279,
                     261341..261647)
                     /locus_tag="CNA00940"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566521.1"
                     /db_xref="GeneID:3253872"
                     /translation="MSIPTTSTPTSGSSPTSSPINRWIPSNPFDLPETRELIAQKVAM
                     GEITDHDVAIMEKGYKWMIYTPPATAISFTFLIWQLMKKQYPRPRMITRLFWGGLSAG
                     AGGLLGFGAAGVAAAMEVEDKVEDVERKSRVFEEITEHSHALQESRLALSRPAPPLAV
                     TSPSLTPAMRQAANRGDSRLPRDFEFPNETEEERKERERRMLEGLKLGKERVEEETKG
                     TLGWVKGLFGSK"
     gene            262344..266298
                     /locus_tag="CNA00950"
                     /db_xref="GeneID:3253871"
     mRNA            join(262344..263122,263172..264376,264433..265446,
                     265514..265983,266051..266298)
                     /locus_tag="CNA00950"
                     /product="mRNA export factor elf1, putative"
                     /transcript_id="XM_566522.2"
                     /db_xref="GeneID:3253871"
     CDS             join(262541..263122,263172..264376,264433..265446,
                     265514..265983,266051..266082)
                     /locus_tag="CNA00950"
                     /codon_start=1
                     /product="mRNA export factor elf1, putative"
                     /protein_id="XP_566522.1"
                     /db_xref="GeneID:3253871"
                     /translation="MSPVVAPSTALPPSTHLEKLTALANAPSNVEAKSIADGIALDLK
                     KAPRTLDALQDARIVDVVLAWASSKSGYERESSVVLVERICRSLGSGIEGVFLPLIPA
                     ILNLAMDKGQPVRSAVNSAMTSLIKATAPEGARKVFEVLTRVLEETKGWRTKIAALKA
                     MEGLVKPGAEDYVANELGTVIPVVEHAMHDTKAEVSTAARKAATTLCGILPNADVLKH
                     VNLLVSAMASPAAVPSTIKGLSSTTFVAEVNGPTLAVMVPLLTRALKERSTDTQRMTC
                     VVIGNLVKLVRDPTVAARYLGPLFGGVQQIATGAAFPEIRAFAQTALDILIGAGASAS
                     ATPLPPRDVILSVTEALTVMAPHLQIPGFPAHPSIPLSASLPNSPVIAHAVEYQANVV
                     ADLVDLRRWDAYIWEGKALGSFMKLLQGAEEGAKATAEIRKAFMDIDKAKYSPPEEDD
                     GSEGQLLCDIQFSLAYGGLLLLNHTNLKLRRGRRYGICAANGAGKSTLMKAIRDGKVE
                     GFPPQEELRTIMVEHALQGEDTSMAIIDFIAADPKLTHKTRAEMAAMLLSLGFSEEKQ
                     QDPVASLSGGWKMKLELAKAMLIGADILLLDEPTNHLDVQTVAWLEEYVCSLHDITCM
                     IVSHDSGFLDNVCTDIIHYESKKLVYYPGNLSKFVEKVPSAKSYYTLAATSIKFTFPP
                     PGNLVGVRSNTRAILKLTNCTFTYPGAPRPSIKNASCSLSLSSRVGIVGPNGAGKSTL
                     IKLLTGETVPQEGSVHKHPALRVGYVAQHAFHHINQHLDKTAVQYIQWRYQDGHDREM
                     MEKATRVLTDEDKEMMERPIEGKNGELRKIEYILGRQKLKKSFQYEVKFRGYDHRYNA
                     WIGRDVLIEKGFQKLITQFDDLESSREGAGMRDTGANAVREVLEAVGLDGDIAQYNEM
                     SGLSGGQKVKVVIAASMFNRPQCLFLDEPTNFLDREALGGLAVAIKEWGGAVCIISHS
                     TEFVTALCPEIWHVDGGVLTHQGKVALVEDAFDDPSRPGSRVASKAGTPRTMPSTPGT
                     ATGTATPAESVATDGTVDDVADGLAKLMEKKKKKKKMTRNELKAQEERRRLRKLNWLN
                     YGGEREPDTDDE"
     gene            complement(266334..268023)
                     /locus_tag="CNA00960"
                     /db_xref="GeneID:3253869"
     mRNA            complement(join(266334..266429,266483..266644,
                     266709..267029,267083..267284,267346..267534,
                     267591..267674,267730..268023))
                     /locus_tag="CNA00960"
                     /product="pyridoxal reductase, putative"
                     /transcript_id="XM_024656162.1"
                     /db_xref="GeneID:3253869"
     CDS             complement(join(266421..266429,266483..266644,
                     266709..267029,267083..267284,267346..267534,
                     267591..267674,267730..267872))
                     /locus_tag="CNA00960"
                     /codon_start=1
                     /product="pyridoxal reductase, putative"
                     /protein_id="XP_024511835.1"
                     /db_xref="GeneID:3253869"
                     /translation="MHKESFNHRPRNEDHYHHIQAILTYFGTMSATTSPTTLVAGKTV
                     GRLGYGLMGLSSWNLLVDPVPFPQEDAFAAMKTAVDSGANCWSTATFYGPPTDPTANL
                     KLIRAFFDKYPEYISKVVLIVKGGMDVRSRSPAKGDDIEFFRNEIEQVKAILGDKELD
                     VYSLARIGGTAVETTFTNMAQLIKEGAVKAIGVSEMSAASLEKAHKICPISINEIEVS
                     LFSYEPSIRDSVAWCTAHSVPILAYSPLGRGQLTRRYRSLEDIPAGDFRTMFPRFQGQ
                     AFYDNQKLVDQVEEIAKKKGVTAGQLSLAWVLAQSEFAIPIPGSRNVDRVRENASATD
                     VKLNNEEVEALNKLASAFEVQGARYPEMFQKDLMK"
     gene            complement(268410..273413)
                     /locus_tag="CNA00970"
                     /db_xref="GeneID:3253866"
     mRNA            complement(join(268410..269018,269072..269177,
                     269236..269385,269448..269790,269848..270461,
                     270518..270958,271014..271189,271247..271434,
                     271494..271609,271665..271716,271770..272244,
                     272298..273413))
                     /locus_tag="CNA00970"
                     /product="two-component sensor molecule, putative"
                     /transcript_id="XM_566525.2"
                     /db_xref="GeneID:3253866"
     CDS             complement(join(268830..269018,269072..269177,
                     269236..269385,269448..269790,269848..270461,
                     270518..270958,271014..271189,271247..271434,
                     271494..271609,271665..271716,271770..272244,
                     272298..273083))
                     /locus_tag="CNA00970"
                     /codon_start=1
                     /product="two-component sensor molecule, putative"
                     /protein_id="XP_566525.1"
                     /db_xref="GeneID:3253866"
                     /translation="MPAEDVDNATLAPATPLAIAMQSNDQIKANTKANSKSRTRFAPS
                     RLSSVWRSLVSHLTPPSHPSTTSESALGSSLRNTTDNMYYEDGSAVRHLPLELLNPKV
                     GTDSRHKRKGVSDTKNSGSRGGLRHRLRGSQANSNSRYGDDDDMSAKPSEPVSRIVVD
                     NNFEHFTPAVPRSDSGYGSGRTPATNGTPGGGEIGDDEDEEGTRGQRSDGASTTQRRS
                     SAAAQWIQKNVVVEWVTDRLWPNVKHFLDSSYPEPSKEHSFQKELWFTQKQGALASSL
                     FFLINYALTVGLLPRPFSNFDWIAYLGIGGVFTLPILPLIVLDWPRRHPRIWQPIIFL
                     ACWVFAYILIVEMHLCGFFTDNNQCGSRNFLNLLGFAFGQPTLALLTMKEDRGMAVAG
                     ASIWIILTGGLTMTQKNSPTLFYRNIVFFALFHAFLIGASFLKERSDRQMFALRQQLK
                     IQYRATQSAQVMERRAADSKKRFVSYIFHEVRVPLNTALLAVQNLQGERVFENVQQDQ
                     AEMVDGLISSLSMMEKVLNDVLSFNRMESGKFAQARKPFDFHKSIQLVALSHRTQAQM
                     AGISLEVELDSDIDKIGGIFVGDEMRLRQVASNLVSNSIKFTDQGSVRIVTKLLYPRL
                     EPTPATEPDDPLRQAAINLQRQQEIEESEKARSGTPTRSFPANPHSLPSHPRSRPDSA
                     KGTHGHTLMDLEKGSVTMEQKRMSRESGRDKEKEEEKKKVQKAVVRVEIHDTGVGLKK
                     TDVMDGDLFSPYVQTEIGRRQGGKGSGLGLALVRQIVKLSGGRLGVESEFGKGSMFWF
                     ELPYSLPPPPKARPGSSKGDRMGGIGIGGGAPGVSHPVASGSGGKPAFGLVMPLSSSS
                     NSTFVPLSLNTGIPHGPNLGVMGTDAASAGEGVGGDDERGPPKRPGTMVRIMSGATMM
                     SSTMEKGTSPTSANSERPAIGTTDSTMPLLPVEPRMSAEEAITAGGVPQSPSTSSHST
                     TQEPFIDPFSPISYTTLRERRSSEWSEEMGRAAASVEKLESERAVTGMGLGMGVGQAA
                     EIKLKTRGMQEQPETKEDPPAEMPLSSLVVDDDKLTRMLMSRMLTRLGHHVTTAENGK
                     IASEMIKDMFENKEGAIKFDIVFLDNQMPLMSGVEVARAVREMNCPIYIVGCTGNALR
                     EDQDEYMAAGADTILTKPIHQKHLIEMIRDARRRVAGETQPRYMDYADESPMSPVHMR
                     DPLPRMS"
     gene            274160..276146
                     /locus_tag="CNA00980"
                     /db_xref="GeneID:3253864"
     mRNA            join(274160..275105,275159..275250,275304..275394,
                     275463..276146)
                     /locus_tag="CNA00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656163.1"
                     /db_xref="GeneID:3253864"
     CDS             join(274231..275105,275159..275250,275304..275394,
                     275463..276075)
                     /locus_tag="CNA00980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511837.1"
                     /db_xref="GeneID:3253864"
                     /translation="MRFPPLLCPRTSPSALRSLRPLPALSSSRPLHTSLAHPNSSQSQ
                     SDLPVDGATDLSHSHFISSASPSSDFNPAQTPNAGQDIAHALKAQWEGKLSPTTSHLF
                     KLIVPLPAPGCQPGQTPTPRPTAFLLHPSQPLSHLSRLISGSLPPPYTHSDISYLALT
                     GSESDVDTHLRNAEKSSDNSSTNENDYAGRDEGGPFLTERKGEGGRWQEVAWSQSTDL
                     SDFIKQSCLNEKFKIVISPERDRDGAQLKGKETELRELVLQVLIPSFASRTHYIRKRL
                     LSLTKDLDTLNKEKRRIDYAAHKGAQRLAVMALGGGVVYWGTIIRFTFFTDAGWDMME
                     PVTWATGFAALLGSAAFLIYHNREVSYSSLLDLSITARQRKLYAEAGLDLEKWTEMVA
                     EAKALRKEIERIAADYDIEWRGELEGLEKVGSREGAGGGSPRVGLPGVEIGEKKEDVR
                     ENVDAKDGSKEGERKEMEEENETKLQGEEGKVETEKIDVDKTIDEASELAEESGEQRS
                     RTKAAQRNGEVMDSSDDDKGSKTRKGEEQESDSVTKGRAAAKKVINEK"
     gene            complement(276115..277791)
                     /locus_tag="CNA00990"
                     /db_xref="GeneID:3253447"
     mRNA            complement(join(276115..276664,276721..277268,
                     277321..277791))
                     /locus_tag="CNA00990"
                     /product="RVB1, putative"
                     /transcript_id="XM_566529.2"
                     /db_xref="GeneID:3253447"
     CDS             complement(join(276170..276664,276721..277268,
                     277321..277732))
                     /locus_tag="CNA00990"
                     /codon_start=1
                     /product="RVB1, putative"
                     /protein_id="XP_566529.1"
                     /db_xref="GeneID:3253447"
                     /translation="MSMAASSSTATVQPSGIITQPPPPSTLREQRIATHSHIKGLGLA
                     DDGTAMSSSQGFIGQILAREALGLHLSLLKGGKYSGRPLLLVGPPGTGKTALALALSQ
                     ELGSKVPFCAMVGSEVYSGEVKKTEVLGSCFRRAIGLRIKETKEVYEGEVTELTPSEA
                     ENPLSGYGKTISHVIVGLKTVKGTKQLRLDPSVYESIQKERVVVGDVIYIEANTGAVK
                     RVGRSDAYASEYDLEAEEYVPLPKGDVHKRKELVQDVTLHDLDMANARPQGGQDIMSV
                     MGQLVKGGRTEVTDKLRREINKVVDRYIEQGVAELVPGVLFIDEVHMLDMECFTYLNR
                     ALESPMSPYVVLASNRGISTIRGTEYDGVAGSASEGIRAPHGLPVDLLDRCMIVKTQL
                     YTRDEIRRIVEMRCKVEGIAISSEAVDKLADEGERSSLRYALQLLTPAGIVSKNKGKG
                     EVGVADVEELGELFLDAKRSAGVLRSTEDFEKRY"
     gene            277910..278635
                     /locus_tag="CNA01000"
                     /db_xref="GeneID:3253856"
     mRNA            277910..278635
                     /locus_tag="CNA01000"
                     /product="ribosomal protein, putative"
                     /transcript_id="XM_567232.2"
                     /db_xref="GeneID:3253856"
     CDS             278049..278438
                     /locus_tag="CNA01000"
                     /codon_start=1
                     /product="ribosomal protein, putative"
                     /protein_id="XP_567232.1"
                     /db_xref="GeneID:3253856"
                     /translation="MPRLARVLAVPLPPRARLAPLSLPRATLSAPAPAPQSSILSSLR
                     TPTSTFVASRPMALSSPPIPTHILPSLPAFSPLGALRHVAMGAFYQPSQRKRKNKHGF
                     LSRLKGGKNGRKTLLRRLLKGRKFLSH"
     gene            complement(278521..280964)
                     /locus_tag="CNA01010"
                     /db_xref="GeneID:3253445"
     mRNA            complement(join(278521..278889,278940..279056,
                     279105..279228,279276..279640,279694..279763,
                     279820..280469,280521..280964))
                     /locus_tag="CNA01010"
                     /product="expressed protein"
                     /transcript_id="XM_024656164.1"
                     /db_xref="GeneID:3253445"
     CDS             complement(join(278677..278889,278940..279056,
                     279105..279228,279276..279640,279694..279763,
                     279820..280469,280521..280928))
                     /locus_tag="CNA01010"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511839.1"
                     /db_xref="GeneID:3253445"
                     /translation="MSKVASQPANNPPRRPSGGRQPPGPMGGPKETPKHTPQRSQPYA
                     QQQQRAAMSMPPPQGKPIYSHIKSVHQPQRAYPASVSRSQHGAPQQQPPHLRETSRTN
                     MPPPRQTGATMPHKRETWKNQEGDKLEEQFDHLLDSLQVPETVRLKFSTVSPAIKSSI
                     LSSTLTSNPSILSSLGLPLPTSPLQSPKAKKKLSTPLLRKSKSSGELKGDHSTTVNVG
                     GEGFVIVASPRSGEGGIMSPPLQPGGMRGQSLDLGRPSHSSRPSSRLFGHNPSPSLGN
                     KNFAKGLGIAVGEQPEAFISWLSTYKGTDLRMDVARCKKLRMLLRQESTDWVGAFVEM
                     GGYGLIIDKLQDLLDIEWREEQHDDQMLYELLRCIKALSTSEIGKAALRKLYPRPFPA
                     LSVLLFSEKKPGDLASRQLIVELWLFIFELFTPLPQTPNKRPTSIRFDEKANPSPRDV
                     TVFIRSLLVPDLPDPTKDQHEFVTQAHRPRVFKAWVGELSDICRDYFWIMCHASNTLW
                     ALEQVDESLVEKPVAPGGATGGVEFEAMNYVTTHFKLLNAFAARQAKENMDKARQLHY
                     DLMASGMDRILVTFRKASTTYYPCVHLELARYVRLLQEASPNGKLPYLISKMVGPPPE
                     EVTKAQYRSGYAWLPMPSVTSGRI"
     gene            281115..283674
                     /locus_tag="CNA01020"
                     /db_xref="GeneID:3253853"
     mRNA            join(281115..281322,281372..281675,281730..282403,
                     282453..283674)
                     /locus_tag="CNA01020"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_566533.2"
                     /db_xref="GeneID:3253853"
     CDS             join(281127..281322,281372..281675,281730..282403,
                     282453..283564)
                     /locus_tag="CNA01020"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_566533.1"
                     /db_xref="GeneID:3253853"
                     /translation="MSALNLPKPVNTYAGEDELRNPNGVAGVANGQAVQENEDAEEEW
                     VPPKASDKLKIGIIYPPKEIRNIVDKTAIHISKSPTPLLLEEKIREHQKTDPKFAFLN
                     DADPYHQYYRYMIVKSQEDAEDAAKGIVKPQEEKKMEKKDEGPKATEPKPWEFKVDLP
                     GVTAMDLDILRLTALFHARRGRSFLSSLSVKEGRNYQFDFLRPTHSLYGYYNRMVESY
                     QKIMQPPPGLIDGVIKEANDPDWKWHILDEARNRAEWEKTRRKRENERAKEEEEEAKA
                     FAAIDWQDFVTVETIEFTQNDEQLELPPPTSVEKLKSMSMAEKRMAAMVMEETGAGPT
                     GETAPPAEEMEMEEDEEEEEARLQRIKAEQEQARAREVQRAAMEQRGMKIKKDYVPRG
                     IQRTNAVATAICPNCGQSIPENELTEHMRIELLDPKWKEQKKQLELRRAQAQQLQQGA
                     DVVSSLKNLASARTDIFGDDVDEAERKRREEEERQKRREREKIVWDGHTASAAKTAET
                     FQSQFSLDEQIKKLHNRAGLTDQPSNAPGPQIGPGITQQAHVPTPLAAGLSTPGGGTA
                     YAGATISAAPTGPTTKEYISTPYDPSFGGTPPPPPGSAPSIHPSRLAAMGGNTPYLGS
                     ATPPMAGQVHPRAEDEGAGDRPVFKRPKIEKLPYGQLYTEIDWQSLHPEPISIAVQLP
                     SMPEKPEWKLDGSIITVPDLPVSTLFSTIRERIRRILDTDVPISRMRLDYNNKPMSNS
                     STLASVNLDEGDMLSLVVKKK"
     gene            complement(283586..285691)
                     /locus_tag="CNA01030"
                     /db_xref="GeneID:3253850"
     mRNA            complement(join(283587..285171,285218..285691))
                     /locus_tag="CNA01030"
                     /product="transcription regulator, putative"
                     /transcript_id="XM_566535.2"
                     /db_xref="GeneID:3253850"
     CDS             complement(join(283616..285171,285218..285518))
                     /locus_tag="CNA01030"
                     /codon_start=1
                     /product="transcription regulator, putative"
                     /protein_id="XP_566535.1"
                     /db_xref="GeneID:3253850"
                     /translation="MSLENRLSPPLSRSETPALGTVGTVLDNATASLPLPNQNFPGEG
                     LAGPGPSTTENHTKKVIREDVERRQYARMGTIMPGTGDGLGIGEECFSWTDIPNVKNF
                     RYHPCALSPTPSPHPVFPFYRTIPYPPPIPPVHLSLLDRSSYLRISPSLLTIYNDRGF
                     RSCRTNVSVREGTWYYEVHIDRGDGEQGARRGAGGEGGNPHVRLGWGRREANLDTPVG
                     CDAYSYAIRDVGGEKVHISRPKPYANKGFRTGDIVGCLISLPRRPSLEDKPVSDPARI
                     KRQRRAFNYKSQAYFESAEYTPSKEMDALIDRDGKLAAAAKVESQAQEINGGDMPKKQ
                     MGATTKNTKKGKKQPEKAHEPVARKLEKLSSSSISFFINGESFGEAFTDLYDFTPLPS
                     LYPPVGGHGKKHHPGDEVLHDDGTLGYYPMVSCFGRAKATCNFGPDFAHPLPEGARPM
                     CERYAEFKEEERLLDEKDEVEDAERLRQILEAEKKMLSKVKPRNQKANSATASGENTP
                     KRKKGPAPKRKREGRDGTEMSTPGVESVRGLTATPAPEAPMSEAGIEWREGTRERSMS
                     VAASLGGQGWGTVKEEISDEREEKKIKKDKEVEVKQENGGNSEDGEFEGINW"
     gene            286052..287327
                     /locus_tag="CNA01040"
                     /db_xref="GeneID:3253442"
     mRNA            join(286052..286293,286347..286527,286583..286634,
                     286679..286957,287021..287327)
                     /locus_tag="CNA01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656165.1"
                     /db_xref="GeneID:3253442"
     CDS             join(286173..286293,286347..286527,286583..286634,
                     286679..286957,287021..287116)
                     /locus_tag="CNA01040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511840.1"
                     /db_xref="GeneID:3253442"
                     /translation="MSTIRQLLDSQSRALMAAGAVVVAAAALWITSDYRDWITFGTGG
                     TPSNPKGYLKMRKFWFKRLFINNDDLTDGSSLPDEGPSYLPGYVTPRRGGRPERMPRT
                     LPHRQKPEAIDAKSKKVLHHLGSKLQSEHPDILNLAPSKTEGGTGDAIYAKEDLPTLN
                     PKAKQVAYEIAHVHPADNSLHVHLSPRDAKMLIEKSWAERFPVHELGPPQWVMVYAPR
                     NKEEVDLVEKIMKAAVGWVTGVTI"
     gene            complement(287322..288903)
                     /locus_tag="CNA01050"
                     /db_xref="GeneID:3253440"
     mRNA            complement(join(287322..287723,287787..287956,
                     288010..288351,288417..288689,288754..288903))
                     /locus_tag="CNA01050"
                     /product="sorbitol dehydrogenase, putative"
                     /transcript_id="XM_566539.2"
                     /db_xref="GeneID:3253440"
     CDS             complement(join(287441..287723,287787..287956,
                     288010..288351,288417..288689,288754..288825))
                     /locus_tag="CNA01050"
                     /codon_start=1
                     /product="sorbitol dehydrogenase, putative"
                     /protein_id="XP_566539.1"
                     /db_xref="GeneID:3253440"
                     /translation="MSTELNPDNTSFVLHGVEDVRFDQRPIPEVHNDQVLIKVVKTGI
                     CGSDVHYLQHGRIGSFVLEEPMCLGHESAGVVVKLGPNVREDLGVEVGTRVAMEPGVC
                     CRSCANCKAGLYELCPYMSFAATPPTIFGTLCRYYVLPADLVHPLPESVSFEDGAMME
                     PLSVGVHSVATLGGCKSDQTVIVFGAGPVGLLCMAVAKALGARRIIAVDINKERLEFA
                     KSYAATDVCIPGSKLDGEDGEAYTARIAGELRQELGIPERGKGAIDLAIEASGAPTCV
                     QIGLAVLKPAGTYVQVGMGAKMTVPVPLFHIISKQLHVVGSFRYGSGDYPLAISLVER
                     GLIDLKPLVTQRFKFENAKEAFETTKVGKDKNGKGVIKCIIDGPE"
     gene            290328..291424
                     /locus_tag="CNA01060"
                     /db_xref="GeneID:3253810"
     mRNA            join(290328..290752,290810..291022,291078..291149,
                     291213..291424)
                     /locus_tag="CNA01060"
                     /product="ribosomal protein S3, putative"
                     /transcript_id="XM_566546.2"
                     /db_xref="GeneID:3253810"
     CDS             join(290397..290752,290810..291022,291078..291149,
                     291213..291330)
                     /locus_tag="CNA01060"
                     /codon_start=1
                     /product="ribosomal protein S3, putative"
                     /protein_id="XP_566546.1"
                     /db_xref="GeneID:3253810"
                     /translation="MSASQIISKRRKFVADGVFQAELNDFFTRELAEEGYAGCEVRVT
                     HARTEIIIRATHTQEVLGDKGRRIRELKALIEKRFKFPENALELYAEKVQYRGLSATA
                     QAESLRYKLLGGLAMRRACYGVLRFVMESGAKGCEVVVSGKLRAARAKSMKFTEGFMV
                     HSGQPARDFIDYAVRHVLLRQGVLGIKVKIMKPSDPAGRQGPAKNLPDDVQITEPKAE
                     GVIEIRSDHKNPPVQAIPPAAAPAPEAQAAEAQY"
     gene            complement(291852..294190)
                     /locus_tag="CNA01070"
                     /db_xref="GeneID:3253747"
     mRNA            complement(join(291852..292143,292223..292261,
                     292382..292520,292581..292606,292678..292751,
                     292850..293090,293146..293361,293436..293653,
                     293715..294190))
                     /locus_tag="CNA01070"
                     /product="C-14 sterol reductase, putative"
                     /transcript_id="XM_566548.2"
                     /db_xref="GeneID:3253747"
     CDS             complement(join(292138..292143,292223..292261,
                     292382..292520,292581..292606,292678..292751,
                     292850..293090,293146..293361,293436..293653,
                     293715..294135))
                     /locus_tag="CNA01070"
                     /codon_start=1
                     /product="C-14 sterol reductase, putative"
                     /protein_id="XP_566548.1"
                     /db_xref="GeneID:3253747"
                     /translation="MDAQEESTTTVITATTHLDLPAHPHIKTYQELNPRSKPTEFFGP
                     CGTGAITLFTPLFTYFFFFACNDAVGCTPTSVQGWKDAFALVGNYPSSAGRLWDWKAA
                     GVYLGWYAFCMICEVVLPGQRVEGNLLRDGRRKVYRMNGLYTLLLALGLLTGVLVQPR
                     GIQAFTWLHDHFVPLISASLAMATFQAVWVYVWSFFSGELLALGGNSGNVVYDFFIGR
                     PLNPTIPGFPSFDLKTFNEVRPGMILWFLLNISCACEQYVRIGKLTDSMWIVLVFEGW
                     YVLDCLLQEHTILNQMDITTDGFGFMLAFGDLTWVPFTYGLQARFLASTPVELGPVAT
                     ALIVGVEVAGMYIFRVANNEKADFRAGKNPKNLEYMQTERGTKLLTSGWWGRSQHPNY
                     FGDWLIALGWCLPTGFNTPLTYFYLVYFVILLLHRQKRDEEACKLKYGKDWDRYCEKV
                     PYKIIPYVY"
     gene            complement(294348..295187)
                     /locus_tag="CNA01080"
                     /db_xref="GeneID:3253816"
     mRNA            complement(join(294348..294598,294702..294777,
                     294850..295187))
                     /locus_tag="CNA01080"
                     /product="expressed protein"
                     /transcript_id="XM_566550.2"
                     /db_xref="GeneID:3253816"
     CDS             complement(join(294432..294598,294702..294777,
                     294850..295089))
                     /locus_tag="CNA01080"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566550.1"
                     /db_xref="GeneID:3253816"
                     /translation="MSLQPQISTYHTSIPSPIPSSPSFNFHLTRMVNTLMIWVGTGLP
                     TDTAGNVAGGVASMGSVEQVDNKLAGDWSVAMPSRGNIPVTATPLFRSGSTDIALPMS
                     QRLAKKFPSNQIHLSLSLPPSLTNQTGQSIDPYASKMMLVMEKKLGKWIEEILLQEKA
                     "
     gene            295221..296041
                     /locus_tag="CNA01090"
                     /db_xref="GeneID:3253786"
     mRNA            join(295221..295606,295667..295817,295876..296041)
                     /locus_tag="CNA01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_566552.2"
                     /db_xref="GeneID:3253786"
     CDS             join(295292..295606,295667..295817,295876..295958)
                     /locus_tag="CNA01090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566552.2"
                     /db_xref="GeneID:3253786"
                     /translation="MADITPPSSQQNTPQRTIDNSLANPDPAAMDVDLDEDLESIASE
                     GSDKISVPSGAERANQVRQAVEADADESGDEGDEEVEAEDEAGAEEKGKVEKKDKAPL
                     GGPTKKRTKRPFKGQSLSTHPHSHAARPRPRTEGPHKADGSLFDSEIVARWNADFGDV
                     LSPSPPCSNTRAAPVPAQAAQS"
     gene            complement(296020..297197)
                     /locus_tag="CNA01095"
                     /db_xref="GeneID:36392652"
     mRNA            complement(join(296020..296459,296540..296831,
                     296900..297197))
                     /locus_tag="CNA01095"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656045.1"
                     /db_xref="GeneID:36392652"
     CDS             complement(join(296131..296459,296540..296831,
                     296900..297115))
                     /locus_tag="CNA01095"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514117.1"
                     /db_xref="GeneID:36392652"
                     /translation="MSLSDLAETPQSGDNTTIPGAISLTVPTNLIMLPAAAGLVGLSI
                     GFIRGGSRARLRFLVENAHRKPKTVQGWYFYTKTRNYRVFFGALKAGGKYALGLGGAT
                     AGFVLVDESVGWAREQVFGPAGEIQGVAQGGPEGSAVKRKAGWRKGEVKWEDGGVAGG
                     LMGLVVGTAYKLPRPLFIRSLVMGIVLGSLTSGMQTVQARIGRMREEEERKAKLTDNQ
                     QLSSPAAEAAATSALVTEEVAPVMSLSEETKPTEEIVVGGVPGEEEPRGWWESVKSWV
                     GA"
     gene            complement(297277..299357)
                     /locus_tag="CNA01100"
                     /db_xref="GeneID:3253699"
     mRNA            complement(join(297277..297615,297673..297692,
                     297748..297787,297854..298026,298091..298184,
                     298240..298274,298363..298546,298602..298672,
                     298729..298885,298948..299044,299107..299203,
                     299275..299357))
                     /locus_tag="CNA01100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567088.2"
                     /db_xref="GeneID:3253699"
     mRNA            complement(join(297277..297615,297673..297692,
                     297748..297787,297854..298026,298091..298184,
                     298240..298274,298363..298546,298602..298672,
                     298729..298885,298948..299044,299107..299357))
                     /locus_tag="CNA01100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656166.1"
                     /db_xref="GeneID:3253699"
     CDS             complement(join(297493..297615,297673..297692,
                     297748..297787,297854..298026,298091..298184,
                     298240..298274,298363..298546,298602..298672,
                     298729..298885,298948..299044,299107..299147))
                     /locus_tag="CNA01100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512024.1"
                     /db_xref="GeneID:3253699"
                     /translation="MGKEKVAVVGSGNWGSAISRIAGINTKKHPDVFDDTRVSVWVYE
                     EEFEGKKLTEIINSEHENRKYLPGVKLEDNVVAVPDLKEAVKDATALVFVTPHQFLGK
                     VLDTLEGNVRKDAKAITLIKGVEVQGDDIHIFADVIEQRLGIPCSALSGANIANEVAR
                     DTFSETTIGYRNKEDGELWLKLFQTPKFKVQLIDDVAGVSLCGALKNIVAVAAGFIDG
                     LGYGSNSKAAIMRIGLLEMKHFCQEFFVDVKEESFLQESAGVSDVITSCLSGRNYKVA
                     AAFVGANKSFDQLEAEMLNGQKLQGIHTAKDVHNFLSAKNRSRAYPLFDKVYQISWEG
                     VPVEQLTEGL"
     CDS             complement(join(297493..297615,297673..297692,
                     297748..297787,297854..298026,298091..298184,
                     298240..298274,298363..298546,298602..298672,
                     298729..298885,298948..299044,299107..299147))
                     /locus_tag="CNA01100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567088.1"
                     /db_xref="GeneID:3253699"
                     /translation="MGKEKVAVVGSGNWGSAISRIAGINTKKHPDVFDDTRVSVWVYE
                     EEFEGKKLTEIINSEHENRKYLPGVKLEDNVVAVPDLKEAVKDATALVFVTPHQFLGK
                     VLDTLEGNVRKDAKAITLIKGVEVQGDDIHIFADVIEQRLGIPCSALSGANIANEVAR
                     DTFSETTIGYRNKEDGELWLKLFQTPKFKVQLIDDVAGVSLCGALKNIVAVAAGFIDG
                     LGYGSNSKAAIMRIGLLEMKHFCQEFFVDVKEESFLQESAGVSDVITSCLSGRNYKVA
                     AAFVGANKSFDQLEAEMLNGQKLQGIHTAKDVHNFLSAKNRSRAYPLFDKVYQISWEG
                     VPVEQLTEGL"
     gene            299540..302916
                     /locus_tag="CNA01110"
                     /pseudo
                     /db_xref="GeneID:3253676"
     gene            complement(299868..302849)
                     /locus_tag="CNA01120"
                     /db_xref="GeneID:3253685"
     mRNA            complement(join(299868..300363,300417..300504,
                     300555..300628,300679..301210,301259..301778,
                     301841..301932,301991..302080,302142..302849))
                     /locus_tag="CNA01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_567087.2"
                     /db_xref="GeneID:3253685"
     CDS             complement(join(300178..300363,300417..300504,
                     300555..300628,300679..301210,301259..301778,
                     301841..301932,301991..302080,302142..302245))
                     /locus_tag="CNA01120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567087.1"
                     /db_xref="GeneID:3253685"
                     /translation="MRSHLSLSLLFSSLVAISVVSAASADEWKGKSIYQLFTDRFAPV
                     SDTAPARSSPIPDECDPIDQTWCGGTWLSIIDKLDYISDMGFDAIWISPVSQNIDRDT
                     PYHYAYHGYWVNDPRALNPRFGTADDLKALSKALHDRGMYLMVDIVVNNIPGTTVNDS
                     FSTSDLVADGSIWTDPSEFHPQCWIDYSNQTSVENCWLGDDKLPLMDVNTENEAVVST
                     LQAWISNLTAEYEIDGLRIDAAKHVPGEFWTGFCGAAGVFCMGEVYTDDINFAAKFQT
                     QNWMDSVLGYPLYYGIVDGFGTPNGNMSRFVDIATQVLGTFPTPGLIGNFIENHDLPR
                     WRNTTADSQLAYNAMTVQFIFEGLPVVYYGQEQDFASGAGDPYNRQALWTSEYANTTS
                     YNHIKRLNEIRHAVISNNTLFDGKNFLDSQTKIVASTDYDVAFRKGPLLAVLTNRGSP
                     SQNVGFGVPTSGWPSQSSVVDLLSCKQFTVGSGGAMLVSYSASGYGGMPYVFAAQSDA
                     SAMGICGDAGMSTYVSPNITSAAFPALAPATGLGSALSLPAAVAGALGLMFIL"
     gene            complement(304225..305620)
                     /locus_tag="CNA01130"
                     /db_xref="GeneID:3253619"
     mRNA            complement(join(304225..304619,304687..304808,
                     304875..305620))
                     /locus_tag="CNA01130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656167.1"
                     /db_xref="GeneID:3253619"
     CDS             complement(join(304392..304619,304687..304808,
                     304875..305484))
                     /locus_tag="CNA01130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512025.1"
                     /db_xref="GeneID:3253619"
                     /translation="MTISTVAFLYPGAMGASLARVLAVRLPHLKLLTSLQGRSQATIS
                     RAESCGLTNVPFADLIAQSDIILSILPPSSAVSLAKEVVAHVATEKKPIFVDANAVSP
                     ETAAQISSIFEAKEIPFIDGCIIGFPATEDFSSIPKLYLSASPEREDLMREVTQTLSG
                     GEEGKGMRVRPMEGSGVGGASALKMCYGGINKAVSGLAAAMVLSAQAHSPGTAKAFLD
                     ELSESQPALTKKLSRAIPDMIPKAYRWVGEMEEISSFITSSILQSASITHPNPADMYQ
                     GLAQMFQRVADDVKHSQAGQRGEEVKILLDWAKRGEKELAKKE"
     gene            305835..308275
                     /locus_tag="CNA01140"
                     /db_xref="GeneID:3253812"
     mRNA            join(305835..306452,306495..306575,306625..306741,
                     306798..307029,307082..307186,307235..307927,
                     307983..308111,308166..308275)
                     /locus_tag="CNA01140"
                     /product="expressed protein"
                     /transcript_id="XM_566554.2"
                     /db_xref="GeneID:3253812"
     CDS             join(306161..306452,306495..306575,306625..306741,
                     306798..307029,307082..307186,307235..307927,
                     307983..308111,308166..308172)
                     /locus_tag="CNA01140"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566554.1"
                     /db_xref="GeneID:3253812"
                     /translation="MIPLGSPRRSHILLAALLSLVLVLFLHTHHHPQSHFLSGPISKL
                     KVQFGLYSSSDGLETKDKGIRKRIDKIRGYCEAEDAFEREYGRTNLRLSRAYEGSHER
                     MRLLLQKIMRGEPLTISAIGGSVTKGHQVWQNEIWFHKFWEWLTEFAGEGVEIKQVNG
                     AAPATGSDYFSFCFPLHIPSDSDLVLVELAVNDEGIPEHVENMENLLRGLLDLPNKPA
                     VMLIEAMAFSNGGMGGGGGRMHLPVAQYYDVPVINQRLPLVNHFARHPQLVGPYFAQD
                     WWGNPDTRHINSHGHRDLGMLVASFVKDVACEMISQPTFHVQSPSAFEALSIVALAQP
                     PQTEDKEDAKIEDELLAAEQKWWPEQSRSWRKDPTEEKPVGELMPGLWSTPIEYGILP
                     RLRVLEGWNPHLDYSVPPFHPTCLSTRAKEPHFNLTPSANEGWEYWVHPEHLDKPYLV
                     ARTPGARVTFELETSVGIVKMYALKSKTFGLGTVECWADEERRKSVKIEGYWDNGNVN
                     IGRFAPIRDNLQPGKHTITCELLEETSDPGGGREFRMISMMSV"
     gene            309246..313475
                     /locus_tag="CNA01150"
                     /db_xref="GeneID:3253749"
     mRNA            join(309246..309522,309618..309675,309773..310003,
                     310062..310141,310274..310744,310797..310888,
                     310937..311723,311774..312299,312356..312588,
                     312654..312671,312772..312936,312988..313475)
                     /locus_tag="CNA01150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656168.1"
                     /db_xref="GeneID:3253749"
     CDS             join(310682..310744,310797..310888,310937..311723,
                     311774..312299,312356..312588,312654..312671,
                     312772..312936,312988..313026)
                     /locus_tag="CNA01150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511843.1"
                     /db_xref="GeneID:3253749"
                     /translation="MSSTTNSHLMKTTRWGRPFVKDTHDLFCTLVASLNFDTHRNFFK
                     TYPNSFTTDDACLNLASLKFSQSTRTADPKDPTRIVTTTTTTTFSMSREMAKGICQHF
                     MDCHLVENATDIMAGFFKDRGIYMLTPKGLHILERFVSKNGITTDHLLKLFATQPITM
                     KLLHLERRSGDDEVIITRNVIEVLFRRFVGRIPNLTKLNEDEILAHYYSRFYTKTPSL
                     PAGETLDRSEGIIVRKPGGGEKTTSSDDYIFSARAAVNWMLDFTSATGIDEAAEILAH
                     FVRYGLITLVSDKGKIKEENLIVSARGGGAGGGAGAIMQEAEFRVTERAIYKITKEGI
                     AVAKWNETTTNHAAGASKANLSVETTPGNKARPSHEASPSVSVQRRTSLSDRFRGDFD
                     ISGVPGGDNHIKDSHTARLKQILEEPALRSLFREFLRSNFCEENLSFWLDVQDFKRRF
                     QTTSSAVAAPGSKQAKVSGHAAMEKHQQDLVAMAFVIYNTYLAPASPCELNIDHNLRA
                     ELVGYMNQITSDKEAGVKGHIEPGVGDTLHASQLQTMVKLYERIQVYIFRLMATDSVP
                     KFCKTELFLTLMEQFSEYTKDEFAVTDLETKAAALTVDSRKTTAHVDGRQPSPTRSYL
                     TISQAANEKQAAKQKN"
     gene            complement(313134..314621)
                     /locus_tag="CNA01160"
                     /db_xref="GeneID:3253807"
     mRNA            complement(join(313134..313549,313609..313783,
                     313843..313920,313986..314508,314565..314621))
                     /locus_tag="CNA01160"
                     /product="LSDR, putative"
                     /transcript_id="XM_566558.2"
                     /db_xref="GeneID:3253807"
     CDS             complement(join(313545..313549,313609..313783,
                     313843..313920,313986..314508,314565..314611))
                     /locus_tag="CNA01160"
                     /codon_start=1
                     /product="LSDR, putative"
                     /protein_id="XP_566558.2"
                     /db_xref="GeneID:3253807"
                     /translation="MSYLQDLFGLTGKTALITGATRGIGARMALALAKAGADIILVQR
                     NTSNTATRDDIIAAGGKADIVVCDLGDAASVAKLIPHVTKELGRTLDIVVNCGGIQRR
                     HPVENFPENDWNDVLQVNLNTVFTITRDAGRHMLESRGGVAGEPVPEGGAAGNPRGFG
                     KIINISSLVAYQGGLNVVAYAAAKHGVQGIVKSFSNGWASKGVCVNAIAPGYIATDMN
                     EALIADKDRARQILERIPAGRWGSPEDFEGAIVFLASRASDYVTGECLVVDGGWMAR"
     gene            315050..317059
                     /locus_tag="CNA01170"
                     /db_xref="GeneID:3253745"
     mRNA            join(315050..315340,315397..315885,315947..315981,
                     316034..316301,316350..316498,316551..317059)
                     /locus_tag="CNA01170"
                     /product="conserved expressed protein"
                     /transcript_id="XM_024656169.1"
                     /db_xref="GeneID:3253745"
     CDS             join(315254..315340,315397..315885,315947..315981,
                     316034..316301,316350..316498,316551..316842)
                     /locus_tag="CNA01170"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_024511844.1"
                     /db_xref="GeneID:3253745"
                     /translation="MTAFNSANWGLASEREYVPMTTRESGRPSSRLKSTAIRLLPTVV
                     ILALGILIGSNVPWYLSIYSRRPSGAISLLPRALPPIASSTVTDQLVSLGLPPPEEPI
                     PNVVHYVYGLADDQPDFPYFAYLAMRSALVSLKPDVVYFHCINEPKGYWWERVKNWEG
                     WIDDQGNRRGMMEIKRARDVQWIGTSKRPVVHFAHKADIIRLEVLLQYGGIYLDIDTF
                     VLRSFSSASLLQYDTVLALEAHGLTFLRKPASDDEMRPKGLCNAVIIARRGAEFLKRW
                     LDSYEGFREDKWTEHSVEMPWTLAQMYPTLVTVLSERTFFWPLWTDDHIHAVYATKEY
                     DFEESGQLAYHAWESKAQPYLSALDPSTITQIETSFTRMARRFREPDELRRWLAVGKE
                     DGAGSGTGLVEGDEEANRKRLLQDRTRRGEWGFIKGKGIKVNRESIE"
     gene            318093..322491
                     /locus_tag="CNA01180"
                     /db_xref="GeneID:3253784"
     mRNA            join(318093..318397,318610..319032,319738..319944,
                     320005..320108,320161..320295,320547..320603,
                     320804..320915,320968..321100,321157..321470,
                     321522..322491)
                     /locus_tag="CNA01180"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_566563.2"
                     /db_xref="GeneID:3253784"
     mRNA            join(318093..318397,318610..319032,319738..319944,
                     320005..320108,320161..320295,320804..320915,
                     320968..321100,321157..321470,321522..322491)
                     /locus_tag="CNA01180"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_566562.2"
                     /db_xref="GeneID:3253784"
     CDS             join(319014..319032,319738..319944,320005..320108,
                     320161..320295,320547..320603,320804..320915,
                     320968..321100,321157..321470,321522..322297)
                     /locus_tag="CNA01180"
                     /codon_start=1
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_566563.1"
                     /db_xref="GeneID:3253784"
                     /translation="MLSSFKQILRHGKHAQQASPSPQPDTKNGRSKTTQAQQPLPPAA
                     VQQQPQQPSQPQQQQQHRRKDEYSAKLTTSTTGQNKIPAASPNYREEAEKIVADERAQ
                     SEKMPVYAGLEEFTLIEKMGDGAFSNVYKAIDRRSGQKVAVKVVRKYELNQSQHGNKH
                     LNANFKKRGPRVTERANILKEVQIMRGIDHPSIVKLLKFFESDEHYFLVLELMEGGEL
                     FHQIVKLTYFSEALSRHVILQVAEGIRYLHEERGVVHRDIKPENLLFERIPIIPSRNP
                     VHRPYDEEKEDEGEFQPGIGGGEIGRVKIADFGLSKIVWDEQTMTPCGTVGYTAPEIV
                     KDERYSKSVDMWALGCVLYTLLCGFPPFYDESINVLTEKVARGYYTFLSPWWDDISHS
                     AKDLISHLLCVDPAQRYTIDEFLAHPWIRDAAPPPPPPTSRAVPSESPMYSPLLASIR
                     AGNREARSPGVGALKEAFDVTYAVHRMEEEGARRRAYNGPGGAGQRGFLQGLNEEAEE
                     EDEQAQVEEARRKHGEAVARQIQEHRGRAAANAAAGIKEPPVANYVGRGGANRREAEA
                     VIYDGRAGQRDRGKGGKSAGGFDLDLNNATLLGRRGKKVAPSPLAQQVQAGQ"
     CDS             join(319014..319032,319738..319944,320005..320108,
                     320161..320295,320804..320915,320968..321100,
                     321157..321470,321522..322297)
                     /locus_tag="CNA01180"
                     /codon_start=1
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_566562.1"
                     /db_xref="GeneID:3253784"
                     /translation="MLSSFKQILRHGKHAQQASPSPQPDTKNGRSKTTQAQQPLPPAA
                     VQQQPQQPSQPQQQQQHRRKDEYSAKLTTSTTGQNKIPAASPNYREEAEKIVADERAQ
                     SEKMPVYAGLEEFTLIEKMGDGAFSNVYKAIDRRSGQKVAVKVVRKYELNQSQRANIL
                     KEVQIMRGIDHPSIVKLLKFFESDEHYFLVLELMEGGELFHQIVKLTYFSEALSRHVI
                     LQVAEGIRYLHEERGVVHRDIKPENLLFERIPIIPSRNPVHRPYDEEKEDEGEFQPGI
                     GGGEIGRVKIADFGLSKIVWDEQTMTPCGTVGYTAPEIVKDERYSKSVDMWALGCVLY
                     TLLCGFPPFYDESINVLTEKVARGYYTFLSPWWDDISHSAKDLISHLLCVDPAQRYTI
                     DEFLAHPWIRDAAPPPPPPTSRAVPSESPMYSPLLASIRAGNREARSPGVGALKEAFD
                     VTYAVHRMEEEGARRRAYNGPGGAGQRGFLQGLNEEAEEEDEQAQVEEARRKHGEAVA
                     RQIQEHRGRAAANAAAGIKEPPVANYVGRGGANRREAEAVIYDGRAGQRDRGKGGKSA
                     GGFDLDLNNATLLGRRGKKVAPSPLAQQVQAGQ"
     gene            322732..324656
                     /locus_tag="CNA01190"
                     /db_xref="GeneID:3253714"
     mRNA            join(322732..322878,322964..323047,323112..323140,
                     323199..323294,323346..323460,323529..323581,
                     323649..323714,323784..323893,323980..324120,
                     324196..324262,324337..324656)
                     /locus_tag="CNA01190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656170.1"
                     /db_xref="GeneID:3253714"
     CDS             join(322763..322878,322964..323047,323112..323140,
                     323199..323294,323346..323460,323529..323581,
                     323649..323714,323784..323893,323980..324120,
                     324196..324262,324337..324539)
                     /locus_tag="CNA01190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511846.1"
                     /db_xref="GeneID:3253714"
                     /translation="MFAVRSLPEIQLQRYSTRSPTMMKAFQITELVHPSKVNVSQIEP
                     PKPDAEKGEVLVDVHAAALNFFDILQSQGKYQTKPPLPFILGAELAGTISKSSPIPPG
                     CPYKPGDRVFGITQGAFAEQAVAEWKRLLPVPKNLSLAEASTVPLTATTSYLAIVNRA
                     QAKAGEWVLVHGAAGGVGIAACQIAKSLGCKVIAAASSEAKRQFCKDHGRVDEVVDYT
                     KEGWQNDVKKITGGKGVDVVFDPVGMIVPSLKCVNFNARILVVGFAGGTIEKIPANLL
                     LLKQASAVGVYWGATELREPETAKQISSSVLKLLSTGDIRPIVHSTPYKGVEGVVQGL
                     KDIEERKVWGKGVVIIREEETKAKL"
     gene            complement(324596..328165)
                     /locus_tag="CNA01200"
                     /db_xref="GeneID:3253718"
     mRNA            complement(join(324596..325042,325110..326558,
                     326621..327579,327662..327760,327813..328165))
                     /locus_tag="CNA01200"
                     /product="conserved expressed protein"
                     /transcript_id="XM_024656171.1"
                     /db_xref="GeneID:3253718"
     CDS             complement(join(324902..325042,325110..326558,
                     326621..327274))
                     /locus_tag="CNA01200"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_024511847.1"
                     /db_xref="GeneID:3253718"
                     /translation="MGSGRKKLPDDEARHERKGVGGGPGETRRGSVMGSGMQHQDHDR
                     ASERKEVFLCKRASMGMGGGAIRGGGTSLFDRRPSLLTNTPAKHVMLSQAIDPPASPL
                     SAAPGATEQPLPPAAGRRRTTVSLHSLADAALADASHRPQLTHRSSITLPPISSLLPG
                     ASAPVPASKSSAQKLPSRNQATSGQPSVKGWSPATLSPKNTGAPVVLPRTRAVYRPIE
                     APVHPLVPDQHVALEYNVRRYTRADSSGRPSSSSQAQSSCCNIAPAAPTSRPTCRGKA
                     PAEQPMPQPHPQTQLHRRYPLQGLQLDKTYPEWSIHGWHEDAQRLLQPPRTLTPPSVY
                     AKSRSISRGAYSSGSEFDKPARPPPGWGDNVHGTSQAYAPPFLQANTLYPPPLRPINS
                     EAKPRQRSYRFITHDTEPSTEQKNHAVTRALGTEEECNGPQTKAKESSSLGNKCSIGS
                     APSSPPSCHPIKGIIPSASPTPVINNHPLTRSTPSTWSITSHLNITTYRSNSHQSSQS
                     PITPKAAFENELDSTSNSSSSSSAPSEYEDDGFELSDMSDRGHEPGRALVHGGMGSRE
                     NIGEDEKGENLSAKLRLQIPPFYSTPSGSPLKSVSSENVTPSSSNYTPTSSTKRARIL
                     TSTSTCNPMSTSSWDAERENGVLKGCTSGNTVTVESTGRNDGKVRQKEQRRNRERRRE
                     QNAVAQKKFRWKKKQMAEKMAADLESANETTLKLQEQLEERDSLVSNLQSELSLYKRK
                     FGECTLI"
     gene            328337..329313
                     /locus_tag="CNA01205"
                     /db_xref="GeneID:36392653"
     mRNA            join(328337..328453,328659..328703,328785..328868,
                     328979..329113,329193..329313)
                     /locus_tag="CNA01205"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656046.1"
                     /db_xref="GeneID:36392653"
     CDS             join(328388..328453,328659..328703,328785..328868,
                     328979..329113,329193..329255)
                     /locus_tag="CNA01205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514118.1"
                     /db_xref="GeneID:36392653"
                     /translation="MPPSKRSKRAVSDEASDEASDESREEKPAIISEPKAKKAKASEL
                     TESSGEGAEIEKNDDGEEFFKLSEYRRLTVRTFKGKTLVDIREMYKDKSSGALKPGSK
                     GISLTAEQWEILRNNIQNVDEMVKKVQK"
     gene            complement(329815..332642)
                     /locus_tag="CNA01210"
                     /db_xref="GeneID:3253737"
     mRNA            complement(join(329815..330069,330145..330594,
                     330650..331327,331381..331684,331733..331884,
                     331934..332401,332449..332642))
                     /locus_tag="CNA01210"
                     /product="expressed protein"
                     /transcript_id="XM_566570.1"
                     /db_xref="GeneID:3253737"
     CDS             complement(join(330004..330069,330145..330594,
                     330650..331327,331381..331684,331733..331884,
                     331934..332401,332449..332607))
                     /locus_tag="CNA01210"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566570.1"
                     /db_xref="GeneID:3253737"
                     /translation="MSSSIITKPKPHRRSSAMSSISIEQPPLLGLPHEILEQIFLALS
                     LPGRSKLARTCSALRDIYAASAQLQYLAILETSAYLDYPRVLKAVEPVEEEPLSAMSS
                     PPSSPEAALTTVPIAFRSPHTGNLRSTIPSVSLAPWPKQPPEVSPFDHVGSLAAKNRR
                     LRDREERWETMEFKEKRTFKVQGQEGVYELQEGIFLLCNDTSTDDEERRPDTIRLIPL
                     PSADDPDLEDPPISVKGHKLPMSIADLTMDPSQDLIVVSEYNPAPSDPSRPLPTHRYH
                     LLTMSSFTPHPLASLPTLDFPPVTQTLPRTRQLLQVMGDTLAVLVAKYIPVWILDALN
                     IDPEVLGHRTQEEEIVVWNWKSGRVLSRLPFTEKQWFSSFAMLSPTTFMVTSTMSSIP
                     SGGPAFPWKRDEHRPTIQIYSILSDPKRSVIPVQPLQSEIMDDTTPRPVCVAVLEMPT
                     LQEDVRVTEFDVRPDPAYPPRSGQTKDDEVEYTLLKHKPFTQDPLKGILVFDYRLQER
                     IPMNPNTRDVVRNWPFEVFVRRETLVKLGQEGEKRLGQAWESGSVLKMGVRDVQQTFT
                     WDEWGEKEARMVDRIMTIRSWVCSCSGYRYISILSEDKSPFAEYDLDEPPEDDQPTLD
                     GHYPYRPEKSHILLYDFNPYTISKELSRQEPYPESDDVDPPRRRTVCGETFVPPFTEG
                     KGWKSRVVTSPTILSKKSIFEEDVRSELPYREVWREYGGWANGIMIDDQRIIVVNTNA
                     RRNGDWSSISQEMTVLCM"
     gene            332820..333668
                     /locus_tag="CNA01220"
                     /db_xref="GeneID:3253731"
     mRNA            join(332820..333017,333078..333257,333315..333668)
                     /locus_tag="CNA01220"
                     /product="cyclophilin, putative"
                     /transcript_id="XM_566572.2"
                     /db_xref="GeneID:3253731"
     CDS             join(332855..333017,333078..333257,333315..333379)
                     /locus_tag="CNA01220"
                     /codon_start=1
                     /product="cyclophilin, putative"
                     /protein_id="XP_566572.1"
                     /db_xref="GeneID:3253731"
                     /translation="MNKTTDQAASSNLNKKSSVYVSGFAPEVDEEQLLQAFVTFGDII
                     EIKIPHEPHDPKKHRGYAFITFSSAADAQEAIDNYDLNQLPGYQGSGKFLKCSLAQPS
                     KYVDESGRNDRAIWETEEWKAEHAGERPEEATE"
     gene            complement(333433..337375)
                     /locus_tag="CNA01230"
                     /db_xref="GeneID:3253709"
     mRNA            complement(join(333433..333689,333747..334282,
                     334333..334522,334573..335171,335219..335972,
                     336022..336119,336172..336304,336358..336779,
                     336853..336918,336971..336990,337043..337064,
                     337127..337132,337190..337375))
                     /locus_tag="CNA01230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566574.2"
                     /db_xref="GeneID:3253709"
     CDS             complement(join(333534..333689,333747..334282,
                     334333..334522,334573..335171,335219..335972,
                     336022..336119,336172..336304,336358..336779,
                     336853..336918,336971..336990,337043..337064,
                     337127..337132,337190..337235))
                     /locus_tag="CNA01230"
                     /codon_start=1
                     /product="ubiquitin activating enzyme, putative"
                     /protein_id="XP_566574.1"
                     /db_xref="GeneID:3253709"
                     /translation="MAAPMQVDEAVPGDSIDEGLYSRQLYVLGHEAMKKMATSNVLIV
                     GMKGLGVEIAKNVALAGVKTVTIYDPSAVEIADLGTQFFLREEDIGRPRAEVTAPRLA
                     ELNSYVPIKILPGAGEITPEMIEPYQIVVLTNATVRKQVEIDEYCRQKGIYFIAADVR
                     GLFGSVFNDFGKDFACVDPTGENPLSGMIVEIDEDEDAIVTCLDETRHGLEDGDFVTF
                     SEIKGMEGLNGCEPRKISVKGPYTFSIGDTRGLGKYKSGGLFTQVKMPKILQFKTLKE
                     SLTNPEFFITDFAKWDRPAALHVGFQALSAFYEKAGHLPRPRNAADAEQVISLAKEIH
                     SAAGGEDVLDEKILTELSYQATGDLSPMVAVIGGFVAQEVLKACSAKFHPMQQNMYFD
                     SLESLPATLPSEADVQPLGSRYDGQIAVFGKAFQEKISNTREFLVGSGAIGCEMLKNW
                     SMMGLATGPNGIIHVTDLDTIEKSNLNRQFLFRAKDVGKFKAESAAAAVADMNPNLKG
                     KIIAHDDRVGPETENVYGDEFFANLDGVTNALDNVSARQYMDRRCVFYCKPLLESGTL
                     GTKANTQVVVPHLTESYSSSQDPPEKSIPSCTVKNFPNAIEHTIQWAREAFDSFFVNP
                     PTTVNLYLSQPDFVETTLKSSGQHHEHLKQIEKYLVKERPMSFEECIMWARLQYENNY
                     VNEIKQLLFNLPKDQVNANGTPFWSGPKRAPTALAFNIDDPLDMEYLIAAANLHAFNY
                     GLKGERDPALFRKVVESMNVPEFTPKSGVKIQINENEPVENNGNDDEDDIEAIVSSLP
                     PPASLAGFRLQPVDFEKDDDSNHHIDFITAASNLRARNYGITLADRHKTKLIAGKIIP
                     AIATTTALAVGLVCLELYKLIDGKNKLEDYKNGFVNLALPFFGFSEPIAAAKQKYGET
                     EWTLWDRFEIEGNPTLQQFLEWFQENHKLEVQMVSQGVSMLWSSFVPSKKAADRMRMR
                     MSELVEHVGKKPIPPHVKNLLVEVMVNDENDEDVEVPYVLVHI"
     gene            complement(337533..339337)
                     /locus_tag="CNA01240"
                     /db_xref="GeneID:3253609"
     mRNA            complement(join(337533..337884,337939..338016,
                     338068..338089,338144..338307,338366..338626,
                     338697..338818,338878..339337))
                     /locus_tag="CNA01240"
                     /product="conserved expressed protein"
                     /transcript_id="XM_567092.2"
                     /db_xref="GeneID:3253609"
     CDS             complement(join(337800..337884,337939..338016,
                     338068..338089,338144..338307,338366..338626,
                     338697..338818,338878..339120))
                     /locus_tag="CNA01240"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_567092.1"
                     /db_xref="GeneID:3253609"
                     /translation="MVPLSVSATAFFLASHLLIFLPQASASPSPIDVAGASEASVILD
                     HVGRDPVERAVLGSATTLSKRASGYTNPEDNGGYMLTIVNGTYPAGMGEPLNVILSGD
                     SDAEVLVKSADDGGFLNYMLSAGLGEECLGQHLGADQQANLGDDQGNVTEVEELRYNY
                     GNPYIGTCQETFNGGLHLRYWIQNTTGAYFMAVSVEKSLTEGHDIVVNGYNIGRDELV
                     GNLTGQSIDTRTLSNTSTLSGSATYNNYTYQTDVEYVPGLLENSSDGINHYLTVEEDG
                     YPAIDGLVAVLTVRITDRPASSSFAFPTLSITPVALLVPLLSAILTLF"
     gene            339453..340821
                     /locus_tag="CNA01250"
                     /db_xref="GeneID:3253768"
     mRNA            join(339453..339687,339757..340092,340143..340350,
                     340401..340529,340583..340821)
                     /locus_tag="CNA01250"
                     /product="ubiquinone biosynthesis methyltransferase,
                     putative"
                     /transcript_id="XM_566576.2"
                     /db_xref="GeneID:3253768"
     CDS             join(339498..339687,339757..340092,340143..340350,
                     340401..340529,340583..340691)
                     /locus_tag="CNA01250"
                     /codon_start=1
                     /product="ubiquinone biosynthesis methyltransferase,
                     putative"
                     /protein_id="XP_566576.1"
                     /db_xref="GeneID:3253768"
                     /translation="MASTKSLLRSTRAFPCITSSHVRYIATSVPRRESQSTPGQTPPS
                     SKTTHFGFREIPEEQKETLVGGVFSSVASSYDLMNDSMSLGIHRLWKDSFVSSMLPRL
                     PPSFHRNPNDPVTEKPVFKCLDVAGGTGDIALRILDRAKDKFACRDIEVEIVDLNEGM
                     LNEGRKRVAKTMYYNTPQIKFTHGNAQHLPSHIADNSIDLYTIAFGIRNCTSLPAVLS
                     EAYRVLKPGGKIGVLEFGKVTNPLFREIYRQYSFQFIPVMGKILAGDSESYQYLIESI
                     ERFPSQPEFAKLVQEAGFKTGQMREGRGGAWTDYTNGIATVWTGVKV"
     gene            complement(341238..342964)
                     /locus_tag="CNA01260"
                     /db_xref="GeneID:3253979"
     mRNA            complement(join(341238..341464,341521..341659,
                     341718..341959,342013..342137,342200..342280,
                     342437..342529,342591..342703,342848..342964))
                     /locus_tag="CNA01260"
                     /product="diphenol oxidase, putative"
                     /transcript_id="XM_567249.2"
                     /db_xref="GeneID:3253979"
     CDS             complement(join(341419..341464,341521..341659,
                     341718..341959,342013..342137,342200..342280,
                     342437..342529,342591..342703,342848..342866))
                     /locus_tag="CNA01260"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567249.1"
                     /db_xref="GeneID:3253979"
                     /translation="MAGDKIQLYEFEGSVWSNAPKIALEEGGLKKDKDVRWTTINLPE
                     GENFEPSYLKINPAGTVPTLVVGNDTFTDSISAVAEIVKIAPQRPRGKVSSGASIIEE
                     IHSAAIDPNATFLIATDDEDRKTKINGVPKGFLAGRQKTLNKLVENPPEEFKEFLTKK
                     QADNKQLLEFFIAEPDEQTRKAHYAQGQQLWNSVGNALRGFITEALTKNNQGPYVGGN
                     EPSEVDFHLITWLARTITNTGVEPGTNADQAIKKLQAKTGGGALDDSIKLYWETWSAR
                     ESFKTLGVH"
     gene            complement(343412..345796)
                     /locus_tag="CNA01270"
                     /db_xref="GeneID:3253767"
     mRNA            complement(join(343412..344416,344470..344941,
                     344991..345132,345188..345252,345300..345796))
                     /locus_tag="CNA01270"
                     /product="U1 snRNP 70K protein (short form), putative"
                     /transcript_id="XM_566577.2"
                     /db_xref="GeneID:3253767"
     CDS             complement(join(344221..344416,344470..344941,
                     344991..345132,345188..345252,345300..345714))
                     /locus_tag="CNA01270"
                     /codon_start=1
                     /product="U1 snRNP 70K protein (short form), putative"
                     /protein_id="XP_566577.1"
                     /db_xref="GeneID:3253767"
                     /translation="MSHLLPPNLLKLFAPRPQPPFLKPLTRDERIRGPNNLGGVAGLA
                     KRIKEEAEDAEVKQGMGMNPEKALDEQKEENVKMELKQDGEDGEVAEDSGKEKKKKTA
                     RDKIAEMGIIGEEAVKMRKELRKKRQEEYKKNAESNYKPQDDAQAIGDPYKTLFISRL
                     SKKANETDLRREFEMYGPIERIRIVRNRKGKSNGYAFIVYERERDMKAAYKDAEGIPI
                     HHKKILVDVERGRTVKGWKPQRLGGGLGGRPKPVAPEASPAPYVAPSNLRGGRGGFRG
                     GGRGGGAGFRGGFQGNRGGFGGGNRGGFGGGDDRGGFAGRGGFRGGFQNRGDRGPGGF
                     GQQQGGFGGPGGPGGYGGQGGGYGGGGGGFGGPGQQNGVQGGQGGGGFGGGGGYKRDY
                     DNAGGPGGYGGGGGGGGGGFGGGGGGYQDRDPKRMRY"
     gene            346020..347625
                     /locus_tag="CNA01280"
                     /db_xref="GeneID:3253773"
     mRNA            join(346020..346416,346473..347044,347108..347158,
                     347221..347625)
                     /locus_tag="CNA01280"
                     /product="conserved expressed protein"
                     /transcript_id="XM_566579.2"
                     /db_xref="GeneID:3253773"
     CDS             join(346070..346416,346473..347044,347108..347158,
                     347221..347579)
                     /locus_tag="CNA01280"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_566579.1"
                     /db_xref="GeneID:3253773"
                     /translation="MSVDPIVIIGAGPSGLLLARYLQLHHIPVVIYERDSSPTHRPQG
                     GSLDLHDETGLKALKETGLLDEAKSYMRAEGEAMKIVDKSGKIWYDENGKEVKAHTEF
                     QDGEPVTGRPEIDRTDLRNILIKCLNSDTIKWDHAVSSCSKISSSHYQINFISQPYIT
                     TPYLIGADGAFSRVRPLIHSTLPSYSGVSMYELTIPPKNMTPELKTYVGQGCLLALDE
                     GMTVLPQMNSGGLCKVYVGLRCPENWTDENPLPDKGKREWLANLFQGWHDQVRDVIMA
                     SEEDKLVIRRIWQFDPDLKWDTDLTGVTVMGDAAHVMSPFAGEGVNQALADALELGIS
                     LVSLFTVPTPRASSPPFPLSLLPISQPRSKPLISSPSPADLHHALRHFERKMMRRARK
                     EMIGSKENMDMFFGENAARNLTHWMSTFMIRFVWQTVTEWPVDFLKAIWD"
     gene            348168..351005
                     /locus_tag="CNA01290"
                     /db_xref="GeneID:3253694"
     mRNA            join(348168..348392,348457..349378,349432..349581,
                     349633..349687,349746..350650,350698..351005)
                     /locus_tag="CNA01290"
                     /product="rRNA processing-related protein, putative"
                     /transcript_id="XM_566585.2"
                     /db_xref="GeneID:3253694"
     CDS             join(348251..348392,348457..349378,349432..349581,
                     349633..349687,349746..350650,350698..350911)
                     /locus_tag="CNA01290"
                     /codon_start=1
                     /product="rRNA processing-related protein, putative"
                     /protein_id="XP_566585.1"
                     /db_xref="GeneID:3253694"
                     /translation="MSDPRFASVKTDPRFRRPKQKNLKVEIDERFRDVLESEEFGGKT
                     KGGAKVDKRGRPVTASHKADQLKRFYRLKSPEAAEGEGEGFIDYARGEGALYSSGSED
                     ESDEDESEVEEEELEVGGKKKVRLPAMSESESESDDDHLDIDLSENEETSVFPPETDE
                     IPSDNESETEPVDPTKRIAVVNLDWDNMQAADLYAVFNSFLTRPATKGEVKAPSALGK
                     LLRVRIYPSEFGKERMAKEEQEGPGGGIFIGSKKKRDNKKERISIARKEESDDEEGNE
                     EEDDEEEENEVSDEDSDEEDEGDTEEENEDNYDKPARKSNDKLHKEIDGLEIFSDVGS
                     EAGSEDIDMDQLRQYQLERLRYYYAIATFSSVAAAEYVMNECNGTEFEQTANILDLSY
                     VPEDMTFDEDSVKDEADKEPKAYKGNDFVTDALRHSKVKLTWDQDDPNRIKMTRRTLT
                     REEIEEQDFQNLVAASGSEVEESDFDDDEGAGGESKKDKKKKMKERKEKLRNLLLAGG
                     DDEDGVTDVWGKAGTAWANELEDIKSAALKDRSKSASKKAKKGEDLEITFRPGLSVAK
                     GDGGEENMTSLERYQLRMKEKKQRKKEKMELKAAARERGDEEKTDGQDEFFGSDSSEE
                     EEEQQPKPKSKPKSLEPTLPDEDDLAAIVGTNEPDSNFSMKDIIKTEKEAGKKRRRRK
                     GKKGEQERDVELGPDDWKIDVKDDRFKALHEEPEFAIDPSNPHFVKTKAMQDLLAERT
                     RRRNNQKKIEPEGRKSATGVKNVEQKEQDLDSLVASVKRKMDQNQHKAKRKRTRK"
     gene            complement(349383..350988)
                     /locus_tag="CNA01300"
                     /pseudo
                     /db_xref="GeneID:3253920"
     gene            351218..354148
                     /locus_tag="CNA01310"
                     /db_xref="GeneID:3253681"
     mRNA            join(351218..351438,351491..351571,351630..351631,
                     351684..352616,352668..353033,353085..353331,
                     353381..353536,353588..354148)
                     /locus_tag="CNA01310"
                     /product="phosphoribosylamidoimidazole-succinocarboxamide
                     synthase, putative"
                     /transcript_id="XM_024656172.1"
                     /db_xref="GeneID:3253681"
     CDS             join(351270..351438,351491..351571,351630..351631,
                     351684..352616,352668..353033,353085..353331,
                     353381..353536,353588..354084)
                     /locus_tag="CNA01310"
                     /codon_start=1
                     /product="phosphoribosylamidoimidazole-succinocarboxamide
                     synthase, putative"
                     /protein_id="XP_024511851.1"
                     /db_xref="GeneID:3253681"
                     /translation="MAAPSETTIQLSPEAEAQYERITRNLQEVTSGEVIRKVLSEGKV
                     VKAYWGTAPTGRPHIAYCVPLLKIADFLTAGVNVKVLLADLHAFLDASKSTLETVQYR
                     VKYYSKLLITVFTVLGVPTDKLEFITGSSYQLKPDYTLDVYRFHALTSTREAEHAGAD
                     VVKESESPLMSSLLYPGLQALDEQYLDVDFQFGGVDQRKIFMYAATFLPKLGYSKRAH
                     LMNAMVPGLSGGKMSASDPKSKIDFLDTAADIKSKIKAALCPPGEVENNGVIAFIKTV
                     LIPIQALRIEQAERRGEKAPVGEGSFVKPGAPEGTIFSISRPEKFGGDIHFKSYEDLE
                     KAYVAGDIHPGDLKTGVQEALIQFLGPIRKSFDEDKEWQEVERTAYPSSSVAPTAEEP
                     KKAKKKDVRSKPPTEEERAALRAAKEKEKAAKAAAKAVNEGTAPPVPPVEDITASQLA
                     QSSKEAVQITTSNATSSCVTSTNLSKLKLLAKGKVRDIYALPGKEDEDKLLFVATDRM
                     SAFDVIMNNGIPSKGITLTTLSLFWFDKLKNIIPNHVLHPSPSACFSTPAQAWEQFPR
                     SLDEYRDQLEGRSMIVKKCEVVKIEAIVRGYITGSAWSEYKKSQTIHGIQMPAGLVES
                     QKLPKALFTPSTKADQGEHDENIHPDKVKDICGPELAAKIEKAAIQLYTEAAAYALER
                     GLILADTKFEFGLLPDPSSPNKTTLILIDEVLTPDSSRYWAAADYVVGQPQPSFDKQY
                     LRDWLIKEGLRGKEDVTLPEHVVSETRSKYEEARDRVMGLGEFGKHGQKGKIAGDEVA
                     LQTDQATDAIEEEARKQL"
     gene            complement(353298..355335)
                     /locus_tag="CNA01320"
                     /db_xref="GeneID:3253704"
     mRNA            complement(join(353298..354080,354151..354284,
                     354336..354549,354603..354862,354924..355129,
                     355179..355335))
                     /locus_tag="CNA01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656173.1"
                     /db_xref="GeneID:3253704"
     CDS             complement(join(354256..354284,354336..354549,
                     354603..354862,354924..355129,355179..355270))
                     /locus_tag="CNA01320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511852.1"
                     /db_xref="GeneID:3253704"
                     /translation="MGKFSEFLASSKGDHKADVPPPPSYGESSTSARPLTPPPPFPHS
                     FGCIHLARSDRIRLIGLPPVVYDDVEQAILRVWVPGLQGKFPMYQSLEWKLSGYPWSG
                     QGAEAVQARRLLCHVLHALSKHGWYLHMSVDLSKKQFDKDTLILHSVYPQERYFFSIS
                     FNEGDKVRIIDPPNDHVKQAFMTAVRTWPRGIQNEREKEPGCYQFKLKGLPWYTSDGD
                     QIIHARLLSCTILAAMDSVGFELKGSVDMSTGTSEHANDMDTWFFASK"
     gene            355979..357593
                     /locus_tag="CNA01330"
                     /db_xref="GeneID:3253698"
     mRNA            join(355979..356045,356096..356126,356174..356238,
                     356289..356487,356536..357054,357113..357292,
                     357339..357593)
                     /locus_tag="CNA01330"
                     /product="actin ii (centractin-like protein), putative"
                     /transcript_id="XM_566591.2"
                     /db_xref="GeneID:3253698"
     CDS             join(356023..356045,356096..356126,356174..356238,
                     356289..356487,356536..357054,357113..357292,
                     357339..357455)
                     /locus_tag="CNA01330"
                     /codon_start=1
                     /product="actin ii (centractin-like protein), putative"
                     /protein_id="XP_566591.1"
                     /db_xref="GeneID:3253698"
                     /translation="MATEFDDVLTNQPVVIDNGSGNIKAGFAGEEQPSCYIPSFVGRP
                     KHPRVMAGAIQDNLFIGRRAQEFRGLLKIKYPMEHGVVMDWDDMERIWGWVYGEGLKA
                     LSEEHPVLLTEAPLNPRQNRDIAAQIFFETFNVPAFFTSVQAVLSLYSSGRTTGIVLD
                     SGDGVTHAVPVFEGFSMPHAVRRIDLAGRDITDHLQLLLRKAGHNLHTSAEKEVVRTI
                     KEKTCYLALNPAKVEKDQGGAWEEFKLPDGKVIQLGTERFLAPEILFNPELVGQEYPG
                     VHQVIVDSINRTDLDLRKSLFSNIVLSGGSTLCTGFGDRLLNEVKKLAVKDVKLKIYA
                     PPERKYSTWIGGSILAGLSTFKKMWVSADEYKEDPDIIHKKAF"
     gene            complement(357466..359409)
                     /locus_tag="CNA01340"
                     /db_xref="GeneID:3253710"
     mRNA            complement(join(357466..357959,358212..358602,
                     358653..358731,358786..358871,358932..358990,
                     359047..359162,359236..359348,359398..359409))
                     /locus_tag="CNA01340"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024656174.1"
                     /db_xref="GeneID:3253710"
     CDS             complement(join(357587..357959,358212..358602,
                     358653..358731,358786..358871,358932..358990,
                     359047..359162,359236..359283))
                     /locus_tag="CNA01340"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024511853.1"
                     /db_xref="GeneID:3253710"
                     /translation="MPQLKTYSEKPVVLLTNDDGPPCASSPNIYAFCKLLQSRLGWDV
                     RVVIPDCQKSWVGKSYAISDIVTANYFYPLEPDGLKGEITQTRRPLKEGESMEWVLLS
                     GTPATCANIALHNIYPGQIDLVISGPNHGRNSSTAFALSSGTLGATLAASLSVPIPGP
                     LTSPSLHEDHMPCIAISYGVVTRPVSDRVLELATETAVDVCQQLFDNWGEDKEVGGKG
                     LVPIYSINIPLVEAALEKNERKIVSTEMWRNAYGRLFKTTKLSKALYDPGDDPVQIAH
                     GYMKSQDKPNTVQTSTSLPSHPHTSKTSTAGPAALPTPAPPSPITPKNTKDEEQQLKF
                     HFAPNMHPLLFPPEGSVPEGTDAWAFAKGWISVTPMRAEYACLGAASIE"
     gene            359633..368152
                     /locus_tag="CNA01350"
                     /db_xref="GeneID:3253726"
     mRNA            join(359633..359891,359956..360111,360167..361947,
                     362000..362643,362693..362787,362839..363059,
                     363114..364266,364316..364467,364522..365229,
                     365282..365496,365553..365602,365653..366573,
                     366622..366796,366847..367892,367952..368152)
                     /locus_tag="CNA01350"
                     /product="splicing factor Prp8, putative"
                     /transcript_id="XM_566595.2"
                     /db_xref="GeneID:3253726"
     CDS             join(359679..359891,359956..360111,360167..361947,
                     362000..362643,362693..362787,362839..363059,
                     363114..364266,364316..364467,364522..365229,
                     365282..365496,365553..365602,365653..366573,
                     366622..366796,366847..367892,367952..368020)
                     /locus_tag="CNA01350"
                     /codon_start=1
                     /product="splicing factor Prp8, putative"
                     /protein_id="XP_566595.1"
                     /db_xref="GeneID:3253726"
                     /translation="MSTVPPGFGAPPPGFTPQPNGNGDGMEGDFFGQLSQEEIDKKAR
                     KWRQSQKRRFNSKRRQGGGGGVDFGKADLPPEHIRKIIKDHGDMSNRKFRNDKRVHLG
                     ALKYVPHAVMKLLENIPMPWEQVREVPVLYHISGAITFVNEVPRVIEPVYHAQWASMW
                     LAMRREKRDRRHFKRMRFPPFDDEEPPMDYGDNVLDVEPLEAIQLELDEEDDEAILEW
                     FYDPKPLVDTPQVNGSSYKYFQLALPQMANLYRIGRQLLSDYSDNNAFYLFDKKSFFT
                     AKALNIALPGGPKFEPLYRDMDAFDEDWNEFNDINKIIIRNVIRSEYKVAFPHLYNSL
                     PRSVYIGVYHEPKNVYIKTDDPDLPAFYFDPLINPISQRVVQEAHTPLVSHEDQVFGF
                     GNDEDVEFELPEEVEPFLGERDLENENTSDAIALYWAPYPYNLRSGKMKRAQDVPLIK
                     NLYLEHCPDGQPVKIRVSYQKLLKVYVLNALHNKPPKAMVKRNLFRSLKNTKFFQATT
                     LDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNLNLKPIKTLTTKERKKSRFGNAF
                     HLCREILRLTKLIVDAHVQFRLGNVDAFQLADGLQYMFAHVGQLTGMYRYKYKLMKQI
                     RMCKDLKHVIYSRFNTGPVGKGPGVGFWAPGWRVWLFFMRGIVPLLERWLGNLLARQF
                     EGRNSKGIAKTVTKQRVESHFDLELRAAVMHDILDMMPEGVKQNKAKTILQHLSEAWR
                     CWKANIPWKVPGMPAAIENIILRYVKSKADWWTSVAHYNRERIRRGATVDKAVVRKNL
                     GRLTRLYLKAEQERQNGYLKDGPYITSEEGTAILISTAHWFESRKFAPIPFPPLSYKH
                     DTKLLVLALEKLKEAYSVHGRLNQSQREELALVEQAYDNPHECLSRIKRLLLTQRAFK
                     EAGIEFFDTYDKLIPCYDVEPLEKLSDAYLDQFLWYEADKRRLFPSWVKPSDSEPPPL
                     LVYKWCQGINNLTDIWDTSEGESVVMMETVLARVYEKVDLTLLSRLLRLIMDHNLADY
                     ITSKNNTTLTFKDMSHINTYGMIRGLQFSSFVFQYYGLVLDLLILGLERASEIAGLPE
                     APNGFLQFKNREIETKHPIRFYSRYVDRIHMLFRFTAEESRDLIQRYLSVQPDPNNEN
                     VIGYNNKRCWPRDCRMRLIKHDVNLGRAVFWNVKNSLPRSLTTIEWEDTFVSVYSKDN
                     PQLLFSMCGFEVRILPRVRTQHGEAYSLKDGVWNLTQESTKERTAQAFLRVSDQGIQD
                     FNNRIRQILMSSGSATFAKIINKWNTCLIGLMTYYREAVVHTNELLDSLVKAENKVQT
                     RVKIGLNSKMPSRFPPCVFYSPKELGGLGMLSMGFVLIPQSDLRWSKQTDSGGITHFR
                     SGMTHEEDQLIPNLYRYLQPWEAEFLDSARVWSEYALKRKEATASNRRLTLEDLEDSW
                     DRGIPRINTLFQKDRHTLAYDKGWRVRQYFSQFFRLRNQPFIWTNQRHDGKLWQLNNY
                     RVDVISALGGVEGILEHSLFKGTAFPTWEGLFWEKACLQNGTRLLRADGSEVLVEDVQ
                     EGDQLLGPDGTSRTASKIVRGEERLYRIKTHEGLEDLVCTHNHILSMYKERSGSERAH
                     SPSADLSLTDSHERVDVTVDDFVRLPQQEQQKYQLFRSTASVRHERPSTSKLDTTLLR
                     INSIELEDEPTKWSGFVVDKDSLYLRHDYLVLHNSGFEESMKNKRLTNAQRSGLSQIP
                     NRRFTMWWSPTINRANVYVGFQVQLDLTGVFMHGKIPTLKISLIQIFRAHLWQKIHES
                     VVMDLCQVFDQEMEALQIETVQKETIHPRKSYKMNSSASDILLFSSYKWQISRPSLLT
                     DNRDTMDGTTSNKFWLDIQLRWGDFDSHDIERYARAKYLDYSSDSQSIYPSPTGNLIA
                     IDLAYNLYSAYGCYFPGLKPLLQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPY
                     LNSSNYSELFSNQIIWFVDDTNVYRVTVHKTFEGNLTTKPINGAIFIFNPRTGQLFLK
                     IIHTSVWAGQKRLGQLAKWKTAEEVAALVRSLPVEEQPKQVIVTRKGMLDPLEVHLLD
                     FPNIVIKGSELQLPFQATLKMEKFGDLILRATQPQMVLFNLYDDWLKSISSYTAFSRL
                     ILILRALHVNNEKSKIILRPDKNTITESYHIWPSLSDDEWMKVEVALKDLILADFGKR
                     NSVNVASLTASEIRDIILGMEIAAPSVQRQQMAEIEKNTEAAAQVTALQTKTTNIHGD
                     EIVVTTTTQYEQQTFASKSDWRVRAISATNLPLRVNHIFVGNDDVKDDAGSYTYVIPK
                     NVLRSFIVNADLRTQVVAYLYGTSPPDNKQVKEIKAVAWIPQRGTNNGVDLPVTLPKH
                     DFLLKDLEPLGWIKTQSQELNHLSPQDVTTQAKIMAAHPEWGPQSICVTCSFTPGSVS
                     LNAWDLTVAGFEWGRKNEDVTGQNPGFNPSMANRVQLLLSDRILGMTLVPEGGIWNYG
                     VGLTQSWSEKIPYTMTLDKPEAFWAPCHRPNAFLNFASMEGDDAADVENSLE"
     gene            368358..374979
                     /locus_tag="CNA01360"
                     /db_xref="GeneID:3253748"
     mRNA            join(368358..369529,369580..372019,372069..372454,
                     372504..372672,372721..372972,373021..374021,
                     374077..374210,374270..374979)
                     /locus_tag="CNA01360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566597.2"
                     /db_xref="GeneID:3253748"
     CDS             join(368410..369529,369580..372019,372069..372454,
                     372504..372672,372721..372972,373021..374021,
                     374077..374210,374270..374752)
                     /locus_tag="CNA01360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566597.1"
                     /db_xref="GeneID:3253748"
                     /translation="MEDNHVSEHPPESTTPASHLFDSIDSEGGAADDPFAQFGSEQDD
                     YAPQRQVQEEEHKPGFQATTEGEAPTPVAQVEGSRTPIPANVLEKQTEEKAAYAPEET
                     EEVQGGGKTQEFIGEQQGSHITSSPVQEPTAGHLFGPVSDGSGEDLFAQLAESEKDEF
                     TQPEQSQDILKSEGIDQSEAQGQTEVSVPHEEKDYSDLLAEFEAENGMLEPPIGGPVK
                     SHSESKGEGIQSLLGQSDTKNDQTPAASSLFIDDPNDSVFDNIIPESDSEPQEAPLST
                     TAGTLTNPSIQGLFSNDTTDFLNQGQIITEAQEAGGLDQSGVEPLDFDIPQGWYDDDG
                     QWQWYTEEEKEQVKFAMMGPTSWQETEQAPPPLTAGAGATLTPVVPRSPALQSQAAMS
                     ENAARRTPQPEPIAAFDSSIYEPPVPASTQLATSTASYFPANQSGYTSAPPANVPPQV
                     TRSATLPASSFSVTAAAPSPHVSSNPKSYNAYDPPVSTKPYHHRSYAPATQPTPSPYN
                     PASLGNVFTSPTDATLAKSEPPKPRPQPQRAVSTAYDPPFLRTQEKISRPASAVSTGV
                     SSAFGVSPIVPSHQIQAPPLPPSGPPKRSKGESRPPSRGPAFAPPPITPFGSPPPVPP
                     LSVPPSGPPRRPTGTSRPPSRGPAYAPHPKPQSSVPPVPPLPTLPVEVPGSHTEDNSV
                     AHGRDSLNFPGSSEVNEPSFTRPNVCSPEGGDEDRPPSRGSQAISPSLAPHTLSVSAE
                     PIQAPPSAPPGQSIGTTELRGHNQTSAPSPMTHIPASSLSEKPTSYAPPEFQQKAQQP
                     QPSSYEQVPYTHDGWEADRSLISAQLSSYEPTPHAPSDSHSDHEAETFKAIASAPAAE
                     SYEPSSYAPTQSDYYKPGPEATTQPTSYKPDPYAPSSTSAVGLQSQSSPYARTTSPAH
                     SSAYGTSPPTNHIPSMAASGNTFVHAPYAGQSAYQSQNESSVRQSNLSMNRSSMPSST
                     SLYVPSQSSSNYNPVGSPAQSPTYGMSPPSTNYFQSMPAQRSASIDTSYVPQQVLEQK
                     PISEDPLARTTLASRNAPIAVFGFGGVLITAFPGASESDNFAKGHARIPSYGYASGRG
                     QLWIRNISEVVAPGALKSDQSAFPGPLVNDISGPKGAAGEKKKKEAVLAYLRDRAEEV
                     ERGLPYLKSSASRARREDEGRLVLLRLLEALVIGEGKLAGNPKVEDAIRVALSNPSSP
                     NVPTAPGHVTTLSNGLYPSTSSKSASPVAANPSQLSRLSTLLAQGQKKEAAEYAIDHG
                     LWSHALVISSAVGAELWKDTVMRFTAAELSARSEGTAGIRASYALIGGMSHSSLDDLI
                     NAATITEDPSQDQWREVISSVLFHAKPADLACLDELGSRFLQMGLVNAAHACFLLSPL
                     SPFLDTTPASYERGIMMTHNTRDEESTIFVEIAEYARSLVPVPKGQEQITVGLPQLLP
                     YKLARAWRLAELGEVALAKRYCAAIEAGAKPLTKSAQIQSLLPPAFMASLEDLLERLT
                     GTPSIDPANVLGGGRKSSKPGFDKLGSWIEGRLTKFIAGEEGEKAIPKPAASSGKAEG
                     PFAHFSSVSPDPSGSISRNPSMADVGSYSASNGFLGVQPMSRTTSPAVQGQYNPYGQQ
                     SQPYGAPPKSTLDVRSLSPATSHSAQAHNNLYTSQSQPSSSTSSSYGDSQGRRTDFGG
                     GFTPWASNAGSEVQAEDGEMTPHAYEAPVGDDQAEFITPMAGLSIGPSTSGTLNYTPR
                     ASQPAYDLGDEGEDLGFGNTSLSKGRPTKTVGEGEGKGEASGGKPTKGGKEEPKKEEP
                     TQPAKQEQHQSSSWLGRLWGKKEGGPVKANLGEETSMVYDPDQKRWVVKGAKGASAAP
                     AAPPPPPRAQTASPSHTSRPAPSTRAMSAAPPPPGPSSSDGSFSTLPRSANVPPPPAG
                     MSASTFAEGPDGGIRRMKSSLTMSQGQGPPSGPLSGPPSGPPSQPPSRTSSASATSAS
                     LDDLLSGSRPASKRPGSAMKKGARNRYVDVFQSEGS"
     gene            375851..376708
                     /locus_tag="CNA01370"
                     /db_xref="GeneID:3253888"
     mRNA            join(375851..375939,376155..376207,376271..376325,
                     376392..376460,376529..376708)
                     /locus_tag="CNA01370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567227.1"
                     /db_xref="GeneID:3253888"
     CDS             join(375931..375939,376155..376207,376271..376325,
                     376392..376460,376529..376624)
                     /locus_tag="CNA01370"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567227.1"
                     /db_xref="GeneID:3253888"
                     /translation="MPVNRAVMKKWFPVEVMPIFGIVGIACVGATAYLWKLSQGPEVV
                     WDRSSDWRPWDKVKHDENLKYITVNPEFWAQRRAQAAGTKTGERAVDAI"
     gene            377183..380656
                     /locus_tag="CNA01380"
                     /db_xref="GeneID:3253591"
     mRNA            join(377183..377357,377408..377489,377547..377660,
                     377712..378306,378361..380229,380303..380362,
                     380422..380656)
                     /locus_tag="CNA01380"
                     /product="peptidase, putative"
                     /transcript_id="XM_566599.2"
                     /db_xref="GeneID:3253591"
     CDS             join(377257..377357,377408..377489,377547..377660,
                     377712..378306,378361..380229,380303..380362,
                     380422..380453)
                     /locus_tag="CNA01380"
                     /codon_start=1
                     /product="peptidase, putative"
                     /protein_id="XP_566599.1"
                     /db_xref="GeneID:3253591"
                     /translation="MVAFHASSALLSFALLAPGFANAFNLDDIKRGSDSVLPGRYIVE
                     FDSDAHLTSAGLKRAATPHEYFYKELDARSSSYTVHQEYDCDLFYGASLSISSDVDLE
                     SLLDIAGVIDLRAVHLLTLPAEPLSKENTQWSASSHSSSSSSASATASAASTSAPFSN
                     LPQIQADVVQASGNKGKGIKIGIIDGGVDYTREPLGGCFGPGCKIAGGYDFVGDDYDG
                     TNDPVPDNDPYDNCYSHGTFISGIIGANENVYGAVGVAPESSLYVYRVFGCNGAASDD
                     IVLAAMQKAYDDDMDVINLSLGEPSGWTESTLSVFASRLVARGTILTISAGNQGQVGG
                     FYSYSPSAGKGVINVGSSDSSIYPAHLATVSTGYGPIAYYNYKAYSDKTLPLYTFDSD
                     IYGCTLPDDVPDLSPYLVVVRRGGCSLSEKAQNVYNAGGTAIFVVNDETSLPIYQNFP
                     LIDFALISDDDGNYLLNQLNTSANTTVSFSFNPIALPNIWTANTTSYFSEIGPTNDLY
                     FAPSVLAPGTNVVGVTPTAFYNWTIADGTSYSSAYAAGAAALYLAAKGTNNVSPSDVL
                     SAFEVTAQQLPVSVSDSSLVSVAVQGAGRVQLSDAIYAVADISPSEITLNDTANFDKL
                     HVLTIKNPGKKWVTYKLSHEPAGTALAFQSGLNQSNDQPLPQVSNAASVNIFPSSLTL
                     WPGQSLLTTVKFTAPTGLDAQTFPIYSGFIKVTGGGSTVKVPYMGVAANMKDMPVLDP
                     TDWYLGMNSPAIVDVDGNVQQGPATYTFSNVSYPSVLYRLAGGTPLLVIDLIDANANL
                     TFTPDYTTRKRSPTFEQETENDERRRSLSARRLKSTGASFAATTKSKGLHSLWCHLTH
                     YKASGCSKTGSTFQQVSIIGNLYVGEYLPRSTDNVDGQGGDYSTFELSSATFSNGTTI
                     PNGDYKFLMRALHITGDNTNESDYESWVSQSFTVAQ"
     gene            380876..382694
                     /locus_tag="CNA01390"
                     /db_xref="GeneID:3253576"
     mRNA            join(380876..381194,381266..382402,382457..382694)
                     /locus_tag="CNA01390"
                     /product="conserved expressed protein"
                     /transcript_id="XM_566601.1"
                     /db_xref="GeneID:3253576"
     CDS             join(380984..381194,381266..382402,382457..382509)
                     /locus_tag="CNA01390"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_566601.1"
                     /db_xref="GeneID:3253576"
                     /translation="MSGDPPGPPPGRPPVANVPYIPQPGAPAAPSFRPPAAPGFGFPP
                     GPSPGMPFSVGGFPHPLLPPGWSEHRAPDGITPYYYNAQTRESTYIRPTFPPFPLGTT
                     PPTGSPVHGAVTPGGTGAGEEKTKKKKKEKPKDKVPIPGTGWMRITTTEGNVFYFEKE
                     NKRSEWTVPDEIKEAVTQLEEEERKKKKEKDKVEQERLEQKRIEKLKELERIRAEIDA
                     ERRKKEEAEKERKRKQGEGGEDDAPEEKKARVGDQEQVEEDVVGPEGEDDKEAWMKAV
                     AAEFAEKDAQTKKDLEEQDEKTKKEEAEAAKKVFAVPEKVNFSVEEGRALFKALLIEK
                     DISPFAPWDQSLPLFINDPRYVLLSSTKDRREVYEEYCREVGRAKRLKKGSSAEEKKA
                     EPEKEYQALLDKEVTSTRTRWDDFRKKWKKDRRFYAFGRDDHQREKVFKQHLRDLGER
                     KRAAAQKAEEDFNSSL"
     mRNA            join(381233..382402,382457..382694)
                     /locus_tag="CNA01390"
                     /product="conserved expressed protein"
                     /transcript_id="XM_566602.1"
                     /db_xref="GeneID:3253576"
     CDS             join(381238..382402,382457..382509)
                     /locus_tag="CNA01390"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_566602.1"
                     /db_xref="GeneID:3253576"
                     /translation="MKVLTHVSIAPDGITPYYYNAQTRESTYIRPTFPPFPLGTTPPT
                     GSPVHGAVTPGGTGAGEEKTKKKKKEKPKDKVPIPGTGWMRITTTEGNVFYFEKENKR
                     SEWTVPDEIKEAVTQLEEEERKKKKEKDKVEQERLEQKRIEKLKELERIRAEIDAERR
                     KKEEAEKERKRKQGEGGEDDAPEEKKARVGDQEQVEEDVVGPEGEDDKEAWMKAVAAE
                     FAEKDAQTKKDLEEQDEKTKKEEAEAAKKVFAVPEKVNFSVEEGRALFKALLIEKDIS
                     PFAPWDQSLPLFINDPRYVLLSSTKDRREVYEEYCREVGRAKRLKKGSSAEEKKAEPE
                     KEYQALLDKEVTSTRTRWDDFRKKWKKDRRFYAFGRDDHQREKVFKQHLRDLGERKRA
                     AAQKAEEDFNSSL"
     gene            complement(382812..384548)
                     /locus_tag="CNA01400"
                     /db_xref="GeneID:3253607"
     mRNA            complement(join(382812..383465,383535..383685,
                     383763..383970,384024..384143,384205..384385,
                     384470..384548))
                     /locus_tag="CNA01400"
                     /product="expressed protein"
                     /transcript_id="XM_566605.1"
                     /db_xref="GeneID:3253607"
     mRNA            complement(join(382812..383465,383535..383685,
                     383763..383970,384024..384143,384205..384424,
                     384470..384548))
                     /locus_tag="CNA01400"
                     /product="expressed protein"
                     /transcript_id="XM_566604.1"
                     /db_xref="GeneID:3253607"
     CDS             complement(join(382957..383465,383535..383685,
                     383763..383970,384024..384143,384205..384385,
                     384470..384542))
                     /locus_tag="CNA01400"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566605.1"
                     /db_xref="GeneID:3253607"
                     /translation="MPDSDSDSSTDFFISKRKPNLKATNSEEDPEGSGRKKKKRLNSR
                     KPQSKLPEWARQTNEQRRERKRSSVARASTETRDRERSTSLFTTTAAEDGGGKKKERR
                     RVELTPPPVISEKKNQELRELVQRMYGGGSALDLLDDDDLEPQAISPVASSPQKEEVV
                     DIVVKMELDPVKKANAPAAAVRMYERPTTLKLRREETMFRALEVMGDKLQRAPDDIIL
                     IYEGKRVYSRDTARQLGILGGSSVEMKGYEKSYWDRLEAERLRRIENFDLDFDRSPSP
                     QLIPQAHAEVSAASKSKSQPQSVGASQLYAGLAPLVVEPPSNPYTQNLARANSDSPAV
                     AEDSIKLVVRGADGKEARMKVAKTVTAHTVLRFYCKKIDRPKDDANKMELVFDGETMG
                     KDMTVGDMDCEDGDMLEVRIL"
     CDS             complement(join(382957..383465,383535..383685,
                     383763..383970,384024..384143,384205..384424,
                     384470..384542))
                     /locus_tag="CNA01400"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566604.1"
                     /db_xref="GeneID:3253607"
                     /translation="MPDSDSDSSTDFFISKRKPNLKATTPPPIRSPSPAPSDSEEDPE
                     GSGRKKKKRLNSRKPQSKLPEWARQTNEQRRERKRSSVARASTETRDRERSTSLFTTT
                     AAEDGGGKKKERRRVELTPPPVISEKKNQELRELVQRMYGGGSALDLLDDDDLEPQAI
                     SPVASSPQKEEVVDIVVKMELDPVKKANAPAAAVRMYERPTTLKLRREETMFRALEVM
                     GDKLQRAPDDIILIYEGKRVYSRDTARQLGILGGSSVEMKGYEKSYWDRLEAERLRRI
                     ENFDLDFDRSPSPQLIPQAHAEVSAASKSKSQPQSVGASQLYAGLAPLVVEPPSNPYT
                     QNLARANSDSPAVAEDSIKLVVRGADGKEARMKVAKTVTAHTVLRFYCKKIDRPKDDA
                     NKMELVFDGETMGKDMTVGDMDCEDGDMLEVRIL"
     gene            384608..386896
                     /locus_tag="CNA01410"
                     /db_xref="GeneID:3253618"
     mRNA            join(384608..384685,384741..385518,385581..385960,
                     386052..386896)
                     /locus_tag="CNA01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_567090.2"
                     /db_xref="GeneID:3253618"
     CDS             join(384953..385518,385581..385960,386052..386524)
                     /locus_tag="CNA01410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567090.2"
                     /db_xref="GeneID:3253618"
                     /translation="MEGAKAEGAGGDERDGRGKQAVEHHQVKKRFEAYRSVLRFPSLQ
                     ITQDTTPTCNQMPPDPPWRTPLGRTFFHLPSPVGEYTQHESNKAEGESAKGSSYTDIL
                     KRTFKDFSDVSVGSDVEIVHLHRQYPPKASAAAEEELEEGELEQDDWTVDIEPMRGYV
                     EDDSNSIIFDDDDDGEPPNEPADLPSFHGECWNCLQQGHSLTHCPYPRNHLQINHSRE
                     LFFYARDNLPPPRTERYLHDYLNMRVTVQEKERRLELLGKFRPGKIGKELDHAARMLV
                     DDSDSGEMLVDEIQWDKREYEWIQNIAKWGYPPGWTTALNPIEFLKDRISSLEAYDTA
                     YRLTPEPGEELVIFGADDDEDDEGSSMRDVTLGNADEREKSKEEGDDGSEMSIVSDSP
                     SPSSLPLSPASSRSPPTPSDIPPPPSPPPDLPPPPPPPPCDLPPPPPPNRWADYHTDM
                     FASSRLVVYDETRPFVLGTYAR"
     gene            complement(386614..388777)
                     /locus_tag="CNA01420"
                     /db_xref="GeneID:3253572"
     mRNA            complement(join(386614..386889,386972..387188,
                     387264..387382,387463..387676,387746..387904,
                     387961..388165,388232..388365,388427..388777))
                     /locus_tag="CNA01420"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_566607.2"
                     /db_xref="GeneID:3253572"
     CDS             complement(join(386757..386889,386972..387188,
                     387264..387382,387463..387676,387746..387904,
                     387961..388165,388232..388365,388427..388625))
                     /locus_tag="CNA01420"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_566607.1"
                     /db_xref="GeneID:3253572"
                     /translation="MSNVFPYPARKVQGYPTFLPEQPQPIGSLLDDNEYKQNKNPPKL
                     FQPITIRGVTFHNRAFVAPMCMYSSDQGRATDHHFVHLGSMALRGWGSIMVEATAVVP
                     EGRISPEDMGLWDDSQIAELQRIVKYIHANKGIIGIQIAHAGRKASTPAPWNEREANE
                     KGHSKGSVVPEENGGWPSKVVAPSEISFLEGDYPDPIEASIEYLESLKKAYADTVERC
                     SKIGFDFIEIHGAHGYFLHEFVDPISNKRTDKYGGSLENRLRLPLEIAEIVRQKWDKP
                     LFYRLSATDWLEESLGKEKNANGEWVWWGIEQTTAFVGKLAELGVDLVDVSSGGNDLR
                     QKIAPGPSYQLPFAAHLKKTYPDLLIGSVGIITDAEQANDILEQGKADVILIGRQLLR
                     NLDWPLDAAVELGVAVAPAVQYERAWTRMLVKRETHDHTSKKHGVTELQGQEGQETKT
                     PPGEHSSIP"
     gene            388865..391048
                     /locus_tag="CNA01440"
                     /db_xref="GeneID:36392654"
     mRNA            join(388865..388944,388999..390591,390671..391048)
                     /locus_tag="CNA01440"
                     /product="expressed protein"
                     /transcript_id="XM_024656175.1"
                     /db_xref="GeneID:36392654"
     gene            complement(388869..389784)
                     /locus_tag="CNA01430"
                     /db_xref="GeneID:3253561"
     mRNA            complement(join(388869..389590,389661..389784))
                     /locus_tag="CNA01430"
                     /product="expressed protein"
                     /transcript_id="XM_566609.2"
                     /db_xref="GeneID:3253561"
     CDS             complement(join(388925..389590,389661..389705))
                     /locus_tag="CNA01430"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566609.1"
                     /db_xref="GeneID:3253561"
                     /translation="MKNLIFRTSLTMTLGFLETLLDKKTKSRISETFVNISAKFVDEQ
                     MLCGESLGVLDHCCRLFEIVGLPPPTAEVELDEYLYKAFFRGVIIILRDFKSNLPRND
                     RSNNYTQIVHDNLGLLDAVWLFIHTADFYLLETFWDVAMMLVEVCEADAEGLVVALWC
                     QALEVEVDKAEDEDRNGDMKWRELSRKRKQRFISNGNRLFDARDTRIGHEDLPRATMS
                     DLNEAWKYGKELLCPRMP"
     CDS             390227..390532
                     /locus_tag="CNA01440"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511856.1"
                     /db_xref="GeneID:36392654"
                     /translation="MYGAEDSELKAVRASKRPERRKKRPKEIVFPDLDLSKIRREVVN
                     RPHRRRSRGAVIQQLKLRCDGPEKSENQVVGVSEAGYEESGIGAGYEARYGSRSAKS"
     gene            complement(391036..395312)
                     /locus_tag="CNA01450"
                     /db_xref="GeneID:3253629"
     mRNA            complement(join(391036..391461,391512..391637,
                     391692..391799,391871..392229,392381..393997,
                     394082..395030,395088..395312))
                     /locus_tag="CNA01450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656176.1"
                     /db_xref="GeneID:3253629"
     CDS             complement(join(391247..391461,391512..391637,
                     391692..391799,391871..392229,392381..393997,
                     394082..394926))
                     /locus_tag="CNA01450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511857.1"
                     /db_xref="GeneID:3253629"
                     /translation="MADPASPPSFDAIFAQQPVRRSSSTSTSSFANYTYSALQQHQQF
                     NSDAPLVDEPQSLSEQTRKQQRDPSKDSSNKRYLDMMSGLADGYGVINGRRQESLRKE
                     SLPFNPQEDSTLIATAPKRGERNGLGRNGYSSPIGDIMFGPEQIIRNQPQRPSQQPSW
                     GEGRISEQSVHYASVQQPQYSSFQSSGPGAGSTGMDYLPPGTASSMNDTMLSNQVSPY
                     LSHDAASEGRPQQQQQQQQGEWGQEFIGVEQQQQYAQGEGQSNGMEDMLTMGDESPFE
                     NELQRVISNTSHPSQYPSRTTSPFPQQSQSNIVPTSTGNHVRTESFPASRSPSPFPPQ
                     QASQTEAPNHVVSPPSMGQPTYPRASSSPRTNPNSPFFNKPQSPPALIIPNSPVLPSI
                     VTQSTSNNHSKGLNQSHTRHANNGAGGLFPPSNPALEHLTGMAGISPIAPNADGPMIC
                     IQPSTPISGLKEGRGLFDAALRRAGGAQRQGPQGQGESQQDQQQDGFNVPPPQSHPLP
                     RTSSSDQINQDVEMQGMDFAAQMQSYEQQGWASDTLRIAGPSRPRAKSDSIIPSPTAD
                     SFDRQAFLAFIGAGNAQPPPSNVEMQPGYVDVSEQWRNTVSAWKAGLGGGELSSQPTL
                     DPRLLPGRESNEAVYQQLLMQQQTGQLPRLDPDQLHQLTQIEAQRARFSLNTNVAPPK
                     YEPGEFSPTSMAFYQSMGLYPHATPEMSGTVSAPWSQTAFGQVPGPGLVGHPATAGPA
                     QQHFLTPTLSHATVRRRSFGGGEHPAMGAGTPGYGMEFSSPFMGKSVGQIRGVNMGHR
                     RAARSEDFGRGGTGWGVGAGGSTAEFLQSITGDDGSLLPPSNRGHAMSHSRHSSTSSI
                     RSASPALSISSQGSSFSHHSPRMDMPDSMYPGHPIIAPATPLQVSGLYEEQQAPARVA
                     KMKVTSVATEVASTSRRTNSGIFKCPVPGCGSTFTRHFNLKGHLRSHNDERPFKCLYE
                     GCPKAIVGFARQHDCKRHMLLHEGLRLFECEGCGKKFARLDALTRHHKSEQGQECAIT
                     HPLPTNFDGSPMSESQYKTYKGIKSTPEGSGRRQSSTASGSGSGSGKKRSKKSETSEE
                     D"
     gene            395993..396620
                     /locus_tag="CNA01460"
                     /db_xref="GeneID:3253627"
     mRNA            join(395993..396092,396145..396159,396240..396348,
                     396419..396620)
                     /locus_tag="CNA01460"
                     /product="expressed protein"
                     /transcript_id="XM_566615.2"
                     /db_xref="GeneID:3253627"
     CDS             join(396072..396092,396145..396159,396240..396348,
                     396419..396522)
                     /locus_tag="CNA01460"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566615.1"
                     /db_xref="GeneID:3253627"
                     /translation="MNTAGSVAYGWGALIVAAGVSFYYAKKEIDARRKEAQIKGTRPM
                     EKLSWEERIAREQQQGVQPSSITDQLKQASANKPSGGT"
     gene            complement(396567..399079)
                     /locus_tag="CNA01470"
                     /db_xref="GeneID:3253625"
     mRNA            complement(join(396567..397020,397077..397261,
                     397315..397340,397390..397563,397621..397925,
                     397985..397989,398058..398092,398145..399079))
                     /locus_tag="CNA01470"
                     /product="glycosyltransferase, putative"
                     /transcript_id="XM_566618.2"
                     /db_xref="GeneID:3253625"
     CDS             complement(join(396644..397020,397077..397261,
                     397315..397340,397390..397563,397621..397925,
                     397985..397989,398058..398092,398145..398960))
                     /locus_tag="CNA01470"
                     /codon_start=1
                     /product="glycosyltransferase, putative"
                     /protein_id="XP_566618.1"
                     /db_xref="GeneID:3253625"
                     /translation="MLSLLSSRYTRYSPLLLLFLLGSTFLLFERSSSSSSTLPRSSIY
                     DYTSPATHCFWPGTDASDESAATSQPKIPANKGNVGKMKEWIGWGDSEEVDEDVPSGE
                     GFAWEGQLPDVVPVRGIERYMLAHIEELQQGYDAKHDYEEYGLKIGNISLSAYTAELL
                     ETYKEYLLPPGTPPPNPPPSFLPIVLSRLSLRPPIAPLPPRPNQVMTTEKSVDDLPWQ
                     FQRWKEIMPEWEIKYYDDNALKNWVRGMFGGTKAEKIWKNLPRQVLKTDVFRYMAMLV
                     EGGIYTDSDTAPIIHADQWGHPYNHHTSPLLTHLSRILSISTSPHLPSSHPLSSFSPD
                     DAGTIDEELDVDVSTGKSTIYDGPLVDDGAELGQPSLVVSVESDAIDFGWHNWREVGL
                     SRAVQITQWTFMARPGHPVFLDALGRTLRKSEEMARKEKEAKKNGEEFIPETALEWTG
                     PGVFSDCVYRYLISRYGFKPDDLIHKKDPLRVGDVLILPAGSFSSVSPFGDEQQRNWA
                     ASWHGFFGRWRGADPGVQEFERLKKLKKEAEEAEKKAKEEAEEAERKAKEAEQQANET
                     SEQADKSAQDAEEKAKEAAEEAARKAQEASDKVEALGEEVEKAKEVAEGKSDGQDGGN
                     GEFTESREETEEEMLV"
     gene            399278..401589
                     /locus_tag="CNA01480"
                     /db_xref="GeneID:3253846"
     mRNA            join(399278..399654,399707..400626,400676..400731,
                     400783..401589)
                     /locus_tag="CNA01480"
                     /product="expressed protein"
                     /transcript_id="XM_024656177.1"
                     /db_xref="GeneID:3253846"
     CDS             join(400043..400626,400676..400731,400783..401471)
                     /locus_tag="CNA01480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512091.1"
                     /db_xref="GeneID:3253846"
                     /translation="MTRNSLPHIQSRPDVISAPPNAPHDTHKKEASSDSSNRGGPSVD
                     ANIGRNKQAARQYSGVFSPLGTTFGLETPQLATPEVTSPDTSMIAVHGSVLGSPFPPE
                     MGRGKHGRCPFSDWECFAVTQQKQVGIVNAGSTNPADTISDHDAEVEVSEAAKDSSPV
                     HNDRIIAIDFDDVCTQNMLAMITEHNTEYGTDLTLDDLETYVFWQNRGWGSPADVARK
                     VKILNQLLPKTAPIPGFAAALRTLHSFGHPIHIVTSRPESDREAVAEWLEQEGITIGL
                     GPEDVIAAAWFTGTYSSAYPEIGEKGDTESAIERENVLNDKLKDIWKEGVGKGKGGLG
                     KLKVLRRINAALFIDDHHGNLEPIVKAEPPIPCLLFGAYGWNRSRSGLTSPVELMDYD
                     ERMSRGLAFPFEEIITGKDHGLHRTKTWSDVIKWVKEWDREAMDVVCYDT"
     gene            complement(401376..403107)
                     /locus_tag="CNA01490"
                     /db_xref="GeneID:3253623"
     mRNA            complement(join(401376..401629,401690..401932,
                     401989..402058,402107..402246,402300..402525,
                     402587..402687,402740..402851,402914..403107))
                     /locus_tag="CNA01490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566620.2"
                     /db_xref="GeneID:3253623"
     CDS             complement(join(401605..401629,401690..401932,
                     401989..402058,402107..402246,402300..402525,
                     402587..402687,402740..402851,402914..403001))
                     /locus_tag="CNA01490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566620.1"
                     /db_xref="GeneID:3253623"
                     /translation="MATVTTTAATSLLFKQATIAGAQVPPMAIGTWSWGDKTWGYESK
                     DFENIKEAWSASVKAGLTFFDTAEAYGNGESERIIGRLIKEGTSEENKARLYITTKFL
                     PFPTRNGFFLFNPPVVEHLKASLERLGLDSVPLYQLHSSISLNSHEKIAAGLAQCVKL
                     GLAKAIGVSNFSKDELIKMSDLLEKHGVKIASNQIEFSLLRQLPEENRLLEEMKKRGI
                     ACLAYSPLAMGRLTGKYNASNPIPPGRRFSSQYSWEQLEPLISELGTLANKYEVTHSA
                     VALNWVMCKGAIPLGGARNKSQAEQNAKAVTFKLTDEEVDRLSSLGFSGKNTWFWQRG
                     "
     gene            complement(403123..404974)
                     /locus_tag="CNA01500"
                     /db_xref="GeneID:3253634"
     mRNA            complement(join(403123..403244,403303..403557,
                     403608..404018,404070..404431,404484..404563,
                     404621..404974))
                     /locus_tag="CNA01500"
                     /product="alternative oxidase 1"
                     /transcript_id="XM_024656178.1"
                     /db_xref="GeneID:3253634"
     CDS             complement(join(403467..403557,403608..404018,
                     404070..404431,404484..404563,404621..404882))
                     /locus_tag="CNA01500"
                     /codon_start=1
                     /product="alternative oxidase 1"
                     /protein_id="XP_024511858.1"
                     /db_xref="GeneID:3253634"
                     /translation="MSAILLRSGNVARSTILAGGPSIGGPMTLRSAYSSTRTFSIFTK
                     AKIQSGNMNRASLSLRPSVREAEKSQGPVVGSEGKGVEGPHYQDQASHNVLSDASTTG
                     AWTMFNPIYTEKELNTVQVVGRAPVTFGDKAAHKTVKFLRKCFDLLTGYTPYEVPASV
                     LAQKPIPIAELRSKGKLLSDQKWLFRIILLESIAGVPGMVGGTLRHLRSMRLLKRDGG
                     WIHSLLEEAENERMHLLTFMTIAQPGIFTRALVLAAQGVFYNAFFLTYLISPRIAHRF
                     VGALEEEAVRTYTHCISDMEAGLIPEWKDMPAPAIAIDYWRLPASSSLLDVIRAVRAD
                     EATHRFVNHSLANLDQKRDFNPFALSEASPEERGSKWGYTREESARFALEQQQKLMTA
                     SEKSKGLVE"
     gene            complement(406120..410222)
                     /locus_tag="CNA01510"
                     /db_xref="GeneID:3253879"
     mRNA            complement(join(406120..406912,407219..407552,
                     407610..407836,407891..408033,408096..408378,
                     408428..408572,408628..408800,408849..408958,
                     409014..409113,409175..409271,409323..409407,
                     409469..409559,409614..409869,409929..410222))
                     /locus_tag="CNA01510"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_024656047.1"
                     /db_xref="GeneID:3253879"
     mRNA            complement(join(406120..406942,406993..407552,
                     407610..407836,407891..408033,408096..408378,
                     408428..408572,408628..408800,408849..408958,
                     409014..409113,409175..409271,409323..409407,
                     409469..409559,409614..409869,409929..410222))
                     /locus_tag="CNA01510"
                     /product="expressed protein"
                     /transcript_id="XM_024656179.1"
                     /db_xref="GeneID:3253879"
     CDS             complement(join(406641..406912,407219..407552,
                     407610..407836,407891..408033,408096..408378,
                     408428..408572,408628..408800,408849..408958,
                     409014..409113,409175..409271,409323..409407,
                     409469..409559,409614..409869,409929..410066))
                     /locus_tag="CNA01510"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514119.1"
                     /db_xref="GeneID:3253879"
                     /translation="MTFDTSPTLLSSRVFRGASPDPTYRGISWSNEGQCMVVTPRTIT
                     ILTPHIASSLPPPRNPLTSQQSMKISEAQKLSNIKPGIQATDSGYNNNNQQLKARRLE
                     GGGVQWWSTAINVEINEEREWLYGWGDVSDNYLSMVETDSKGATVRQATWSPSGLSNL
                     GSCLLVVLTTSLQVSVYAPVENPLTQRWVEIADLTMLTKELLPPKEILNGLTSRGMLE
                     MRASSISWSPSLPLSSMLGVDGSILAVSDRIGKLALWTYGHQKRFQRLASISIGSPAN
                     WIADISWSDWTVKGDTCEALLALVFTDGSVQLLKIQQHAKQKLDSLSGWSCTIGEPIS
                     VDDSDRRPITAVKWVKDVLVWTKAGSVHMFANDESQSVPWKGMRNLRLERVGDWANAN
                     GLSACVGIHLINSSTLMITLSSLTTHFVYSFDESPEIAPTVENLRLTWPLRQMSLEPL
                     PISQPYLVERWRELTSNHAGWTLQTSGWAAVGEYGNSLTWITEPINLHTLHVSADADR
                     NSHFFMANFDNVIPPEKPVLSALEEIVEKPPNLLRISSKFALLPFLLHLSSSLQEDLA
                     ADLLQFLSSAVDGTADLKSMVALKNWPVDVWESSALNSLRICLVLTIWCTSAFPAFAN
                     EFQTLRLKISTCLHSYLITLTLSWLVTTEIASRPIGSFDRRFLHRLIKSVEGSPGPTV
                     APIISVAAEANQSRARHLAAELGMDGDAGLSGEPDEDKETSADGSPFAAETCSVTGLP
                     ITEARCRRCTTCSACSLIPERDFALQAVVGRDGKPEAPRNIQTGIGQTDWIVSTLLEG
                     AIGCVICGSRWASSAGYAL"
     CDS             complement(join(407208..407552,407610..407836,
                     407891..408033,408096..408378,408428..408572,
                     408628..408800,408849..408958,409014..409113,
                     409175..409271,409323..409407,409469..409559,
                     409614..409869,409929..410066))
                     /locus_tag="CNA01510"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512046.1"
                     /db_xref="GeneID:3253879"
                     /translation="MTFDTSPTLLSSRVFRGASPDPTYRGISWSNEGQCMVVTPRTIT
                     ILTPHIASSLPPPRNPLTSQQSMKISEAQKLSNIKPGIQATDSGYNNNNQQLKARRLE
                     GGGVQWWSTAINVEINEEREWLYGWGDVSDNYLSMVETDSKGATVRQATWSPSGLSNL
                     GSCLLVVLTTSLQVSVYAPVENPLTQRWVEIADLTMLTKELLPPKEILNGLTSRGMLE
                     MRASSISWSPSLPLSSMLGVDGSILAVSDRIGKLALWTYGHQKRFQRLASISIGSPAN
                     WIADISWSDWTVKGDTCEALLALVFTDGSVQLLKIQQHAKQKLDSLSGWSCTIGEPIS
                     VDDSDRRPITAVKWVKDVLVWTKAGSVHMFANDESQSVPWKGMRNLRLERVGDWANAN
                     GLSACVGIHLINSSTLMITLSSLTTHFVYSFDESPEIAPTVENLRLTWPLRQMSLEPL
                     PISQPYLVERWRELTSNHAGWTLQTSGWAAVGEYGNSLTWITEPINLHTLHVSADADR
                     NSHFFMANFDNVIPPEKPVLSALEEIVEKPPNLLRISSKFALLPFLLHLSSSLQEDLA
                     ADLLQFLSSAVDGTADLKSMVALKNWPVDVWESSALNSLRICLVLTIWCTSAFPAFAN
                     EFQTLRLKISTCLHSYLITLTLSWLVTTEIASRPIGSFDRRFLHRLIKSVEGSPGPTV
                     APIISVAAEANQSRARHLAAELGMDGDAGLSGEPDEDKETSADGSRKS"
     gene            complement(410561..412903)
                     /locus_tag="CNA01520"
                     /db_xref="GeneID:3253644"
     mRNA            complement(join(410561..411414,411466..411847,
                     411907..411966,412023..412102,412151..412193,
                     412250..412524,412607..412903))
                     /locus_tag="CNA01520"
                     /product="conserved expressed protein"
                     /transcript_id="XM_024656180.1"
                     /db_xref="GeneID:3253644"
     CDS             complement(join(410778..411414,411466..411847,
                     411907..411966,412023..412102,412151..412193,
                     412250..412466))
                     /locus_tag="CNA01520"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_024511859.1"
                     /db_xref="GeneID:3253644"
                     /translation="MVMFSLDAFIFSTICLLSHLPAAFAFGVQSYPNLFFDASTIVNN
                     EWFNGIDSRWARAMSEYWAQTLIQYGPWSVTNKSIAAKSGDKKDYLSWAVYHWPDCSN
                     VQNTTELTTEEVWDECDYVVRDGQVNPDTELVKDKEALQNMSNSIYLSAMAYLHTGDS
                     QYTTHINHALHTFFINNETRMNPNLNYAQVIRGPGDQMGRHTGVLDLACMAKIVSGVQ
                     VMRSIKPVEWQQETETGMMQWASEQLDWLYTSELGLAELNATNNHGTFAVNQVCALNV
                     LLNQSDACATALDDFYNGIYLDQIDANGDQPLESARTRPYHYRAYNLMALVTNAQFGD
                     FVGLSPSAWERRSAANATIVDAVHYAMLQNYTTSDELNQEKALNPVVAAISAKYGDPD
                     NKYADFLKSTDPYFPGQPWFALNEGLSDAGIKQGLLETTYGPVPPQPTLGAGSPDDLE
                     YGKKRDWKPRGAGWPTGAPRAP"
     gene            complement(413626..415086)
                     /locus_tag="CNA01530"
                     /db_xref="GeneID:3253655"
     mRNA            complement(join(413626..413825,413886..414105,
                     414159..414270,414318..414760,414818..414875,
                     414933..415086))
                     /locus_tag="CNA01530"
                     /product="glutamate biosynthesis-related protein,
                     putative"
                     /transcript_id="XM_566626.2"
                     /db_xref="GeneID:3253655"
     CDS             complement(join(413766..413825,413886..414105,
                     414159..414270,414318..414760,414818..414875,
                     414933..415035))
                     /locus_tag="CNA01530"
                     /codon_start=1
                     /product="glutamate biosynthesis-related protein,
                     putative"
                     /protein_id="XP_566626.2"
                     /db_xref="GeneID:3253655"
                     /translation="MRLFHLSRHLIQSKTFSLNRITFPVYSKMENNEKVLVGCIGGSG
                     LYHLDNLTFVKTVHIETPWGKPSSPINISSLPSGALVAFISRHGSHHSITPSEVPCRA
                     NIAALKHIGCEAIIAFSAVGSLREEIAPGHFIIPDQIIDRTKGIREDTFFRGEGLVVH
                     SMFGEPFSQKLNAFVAPRVEKILKETGDVVLHTGKTVVCMEGPAFSTRAESLMYRQWG
                     GDIINMSVIPEAKLAREAELDYTLICTSTDFDAWRTGYDPVTVEEVVKVLHTNAGNSR
                     AVAAGILQDVHDVVVEGKTLTDIKGSMKFACVTRKDIQPEASRKKLSYILPYFSD"
     gene            complement(415915..418212)
                     /locus_tag="CNA01540"
                     /db_xref="GeneID:3253469"
     mRNA            complement(join(415915..416160,416228..416894,
                     416951..417355,417408..417531,417585..418212))
                     /locus_tag="CNA01540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566498.2"
                     /db_xref="GeneID:3253469"
     CDS             complement(join(416062..416160,416228..416894,
                     416951..417355,417408..417531,417585..418149))
                     /locus_tag="CNA01540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566498.1"
                     /db_xref="GeneID:3253469"
                     /translation="MAVSKKSRKSEPSAAFTAADGLVLDQSEIMRAMLAAQKGKQKEE
                     SEGNDESDEEDDDVSNEGEDEGESSGSEAESSVAAQRNLKRRRSLSFELDAEGEEDKE
                     NEESEPRPQPSSGAGMLSRTALATKDMTPKPRSKPQPNGLASASKPSADVTFESLGLS
                     HPLITALASINIKKPTEIQAACVEPILSGRDCIGGAKTGSGKTMAFALPIVERIARDP
                     FGVWAVVLTPTRELAYQLSEQFLVIGKPLGLTTATIVGGMDMMKQAQELEARPHIIVA
                     TPGRLCDLLRSGGVGPGKLSRVRTLVLDEADRMLTPSFAPELAYLFSQIPAKRQTCLF
                     TATVSEAIMELANKEPPAGKQRPFVYRVASDTLTVSNLKQKYLFIPSQIRDPYLLYIL
                     QNPLEDIDVALRVDPKKAKAREREAALGKKGKKPRQAKEEEDAPSVPSTVIFTQRCAT
                     AHLLHLLLNSLDIPSVPLHSHLTQPQRLLSLARFRAHEVPVLVTTDVGSRGLDIPEVA
                     MVINWDCPRRSDDYVHRVGRTARAGRGGVAVTIITERDTELVKIIEDEVNVRLEELKL
                     DEDKVLEGLNKVSLARRMATMEMHDSGFGERQATNKAKQIKRMKRDAAAAGKA"
     gene            418412..420712
                     /locus_tag="CNA01550"
                     /db_xref="GeneID:3253467"
     mRNA            join(418412..418721,418780..420220,420274..420712)
                     /locus_tag="CNA01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_566500.2"
                     /db_xref="GeneID:3253467"
     CDS             join(418477..418721,418780..420220,420274..420645)
                     /locus_tag="CNA01550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566500.1"
                     /db_xref="GeneID:3253467"
                     /translation="MSPQQPANPSAASHNAQLLQSHDLVASLPTPYLRLLVLFARPIA
                     LFKHVLQVFLWSPGRRVESWMVVGAWWALCLGSQPAFRFLLPPLVFLPLLPLATLRLK
                     HTQKTPTENSPSSPATHDTLLLTLSDLNEIYALLPISPLPAMSDVYARFRQLGPVRLI
                     RGLAVLWGTWLVLGQLVVGYKTLLALIGTVILLLPSPPLAHFINLLSGSLFFRQAVAL
                     AFLFTFGSPPETSYRFKLNFSLWGWFKSKWTASRRPSLAFAFRPKMSGKVPSGSALEV
                     EREKSEGKEESHIKVESPIYFRFEIHENQRWWMGLDWTSALLPQERPSWCDSHLLPVS
                     PPQAFTLPAPVSVVINTATMKDRYARVMRSAEWKWLDDDWSIVRSGPGASAAPGTQTN
                     PVLPPENDPDSGHSLHQGQHHNQPQSPQARTASRPSSFISAFGSPTAYSPSSTEDSTS
                     SAGSRAQSIAEQAFTKGLERLKARAVSGTAPPATASSPRRSGESVRGRTGSYDATDEE
                     GSEGTPSTQIGQQPGSAPLPSETIPERDAATDADGWVYGDNKWENVGSKGGLGKFTRR
                     RRWRRRAICIETVRKLSPSDDPAITISPSATESGANTPTPATFAAAPSSPLKSKPAIG
                     LSEAQTKGTTASEEVLESVKESTIPEHKIGPYGASSSGSAPVSRDEMLRMRLKKAMGS
                     VGA"
     gene            complement(420703..423228)
                     /locus_tag="CNA01560"
                     /db_xref="GeneID:3253843"
     mRNA            complement(join(420703..421740,421797..421839,
                     421890..421975,422030..422104,422166..422653,
                     422724..422960,423052..423228))
                     /locus_tag="CNA01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656048.1"
                     /db_xref="GeneID:3253843"
     CDS             complement(join(420896..421740,421797..421839,
                     421890..421975,422030..422104,422166..422653,
                     422724..422827))
                     /locus_tag="CNA01560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514120.1"
                     /db_xref="GeneID:3253843"
                     /translation="MFFAPMTLVQLCSALIFMLLPVSAHIALWDPAMYGWDDDPNQSG
                     PVTPLMDLTFDQWWFHGYINSPPANNSIMELPAGGTYHGQVACNKALTSYGQDPAKQT
                     GIYACDGTGPSGGIGAMHTSDAWESSDPQDVKGCAIGIAYESNVAKIQPENFTVISVN
                     YTCPWKKQVEFQIPSDLPPCPKGGCHCMWGWVHAADAGSEQNYFLGYRCNITGATGVK
                     PLPQANTANKCDYPTDTSNCTLGAKQPHYWFQKERNNNFQDTYDPPFYNGAYGFMNGA
                     QTDLFDAVNKSNPTNTNVTTSSGNVNVSEALGSSVAVSSATVSASEGRSSLVISSPIV
                     SSVSSSTNVMATTSLTSQSVPSATTFSADVVAALQTSSSPSDSTRSSSASQTSAPSSA
                     AKTSHALDGTADPSTTLKTTLTRTITMYRSSTTSTTSASSSSDASPSNSSFMASTSVI
                     TSESSSVSIPSSISVAILYSPLVSTLSLSTSSLSSTFTAAATSPATTEIPPIVADANL
                     SSTKSSTCKRKRSGIRKHGIKEGRRKERVLGRAIGGAT"
     gene            complement(423424..426325)
                     /locus_tag="CNA01580"
                     /db_xref="GeneID:3253808"
     mRNA            complement(join(423424..423458,423514..423868,
                     423953..424038,424103..424181,424244..424302,
                     424359..424464,424519..424857,424909..425135,
                     425188..425325,425377..425471,425527..425680,
                     425728..425928,425985..426046,426095..426325))
                     /locus_tag="CNA01580"
                     /product="conserved expressed protein"
                     /transcript_id="XM_024656181.1"
                     /db_xref="GeneID:3253808"
     CDS             complement(join(423524..423868,423953..424038,
                     424103..424181,424244..424302,424359..424464,
                     424519..424857,424909..425135,425188..425325,
                     425377..425471,425527..425680,425728..425928,
                     425985..426046,426095..426276))
                     /locus_tag="CNA01580"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_024512047.1"
                     /db_xref="GeneID:3253808"
                     /translation="MRHSSLALLSSLLLLSLPTFAFWPFKEKRFKDEAFINAGPLGLS
                     KLGGRVAAIGDWDGDSKLDLFTLSDEAKTVQIHLWNGDKYKYIPSHTLSLSERIINVV
                     PGDYNHDGHLDLLLMYDKSEGGGWWGSKVERLGMGVYLGGGPDGGFQEESWTLPLSTP
                     SQPMVYDADGSLRPSLLGYQPTETGEGVVCWRNNGTGFTLEIPQLRPIDQICTMANPH
                     SSAFVDIDGDCLPDLVLHCSRSKTVSFIQIWLNRGDAGYILARSYDLPSGSGPISFAD
                     TNRDGSVDIIFPTCTHKSTSTGLGRDCSINIAQNKQVPLCSTEGSQWSTDGLLKCRGW
                     GDMCLSDEKFEFSFDESDPSFTSIPLSELLPDSSNPGILLHPPSDSSIPLPLRPGDFN
                     VDGFPDFLFVTSDDTKSSKSTQVNILENVPCAKGVIGCTKGVRRGWRLGHGKGWYDLE
                     GITDAVGASWLDLDEDGSLDIMVQRSGDQIGHKVTFIQNNFYHDAFFLKTEVLNGVCD
                     GKCEPVAGGKSYNPLGVSYSGATYKFTVLDTAGHRVAQQVAQLPQTGYHALQTPYAFF
                     GLGRTNNYVEKLFIGVSLAPPNHITFLESLIPNSQVIINPPYPAAISSPDEKREEPRS
                     PVKARSTEWKSQLYLKPGEWVPWVGAAVLGTVIVLGTVVLGLNEREKREDERDRQRAL
                     HAINFQAL"
     gene            426513..428274
                     /locus_tag="CNA01590"
                     /db_xref="GeneID:3253890"
     mRNA            join(426513..426716,426768..426921,426978..427194,
                     427239..428139,428205..428274)
                     /locus_tag="CNA01590"
                     /product="(R,R)-butanediol dehydrogenase, putative"
                     /transcript_id="XM_024656182.1"
                     /db_xref="GeneID:3253890"
     CDS             join(426576..426716,426768..426921,426978..427194,
                     427239..427983)
                     /locus_tag="CNA01590"
                     /codon_start=1
                     /product="peroxisome assembly protein, putative"
                     /protein_id="XP_024511833.1"
                     /db_xref="GeneID:3253890"
                     /translation="MGEVYEGESPAESSRAPKVNQLDADELDDALVSMLGEKVLRSID
                     NFKPKVSWDFKPEIELVIKLVIFRLGICDSLSRSSPGAKLQNLKLIHHPQLGIKTIRS
                     ALLLYLLLHPPIFPSYLLKRIRQHALSKQWPDLPNYDWRKKAWKALGRIELASKIWEA
                     SGWAGFLWDGKYPSLLMRILGLRLVPSQPHLTKLVSYEFMNRQLVWSAFTEFLMFVIP
                     LLPTVPPFLRLSPSRFFKPISTFLSQPTDIDYSSLPPIPLDRRGLNCGDNEPRKHGGP
                     LAHLPKTTCPICYIRHSAAPVPLSSTSQGSSLTLPPIPGSSEAAFGHEASETDGEEEC
                     GIFMPARTDCDGGCLWCYYCIGEELYRHRKTNLQKIYRSKQMRNGRQELEKTDEEVKW
                     NCLRCGDGVTKAWRADSQDEAQLLYG"
     gene            428455..432306
                     /locus_tag="CNA01600"
                     /db_xref="GeneID:3253614"
     mRNA            join(428455..428750,428799..428936,428989..429085,
                     429141..429261,429311..431849,431901..432306)
                     /locus_tag="CNA01600"
                     /product="(R,R)-butanediol dehydrogenase, putative"
                     /transcript_id="XM_567251.2"
                     /db_xref="GeneID:3253614"
     CDS             join(428723..428750,428799..428936,428989..429085,
                     429141..429261,429311..431849,431901..432181)
                     /locus_tag="CNA01600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567251.1"
                     /db_xref="GeneID:3253614"
                     /translation="MDNNAIQIAVRVRPWHPEKELPFVQRPSTQPFFQGDGNFGQLPQ
                     KAAAGSLREVVDVIDHRMLDFDKPLEEPGKRGPFVMGRRYKNRKYVFDQVFGMGAEQE
                     EVFTKTAKPLLPGVLDGYNATVFAYGATGCGKTHTISGTEEQPGIIIRTMRELFDLVE
                     ETKDKYDTYFEMSMVEIYNETIRDLLGDDYPNCPYGGLKLLENEKERVTIDKVTLKRP
                     TSVEEVMSLVMLGNDRRSTSFTERNSVSSRSHLVLQINVGRNERGTDIDVANSIVRQC
                     STSATLSIIDLAGSEKASVNRGQRMKEGANINKSLLALSGCISALCQRPVRGVRVHVP
                     YRDSKLTRLLKFSLGGNCRTVMINCISPSSKDIEETNNTLLWADKAKKVSTKVSRNTA
                     GVELRTAQWLQKIVTLEETIKTLRSQLDNSHNAKSGLQQKRLEKARAESREELGKVEA
                     ELDALLPIIVEGSEMEALWSASVLQVEALEARLQDITVEVKDGRSEEDAKKEKDHLRS
                     LILQQDDAFRFNHEIQAGIQNKSLKYITLTNLLKKAEEKMFGEDIEEALYQHQLKVAE
                     HKAHTARSVAAARERGLRDYISQQAEALAKAASAFSRFSNQLRSEIIAVQSMQSGDDL
                     ASLKSRFLALGNQVDQSTAVLFGKSHSLPAAPSQHRLPVSLAAPSPRRVSVGRHAHSP
                     MRQNASPKSVLRKNLFAGMSVPEKAIEAKPRQIRWPDETGEGKIDDRSIAPDCPIFSS
                     PGSGGEDSVLEEETNPVSMIPPSLRPASSATSCASMSPAPSTSNTSASEEIPAWKQMR
                     MARGLIPQSQSGDNVGGNLSFDSKSPTSGSSRAGRTGFVGSSAKPGRPGPLSEMSIQT
                     SAQPSPPSSSSTSSLLKPTASSAAKANSSSAFANIKIAMPASATAGTMLPPPVPPHRR
                     DSMIGPDRHGRPKQRLSMIPGHAEASFSGVGKGLPSGGLSTLSGGARIVSNDSKRRMS
                     VQAGSVGSTYSPPVRAPSISSRPSLSNLRGAASCGDTSVSTSRGLSTRPSVNRLNVGD
                     VSALAPLPRPSLSTRYSMTRLNSGVTTGEGGGKPVWR"
     gene            432711..434139
                     /locus_tag="CNA01610"
                     /db_xref="GeneID:3253463"
     mRNA            join(432711..433160,433220..433246,433304..434139)
                     /locus_tag="CNA01610"
                     /product="expressed protein"
                     /transcript_id="XM_566504.2"
                     /db_xref="GeneID:3253463"
     CDS             join(432732..433160,433220..433246,433304..433993)
                     /locus_tag="CNA01610"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566504.1"
                     /db_xref="GeneID:3253463"
                     /translation="MPRGYSSSIGSASTYSPLLINPSSQPESSFVPPPTNGHRLSLRY
                     AYPLVPLASLDALYTLHHHISTSQGLPGDVLTIGIARALVLFAVGCTQRWRARGGWVG
                     VVKAVSIFMAIWEACRRVLSRNLENDGNEGLETNLIWFLMAFGGLGIVEYLVFLLLLR
                     LSPPPLRINPLALRLPRSYTQTDMPFAFHTESAILTPGSLRAQRRMHGRNISNVSRTT
                     VRSDWSRSERGVQGERDVFRVNDQFMEDGEDTDEDEGGSGEPVYEYDDYTSDGHDGFP
                     EGDDASSVSSSSIIDLPPPLSPAALSVPTFPASLSISSRLGALDRSPVIGPLVRRTRS
                     ARFLGRSWGSSTGREVDGEAELGQAGSSIGRDWCTREMDEGYGTFND"
     gene            complement(434025..438241)
                     /locus_tag="CNA01620"
                     /db_xref="GeneID:3253886"
     mRNA            complement(join(434025..434505,434572..435002,
                     435083..435500,435561..438241))
                     /locus_tag="CNA01620"
                     /product="conserved expressed protein"
                     /transcript_id="XM_566506.2"
                     /db_xref="GeneID:3253886"
     CDS             complement(join(434163..434505,434572..435002,
                     435083..435500,435561..438229))
                     /locus_tag="CNA01620"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_566506.1"
                     /db_xref="GeneID:3253886"
                     /translation="MPKPTFIQTVLRKPARSYADPNAPPPWSDSYRDADRYPASAASR
                     YAPVDDYRPAYAHSHICHQDAGPSRRVSRAPSSVVSASAASDTSFRTTRFPKPSGKAT
                     HHVVLRNGEIVHAPVGESVSEIGTASAAPSVRSSRRKEKPPPPVQAQPGNVPAKTTKK
                     RKPKPVIDRSDSSLCSTPPALHSRLSETSSASSSPLVPISPVAPTLPRVTQSAAEKQL
                     KAAKQPTRPPISVPANAPTALLTPPASRQSTPSSSSQSVTPPTPIPPKIELVQQVSNS
                     DSDSEVFYTPRSSFSFSFDAAAPVAIDAPLPEPIETPRAVDMAEPMLDPVVTPKPRPK
                     TEILLGAPVFNLLPPTPAPIPDPISTPFHSQPTSPIDRSALHPDHLPHTTSRPTLAPR
                     VINPPRNTAEQPPPLPSKDDEDMESASGQAGSDDEEESARQPHRRAGGSRTPKSSSRP
                     CSRAQSIRSSSRRSHNAFEGISRSTSEASFGSGGGGGGGRDGASGASRASSIVAGFGK
                     GGWAAAAASTGSRSGATTPVMYLPPNGTTGWEGFPPTPAGASNSPPRRQSKFTPLPAA
                     SLPSFDKLINSPSLAGGSIHSPSNASANGGNVPQALYDPSVSASVSASASVPVSYSSP
                     SEYSQGSASDNLPLPSRSYAPKLYSSETRQSSSSSRLSEADADGQEDNRQGLNTTRSE
                     LQRPEAPVYPPRTPSPLPPSSSSPGRLSQSSRPTSPSLLTSESTWRPPQSQSQSQSPI
                     PTRPTTPRAGFEPPSFLDPDILTILPEMTPQDSERLYRSSPPPERSRSRLSMYHDNGG
                     GHLSHSRKSSIFRGSRSEVGHGPTAGHVHGGSEAGEEDDGLAELPLPSMIKRSKSAAG
                     YRFTGGSKWEGSSYGDGMLMESHGRDQESAPGYTNLILPLGAYKQSNPAKSAPDLDAR
                     ILGLPHATMASITLHSTFDHHNATPAHLRDQLPPLVEFSSHSKPPGKTGKNQVLVQVY
                     AVAVDQVDVRAVDEKGRGDVGKYVPGRSFVGRALVVGTDEKEVVRGDVVMGLLDIRKS
                     GALAEYILVDRRRVSRAPFPTLLTLEQLSILPLQGIAAARCVRGSLNRQFRAIIINAH
                     TGIAALVCQVMSRAGVYVTAIVPGGDDSHEAHQKCIENGAKGVLMGSPAAVMINLEEN
                     GYDFVFDTQGGQRVYDTAKRALKSGGKLVSTKRPETTLNRVPPHLASRPSGIKTLRTV
                     FGSKRKDSKFIAFEYVSPIGSGEPEIDASGMDCRDVMEEPCMATFRPVLEGENAVVPF
                     ERGADVFKRQGWDECGVRVVRIIN"
     gene            438571..439981
                     /locus_tag="CNA01630"
                     /db_xref="GeneID:3253461"
     mRNA            join(438571..438659,438695..438828,438872..439981)
                     /locus_tag="CNA01630"
                     /product="conserved expressed protein"
                     /transcript_id="XM_566508.2"
                     /db_xref="GeneID:3253461"
     CDS             join(438606..438659,438695..438828,438872..439961)
                     /locus_tag="CNA01630"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_566508.2"
                     /db_xref="GeneID:3253461"
                     /translation="MDEEKLGMGRTEVALALKTILDPALYPLCIADVDGVSHTTLVVA
                     CLRKLQGWHMDSIVDEISRFAPNYEDLPLVAFISSFCAPPSSSSASAGAPSTADQFTL
                     PPPPYPAWLWPCPPSAQPRPKPRDRSSSTPAATPVSFNPLPFPHPLVARKHPTMRLVF
                     PPLPPHAQTQLQSQPPGQQQQQQTLTALPLNSPGPIVPILPSPAHSDISRMPSLRHHR
                     EKSTTSSPTHTQSPPPPPPPATKDDAQTSVSPGPNAGAGVGRTDTVSDRAGSPEQGVL
                     GVAANIVNASLNGIAGVLSSAGVTPPQAEEQAKSAKQAAVETPKDEEREGERERGDLT
                     EGKAANQTITTSMNAFNMNREPTLSSSEMAESSTSGVTASADDVDDQDHLRESEGEED
                     EDDYDEEEEEEEEEEEDIRATSQYISALDLAGF"
     gene            complement(440022..442370)
                     /locus_tag="CNA01640"
                     /db_xref="GeneID:3253450"
     mRNA            complement(join(440022..440137,440202..440405,
                     440461..440472,440535..440680,440752..440793,
                     440852..440909,440976..441148,441199..441354,
                     441426..441744,441879..442041,442104..442121,
                     442172..442370))
                     /locus_tag="CNA01640"
                     /product="glutamate carboxypeptidase protein, putative"
                     /transcript_id="XM_566524.2"
                     /db_xref="GeneID:3253450"
     CDS             complement(join(440084..440137,440202..440405,
                     440461..440472,440535..440680,440752..440793,
                     440852..440909,440976..441148,441199..441354,
                     441426..441744,441879..442041,442104..442121,
                     442172..442257))
                     /locus_tag="CNA01640"
                     /codon_start=1
                     /product="glutamate carboxypeptidase protein, putative"
                     /protein_id="XP_566524.1"
                     /db_xref="GeneID:3253450"
                     /translation="MADPKFLQYVDDHKDDYINRLSKAVSIPSVSGNLSYVKDVEAMG
                     EFLLEQLTSLGVKAEKRAIGTHTLEGKEVDLPPVIIGQIGQDPKKKTLLVYGHYDVQP
                     ALLEDGWLYPPFELTPDPNGSGRLYGRGSTDDKGPVMGWLNVLEAHKKLGIELPVNLK
                     VCFEGMEENGSVNLDKFIESEKNKFFAGVDCMCISDNYWLDTKTPCLTYGLRGINYYE
                     IKISGPDRDLHSGVFGGTVHEPMTDLIALMSKLVTPDGQILVTGIKDLIAPVTDDERA
                     KFEAIHFQMEDIHAAVGGEVTISDDTVTTLMGRMRNPSLSLHGIEGAFSAPGSKTVIP
                     CCVKGKFSIRLVPNLTVAGVTDLVVKYVEEEFKKLGSKNKMEVYLTHGGEPWIADPNH
                     YSYRAAHKATESVYGQVPDYTREGGSIPVTLDFANILNLNVLLLPVGRGDDGAHSTNE
                     KIDTDNYIRGTKLLGTYMYELAAAQA"
     gene            442577..444745
                     /locus_tag="CNA01650"
                     /db_xref="GeneID:3253603"
     mRNA            join(442577..442633,442702..443088,443139..443411,
                     443464..443700,443751..443867,443921..444254,
                     444319..444330,444415..444745)
                     /locus_tag="CNA01650"
                     /product="expressed protein"
                     /transcript_id="XM_024656183.1"
                     /db_xref="GeneID:3253603"
     CDS             join(442592..442633,442702..443088,443139..443411,
                     443464..443700,443751..443867,443921..444254,
                     444319..444330,444415..444599)
                     /locus_tag="CNA01650"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512026.1"
                     /db_xref="GeneID:3253603"
                     /translation="MANPFSLINAPRPDDGSPPRQSGSSKFVILGPNIGQYFEVSSSE
                     GSSCSSSPSTPSHSPNRLNHQHSFDTSKGRSPSPTECDEIDRVEYSSPAIEMEACQMS
                     GWDSSVSELSEGDSETETSMIITPDRDIRDGQSQRLDIRDIALLLKQTSIKSEHPALR
                     PNRLLSCRTTSSHTVVPRDFNRRCSESCSVTSASSSSFHAPQPGELNQHGDTVACEAC
                     GRGTTITNAKKIMPCQDVTCASCFSSTLGAVTVTQSQAKCPVCFCLIGTFEAVTLEDI
                     VKLQHCSEKSPTTTLPSPFEHGLGVGPVVMRIDNVAWDITPAIVEAFLPRNSLSHRTL
                     QPIHILLDRFDGRTKDYLYIEAATPQAAQTILKTCQNTFLSGGALTSGRRRPVTITPV
                     SHSELIEELRPHSAQELHSLLALCQAAIDSNSGSKQSTSKYIKSRHGPYYALMSTMSK
                     MNGEQSPSYWDMFYVASGAISALSKAITRQAYFRSSQGSPARSYPTDAITLVSEEDLL
                     VRNKLLMLFEKCFGMMPRAN"
     gene            complement(444655..449280)
                     /locus_tag="CNA01660"
                     /db_xref="GeneID:3253448"
     mRNA            complement(join(444655..446261,446315..446473,
                     446528..446865,446916..447160,447214..447941,
                     447993..449280))
                     /locus_tag="CNA01660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656184.1"
                     /db_xref="GeneID:3253448"
     CDS             complement(join(444822..446261,446315..446473,
                     446528..446865,446916..447160,447214..447941,
                     447993..448847))
                     /locus_tag="CNA01660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511836.1"
                     /db_xref="GeneID:3253448"
                     /translation="MPTPENKPAGKDSDPSSSFPISSPSFWAEAANIPIPPVDHKHPR
                     SSPAEADTGEVSSRVQDDSPLPKRPRTSTKSPDHGLTFLPNPQDIDPDDPQAYLANPE
                     YAPNRFGDIGDYMRKKEIKVQAQNASIAASVASGTLPQIFAGLSFYINGNTQPSMEQL
                     RKLLLQRGGTVYPVLRNKTMVDYIIAPVLTLKKHEEFKRHKVVKEGWVVESCRQDKLL
                     DWRKWRLQPDGEGSEAGAKGLESFFAQKAKARQDFVEPIEESSNDPIDKKLAAPVDED
                     TARNVPSEVINVTPTKPIPMQLQRLLTPRKQRHAPIPISPGQPPPSPTFSAPVSPKIQ
                     KPEGAWEHYYKKESNEHAAKALQSDTWRAQNTAEQGNAGGFIDGYYQNSRLHHLSTWK
                     AELKVLVRDAQKRSEEALAKAAVKELAEGGEERGQAVHSLAKSVLPSIPLPAVPSDSA
                     NRVIFHVDFDAFFVSCGLATRPHLKGKPTVVCHSSGRGVGSTSEIASCSYEAREKGVR
                     NGMSLGRARELVGPDLKTMPYEFETYKRFSLAFYTVLMAYADELQAVSVDEALIDVTS
                     HVAARAALPQETAVGQKREERDPAVELAEKIRDDVREVTDGCEVSIGIAHNILLAKLA
                     TRHAKPAGVYHLISEAIPSFVHRLSVEDFPSVGYSTKSKVEAAFKTTKAGELLDISKG
                     RWKSVLGEKTGEMLWGYLRGIDSRKLEGDKVRKSVSAEMNYGIRFQTQVQAEQYVHDL
                     AAEVSKRMKNVGVKGRQITLKLLKRHPDAPVEPPKFLGHGWCETYNRSSTLSAPGGGP
                     TDDPKVLGTEGVKLLRSLSIDPVELRGVGIQVTKLDTEGTERGQVDRPTGQRTLNFAK
                     QSKNDTEPVAGPSRLPAQAQNTEIDGLDAEFLAALPPSLASEVCRDHALNNSNATKAV
                     AVQPSRTPPLEIISIPSSTPPLKAESPRSLRPPSPQADTSPEKPISKLRGPNEAAHIA
                     RQLRPKTKVQMKAGMVAEGPLFGAWSKAREKTVEVELDKTRHQKSTIVDLTNTSSPQG
                     TGSDNKAELDEDQIVPGYTLAYLRSLGIDPDVLLALPKAMRKEVIVQEEENARRRQAL
                     FQPGDRSRSRGTSTSVSPVKLGGVGAYRGRSTSRSIPPQQRQSVKIIRPPKPALMNST
                     ELPDVLRTIELWIESREDSPPADKDAIKVAAFLKKCLNDGEGKVGDGVEKVVEVLRWM
                     RMIIKEKWAQDEGLNEGASEAGREWWRIWRQMRDEVNLICVKKFGAGLRI"
     gene            450060..451149
                     /locus_tag="CNA01670"
                     /pseudo
                     /db_xref="GeneID:3253936"
     gene            451436..453670
                     /locus_tag="CNA01680"
                     /db_xref="GeneID:3253861"
     mRNA            join(451436..451528,451599..451911,452076..452180,
                     452232..452364,452423..452704,452757..452849,
                     452910..453043,453098..453425,453476..453670)
                     /locus_tag="CNA01680"
                     /product="heterotrimeric G protein alpha subunit B,
                     putative"
                     /transcript_id="XM_566528.1"
                     /db_xref="GeneID:3253861"
     CDS             join(452138..452180,452232..452364,452423..452704,
                     452757..452849,452910..453043,453098..453425,
                     453476..453521)
                     /locus_tag="CNA01680"
                     /codon_start=1
                     /product="heterotrimeric G protein alpha subunit B,
                     putative"
                     /protein_id="XP_566528.1"
                     /db_xref="GeneID:3253861"
                     /translation="MGCTQSTEDAAAKARSAEIDEQLKRDRANLRNEIKMLLLGAGES
                     GKSTVLKQMRLIYNKPYDAEERDSYREIVYSNTVQSMRVLLEGVQFMDIPIDTSNQSR
                     WELIMAAPPQIEGDVFPPKLTDAVAGLWKDYGVQQAFFRRNELQLNDSAPYYFDAIAR
                     IAQPNYMPTDQDILRARVKTIGITETHFKIGELTYKLFDVGGQRSERRKWLNIFDSVT
                     ALVFLIAISEYDQKLYEDETVNRMQEAMTLFESVANSRWFTKTSIILFLNKIDIFREK
                     LLVSPLSNTFPDFRGGNDYDMACSFLLEKFVGLNNNPSKSIYAHYTDATDTKALKFVI
                     SAINDVIIQVNLRDCGLL"
     gene            453979..455450
                     /locus_tag="CNA01690"
                     /db_xref="GeneID:3253446"
     mRNA            join(453979..453999,454061..454154,454223..454234,
                     454306..454515,454565..454691,454759..454906,
                     454970..455045,455107..455450)
                     /locus_tag="CNA01690"
                     /product="carboxyl-terminal proteinase, putative"
                     /transcript_id="XM_024656185.1"
                     /db_xref="GeneID:3253446"
     CDS             join(454107..454154,454223..454234,454306..454515,
                     454565..454691,454759..454906,454970..455045,
                     455107..455202)
                     /locus_tag="CNA01690"
                     /codon_start=1
                     /product="carboxyl-terminal proteinase, putative"
                     /protein_id="XP_024511838.1"
                     /db_xref="GeneID:3253446"
                     /translation="MSEAPSKWVPLEASPDVFNAWSEPLGLPQSLAFQDLFSLDPSFL
                     SFIPAPHRAVLLLFPSKGKLQEERSKEDRDDGKQFKGEGIWWIKQTIPNACGSIGLLH
                     SLLNLPERGPDALNPDSKLAQFKAESLPLTGLERAKLLDETTFFTEAHTSAASTGQSV
                     VPTDLDVDEHFIAFVEGVDEKGEKRIVELDGGRNGPLDRGASNNFLEDVAKVVQEKYF
                     ERAEGDVNFNMIVLAGKSDD"
     gene            complement(455193..457385)
                     /locus_tag="CNA01700"
                     /db_xref="GeneID:3253444"
     mRNA            complement(join(455193..455432,455477..455992,
                     456060..456245,456313..456438,456489..456609,
                     456663..456880,456941..457060,457124..457198,
                     457277..457385))
                     /locus_tag="CNA01700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566532.2"
                     /db_xref="GeneID:3253444"
     CDS             complement(join(455331..455432,455477..455992,
                     456060..456245,456313..456438,456489..456609,
                     456663..456880,456941..457060,457124..457198,
                     457277..457330))
                     /locus_tag="CNA01700"
                     /codon_start=1
                     /product="negative regulation of gluconeogenesis-related
                     protein, putative"
                     /protein_id="XP_566532.1"
                     /db_xref="GeneID:3253444"
                     /translation="MAPAYPANPLLLEEPLIRTSYELLRRSHRSAQRQVEKDFNAINS
                     GLQAILKSMEKGSITDEGRMEIVKKVDQVTERANGLKRKLDDLQPSASRPNTLRARLD
                     YLEQNFPGSTTPSKKTKPKGESNRAAASKADKADAASNDMQIDEEDATPLPSNEADKS
                     EPTPDSSTLDRYIVDYLIRKGRLNSATALATSQGIEELVDIKLFAELAKIENALVEKH
                     SCTEGLAWCGENRGTLKKTKNNLEFTLRLQEFIELCRKRDITTAIAYARKYLSGWASA
                     HMSEFQKGMSLLAFGEKTGVAPYRKLYDQSRWEAVRDQFRETFLDLYAQPSQSLLALA
                     LSAGLASLRLPSCVQNVRPNKSTGGDNTSVNPVVPLLPAVPPLHNLETTLFSPASSTH
                     LTAPLGGIPSSPTTDLHAHPEAVTGNIDCPTCDENMRVLASEVPMSHHVNSTIVCRIS
                     GQVMDSENEPLAFPNGYVYSSKALAEMAKNNFDVVTCPRTRESCAFGRLRKVYIS"
     gene            457574..458648
                     /locus_tag="CNA01710"
                     /db_xref="GeneID:3253443"
     mRNA            join(457574..457695,457772..457888,457957..458114,
                     458177..458257,458309..458390,458442..458648)
                     /locus_tag="CNA01710"
                     /product="retrograde transport, endosome to Golgi-related
                     protein, putative"
                     /transcript_id="XM_566534.2"
                     /db_xref="GeneID:3253443"
     CDS             join(457615..457695,457772..457888,457957..458114,
                     458177..458257,458309..458390,458442..458534)
                     /locus_tag="CNA01710"
                     /codon_start=1
                     /product="retrograde transport, endosome to Golgi-related
                     protein, putative"
                     /protein_id="XP_566534.1"
                     /db_xref="GeneID:3253443"
                     /translation="MVLVLVIGDLHIPNLVHDLPAKFKKLLVPGKIGQIICTGNVCDK
                     ETYDYLRTTAPEVHVVRGEFDENPHFPLSLIIQHQSLRIGVVHGQQVVPAGDPDMLAA
                     LARQMDVDVLISGGTHRFESFEFEGRFFVNPGSATGAWSSLWNGEVTPSFALMDIQGP
                     VIVTYVYQLVDGEVKVDKVEYRKPDPTSEIQSQSTRSEVAARW"
     gene            complement(461722..464296)
                     /locus_tag="CNA01720"
                     /db_xref="GeneID:3253848"
     mRNA            complement(join(461722..462709,462766..463053,
                     464052..464296))
                     /locus_tag="CNA01720"
                     /product="expressed protein"
                     /transcript_id="XM_566536.2"
                     /db_xref="GeneID:3253848"
     CDS             complement(join(461855..462709,462766..462939))
                     /locus_tag="CNA01720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566536.1"
                     /db_xref="GeneID:3253848"
                     /translation="MSASAIPAYRHNSASPVSSRKAVKASASASASSSRPPTRSSQDP
                     YYGHEETAVLAARFITHLFQCPNIPAPSTPGAPTPTLAHFVAYALHRTRLPSVVTFAA
                     LLLLQRLKRRYPAARGSSGHRLFISAFMIASKVICDDTYSNQSWGIVAQKMFALKEIN
                     QMEREMCGYLEWNLNFGEREMLEFEMDLRALHGPRAVARASSSSSSRSDIVLTDSPCN
                     SYPTPETTPDPQVSSRPIRPVPSPYKTRCYSHVPPMAPAFLSPPLSPHHAHLSPQPPR
                     LSSANSSLQSSPASDDCKTPSPITVMATTRPISSTKSFDMTKAFEATARTRGVSVVRR
                     GDDSVAVW"
     gene            466534..469025
                     /locus_tag="CNA01730"
                     /db_xref="GeneID:3253441"
     mRNA            join(466534..467081,467139..468106,468154..468328,
                     468392..468628,468678..469025)
                     /locus_tag="CNA01730"
                     /product="cleavage/polyadenylation specificity factor,
                     putative"
                     /transcript_id="XM_566538.2"
                     /db_xref="GeneID:3253441"
     CDS             join(466848..467081,467139..468106,468154..468328,
                     468392..468628,468678..468899)
                     /locus_tag="CNA01730"
                     /codon_start=1
                     /product="cleavage/polyadenylation specificity factor,
                     putative"
                     /protein_id="XP_566538.1"
                     /db_xref="GeneID:3253441"
                     /translation="MAYQAHQAYQQAPYYPPPPVQPTTDVFRRQYADRLRALTFNSRP
                     IIQDLSMLAMAARDRNDWNGMQAVVEEIELAVLRALPQQKLPLLYLLDSISKNVGPPY
                     TTRLLQAIVPRLYIKTYREVDGVTKTKMEEMIGLWRTGGPGGSELYGSHVREQVEREL
                     FGSAGIQNFKVPNRQQVQVLLNAALDNKRREVAMRPGDVVLGRQMNALLGIGELLSTT
                     NVQPQELSMIVEQLKSMAPPSVAPTPTQVSVTPSWGPSPSVNDLAPSNLPPFPPKLPA
                     VNGNGYTNVALPPFPSNIPTPLGTISTPPVTSSQTPIPGNQRSLTPVMAPASLAPVSS
                     IVPSVPSIPVDVARILQTLNKSGIGSQPQTPDVDRGTPGPNMVPAIEAYEDMILRLDI
                     KLKSIDLNAPHKLSFAHLSHRCQQCGMRFPSANAAFDAHMDWHFRRNKKERESGGRGA
                     HRRWLPRVEQWINDATTLPSTAASSSQTEKATVSAERLAQLRQKWVKVPQDSKKAASV
                     CPVCKEAFRAEWSDSEEEWIWKNALAINGIFYHATCRAEQTSALKRLKAADPNRRTSS
                     SASPRTTPSNEGLKPEAQKRKVEGMDIEHEEGSKRVKVEEIVGDI"
     gene            469179..470691
                     /locus_tag="CNA01740"
                     /db_xref="GeneID:3253439"
     mRNA            join(469179..469541,469595..469771,469832..470016,
                     470065..470339,470391..470691)
                     /locus_tag="CNA01740"
                     /product="expressed protein"
                     /transcript_id="XM_566540.2"
                     /db_xref="GeneID:3253439"
     CDS             join(469226..469541,469595..469771,469832..470016,
                     470065..470339,470391..470532)
                     /locus_tag="CNA01740"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566540.1"
                     /db_xref="GeneID:3253439"
                     /translation="MRIPFLAASFPFVLLPFATARSSQQPLQVYLYPSPQSSTNQQLT
                     PPTLSYTQAKAVLDHHLRQDSSVFDEIPEDESMWVHLLGLWDSRETGKARVVVVDGGV
                     EAQDVLPPSLPSEPSFYLDDNVRSHYLLKPYVHSARKTFESIGDALPAFSKSIKDMFD
                     LAGTKAAEILFQELSCLSALADSLPWIDRAGEHPWNAVTITGLKDAQKGSELWETGRK
                     TVQAGLESMTGFDSPPLLLIIRPSSSKVLLPRSAMTNSLQGRSLSSQTCYSSNEACTE
                     ATNCNDRGRCAIKSAENDLECWACKCKNGYTGEECQKEDYSTSFIILIFSTVLLLALA
                     GGSIALLSTIGETKLPSTLNLAVSGGVKHN"
     gene            complement(470573..471140)
                     /locus_tag="CNA01750"
                     /db_xref="GeneID:3253988"
     mRNA            complement(join(470573..470734,470805..470875,
                     470934..470966,471019..471140))
                     /locus_tag="CNA01750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566541.2"
                     /db_xref="GeneID:3253988"
     CDS             complement(join(470675..470734,470805..470875,
                     470934..470966,471019..471073))
                     /locus_tag="CNA01750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566541.1"
                     /db_xref="GeneID:3253988"
                     /translation="MSSTQDEAILRNARETIDSLYDLSQLLQTGLDKSTLSICVGMIE
                     QGANPDTLAAVIKELRSENEALNSQSNA"
     gene            471286..473867
                     /locus_tag="CNA01760"
                     /db_xref="GeneID:3253833"
     mRNA            join(471286..471834,471904..471980,472042..472584,
                     472635..473867)
                     /locus_tag="CNA01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_566542.2"
                     /db_xref="GeneID:3253833"
     CDS             join(471342..471834,471904..471980,472042..472584,
                     472635..473648)
                     /locus_tag="CNA01760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566542.1"
                     /db_xref="GeneID:3253833"
                     /translation="MRKRRTTPRSNISKNANISKQLATTLPEGETQSTRKIQAASVEK
                     QKPVIELLGAGRSTLVSNDEDYLSPQVPPKPIISLEHPSSTTSTIKVATTFPHIVFDD
                     LWIDILSFFAQVYLALYEMTLGIGKWWAGTEIEDSHRGKETKEKEIKAKRRRRRVEPS
                     SNSSDSATGRFFPGMVNLSGTLCYMNSVLQSVASIPSLIIHLEKVIDLAVEVDIPTHV
                     TDALLDVIRDLNTPNKRPPPALRPHNLLTALYPLPAIRRLLSTHEQQDAHELFLVLAE
                     AVSDEVVKVAAEVAKVRGIGEIISLQGYLSGKNDGSDQPRRAGDMEGAKRRQRIRGVA
                     QPWEGLLARRRVCQRCGWSEAIRMDTLGGIELPVPLHGNTTLDACIMEYLAPEILSDV
                     TCEMCSLKLTLDYYTSEVERLSGSSCKKTSTKEENEPGSDNQVSASRKKKAREARRAE
                     TRLREMVNSNTVSDFGEPNLTPLPSSGLTAQIPVKWLTAKTASTRQCVIVRPPQSLQL
                     HFIRSEFTMYGTVQKKTAKVSFPLLLDLTRFVSDGVWEERGGIKNMLASVSTEKTIPP
                     ITGQRVIYQLESAILHYGFTHSSGHFVSIRRKPSPSLTKEEKSFRPLQVAKNCPDGCK
                     CQDCVYFGQVRDLENTKVPGRGWLRISDADVEEVGEEALHEAGGAVVMLFYERVMEYV
                     AKKVVHDERLQGDGDSQDAGGLEDNI"
     gene            complement(473367..474801)
                     /locus_tag="CNA01770"
                     /db_xref="GeneID:3253839"
     mRNA            complement(join(473367..473594,473669..473730,
                     473800..473887,473943..474069,474128..474258,
                     474318..474406,474465..474540,474607..474801))
                     /locus_tag="CNA01770"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_024656186.1"
                     /db_xref="GeneID:3253839"
     CDS             complement(join(473689..473730,473800..473887,
                     473943..474069,474128..474258,474318..474406,
                     474465..474540,474607..474647))
                     /locus_tag="CNA01770"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_024511841.1"
                     /db_xref="GeneID:3253839"
                     /translation="MAFIKLDYTVSQSKPSSVPNPPGYLAPFTAKQSASASSKHFQAN
                     EEALAKQARKSTELKMKRAWDLALSPAKSLPMQAIMLYFSGSGIQIFSLGMIFMLLTQ
                     PISAVLNIFQAFEPFRPTPSSTSRKGIKAAAEESTYAPLIGPMVLYVACQGLILALGL
                     YKCSSMGILPTGSGDWLHFETRSDPPEWSAVRSQLLG"
     gene            474921..476562
                     /locus_tag="CNA01780"
                     /db_xref="GeneID:3253782"
     mRNA            join(474921..475262,475315..475495,475557..475628,
                     475683..475757,475811..475888,475938..476068,
                     476143..476562)
                     /locus_tag="CNA01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656187.1"
                     /db_xref="GeneID:3253782"
     CDS             join(475057..475262,475315..475495,475557..475628,
                     475683..475757,475811..475888,475938..476068,
                     476143..476377)
                     /locus_tag="CNA01780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511842.1"
                     /db_xref="GeneID:3253782"
                     /translation="MHHFASAVAALLLLGFSRAQELSCSSPKVNIDPCLSPSPGGLFV
                     FRQRFEPDVGDDFGSWNIDGLEVLTCDTQQPQNDTAYAPTYNHEEIGSFCLKSTLFSE
                     ENAFANSEKAWAQSEVGEGVEEVWERAWNVAGRFISTFHPECYKNAQRGSGVPEFFAV
                     LQKLHWRFPTAQLLSDNDIIPSEDISYSLAELTSALSMGGNFPVVICDNTTLSTILWP
                     LLVRGSFATGTFEPTSMLQRESNCPQDGIIYQLSNRRPVPTTTATWDRIFRPSPRPIT
                     LSHDESKLYYRTQVPDDLRQKLALFKGYEQGKEEGKTERADKKFWRDEL"
     gene            477117..479331
                     /locus_tag="CNA01790"
                     /db_xref="GeneID:3253740"
     mRNA            join(477117..477348,477404..477724,477786..477967,
                     478030..479331)
                     /locus_tag="CNA01790"
                     /product="expressed protein"
                     /transcript_id="XM_566545.2"
                     /db_xref="GeneID:3253740"
     CDS             join(477225..477348,477404..477724,477786..477967,
                     478030..479040)
                     /locus_tag="CNA01790"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566545.1"
                     /db_xref="GeneID:3253740"
                     /translation="MPEDLSFLDQLEDWLEAQIPNNLHDLPSKMFDTVEKLTNDLFET
                     LNVHGPPSISIPFPPFGAKEVPTVPLPPPPPPSSTISCCQNAVHRSGRFVKTHPIAVG
                     AVISVGLGFTGLLAYHGASFFAKGRKEKRQFGVNGVVRDGMLKEAIVILAPSPMPHIL
                     VPLAASLLRAGYIVLIAVTNNRDAQSLEKRLNGLEERSALRVLVYDPDDPSTFPPFHR
                     SLLATLTLRFPVSGRYTAGDPYNPQPSQLAHIHAFLSLYPLHPSPPSQPGALPALPTL
                     LAPNPDGSKPMLVNFYPSGSVPTTPVTFASQILSSNHVLLGRNLAASSGARVISIYIG
                     DVDLPTLPAILSHGKTLSRRQIAKERLAQVASPQQKVSIIRDYIYGSFNAVFSVVIGS
                     LGLGTAVRDYKTFEKGVLKAIKSSHGQLFFIGQRSFLPFFVAHLPIPSSFLPPLLAYL
                     PAMPSCTGPAASEHVKSAGYKNKTSVAKQGATSRQDANGEKERLSASEGSEHEAGEDL
                     ISSVHTGTSTSSRGVGSESSEGASGLGGSWVGLEDAV"
     gene            479477..481953
                     /locus_tag="CNA01800"
                     /db_xref="GeneID:3253581"
     mRNA            join(479477..479945,480009..480044,480098..480266,
                     480325..480587,480645..480727,480781..480857,
                     480909..481265,481326..481433,481499..481748,
                     481814..481953)
                     /locus_tag="CNA01800"
                     /product="expressed protein"
                     /transcript_id="XM_024656188.1"
                     /db_xref="GeneID:3253581"
     mRNA            join(479477..479945,480009..480044,480098..480266,
                     480325..480587,480645..480727,480781..480857,
                     480909..481306)
                     /locus_tag="CNA01800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567094.2"
                     /db_xref="GeneID:3253581"
     CDS             join(479575..479945,480009..480044,480098..480266,
                     480325..480587,480645..480727,480781..480857,
                     480909..481217)
                     /locus_tag="CNA01800"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512027.1"
                     /db_xref="GeneID:3253581"
                     /translation="MLHRRHPISHPVPPSPSRQHRDYLGTTSTTGIPIPPTSSRTSTP
                     GRPASNPVHWELDAREQTSLYDHGLNRPGRSSMSKGTDIGWDTAESRKNLTNRMGMGL
                     RNVRHGMKDALRMDRSVNLVWHDRELKTLIIKSMLINLLSLLLLSLSSLIFSPILVHP
                     ASTDMQTRTKAIGMWYNILLSWPVFVVCFWVNANWGPGISKRAQVLLHPTYRHQPSVW
                     GTPSKSTQMATGYTAKLFSSATRVLLISDFTLVSRLIGAIPLIGRPCALAYMSIISSY
                     YCFEWTFSTKNWSLDYRIEYLQARLAYMFGFGLPVTLMTSFGPPLVTMAIFALVYPFF
                     VIQALQSSPPRNATLLPLNPSSRPLTPSFRVKSSNALPADPFGEPTYCDLEAPSGREK
                     EWEFKVPIFWFANHALRGLKWLEDAVAKDRSGRKDIFGLGSQG"
     CDS             join(479575..479945,480009..480044,480098..480266,
                     480325..480587,480645..480727,480781..480857,
                     480909..481217)
                     /locus_tag="CNA01800"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567094.1"
                     /db_xref="GeneID:3253581"
                     /translation="MLHRRHPISHPVPPSPSRQHRDYLGTTSTTGIPIPPTSSRTSTP
                     GRPASNPVHWELDAREQTSLYDHGLNRPGRSSMSKGTDIGWDTAESRKNLTNRMGMGL
                     RNVRHGMKDALRMDRSVNLVWHDRELKTLIIKSMLINLLSLLLLSLSSLIFSPILVHP
                     ASTDMQTRTKAIGMWYNILLSWPVFVVCFWVNANWGPGISKRAQVLLHPTYRHQPSVW
                     GTPSKSTQMATGYTAKLFSSATRVLLISDFTLVSRLIGAIPLIGRPCALAYMSIISSY
                     YCFEWTFSTKNWSLDYRIEYLQARLAYMFGFGLPVTLMTSFGPPLVTMAIFALVYPFF
                     VIQALQSSPPRNATLLPLNPSSRPLTPSFRVKSSNALPADPFGEPTYCDLEAPSGREK
                     EWEFKVPIFWFANHALRGLKWLEDAVAKDRSGRKDIFGLGSQG"
     gene            482766..486671
                     /locus_tag="CNA01810"
                     /db_xref="GeneID:3253592"
     mRNA            join(482766..483486,483541..484151,484219..484398,
                     484454..484623,484685..484863,484917..485298,
                     485355..485398,485451..486671)
                     /locus_tag="CNA01810"
                     /product="expressed protein"
                     /transcript_id="XM_024656189.1"
                     /db_xref="GeneID:3253592"
     CDS             join(482828..483486,483541..484151,484219..484398,
                     484454..484623,484685..484863,484917..485298,
                     485355..485398,485451..486435)
                     /locus_tag="CNA01810"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512028.1"
                     /db_xref="GeneID:3253592"
                     /translation="MSQHRPSPDQPSYYPLPHPPYQPQYAEPMPARPSRPMTISLPQF
                     QPPPYSQQQSQTLLHSPFETPRSMPMSSTPLSSHIEGMVDYFSTWDGQTMQPVPDFHQ
                     HALQHQPLLSQHPSSLPLPNHSPNEWQSQAPRSSRKTSRQPNSKATSSDSMSSTKTTR
                     QQFTACGACRHRRVKCDLKDKQEQAEKTALLESNGHTGPMREQAKKVQCSNCLERGLN
                     CVDEFAPIKAAKQLRRGKRITEIEQLYGRSATDAASVHDNASTSSIKQPVSSVKSNTQ
                     PVHSIIPELTREFFESDFFRRFQVQRPVIDPGNFLERYLSQANPHAAAMGTEGAILCH
                     VLYAWAVSYGVDEYGRLDLPEGGREPLTGVNVTNACPGEVQREKDRSVRKEKMKSVVK
                     IILKEIDDCGVMRKPTWDGVRVLLMILPLTEGISTPVERLVMYDAAISQVFMLCSHVA
                     MGYDGLPSASSEAANGATEDDQGMTVVRVRVYWYAFVHEGITTGLKGGRLHLDEEDME
                     TMQDIIDNNALVRDSVSFRISTKFATAPINLALACRKINKALTGPKAKRRTAVNVDLV
                     KQAWEALERCWEEFDDLLKVGPNHKYILGEEVARFADGWKIFLFEAQNVIYNNLEARR
                     QKLSNTAVQLTARITESASPSTANSPETMHADLVTIDHLLDIAKSKCEVKTRQIVDLV
                     KTYVGTRFFEWDASLVRDGTYYAAMWLVKQGGSSEDVAVCIQALNELRWAHAKAWERS
                     ADLRKEWLEKHVVDDPQEQNKTWDSVITNLEKLGEDKTTTEAPQRQHEVLEQPNMPRH
                     NTCNPGIGNEKSQSQLQDNSKRLKQTHASLDHHIHQQQQQPHSSQIYAYPDSQHHLQQ
                     SLPNSYLDQRHVDIIPPGSNTSYSSQPSGISGPQYQTEGNHTPTTDSTFTSSHTTLPI
                     NDTKVNVMDMSSSYHHVNMREGLFEDDSFHSSHGAQQTQMYEEAETRNGSVPSHHGLV
                     GHGHGNIMLGENGYRAYEKFDGQTGYMAAEGYPQSRQIHQVYDYHHDPSHLHPHVQDA
                     HTQGTGQGDYNSYQHPTEELQGQFVLQYDGTHLFTPYSN"
     gene            complement(486751..491981)
                     /locus_tag="CNA01820"
                     /db_xref="GeneID:3253806"
     mRNA            complement(join(486751..487254,487304..487359,
                     487412..488963,489015..491333,491708..491981))
                     /locus_tag="CNA01820"
                     /product="transcriptional activator, putative"
                     /transcript_id="XM_566547.2"
                     /db_xref="GeneID:3253806"
     CDS             complement(join(487080..487254,487304..487359,
                     487412..488963,489015..491104))
                     /locus_tag="CNA01820"
                     /codon_start=1
                     /product="transcriptional activator, putative"
                     /protein_id="XP_566547.1"
                     /db_xref="GeneID:3253806"
                     /translation="MDKLPWRTTSGGKKGPFTVDAGGGQGVYNGKVNSARVPERPPSA
                     ASSRLSNPPTPAMSPSIPINRHNFPYPPQGYQSFSQPSSIGHSGSGSFHGNDHSSIAT
                     TPTPMTPIDIVGVSSSVPRNSFSQGVQPSSHSQLSSSRSKRSVPMISTTPVEPPPSSW
                     GASFPDQQGENDANSKPFDWTSLPNPANWFSPLGTVQKTTCNDDPIDPAVFASLADLV
                     ERNQGKMNDSASIDFMGALNANTSPKAARSTAHSTSHPGGTSLLSRRLQHQQQTSSDG
                     QNIHSSSQSSANSPGILHNSGGLSGFPGPQQQYNHVTFAQPGKVSKGASNQPLTPWPL
                     SERAMGSSETPVTTPGGSDFGVNSPFEMGITGSWQQESMAKHELQGSNSSSRYPPIAP
                     RRREAPQHPAPVFQTHRGSVPSSEHASRAGSEAPHDGPMPGGVSLNGLPPLPNGLSLE
                     HLAQYGAAGLEMALRVGMGIGMGLSQQTQQTKQTVDVASPPWPLTKSVPTPSFSQNPS
                     SPEASSRKGRKDSNIVSDILQDDFLTARVPSTPLMTPPLNGFGSFPVTRRPSQSDATS
                     PLPEVGPPEQVAEKDPLAAQVWKAYARARDTLPNGQRMENLTWRMMHLTLKKKEEEQA
                     AKEKEEREKEDKEAAEKEAAEAAAAATAAAATAAAAAAAAELPPVEERRGRTKGKSRI
                     VGFAGATSSNSQSPNGMDIDWRAASRSRSRIPMDIDWRASSRSRSRSAAPFRNPFSEA
                     HAHHLLAAGGTPIAEMGQYMAGHGSLNIHAANAHSTSHHGNQNQYHHASSLPGPSSMM
                     LQSLSQLPEKEGEQDEVQQAVEHMNGADLYPASAPQNRSALEHLQMSLASGLNPSEEA
                     TSNLPGINGPGLYTHSQENFHPHYGFLPRRVRKTSFDHTVKLLEEGEPSSSPQFMSNP
                     RKRHAEASPQGGANSPLPEGDSGFPTSNFTFSFPQSYENFFDLAAASATPSGTQENND
                     VNHEGDDDLADLTDWASHPVTADTSAFGSPSAFGHIEPGMSLPSMPQATGDNPFDFQQ
                     LMHLYLNANSSASPFTHINPSQVLGAVPGQAANEFSPSAVSPQSGAPTPSNNSSGNNI
                     RPLPKAVGGKAVDNRQMPPPNRSSSTPNLAALRMSSQSESSKHGRTASTNASGNAGSG
                     SSKGNKGSSGNNKSRPGTPTSENEGGPGSIMPSGENPTMCTNCQTTNTPLWRRDPDGQ
                     PLCNACGLFYKLHGVVRPLSLKTDVIKKRNRAGPGPKESNPSRKNSVASSKNVSVRSK
                     PSSPTVASSANSGGGSKKARHASDAPVE"
     gene            493713..494793
                     /locus_tag="CNA01830"
                     /db_xref="GeneID:3253789"
     mRNA            join(493713..493891,493942..494230,494281..494793)
                     /locus_tag="CNA01830"
                     /product="4-aminobutyrate aminotransferase, putative"
                     /transcript_id="XM_566549.2"
                     /db_xref="GeneID:3253789"
     CDS             join(493772..493891,493942..494230,494281..494606)
                     /locus_tag="CNA01830"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566549.1"
                     /db_xref="GeneID:3253789"
                     /translation="MTQSPFSTFGYQTAMPSGSSFKPKRKRMSWGPEEEENGAKHMRM
                     LSPTLNHPGFPLPELVADHSNNASDDDQVMDMDQDMPDSSSAVGPPSPAEGYAQNSYS
                     YGASGSGGFGFGPGAEEDEFEMDMMDDMGTIQSKNYPSLTPHPNPHHFSNPGNNHNLR
                     GTSPLAAQPFSTALPAPPARGIFQPTVSGPLAPDASDIERARSQHGPWCQSIPKLIMS
                     EYPDASGRRSMWTVCGDCGACEKTQD"
     gene            complement(494728..495736)
                     /locus_tag="CNA01840"
                     /db_xref="GeneID:3253820"
     mRNA            complement(join(494728..495155,495215..495269,
                     495324..495379,495429..495736))
                     /locus_tag="CNA01840"
                     /product="expressed protein"
                     /transcript_id="XM_566551.2"
                     /db_xref="GeneID:3253820"
     CDS             complement(join(494827..495155,495215..495269,
                     495324..495379,495429..495609))
                     /locus_tag="CNA01840"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566551.1"
                     /db_xref="GeneID:3253820"
                     /translation="MSESSPKDTLSALNESLDALEAALAPLEAKPWSQTVEKLSPLER
                     TKMDVLGAYLINDLVWVYLKTKGIDPTKHDVTAELERIKTYYSKVSSAEGHEEIRPKV
                     DAAAAHRFVSSSIPRTQHLPPTTSAELAANQRALRVAEEEEEESIRRLGKPSRFRHIQ
                     ERGQLKLIPGQEVETIGDEDVMIGGEDGQREAENFLREFANEIEGR"
     gene            complement(498616..500873)
                     /locus_tag="CNA01850"
                     /db_xref="GeneID:3253769"
     mRNA            complement(join(498616..498800,498857..499198,
                     499266..499447,499512..499571,499628..499811,
                     499871..499884,499942..500131,500224..500466,
                     500524..500873))
                     /locus_tag="CNA01850"
                     /product="alcohol dehydrogenase, putative"
                     /transcript_id="XM_566553.2"
                     /db_xref="GeneID:3253769"
     CDS             complement(join(498678..498800,498857..499198,
                     499266..499447,499512..499571,499628..499811,
                     499871..499884,499942..500131,500224..500466,
                     500524..500745))
                     /locus_tag="CNA01850"
                     /codon_start=1
                     /product="alcohol dehydrogenase, putative"
                     /protein_id="XP_566553.1"
                     /db_xref="GeneID:3253769"
                     /translation="MPPPASRASIVRLLSLTANQGCRGCGRTHSVLDHAHNHGHTQSH
                     VPLGLRGMATPVDLPIRGGPPPGNTDYAFEMAASNLRFGAHATSEVGMDFANLIKEMP
                     AVDRSQAKIGVFTDPNVAKLPVIEIVEESLLRAGLNFVMWDKCAVEPTDKSWQEAIDF
                     SRSSHLTHFLAVGGGSSMDTAKAANLFTNYPKADLFEFINAPIGKGTPITKKLSPLIA
                     IPTTAGTGSETTGTAILDIPSRKFKTGIASRALKPTLGIVDLLNTTTCPKEVAIAAGL
                     DVLFHSLESWTAVPYHQRTPRPANPINRPAYQGSNPISDIFSKWALETTVKYLPRIAR
                     DPFGDEEARAQMLLAASTAGIGFGNAGVHMCHAFSYPISSLNKGRPKETQYHHPSYNP
                     DVPLIPHGVAVSLTAPAVFNFTAPSSPDRHREALLVFLGKDRAHEATGLKDEDLGPKL
                     SEEIRRFLDIVEVPRGLSKVGYTGNDITSLVDGCLPQRRVLDLAPVLAKNNNAEEREQ
                     LAHIVELSMNW"
     gene            complement(501034..502746)
                     /locus_tag="CNA01860"
                     /db_xref="GeneID:3253824"
     mRNA            complement(join(501034..501541,501595..501978,
                     502028..502328,502381..502746))
                     /locus_tag="CNA01860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566555.2"
                     /db_xref="GeneID:3253824"
     CDS             complement(join(501082..501541,501595..501978,
                     502028..502328,502381..502570))
                     /locus_tag="CNA01860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566555.1"
                     /db_xref="GeneID:3253824"
                     /translation="MAPLDVFITTWNTGLQGSKAQSQDLTSWLLPVLRNASNPELPEG
                     FIPDLYAIGIQELLPLHLAMAGLTEPVLLALTSRIENLLSAHASSLSPNKTPERYSLV
                     ARVAHVGNALWIFSRDSTMDGRIGKPSTATLGLFWGGMGNKGAVGVRLPVRRGKIGGW
                     ENLTFVNAHLEAYDHNIPRRNAQYQRILSSLVFNSTDPLTTSQQIFDTSHLFFMGDLN
                     YRLSKQPPPGALQENNMFGNVLELEKSRMGMLDTDTLRQEQREGRAFGGLREGDLTRF
                     APTYKRIVGQVEGYSKKRIPGWTDRILFASHTDPPHLFSPEASLDPVPSNVADTTTIL
                     HFNSTIELVISDHKPVHAILSLPEVSHETPSPHLAPTLPPAPSPHHPRPLPTQREVLL
                     IEKFFGTLLDRLVGWPWCIIVLLGFGNTRTGMGVSAFVAMIWGIWWSGIYSG"
     STS             502827..503703
                     /standard_name="Hind32"
                     /db_xref="UniSTS:470883"
     gene            502984..506375
                     /locus_tag="CNA01870"
                     /db_xref="GeneID:3253797"
     mRNA            join(502984..503078,503140..503168,503222..503272,
                     503322..503542,503596..503737,503793..503966,
                     504022..504353,504406..504715,504765..504983,
                     505037..505897,505956..506048,506106..506375)
                     /locus_tag="CNA01870"
                     /product="gamma-adaptin, putative"
                     /transcript_id="XM_566557.2"
                     /db_xref="GeneID:3253797"
     CDS             join(503054..503078,503140..503168,503222..503272,
                     503322..503542,503596..503737,503793..503966,
                     504022..504353,504406..504715,504765..504983,
                     505037..505897,505956..506048,506106..506213)
                     /locus_tag="CNA01870"
                     /codon_start=1
                     /product="gamma-adaptin, putative"
                     /protein_id="XP_566557.1"
                     /db_xref="GeneID:3253797"
                     /translation="MSGHYNLKALIKAIRSCKTLADERSVIQKESAAIRTSFKEEDTF
                     ARHNNVAKLLYIHMLGYPAHFGQIECLKLVASPRFSDKRLGYLGIMLLLDENQEVLTL
                     VTNSLKNDMNHSNVYAVGLALCTFANISSEEMSRDLSNEVEKLLGSSNAYIRKKAALC
                     ALRIIRRVPDLLDHFTSKAKSLLQDRNHGVLLAGITLVTEMCEINEDVCAEFRRATGL
                     LVKHLKNLVSTGYSAEHDVLGIADPFLQTKILRLLRLLGKGDVASSETMNDILAQVAT
                     NTDSSKNVGNSILYETVLTVLEIEADSGLRVMAINILGKFLANRDNNIRYVALNTLNK
                     VVSMDTNAVQRHRNTIIDCLRDGDISIRRRALELSYALVNESNITMMTRELLSFLEVA
                     DNEFKLGLTTEICLAAERFAPNKRWQIDTILRVLKIAGNFVRDEILSAFIRLVSHTPE
                     LQFYTAQRLYAALSSDLSQESLTLATVWVIGEFGDILLQGGTIDDGDKVKQVSDSDLV
                     DLLEHVLNSPYADSLIRQFVMTALAKLSVRISELSTPNQNTLQDRIVVILASFSSNLE
                     LEIQQRAVEFGSLFAMREVKMGVLERMPPPEIKATIMGTVSERKPVGSTRTDKDMIVD
                     LIGDDSAPSTAGLPVAATGPSTQDLLADIFGTGASDIASPGAGSPTAPRSNANDIMSL
                     FNTTPAAAASPPVTSSLPAASTGGSLFDLVSPSPTLSSAPAPAPAPTSAAKPQLQSYT
                     AYDKNSLKITLTPKVSPAQPGVVQILARFTTNGTEKIEGVNLQVAVPKTQQLQMQAMS
                     SQEIAPGGVETQQMRIHVPAGATIRLRMRISFTRAGQSLTDQQDFAGFPAGLTGSK"
     gene            complement(506412..507395)
                     /locus_tag="CNA01880"
                     /db_xref="GeneID:3253752"
     mRNA            complement(join(506412..506748,506800..507025,
                     507082..507171,507223..507395))
                     /locus_tag="CNA01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_566559.2"
                     /db_xref="GeneID:3253752"
     CDS             complement(join(506488..506748,506800..507025,
                     507082..507171,507223..507299))
                     /locus_tag="CNA01880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566559.1"
                     /db_xref="GeneID:3253752"
                     /translation="MSAPEATGTRQRTNKVETPTNENQNPASLSANPNKKVPRNKPHV
                     KPPFVDMSMNKFLTYLVLSLFLLFAFYMWRFTVWAHQAGGYWALITGHHMSPAEVAAK
                     QAASSASASSSVASSTASATTSGHPQKIKAKPTQDAGDGDDNIQSQIFNLASALGITP
                     AELSSAIRPLVDPSVPNPAEKAKQDAQLLQAKMASQQHENENQEGSVLDMLGEALLD"
     gene            507664..510353
                     /locus_tag="CNA01890"
                     /db_xref="GeneID:3253829"
     mRNA            join(507664..507925,507981..508192,508244..510114,
                     510176..510353)
                     /locus_tag="CNA01890"
                     /product="conserved expressed protein"
                     /transcript_id="XM_566561.1"
                     /db_xref="GeneID:3253829"
     CDS             join(507740..507925,507981..508192,508244..510114,
                     510176..510237)
                     /locus_tag="CNA01890"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_566561.1"
                     /db_xref="GeneID:3253829"
                     /translation="MAEDHNEGVSNTPLDLLINAIAGNHYPIPHDHTHEHDHDHDVSL
                     DHLLSQRKDSAEDSQQHASSHKRARSQEVVSSRQRKVPKPLGSQAMFYPGFAPADKAP
                     GSLDENNSHRFNTLEVWHPTTGQKSYGKERRMLNPPPILRLSGPASSCISSITMVSVV
                     SPNITQPVAICAPQTHHMGRPPDITPHLGTPGVEDKKKERREEQKKLRTAALNAGFAA
                     TLPKNRNATDLKDRTLLKDGLTFPGLWIGEEAGKMKEFRLELKIYAEPTEKGLSSPST
                     QDFAQSSYHLGNPDNDHETAHTFADMLEPPSMDALQPLAEAVQQSSQQGHDTLSEHFP
                     EVEPSLAATNLHNDNDAENPGNSPLPITQATTEEQPLGSFLSGPIRIVSKPSRKTSKT
                     RSLAICFPRDSVFSLWTRIHGQTVRTKWMNLEANFNGHGPRLTSRTAKWTPFRFEVLD
                     HANAPFAYRTARNKFDETDHLEGQQLTYGSIVVLVDLQTGVKSDPVKVVRVESGKSVV
                     GQYDGQPVSELQRIGLVRTIDGQEDMSEGCRWYLSAPGARIGGGELSAESAPGIRMRR
                     QRANAKAASQLKELNEERGKEKEIEGTSHDEPHLTSSFLQDPQTLSAIENVSGSSTET
                     NHNQQSVLSIELSLPEGVHSADTFDHTDHPPVIDPSFENMAPLVDSQQQTKNPKGQSS
                     FQRRSNKTRRLALAAAVLAEDDDNAVQTLLSWVKAERSEEVSSGADGLDTQPDEVRSV
                     IVDSVADWMSWTIGGAASFSFTFKPTEHNEERVEAP"
     gene            complement(510349..513791)
                     /locus_tag="CNA01900"
                     /db_xref="GeneID:3253759"
     mRNA            complement(join(510349..510808,510862..511049,
                     511110..511546,511612..513420,513487..513791))
                     /locus_tag="CNA01900"
                     /product="conserved expressed protein"
                     /transcript_id="XM_024656190.1"
                     /db_xref="GeneID:3253759"
     CDS             complement(join(510514..510808,510862..511049,
                     511110..511546,511612..513420,513487..513724))
                     /locus_tag="CNA01900"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_024511845.1"
                     /db_xref="GeneID:3253759"
                     /translation="MVSPPPPRPVHPFFQLSSAQSKRKRQAGPEAGDSARRGHNSPIR
                     TGQDSKENTPFGDLSVEYPLNGRGKTDETLDSTDDESEVVFTHASQAPSSFASIGTPS
                     GRASSRLGPKRVRPSFPSSATLSSQATASSSSMNEVVDLSSDADDWEDRIPVTRCPKR
                     RIASKDAIGSRPMLSKPKPLSRSTSWTGSKGINEKEAIEILESTPSPVALKVLPAPKN
                     LGFGQETGKAAHPFFTHTHRQSRHGASNPSQERSAPMAAEDVSVLKTTAAPFGLDKQL
                     PKIHSFFSMSTLDRAQEKLKNGWGKEEREAPLPMRPWPNHIGGYCAPASDPRWKGKRR
                     KPTPAVKDDGFWEGVLGRTSTPVYQGITSKAYEIPIFPHIAKHPSFLSIPSKCSSSSS
                     NRALWSDRYRPLRASEVIGNEVEATYLRDWLSTLAVGGQHAKGSKIVRQVVKKPRSAL
                     VDGFIVDDLGLYGDTPNSEEDGEDEFPHLEDLPDPPISHDLNARPDKYPSLASHLANT
                     ILLTGPTGSGKTAAVYAAAHELGWEVFEVYAGMGRRTAANLMKWVGELGKNHTVLPQD
                     GKSQGTINDNEKKGKSRGRGKGLSSFFDKGSFQSSKVSLSRGIASDPIDIESNGESDK
                     IPVTEAANVSGGEPGIKFKESLLLIDEADILFEEEGSFWPAVIALASESRRPIVLTCN
                     DHQRIPRIQLPLQAILQFHPIPSFIALPYLQAISSQESQLRGKPCNPCVETIFRGAIH
                     QTPEKDVLSDQCLPPNGHERIPFFDLRQAMMQLQFGLTDQILQRGCAKKYGTPDEDEK
                     KDDLQLMTERMEVISFSDAFIDIRPRVLMELYDVDKLQPTSDEELDVAALLKPEMYET
                     YPILAMIDRSSDIAGSLVQAVGGHLPPFGDLGLARAKYIRSMLPLLDPLIPLSEPLLP
                     HSTLFLYTLPTMQSIISADDIFEALEQQAVDRGDEKINPRTGKPMRRVAGYTYTRYWD
                     LEGAENEARRISRLIW"
     gene            complement(513911..516668)
                     /locus_tag="CNA01910"
                     /db_xref="GeneID:3253717"
     mRNA            complement(join(513911..514179,514231..516282,
                     516341..516422,516474..516517,516575..516668))
                     /locus_tag="CNA01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_566567.2"
                     /db_xref="GeneID:3253717"
     CDS             complement(join(513997..514179,514231..516282,
                     516341..516422,516474..516517,516575..516640))
                     /locus_tag="CNA01910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566567.1"
                     /db_xref="GeneID:3253717"
                     /translation="MAKRTADNQKTKDDVEEEGNEEPGIRAAPLAAVEGRPVRGLPKR
                     RGLGGASAPTPTPAPAPVADIPPAPTSGTSSPVPPSGTSNAFTGFSFGASTSSTPSFS
                     FGQSSASSPASTTPAAAPKPFAGFSFGSAAATGSSTSAPVTEPTGTATPAFSFSQKPV
                     EPTQTKALQPSKPFAGFSFGAPAAAAPSTGDNASEPPRFSFGAKPTSDVTKEVPAHEP
                     IKSKAAPFSFGTASSAPVASGSKEATQVQGFSFAKTLIATATSTTSKPTLTEASETAP
                     AKPSFSFGPMATTFGTGTAPTSNSAPPAPAAEAAPAPSTSSSSSESETSYYTSLRGLN
                     QSFLTFFSTTIEKDQFIDLTTVLPKLLVQYEEHLTGIETKAGWKPDATSKDKIETTAA
                     PEPPKATGFTLPKAPSAGSFSLPKAPSTSSAAPATGGFTPSAPATAPSKSSIFSFPAA
                     DTTPKKSSDEVNKIVSEAIADKPEEEKMAEKTGFGFSFGTDSTKPKESSAFKFEAPKK
                     STSLFASSPATPAKSAAGNEAAPLGKFGPGGSQPQLSFGAKAGTSPAANTTSSFNFNV
                     GKPSTPAGAGTSFSFGTSSSPSVAAGASTTSASVFGGTSTRSAPTFSFGATTPSASSS
                     SSFVFGKSPVVQPSGDAPKFGASLQPFGSTSSVSTPAPAVNESNTEGEEATEPSSPSK
                     NLASVAGAGEENEDTVIEQRGKLNRLEDGEYKLEGLGQFKLKRTKNEEDRKRRLLMRT
                     DGNGNVILNMAVKSTFNPSVEGPYLKFLGFNMDGKPTPYALRVKNAEAANTLLEGLKK
                     EVEEIKDDKS"
     gene            516854..519703
                     /locus_tag="CNA01920"
                     /db_xref="GeneID:3253733"
     mRNA            join(516854..517961,518019..518258,518311..518954,
                     519002..519067,519122..519303,519369..519703)
                     /locus_tag="CNA01920"
                     /product="cactin, putative"
                     /transcript_id="XM_566569.2"
                     /db_xref="GeneID:3253733"
     CDS             join(516876..517961,518019..518258,518311..518954,
                     519002..519067,519122..519303,519369..519406)
                     /locus_tag="CNA01920"
                     /codon_start=1
                     /product="cactin, putative"
                     /protein_id="XP_566569.1"
                     /db_xref="GeneID:3253733"
                     /translation="MPRSPEHDSKFEKDSGRERAGDRRDRDRDRYRDDYDRRESSSRR
                     DESERNRDRDRRDKDDRGQGKDRERERRRDKGRGDYYDSDRDRDRDRDRRDRKRERSR
                     SRERSYKKERKHRDSRSPSPSSKTRRKEAKAAAKAAAKREAELEQSRALAELSMYSAT
                     DNPFHDANLGEQFQWHKKRDKEKKAGLTAEEIARKDALRRQEAKEELERLNKRRADRE
                     VELQLREEEETRQRRLAEDAAMAEWIAKEDDFQLEQSRRRAGIRLREQRAKAIDFLAI
                     NLRFTDPKSSHQTAAIGALTNPRASEIEREEEEEGWGWADAGFEFEIDEPWKIFENLT
                     LDDCVELEQDIKMYLSLEKSPINIEFWQAMQIVCEHYLSQLRDPEHAVGGPLSDPEVE
                     EATNKIVSGLSLQRLVELENKANGLLRSGQPVDSDFWDLILKKIHVEKAIAKLNSIHE
                     IVLKNRLEQFKRRQREDAAKVQAELGGVLVSNENAFGGDIRADAGPVPTGGDEADDEE
                     EDEDDYIEDYDREMSPPIAEPRTMGLDERRLPIVNEEDELRALFSARHSITSSNFIPT
                     QARASAHTSQSISRPSAADLEAERIYREEAEREARDLGSDESEEEFGDLDAGLEVPST
                     YDWSDRYRPRKPRFFNRVHTGYEWSKYNQTHYDTDNPPPKVVQGYKFNVFYPDLIDKS
                     KAPTYYLKSIPDDPDTQIIVFTAGPPYEDIAFRIVRRQWEYSHRKGFRSTFDRGVLQL
                     YFNFARTFYRK"
     gene            520371..522844
                     /locus_tag="CNA01930"
                     /db_xref="GeneID:3253715"
     mRNA            join(520371..520782,520845..521132,521185..521845,
                     521902..522239,522298..522844)
                     /locus_tag="CNA01930"
                     /product="expressed protein"
                     /transcript_id="XM_566571.2"
                     /db_xref="GeneID:3253715"
     CDS             join(520565..520782,520845..521132,521185..521845,
                     521902..522239,522298..522709)
                     /locus_tag="CNA01930"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566571.1"
                     /db_xref="GeneID:3253715"
                     /translation="MNNIRQDSGPSPTPESSFGSPRRRASSPRPHRPSADGLLFNNER
                     QVPPPIYLRNSSPRGLSSRGEVKIHIPAWGIAFVRPPRPLEVHPLETTPNHPIRPPSK
                     DTVLSGGLEIIMKERRRVKAISVGVQSVCRLYMGQSRGWEEDGIFERGVEVLSGDEEG
                     IWLEKGSQSFSFSILLPGTLATTDSHTFGRVSYIITARVEGIESSTSSFSSIFKFKTL
                     SNSFPSSTSGIPNIADFERVIARSNKFAADVALGRARSASMSRSGTSDRVSTPEPGID
                     RSSIDDQAVSDVIDSGSPPFDGLYTRRHSSDLSPVSTPLSLSSSLPDTSFRPNRNGNT
                     QTEKAGWLEGDLKGSRELSIYAVSPSTGGVCQLDVRKEGSVDGLGSWKFNAAAEVFSV
                     SSVILLSISIPAPSAKTTIFLARLVLTQSYTITSPRTPNVPPSSPESQQKFVLYQVGR
                     QHKQGEVAPGRSADALWRGIEAAGAGGEEGWKIKAVARIPGHDKIRPTTYDGTITPIK
                     VSHELTLQLYYSMDGLSVTGQCVEGPGALRLMQVRIPIFLPSCHCVSDALHLPTYNRS
                     NTSPWETIDEFMASQPDDRACMCGWTFAELGEAALRKMRMTERDEAEEHLRQLATEGN
                     KGRREDYDNGDAVI"
     gene            complement(522835..523701)
                     /locus_tag="CNA01940"
                     /db_xref="GeneID:3253684"
     mRNA            complement(join(522835..523174,523231..523494,
                     523556..523701))
                     /locus_tag="CNA01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656191.1"
                     /db_xref="GeneID:3253684"
     CDS             complement(join(522917..523174,523231..523446))
                     /locus_tag="CNA01940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512049.1"
                     /db_xref="GeneID:3253684"
                     /translation="MPSLESAGSFSTLSEATASGASTATHSSTGSASQSATSTSYVYS
                     YATSKIVKVAVATGVIVLCLAAIVLFFKVSSWIRLRQRLRRQRLLTLTLKSEQQANAY
                     EIAAWADEPSTVPARSVGIREDKEKKSKKEREELRAWKRGGANAWALQEWEGVAA"
     gene            523906..524743
                     /locus_tag="CNA01950"
                     /db_xref="GeneID:3253753"
     mRNA            join(523906..524058,524135..524172,524316..524390,
                     524614..524743)
                     /locus_tag="CNA01950"
                     /product="expressed protein"
                     /transcript_id="XM_566573.2"
                     /db_xref="GeneID:3253753"
     CDS             join(523921..524058,524135..524172,524316..524390,
                     524614..524698)
                     /locus_tag="CNA01950"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566573.1"
                     /db_xref="GeneID:3253753"
                     /translation="MVRSALASLARPLSRQSTQSTSLSAKRYASHGPTYNPPSGYLFG
                     ERPPKDGKRVKESWENIYYVGMFGGMVFMGVVYAYKPDTSIQSWALKEAKERLEARGE
                     EYQYKPKSA"
     gene            525707..527298
                     /locus_tag="CNA01960"
                     /db_xref="GeneID:3253765"
     mRNA            join(525707..526241,526307..526403,526454..526791,
                     526839..527298)
                     /locus_tag="CNA01960"
                     /product="glycerophosphodiester phosphodiesterase,
                     putative"
                     /transcript_id="XM_566575.2"
                     /db_xref="GeneID:3253765"
     CDS             join(525760..526241,526307..526403,526454..526791,
                     526839..526950)
                     /locus_tag="CNA01960"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566575.1"
                     /db_xref="GeneID:3253765"
                     /translation="MACRPSLYALSRLSFIPNTRPFTSAHFPRQKSTSRQRLYALLGL
                     SLSLPAGYYFFQSSPSLSPSVYSDQELKSSKSLTPFHKLVTIKIPSSSYGFFDKPYRL
                     DGEVADVKGGEVVIQHVMVKSPDIQIERPYTLINDPNAANGEREMRMVVKRVRGGEVG
                     RVVHTTKEGEMLGVRGPIPTFSIYPQRYDKIIMISTGTAVSPFLQLLAKLSPSNAPRL
                     ELIQALPALSSSTPPFSHESLDRAAPIKWDWVDTNEDPSFLPSLEKKFGEKLKITRFP
                     QGAVPAGAVQAALEGMNRERVLVLVCLPPWLMRPLCGGMTRNLDQGPVTGVLRELGLG
                     SKQVYKLE"
     gene            complement(526290..527902)
                     /locus_tag="CNA01970"
                     /pseudo
                     /db_xref="GeneID:3253691"
     gene            527458..528337
                     /locus_tag="CNA01980"
                     /db_xref="GeneID:3253774"
     mRNA            join(527458..527775,527828..527942,528014..528337)
                     /locus_tag="CNA01980"
                     /product="expressed protein"
                     /transcript_id="XM_024656192.1"
                     /db_xref="GeneID:3253774"
     CDS             join(527839..527942,528014..528125)
                     /locus_tag="CNA01980"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512048.1"
                     /db_xref="GeneID:3253774"
                     /translation="MLSLEDHLRRERTVFRRLSSTMMMNDAAYSRRRKQIPSLSSLLA
                     IFPQPLRILLVLFPFSPSLPIVYASLS"
     gene            complement(527948..531777)
                     /locus_tag="CNA01990"
                     /db_xref="GeneID:3253770"
     mRNA            complement(join(527948..528259,528313..528572,
                     528629..529075,529132..529276,529338..529543,
                     529604..529794,529843..530646,530706..531045,
                     531101..531312,531365..531467,531518..531777))
                     /locus_tag="CNA01990"
                     /product="conserved expressed protein"
                     /transcript_id="XM_566578.2"
                     /db_xref="GeneID:3253770"
     mRNA            complement(join(527948..528259,528313..528572,
                     528629..529075,529132..529276,529338..529543,
                     529604..529797,529843..530646,530706..531045,
                     531101..531312,531365..531467,531518..531777))
                     /locus_tag="CNA01990"
                     /product="protein phosphatase type 1, putative"
                     /transcript_id="XM_024656049.1"
                     /db_xref="GeneID:3253770"
     CDS             complement(join(527980..528259,528313..528572,
                     528629..529075,529132..529276,529338..529543,
                     529604..529794,529843..530646,530706..531045,
                     531101..531312,531365..531467,531518..531769))
                     /locus_tag="CNA01990"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_566578.1"
                     /db_xref="GeneID:3253770"
                     /translation="MLAPYHLQPLIPQLRPAPDLLQFDTQHSLAPRSSSPPQSPVRSS
                     NNNNEHREIRCVEGYGYNLYVGASDGTVEWWVCEGSMYPQANGWVMRHKHTLFPRRPV
                     SKMYILPKVSKLFVISDGTMHALTLPSLEVVPSTIIPTMRGVVSVILNDDELDYGQGS
                     EEKTDMTVVIVRRRVLGIYRLGNRLQSIKEIPLPSAPTAHALFQTYLCCALLSPETSQ
                     IVNCVVDLSDASLTEVLPVSQVPPLEGEGGEGQEAVNANIVVIPDEKEFLVTSYTGTS
                     TMGVFLNGQGDPVRGTITWTSHPLSITVESNWIIALLSDQTISIHSLSDLDGPAQVIS
                     LPPGTNATSLSYSPYGVRVSDVFSGEKLKPSKMRFLSGKIAPTVESPATVEEHGKRQG
                     DSIKEKEDDPPAGSGLTPPSSPKPTLEHTADKSPAFITAMCETFLVTPSSILSLIPTP
                     DIMLLENLCEEHQLSEAASLVSDIRRRYRKGTIEPSPSPIDTLNASHLIRYLSLVLAS
                     HLTLSASFEKAAEYWVKGKVDPRWVVRLFEGLRGKMIGSEEEGEIFSGLANTFMDMDL
                     VDDSTSSIKRNYSPHLTPSTSLSPASTDLRQALENEANKMLAEVLSKIRGTRRKGGGA
                     RGLDSRKIDMVVDTTLAKLLTLLANDSQEPTEQLLALLSSSNDIIMSEVEPFLEKRKY
                     VLAKVKEKNGEWGRVLDILRELVESGDQDPMCKDPVQEVALALTNVQDVDTWTDHVLW
                     LTAKRPEKALDVIINHPPATLSPANFLPRLQPYPETHQAYLEHIVVKQRSPSRDLHQQ
                     LLCSLLDEIQRTIVDDGVKYHLDELQEEYKKETERIAGIKGKERETFIYFFARLAPDT
                     PIKRLRLKLAFFLHGSPFYDITQAEQRLEGMERLVYEKAIVYGKLGKHRPALQLLALT
                     LSDPLSAQTYATASGEILPPRLARSASSISGIGALEAWATLGEVGKRKKVKDDGGKLE
                     EALVQDLLDVYMQDGTPLSLHCASTLLNTLPHLLPLYPILGSMPASWPLNIVSPFFVR
                     SIRRGTHKRWEGMVRKGIARGEFAEVEERWLEEMRGMVFSYNPIRRNHS"
     CDS             complement(join(527980..528259,528313..528572,
                     528629..529075,529132..529276,529338..529543,
                     529604..529797,529843..530646,530706..531045,
                     531101..531312,531365..531467,531518..531769))
                     /locus_tag="CNA01990"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_024514121.1"
                     /db_xref="GeneID:3253770"
                     /translation="MLAPYHLQPLIPQLRPAPDLLQFDTQHSLAPRSSSPPQSPVRSS
                     NNNNEHREIRCVEGYGYNLYVGASDGTVEWWVCEGSMYPQANGWVMRHKHTLFPRRPV
                     SKMYILPKVSKLFVISDGTMHALTLPSLEVVPSTIIPTMRGVVSVILNDDELDYGQGS
                     EEKTDMTVVIVRRRVLGIYRLGNRLQSIKEIPLPSAPTAHALFQTYLCCALLSPETSQ
                     IVNCVVDLSDASLTEVLPVSQVPPLEGEGGEGQEAVNANIVVIPDEKEFLVTSYTGTS
                     TMGVFLNGQGDPVRGTITWTSHPLSITVESNWIIALLSDQTISIHSLSDLDGPAQVIS
                     LPPGTNATSLSYSPYGVRVSDVFSGEKLKPSKMRFLSGKIAPTVESPATVEEHGKRQG
                     DSIKEKEDDPPAGSGLTPPSSPKPTLEHTADKSPAFITAMCETFLVTPSSILSLIPTP
                     DIMLLENLCEEHQLSEAASLVSDIRRRYRKGTIEPSPSPIDTLNASHLIRYLSLVLAS
                     HLTLSASFEKAAEYWVKGKVDPRWVVRLFEGLRGKMIGSEEEGEIFSGLANTFMDMDL
                     VDDSIASSIKRNYSPHLTPSTSLSPASTDLRQALENEANKMLAEVLSKIRGTRRKGGG
                     ARGLDSRKIDMVVDTTLAKLLTLLANDSQEPTEQLLALLSSSNDIIMSEVEPFLEKRK
                     YVLAKVKEKNGEWGRVLDILRELVESGDQDPMCKDPVQEVALALTNVQDVDTWTDHVL
                     WLTAKRPEKALDVIINHPPATLSPANFLPRLQPYPETHQAYLEHIVVKQRSPSRDLHQ
                     QLLCSLLDEIQRTIVDDGVKYHLDELQEEYKKETERIAGIKGKERETFIYFFARLAPD
                     TPIKRLRLKLAFFLHGSPFYDITQAEQRLEGMERLVYEKAIVYGKLGKHRPALQLLAL
                     TLSDPLSAQTYATASGEILPPRLARSASSISGIGALEAWATLGEVGKRKKVKDDGGKL
                     EEALVQDLLDVYMQDGTPLSLHCASTLLNTLPHLLPLYPILGSMPASWPLNIVSPFFV
                     RSIRRGTHKRWEGMVRKGIARGEFAEVEERWLEEMRGMVFSYNPIRRNHS"
     gene            532001..535161
                     /locus_tag="CNA02000"
                     /db_xref="GeneID:3253796"
     mRNA            join(532001..532577,532625..533827,533877..534012,
                     534061..535161)
                     /locus_tag="CNA02000"
                     /product="transcription regulator, putative"
                     /transcript_id="XM_566580.2"
                     /db_xref="GeneID:3253796"
     CDS             join(532348..532577,532625..533827,533877..534012,
                     534061..534561)
                     /locus_tag="CNA02000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566580.2"
                     /db_xref="GeneID:3253796"
                     /translation="MPSPPPQPVPTRSTRSSNPHAGAHPRTGASPMSYGAMTGISFTN
                     GGGFSFEGKPRSVKWGNGGMMGSFGARFYGDAGGDSPVIPFSTSVTMEPSSFAASAQA
                     FGLPGSMSSSYHRRSYAAAVAGSRDPHNLSTSFASMSFQPMSLGTSYNRSQVQGLMAR
                     SDAELTKAYECCGKTHSGLHSLLEHVEDCHPFSDPNMPPEDSFSPVTHAMDLDLDDVP
                     EEPAQPPAPGSSQSSLSPDPIAAVPVPSYPLPTSKTPTDSVGKSPLKLSDVLKSPPEG
                     ESMVKASNLTLTRTQSSSSSPPDGSLATPTTSTQPSPVFLQPKINPARPAFMSMGTNA
                     MRPAAQQKRFDRAFNEVVAGRKEDEPKGDMPTAVAPGVLFASAVSSLGIPTVPPGTKT
                     TETTTPKEGEAEVKPAATDATTSAAAAQPSSTSTGAAAPSAPKVFPEPALPQPSLFSS
                     HKPWRCPNPGCNKAYKQSNGLKYHQQKGQCDFAIHDAVDLGLTLEEAEERNRPFVCAV
                     GAGCTKRYRQMNGLKYHYLNSGEHGLYGLRMLQNGTHPHPPSLPAPPPVRARPNPPSS
                     SGVTSGVSAPQRPAGAPYAIPSQATNTINGAGQGRVIGQGGHGQNHHALPRMGTWPNQ
                     SRPANGPNPINGKPAPNHALGPQKVQPQARPNPPPQPQPVTKGRDAVLFSAISEDPMD
                     IMSRMDS"
     gene            535270..537531
                     /locus_tag="CNA02010"
                     /db_xref="GeneID:3253805"
     mRNA            join(535270..535815,535875..536114,536173..536250,
                     536302..536498,536559..537531)
                     /locus_tag="CNA02010"
                     /product="expressed protein"
                     /transcript_id="XM_024656193.1"
                     /db_xref="GeneID:3253805"
     CDS             join(535397..535815,535875..536114,536173..536250,
                     536302..536498,536559..536704)
                     /locus_tag="CNA02010"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511848.1"
                     /db_xref="GeneID:3253805"
                     /translation="MVLPEARPLHLPLSSIIPPSGPNPGPPHTLPVPSYILGPLPPTS
                     PLHLALRYLDLADDATREDCASNARHGSNSQGSNSQNMTRGEHDGKGALNTPTRVLLV
                     TGPKAAFQDAIESEDERWFREHGGWMSVIQKLKRIDMRFCPSAKHLQLLLTLLSKNQS
                     RQANADSHTLDGCPGLVILWNVAELFMVSSTDTELQENKVKEDKNGNSPGCSSGKQFN
                     ASICISDYLNVLAAARETANHFSSIDPSGLSTQLVVMEPNLTAHSSLPVLPPSAQGES
                     SGVSSRQAPREKRIFVVDGARHLMGESNVAVIQQQGEEQEVPTEYELTVGRAQGTFAM
                     KRQRRKGGDWTAQQDELHGWEWEWE"
     gene            complement(536176..537618)
                     /locus_tag="CNA02015"
                     /db_xref="GeneID:36392655"
     mRNA            complement(join(536176..536480,536581..537441,
                     537525..537618))
                     /locus_tag="CNA02015"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656050.1"
                     /db_xref="GeneID:36392655"
     STS             536295..537492
                     /locus_tag="CNA02010"
                     /standard_name="D1S3691"
                     /db_xref="UniSTS:474269"
     CDS             complement(536721..537341)
                     /locus_tag="CNA02015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514122.1"
                     /db_xref="GeneID:36392655"
                     /translation="MPPSKGHDAAPPPNWPASVIYLSKPRLSPKFPPSLLPFIASPSF
                     TPQTTKHPSHVQIKKIAEVSHPAYGQLGLFARQKVKENELVIPYLGIIHVTFTPDNGS
                     DSILDEHSESDYDLSLLRLSSSDIRNPFPGQHISIGVDAAREGNAGRFVNDYRGVKPA
                     GPNAEFRVGKGEGGELRMEIWSLRGGIGKGDEVLVSYGKGWWGARK"
     gene            complement(537834..540774)
                     /locus_tag="CNA02020"
                     /db_xref="GeneID:3253827"
     mRNA            complement(join(537834..538047,538101..538160,
                     538209..538457,538520..539626,539679..539888,
                     539944..540192,540249..540270,540312..540353,
                     540485..540563,540655..540774))
                     /locus_tag="CNA02020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566582.2"
                     /db_xref="GeneID:3253827"
     CDS             complement(join(538021..538047,538101..538160,
                     538209..538457,538520..539626,539679..539888,
                     539944..540192,540249..540270,540312..540353,
                     540485..540563,540655..540718))
                     /locus_tag="CNA02020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566582.1"
                     /db_xref="GeneID:3253827"
                     /translation="MSTQSGRSTTSKSSSRKKPLSCAECRRLKLKCELVFPCRHCVKR
                     GLASICPEGELVNGSRRTKILASTEDLHSRIAALEEALKTATSSQHPLLQDSLYANRK
                     EIRQRRSSSSSPESSIQLPSDCLTSFSHLTLGDDPHFSRYYGAASSVYLSKQQSIPVS
                     CERFVPSDESVAPRQPHAISNDYTDLFPPFSSVHSQLDIDGIFHQYLPPPEIGLTLAE
                     VYFHTFGWFTNIVQRPSWNDVFFHHVYRESASIRSNPVKPQRLAVVLLVFALGALMDL
                     SKPPHNEEARHYFNGARACLSLDPSHSVTYVQCIYLYGSYLMNRGEDTSGGDTFWPLL
                     RMGMAVCEAIGLHRDGSNWGLEEDQAMVRRIVFWEIHGYDVLQSTALGRGMCISDASI
                     DCQVPLAETDSGFHARAYALTKIWSQINEKQVRIKPFVYSEVAEIDKALCAFQDDLPY
                     HLSPSLPPSPDDLTNLARHKEAFQRNTLLLYINEAKLTLHRGWFIRALREYPDEPLSS
                     PFKHSYLSCLEACRGVVFLVRNMLILHGQLIHRRWHFFFHLFAACVCLAAAVIRAPAS
                     SLVRSILTELESGINLFKIADREELITVNRLREKAVRAMQNISSASFNELETETEDLD
                     LLGARTTLRRAAPKVSTHEQSGVIPLTVPLFYENTSIPPNAERTETMTAMLDVDDMNQ
                     GNLEWNDFDMDTFLREIGAI"
     gene            540933..546310
                     /locus_tag="CNA02030"
                     /db_xref="GeneID:3253830"
     mRNA            join(540933..542415,542466..542761,542816..542905,
                     542961..543194,543249..543549,543615..543745,
                     543799..543850,543909..544045,544106..544933,
                     544984..545092,545143..545407,545460..545991,
                     546044..546310)
                     /locus_tag="CNA02030"
                     /product="ubiquitin carboxyl-terminal hydrolase 2,
                     putative"
                     /transcript_id="XM_024656194.1"
                     /db_xref="GeneID:3253830"
     CDS             join(541082..542415,542466..542761,542816..542905,
                     542961..543194,543249..543549,543615..543745,
                     543799..543850,543909..544045,544106..544933,
                     544984..545092,545143..545407,545460..545991,
                     546044..546240)
                     /locus_tag="CNA02030"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 2,
                     putative"
                     /protein_id="XP_024511849.1"
                     /db_xref="GeneID:3253830"
                     /translation="MTQYSSPSPPTSNLTSPPTRPGTLPVAFSPRSHPHGPRSPESQS
                     TRRSAPGSSHTRYRTMPLPADSSSTSIPHRSSSISEHADSPVIVDEPEIGLPEAPYRP
                     PEAVIDPPEDDPPPYTPGIVAEHIGEDGDMQVDSKFTAKDFNAWQSNLESYDQMEIDQ
                     STSQSSMPQLGPGVLPRRWLAIAHEHELVRPYIEALPPPSKKFHSQTHAQVAAGQASL
                     PPPSQRPTPVFASNNPFAQDSPRIATLEDIIQALPGDGDDSEHWYFCSTCWGWLKIKA
                     GHGLPPGLQSMEEWEASVIEQKAYPDIESFEKAREQRRDEWARLVGIQNSRLVAPQEH
                     HHFHQFNTLLPSSKLARIDRVVVEEHLNVFPHITVGLDPEESWESFNLPHSPSRLFLS
                     DSSDVWISVDEGLVPGQLPVGLVNAFTAEKMSNPNPGLDGVQSVNEAWNLIATLLINP
                     LFKGQRGWVNLNNAKFQSKIGAGLASSHIMYHIGFACQQEPDGLRVGPFKGGSESGSA
                     AQIANEAGNMAKMDKYMLRVWIEVTLYLLAFLRRNKLQAITPPYMDAIPLEISINDIV
                     PFAQYPTSTAPFPDNVREACHILGVTKYDTAETLETAYDLQIMFDEHNTPRYLGALER
                     ISEASVVGKSSLELKVAVERSLDKYTDDEVLKAYSLIGYTRQHAEDISIPPQGAPDDY
                     ILSMHKSAIQASTSSQQRQDLNRALVLIGKDRRSEQLKSMGEKGQTFVSVQEAYEALS
                     APRDAVDDGLIMQYEMAVNEYPGKADHYRMCLSVIADAPGEERPGLKQFLQTGSREPD
                     VPARKDIPAGLQNIGNTCYLNSILQYLYTIKPLREAVLIFEQDKSKIVPTSKSEVERA
                     KRFVRQLRLLFLQLYKTELPAVRPDEELAYLAITRPEIDSMVEQTQEPPTELSASTAT
                     ATDSAQITPNLLDSIPSVPELTTLPSPSSTIFASPPESPRQDLTGTPIPLEQDEITEE
                     MELDADKENIRSPESSSTRSRDTSSTSTILGKRGNQDRERDNSRSPGEERVKYKQAEG
                     SGNNATRGKSESESALEFELGTGSRVETTQADQVESPSLGTATEIAHLELTTPAGSPS
                     QTRKEEAEVLALTQPEDKYESPSAPPSLPPRPQARKQETLSSGLRFGLQQDAAEVLIN
                     VLSQLELALEQPGEDGKEASNLIKNLYSCKYRQQTVYESSSPSSDDQPTYDAQTPVES
                     VFTHPIIGVEEEGKDLYDCLAELYLGGSAIEYEGKKGFMMDLMDEFPPMLYIQMRRSQ
                     YDPVTGRDRKTNTHISFPQTLCMSRFLTSAPAEKREESIALTREIIRMRTRLHSLRNH
                     TPLSIPSTYKHASSALRQLASSGLDIPELNEVLSPELCDALDREGDEVIKEIEELQQE
                     LPKLKERMDEIWRDVHEEEEEDEHVKAYDYELVSVYMHRGKTSGSGHYWTYQAHLPGH
                     SEEFYNYNDEKVTVVPASEVLQDRTGSDANPALLCYARKGWDLVDSLHREILEHSSPE
                     VEELVLT"
     gene            complement(546174..548736)
                     /locus_tag="CNA02040"
                     /db_xref="GeneID:3253695"
     mRNA            complement(join(546174..546810,546862..547378,
                     547439..547511,547572..547667,547724..548042,
                     548108..548565,548615..548622,548667..548736))
                     /locus_tag="CNA02040"
                     /product="ferric reductase transmembrane component,
                     putative"
                     /transcript_id="XM_566584.2"
                     /db_xref="GeneID:3253695"
     CDS             complement(join(546368..546810,546862..547378,
                     547439..547511,547572..547667,547724..548042,
                     548108..548565,548615..548622,548667..548723))
                     /locus_tag="CNA02040"
                     /codon_start=1
                     /product="ferric reductase transmembrane component,
                     putative"
                     /protein_id="XP_566584.1"
                     /db_xref="GeneID:3253695"
                     /translation="MSSSTEHLRRYIPIPTQYQIYNSYTEDPKWQKKFTIIWTSFLAF
                     SLLLSIPYIIHHFRIGRLYSGLAIRESLDPSQNVSDSSHGNAKRSHSQNKWRGTFIGR
                     AVTGVGAIVQSITLWTLPMPDLSWLKGEVGDCCRRAYFTLSVSQIVLVLGYAGAVIAC
                     FVVGASLTQNSNRPGFLALSQLPLIVLLSLKSPLPLPIFVPSLSYEHYNFLHRWTGRT
                     LFLSATVHGAMWIHQFVVTDQYDQIAAAKSKRGILAYALMGMVVITSLKPIRRKCYQL
                     FWMAHIMFFVGFFAAISYHTPYSRPWIWPCVAIYAYDLVVRMLRYRIKDATLVPVDKT
                     LTMIHIPDCDAGWLPTQHVLLRVLSGSGIFESHPFTITNAPSTAFSASPRGIILYAKV
                     AGDWTKKLHDLARDVKSLEVGDDLEEKESFLANKAQNEGGVNADEEGIDHPGKRVQVM
                     IDGPYGGLKMDLGQYESVLLVGGGSGITFILGSIEEALRVREKGRGPAKVDVAWIVKD
                     LCTIEALAPSLLHLYTLAQRLRLTLTYNLYLTDPPHPLPSTPSLLPASTTLSPYRPEV
                     AQLVRESLPLPLTKAQETLLEQGRELITGDDDGHQTQHHGEGRGHAGGLAVVACGPEG
                     IVMEAKSAVAGLGIAERVRCGGVGFHGECYLL"
     gene            548886..549945
                     /locus_tag="CNA02050"
                     /db_xref="GeneID:3253648"
     mRNA            join(548886..549000,549039..549621,549672..549945)
                     /locus_tag="CNA02050"
                     /product="L-cystine transporter, putative"
                     /transcript_id="XM_024656195.1"
                     /db_xref="GeneID:3253648"
     CDS             join(548888..549000,549039..549621,549672..549866)
                     /locus_tag="CNA02050"
                     /codon_start=1
                     /product="L-cystine transporter, putative"
                     /protein_id="XP_024511850.1"
                     /db_xref="GeneID:3253648"
                     /translation="MQPHPLAAFLVNLTGVTYFIAWSYSFYIQLVHNFKRKTTHGLSP
                     DFVWVNPLGFLALTLWNWGAYFSPVARKQYQDRHHGHLPQVSTSDLAFSLHALIISTI
                     TLAQVFWYGYFRQLLTGHSSSDQHSDEASPLISDSVHNSAAGDDSESSNLVIFHSPIR
                     PSPVAQLFLGGIVISPFVYAIFVWTGKAQFLDWLYYVGNIKVVISAVKYIPQVVLNHR
                     MRAVNGFAIGVIICDIIGSVLSFSQLVISSVFIDHDPSGIIANPAKLGLAGLSFTFDL
                     VFIAQKYWLYRIKKDDEERT"
     gene            complement(549899..551246)
                     /locus_tag="CNA02055"
                     /db_xref="GeneID:36392656"
     mRNA            complement(join(549899..550467,550553..550844,
                     551047..551246))
                     /locus_tag="CNA02055"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656051.1"
                     /db_xref="GeneID:36392656"
     CDS             complement(join(549973..550467,550553..550844,
                     551047..551240))
                     /locus_tag="CNA02055"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514123.1"
                     /db_xref="GeneID:36392656"
                     /translation="MSQMPRPPKRPPAARSTQQQYPSTAYIHSYEASLTCPESSSQTE
                     TGGLIRYAGEVQGDYEIWADRHDIIHLLPSLPNTTSLVSPPSPTLSSSSSSWSLPSDT
                     EEIWYLSDPEEIEVYKNEKKKKWMEALRQERLREREREDLEAGKVEKAGHVDGRWDPD
                     EEPPTQIRTLMSHTATSIFSSPNPSLLEMRILTHHSTDERFAFLRGRWRNAWEKVKGN
                     IKGEKENKRRLEEKERGLGGLGGYESDSEESGEEEEPSIPPEDDGIPPPPPDVDDTVP
                     PPPPLPVEESESGTFPPPQPQPSTEEDQEEEKKRQRRLRVEEWKKQRVSG"
     gene            551378..554846
                     /locus_tag="CNA02060"
                     /old_locus_tag="CNA02070"
                     /db_xref="GeneID:3253701"
     mRNA            join(551378..551485,551568..551768,551827..552984,
                     553036..553109,553169..553223,553288..553698,
                     553751..554229,554289..554354,554412..554533,
                     554584..554651,554703..554846)
                     /locus_tag="CNA02060"
                     /old_locus_tag="CNA02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656052.1"
                     /db_xref="GeneID:3253701"
     CDS             join(551427..551485,551568..551768,551827..552984,
                     553036..553109,553169..553223,553288..553698,
                     553751..554229,554289..554354,554412..554533,
                     554584..554651,554703..554757)
                     /locus_tag="CNA02060"
                     /old_locus_tag="CNA02070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514124.1"
                     /db_xref="GeneID:3253701"
                     /translation="MRFREIIITPTWEAIGPFPSGTRELPFLGSPLAAYSTSSADPDI
                     EFAHRPYSPEETWPSELGNGGRVSWSRFEAKGDWLEISYPNVNWDQLRSDHGWSALQY
                     MVLLRTRLTIPKSGHKRLTPVLINMLQLSEFALVRQGADPHTSGPVRWYQGNSYGFGG
                     PAPGLDSTIKPAAVRFERSLLLEPGVYIMLARAVYDIRQFGDPGPGNPPIIKMSSVNM
                     VHDTEKHVTQLPEEMGTFPSVLSGWLMGEWASVGVRVPEGALETTVIDVNSAKVIYKS
                     RDAEPLERVLAVEIVSNISIVPGQTRLIPMRIRQQTPLSLEARTLSISIDFQSGGQTR
                     VLQWSFPLHHVTYDSHNLTTNNPHFWITCASPSLITDSHLNHLPAHVSSAMIVPPKHS
                     VRHDEEKPVILALHGAGVDVKNSEWGERMPEVPGVWAVLPIGKNEWGEDWHGGSMEDA
                     WAARAAVEVLLRKAGIALSDKTVIIGHSNGGQGAWHLAARYPDRVVGVVAASGWLTIQ
                     HYVPYTDYTSNRYADPALMGILHSSLAPYHNDLHSSNLSDIPILAIHGADDDNVPPRH
                     SRAHAALVSSWAGEKDSFIKVLEIPKRGHWWDDVLSSSDVVDFIQKLPPRQSWDEQRK
                     KGYTLTTANPQECGGRAGIRIVELDTPGRLARLDVNARQWKSNQTAETLDIRGMNVRR
                     IEIKSLQSSQHFQTYVRCRPYGFSPVNNSILGPLAPARAYGPMIRILSSPASFHLIIP
                     SSGEAQPHHLSIAKRIAHDLYVYHKADCDIIADQEGLERVAKGKIGPGSIIVIGRPEN
                     NRYTEWMAAEGKIPIQFPTKGVMAISKDKVVSDRGAGFIALHPHPTHSGSLSLLIAGN
                     DELGLELATRLFPTRTGVPLPDWAMICPRSRWQGANGLIGAGFWGGEWEYNEAMSWMD
                     R"
     gene            complement(554824..556339)
                     /locus_tag="CNA02080"
                     /db_xref="GeneID:3253598"
     mRNA            complement(join(554824..556077,556165..556339))
                     /locus_tag="CNA02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_567147.2"
                     /db_xref="GeneID:3253598"
     CDS             complement(join(554981..556077,556165..556312))
                     /locus_tag="CNA02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567147.1"
                     /db_xref="GeneID:3253598"
                     /translation="METPHSLNRRKRETREDGTDLPESSPRAPLVAWKHDQRIRNAIL
                     QATEDELIDPPIPTQQPRPISSKLSHSSTTINDPVRPRKRICRNHRSLPPCLRNALPS
                     SSASHSLAGSSGVLSEASIKDISGSASAKTQLDLLLEQFRLQVSPMKRATEEGSQPEG
                     RPKRHGKENQTNSARRKSKEKERGQQKALQDKKAKKGDVPLQKHAELSTSAKMRGDSS
                     SSILSHNSSATDISFISAPTHHTSFDRRMSHSSSISSIRSPLSPVKPGAAPRIGLGSQ
                     NKPSKIPPPRISTLKTFKTPFLEPRQGIRSSPRLIESARPAIPQTPARDRACSRVPTT
                     PSIRTTVSGSSSRATPTRPNSSGPQTRSAKKLASNPSGFTNFDVGEDEPEGDRSFDSF
                     DGIFNEGGPEIEMLLRQVDGTQ"
     gene            556541..557667
                     /locus_tag="CNA02090"
                     /db_xref="GeneID:3253707"
     mRNA            join(556541..556653,556706..556759,556827..556948,
                     557006..557086,557146..557216,557267..557453,
                     557504..557667)
                     /locus_tag="CNA02090"
                     /product="vesicle-associated membrane protein 712,
                     putative"
                     /transcript_id="XM_566592.2"
                     /db_xref="GeneID:3253707"
     CDS             join(556572..556653,556706..556759,556827..556948,
                     557006..557086,557146..557216,557267..557453,
                     557504..557566)
                     /locus_tag="CNA02090"
                     /codon_start=1
                     /product="vesicle-associated membrane protein 712,
                     putative"
                     /protein_id="XP_566592.2"
                     /db_xref="GeneID:3253707"
                     /translation="MSLIHALIARGTTVLAEHATGTAELKPAAQITILSKIPPNNSKL
                     TYVWQDRLIHYVSSNGVIYLVMADDSVGRRMPFAFLADLERRFTAQYESDDIVSAGAH
                     SLEEFEPELAKLMHQYTSSPPADPLRQAQSDLNNVKDIMVQNIDSILQRGERLDLLVD
                     KTDTLAGQAYAFRRGARSVRRQQWWKNMRIMALSGVVGLLLLYLFIAQFCGASLGHCR
                     S"
     gene            complement(557574..559102)
                     /locus_tag="CNA02100"
                     /db_xref="GeneID:3253719"
     mRNA            complement(join(557574..557862,557919..558052,
                     558103..558313,558370..558451,558513..558625,
                     558674..558751,558814..558853,558910..559102))
                     /locus_tag="CNA02100"
                     /product="DNAj protein, putative"
                     /transcript_id="XM_566594.2"
                     /db_xref="GeneID:3253719"
     CDS             complement(join(557674..557862,557919..558052,
                     558103..558313,558370..558451,558513..558625,
                     558674..558751,558814..558853,558910..558995))
                     /locus_tag="CNA02100"
                     /codon_start=1
                     /product="multidrug resistance protein, putative"
                     /protein_id="XP_566594.1"
                     /db_xref="GeneID:3253719"
                     /translation="MEGLQRLLQGGRGMGMGGAAGGQTVVADNGETVHISALALLKML
                     KHGRAGVPMEVMGLMLGEFVDDYTISCVDVFAMPQSGTTVTVESVDHVFQTKMLDMLK
                     QTGRPEMVVGWYHSHPGFGCWLSSVDVNTQQSFEQLHPRAVAVVIDPIQSVRGKVVID
                     AFRSINPAALATGQESRQTTSNIGHLNKPSIQALIHGLNRHYYSLAIDYKKTEAEQGM
                     LLNLHKRGWTEGLKMKDFEEMEQGSQKAIENMLNLAVAYTKSVQEESTMTEEQLKTRH
                     VGKLDPKRHLSEAAEKAMEDQVIQSLAMGVLAEL"
     gene            559251..559336
                     /locus_tag="CNA02110"
                     /db_xref="GeneID:3253556"
     tRNA            559251..559336
                     /locus_tag="CNA02110"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:3253556"
     gene            559723..>561987
                     /locus_tag="CNA02115"
                     /db_xref="GeneID:36392657"
     mRNA            join(559723..560683,560737..560972,561039..561392,
                     561456..561598,561668..561779,561829..>561987)
                     /locus_tag="CNA02115"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656053.1"
                     /db_xref="GeneID:36392657"
     CDS             join(560467..560683,560737..560972,561039..561392,
                     561456..561598,561668..561779,561829..561987)
                     /locus_tag="CNA02115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514125.1"
                     /db_xref="GeneID:36392657"
                     /translation="MKRKKNPYRQEMLDLMTAWRKVLPEAFITYTRFGRGSRNFQTPL
                     RGDKALDLNEPCACTKKSRIVTLISLEEQWQEDVQFCPCSSEPIRLIERGFMPVTMAF
                     PETAISFRLLSFFHSIWQHVPIAVQGFADGLFAWQSQLSGVVRAKGSHKARNGGPLIR
                     QAMQFYRELLLRERKVIDKAVNRSLRDIVAGQCPCCFGPRKEQDLPAGTADFVIACDG
                     NFEHSRPIAAAQNDFPKNHPDLFLKTNQLDKARLAVLANGGNSTKVKFDDSACSDHWK
                     AKDGGVSDNAFKDKVDTGLFGMVCRHEIGLKLINLVKTGEKLYNPLALVLWILQDVDK
                     EGRLALLYDIGCNFDAHIKKRNLLVEERDQNRLLIGVSVFHAYAHNWLCQMRYNPRLI
                     AGFGFSDGENSERF"
     gene            complement(561685..564058)
                     /locus_tag="CNA02120"
                     /db_xref="GeneID:3253562"
     mRNA            complement(join(561685..562058,562136..563242,
                     563312..563834,563897..563942,564009..564058))
                     /locus_tag="CNA02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656196.1"
                     /db_xref="GeneID:3253562"
     gene            562009..563919
                     /locus_tag="CNA02125"
                     /db_xref="GeneID:36392658"
     mRNA            join(562009..562094,562149..562277,562337..562576,
                     562628..562795,562867..563919)
                     /locus_tag="CNA02125"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656054.1"
                     /db_xref="GeneID:36392658"
     CDS             join(562160..562277,562337..562576,562628..562795,
                     562867..563246)
                     /locus_tag="CNA02125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514126.1"
                     /db_xref="GeneID:36392658"
                     /translation="MKQLCRVHAAFITLRQQFRKYKAVTEKFEQTRKGRKPKLGTKNT
                     QRYSKQLRSPALAAAIKKYDLAVKNYADTFNPKNVPEFAVSVEALQAKDDEDIFWDDM
                     VFDIKEADWSRNQDCRQGIKFMLMRDRAVEEKARLQAETARLIRWCHDRHNIIEECIS
                     KIKSKMTVPSSSNSTADCNDVNLFFLEETKERHAALEEQRIGDGLWRVWDKRPEPCLE
                     DEGVEDILIMLRERVGIRWGFETTGMDGNPSLDEVYVEKDREIVEVDVSETDGEERTD
                     DREDVGAGKLPGCFVHFLSADILED"
     CDS             complement(join(563139..563242,563312..563789))
                     /locus_tag="CNA02120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512050.1"
                     /db_xref="GeneID:3253562"
                     /translation="MSSQNPARSIQDRPGDNAVFPTDDIWDRATPDDSFSSKTGDSED
                     EEGEDLPARDTPFGDRERQGGDSQTTRDEGINAELFCAAQKGRCRMNKSVKTALNKFL
                     SAQRKALMEFCVQHDVRLATAERYANSQNHRRESGTWQLWRRSRMRRTALLEKFGEEI
                     LKNVSRKEMDEASRELSRTDVFSIICSFFAVCL"
     gene            564218..566041
                     /locus_tag="CNA02130"
                     /db_xref="GeneID:3253735"
     mRNA            join(564218..564427,564474..564590,564645..564815,
                     564867..566041)
                     /locus_tag="CNA02130"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_566596.2"
                     /db_xref="GeneID:3253735"
     CDS             join(564419..564427,564474..564590,564645..564815,
                     564867..565847)
                     /locus_tag="CNA02130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566596.1"
                     /db_xref="GeneID:3253735"
                     /translation="MSEYQALKARALEMQREKEEAMKMELAAKQEREKQLAREQEERR
                     KRLEEASKEARRRELMRAHEELNRKTGGAGNRVSQAEYDPFAEDVKPIATANIPKPSA
                     RSGPSKISKTSLNKPASSSSTKASTSNKSGNSKNGGPSKGSSPPVTAVLGRKEKAARL
                     FAQKAKKSAADSLFSVRSLVESREPAQVRVTPRAGPSQVPPTSMKTEMRGKANGGGRN
                     AAVRSRLMMNGKEELRKLCPDRDVRDRRSIDEISRDLKAKRLLTDESSPQKNSRPLTA
                     SMSKLSIPSSKAREKRPISNPPSEKRRRYSLDDSTDSESESSSSRQAKRRPKKRSRSP
                     PSQFSEPSAAFISAEIQALFRRPGRSGPKYADDFSDASSDDMEAGLSDVEIEERRAAK
                     IARLEDEAAEKEEREHKLRKEALKKQKLKGGKA"
     gene            complement(565908..567764)
                     /locus_tag="CNA02140"
                     /db_xref="GeneID:3253573"
     mRNA            complement(join(565908..566310,566368..566435,
                     566498..566861,566907..566984,567032..567135,
                     567188..567764))
                     /locus_tag="CNA02140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566598.2"
                     /db_xref="GeneID:3253573"
     CDS             complement(join(565940..566310,566368..566435,
                     566498..566861,566907..566984,567032..567135,
                     567188..567750))
                     /locus_tag="CNA02140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566598.1"
                     /db_xref="GeneID:3253573"
                     /translation="MLAPTVAKIPPTPDLPRDHHGPPAKPLASLQETAAPKYFRNPWP
                     SYRTASMWDAYQAYQRGASIAPHPSFFQGSRFFDGEEPYRDQEEDDYESEPIWTESDS
                     IKKRKIYIRPEFSDIRPGDEKDDWRDPPVGLVEPDWGGNSKTGERVTWLGHAGVLVQI
                     PWRIMDQEQTSRGGATCGILFDPIFSYRCSPTQYIGPARYMDPPCSVSMLPEIHICCI
                     SHDHYDHLDYNTIMDLWKYHQATIHFFVPIGLKPWFTASGIPYHRVTELDWWREAIVS
                     FEASPDVDYDPHYPPDDYENKKSIAEDLTKTDTSALTLKVAFTPAQHRSGRSVLDHMT
                     TLWGSWCVGVVEAADAGKVLKRGMNDWKGFKIYFGGDTGYRYASAPEGDSDAICPAFQ
                     QIADYYAPFNLALLPLSTGSSLPFLRTVLSLSLDQYILTSSLHCSPADSLDIHLIIKS
                     ERTLGIHWGTFCDADEARGTRVDFGRCRRSYGVSPEWDTIEAEKGRFVITDIGQTLIF
                     PTTTDDN"
     gene            567919..569626
                     /locus_tag="CNA02150"
                     /db_xref="GeneID:3253599"
     mRNA            join(567919..568113,568163..568354,568411..568538,
                     568590..568663,568713..569116,569170..569626)
                     /locus_tag="CNA02150"
                     /product="expressed protein"
                     /transcript_id="XM_566600.2"
                     /db_xref="GeneID:3253599"
     CDS             join(567998..568113,568163..568354,568411..568538,
                     568590..568663,568713..569116,569170..569572)
                     /locus_tag="CNA02150"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566600.1"
                     /db_xref="GeneID:3253599"
                     /translation="MLFAPATSPPNVRHPYPRPSPGTEFLHFLFHLARLAFAPIIIPL
                     RLLYQTLTAPLTISLLLKLVLLFSLSLISLVLSVLAVGAFFWTWSTGGPIEAEGWLVY
                     GSRKFRLPHTNLQVPLSSIIEDVRYDIQVEMELLRPRKGSDVLDNFMLSLDLMSAKYP
                     QTALMSAAQPTLAPSPLPESFITLPSLATRFIPPCVLPWPFRSFCPSKIIGYGDPVDQ
                     KVLQRRAKAGFLELASTKDIVPLRKDLMEGVLLKPSSAPESVIGSIFLSIGREDSFTG
                     DTEGESHSTEVKTTGWVVVRFIPRPSGIRWLISVHPFPPILLLPPLSLSLTLLSSIFG
                     CAIITGIRRKPSNSRKSKRSLKAPSRSHRIRDSNARSGQEGTERQARVQYRAVRTRRA
                     SNHTDADSTTYSESRIPTENTNSASTSEIGDRNSIVISDDESTSSR"
     gene            complement(569480..570505)
                     /locus_tag="CNA02160"
                     /db_xref="GeneID:3253438"
     mRNA            complement(join(569480..569998,570158..570505))
                     /locus_tag="CNA02160"
                     /product="expressed protein"
                     /transcript_id="XM_024656055.1"
                     /db_xref="GeneID:3253438"
     CDS             complement(join(569863..569998,570158..570249))
                     /locus_tag="CNA02160"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514127.1"
                     /db_xref="GeneID:3253438"
                     /translation="MFGFGRLGHIVFDLLAISTILAGVKKSTGYSIQTSLFTDTAIRS
                     FIDSYLSVGETVFGMLSGYAVNSRYFKRNIE"
     gene            complement(571134..572558)
                     /locus_tag="CNA02170"
                     /db_xref="GeneID:3253606"
     mRNA            complement(join(571134..571268,571336..571446,
                     571497..571718,571779..571910,571976..572039,
                     572159..572279,572349..572558))
                     /locus_tag="CNA02170"
                     /product="peroxisome organization and biogenesis-related
                     protein, putative"
                     /transcript_id="XM_024656197.1"
                     /db_xref="GeneID:3253606"
     CDS             complement(join(571193..571268,571336..571446,
                     571497..571718,571779..571910,571976..572039,
                     572159..572279,572349..572435))
                     /locus_tag="CNA02170"
                     /codon_start=1
                     /product="peroxisome organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_024511854.1"
                     /db_xref="GeneID:3253606"
                     /translation="MSTLATNIILHPKVNRSLAILATTVGRDKVTRLLQYLARLVSWY
                     LLSRGRMESASRFEGLKTGLANGRKVMRLFRPAEFLQSAVNLAQRPVTSLKGPGQIAH
                     LAQIGRQIGYAGFHTADMIVWLAQVRFLKFDKVTTQRYVRLMYKFWFAGIVCSLVSSS
                     ASLVRLRADSRRFALSSQVAKEEEKEGRSGEEAARQMAERRERGRALLAQRQSILSQL
                     VSDSLDVWIPATGLGYTNLNEGTLGAFGVMTSYMGLQTQWMKHSAAGVKKSI"
     gene            572760..574480
                     /locus_tag="CNA02180"
                     /db_xref="GeneID:3253584"
     mRNA            join(572760..573484,573530..573845,573894..573921,
                     573973..574088,574136..574195,574252..574480)
                     /locus_tag="CNA02180"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_566606.2"
                     /db_xref="GeneID:3253584"
     CDS             join(572775..573484,573530..573845,573894..573921,
                     573973..574088,574136..574195,574252..574446)
                     /locus_tag="CNA02180"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_566606.2"
                     /db_xref="GeneID:3253584"
                     /translation="MFKRLPRTLLQPSSRPPQVCSQCRNLSQLRAPVHISQFPRYAST
                     ISDRQTKQARMSKLPVSHKPPKRRLEAASQPLRNAASITRGPVLQCIAHTTAEKYDLI
                     ALGTTLQSLGVRWDEVPEGDPDRALVIGPWKGRGGAERLISGKDVRSTSTIAKSPAVE
                     WAENEGVDLRDMGFGYGERGEIWVFSSGSFVTWGLTEEEGKAFLRQVIRGGRNVEIDR
                     VSPKECELEEVDFVVDPTAKTHILGNLILLGRPPQLSTFHYSPSLASLLARYTLSLSL
                     SRSSSLSVLEERLDNHLASVSILPRTLEMYGRQPLPRKEVIRKMGELMTLRMAVNTAG
                     GGLDDTPEFYWSEPELESYFDSVASEFEIKERIDVFNKKIDYAQEVQSTLRALLTESS
                     GHRMEMIIILLISVEVVIVLIREGPDLIHKLLEIVGVAPAEAEDITENIQKVADKLPS
                     IGAISSPAIRHTTTHWADGSERYV"
     gene            574947..575041
                     /locus_tag="CNA02190"
                     /db_xref="GeneID:3253971"
     tRNA            574947..575041
                     /locus_tag="CNA02190"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:3253971"
     gene            complement(575209..575303)
                     /locus_tag="CNA02200"
                     /db_xref="GeneID:3253966"
     tRNA            complement(575209..575303)
                     /locus_tag="CNA02200"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:3253966"
     gene            575664..579222
                     /locus_tag="CNA02205"
                     /db_xref="GeneID:36392659"
     mRNA            join(575664..576899,576950..578414,578466..579222)
                     /locus_tag="CNA02205"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656056.1"
                     /db_xref="GeneID:36392659"
     CDS             join(576698..576899,576950..577062)
                     /locus_tag="CNA02205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514128.1"
                     /db_xref="GeneID:36392659"
                     /translation="MGPIVMQLADLPNQYRSQFLYTMLMGITPAPREPPSCFLHRLLL
                     PLAVELLSAHCDGLWVKTPKYPEGRLILSALARFTVTDLLLWLLPGALTTRGKTRHAS
                     NV"
     gene            580568..582335
                     /locus_tag="CNA02210"
                     /db_xref="GeneID:3253762"
     mRNA            join(580568..581051,581119..581345,581402..581655,
                     581714..581847,581897..582041,582101..582335)
                     /locus_tag="CNA02210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567145.2"
                     /db_xref="GeneID:3253762"
     CDS             join(580698..581051,581119..581345,581402..581655,
                     581714..581847,581897..582041,582101..582273)
                     /locus_tag="CNA02210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567145.1"
                     /db_xref="GeneID:3253762"
                     /translation="MKIDSLSTPGHSTIDDESFIPHLLTFQRQYFSLYPPYLLTFPDS
                     FLLASPLGQDFLLRCILGENVEADEPDLDQPIQRERWVKLYQPEKTYQTKVWKKIMAS
                     LEAGIKSVERLDNSEWAIDDRFYDHMVTLMVSSNPIPLDNGPQTSYRTFLYDMPDATF
                     HGTFGHDKPQNDARITLLEEQIAIQGGTTGLRTWTAALHLGHHILNHFSTLFSLPRDP
                     DRGFIELGAGTGFVSILLAQMGFKVVATDLESPANQTGEQSENGNSVITPLGRLQSNI
                     ELNQYDVKPQSLHLNWYDARRPRDTDPSLEAWSKIQELHWDIVAADVIYDPDLVRPLV
                     DTIDVLLGNHDGPEKLRAVISATIRNQETFDLFLETCDKHNLRVDILSLPTMSAQAST
                     FWDSALDAGTRVLIMRITKHPITSRGNIISRQSYDF"
     gene            complement(582327..583057)
                     /locus_tag="CNA02220"
                     /db_xref="GeneID:3253567"
     mRNA            complement(join(582327..582404,582458..582572,
                     582624..582693,582900..583057))
                     /locus_tag="CNA02220"
                     /product="60s ribosomal protein l30-1 (l32), putative"
                     /transcript_id="XM_566608.1"
                     /db_xref="GeneID:3253567"
     CDS             complement(join(582381..582404,582458..582572,
                     582624..582693,582900..583032))
                     /locus_tag="CNA02220"
                     /codon_start=1
                     /product="60s ribosomal protein l30-1 (l32), putative"
                     /protein_id="XP_566608.1"
                     /db_xref="GeneID:3253567"
                     /translation="MAPVKKSKSAKSSESINTKLQLVVKSGKFTLGYKQALKQLRSGK
                     AKLILISKNCPPLRKSEIEYYAMLSKTNVHHYDGSNVDLGTAAGKLYRVGVMSIQDAG
                     DSDLLQQQESA"
     gene            583277..584071
                     /locus_tag="CNA02230"
                     /db_xref="GeneID:3253632"
     mRNA            join(583277..583534,583648..583770,583891..584071)
                     /locus_tag="CNA02230"
                     /product="chaperone, putative"
                     /transcript_id="XM_024656198.1"
                     /db_xref="GeneID:3253632"
     CDS             join(583368..583534,583648..583770,583891..583912)
                     /locus_tag="CNA02230"
                     /codon_start=1
                     /product="chaperone, putative"
                     /protein_id="XP_024511855.1"
                     /db_xref="GeneID:3253632"
                     /translation="MASPLVVGLGLLGAGLAGRVGYQMMRASRGGAQEFLKGGFKAKM
                     DRSEAIQVLGLREPITSNKLKDAHRRLMLANHPDRGGAPYLAGKVNEAKALLDKEVVR
                     R"
     gene            584386..585863
                     /locus_tag="CNA02240"
                     /db_xref="GeneID:3253630"
     mRNA            join(584386..585176,585227..585475,585528..585863)
                     /locus_tag="CNA02240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566612.2"
                     /db_xref="GeneID:3253630"
     CDS             join(584479..585176,585227..585475,585528..585804)
                     /locus_tag="CNA02240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566612.1"
                     /db_xref="GeneID:3253630"
                     /translation="MALDQDATDEQLYADLPSPLHLSPSELIETYHPNVLAPLVRCSK
                     LPFRHLTSLYETHITHTPMILAEEFSRAQIARTSDFSTSSNERGVYWMAPNNGKCRGK
                     GEYITRVGHPEDVRPAKEPWKTYHSPPSTERLPPSPAPPNPQAQLVRGCLIAQFASPN
                     AKSLADAAELISPYVDGIDLNCGCPQRWAYNEGIGCALLRKPELVRDMVRGVKDRMGW
                     GWPVSIKIRIDSEQEKTEQLISNALQAGISHLTIHGRTRHQPSTDPVNLPGIKFAVDC
                     VKGEVPCVANGDVWELEDARQMRLHTGVQGVMAARGLLANPALFAGYDKTPEDCVSQF
                     INLGLDYGFNFSLFHRHLAYMLESHLSRVEKVWFNSLTSQASAIEWLNERAINFKEKR
                     GTIWDARRGYNITDV"
     gene            complement(585831..588337)
                     /locus_tag="CNA02250"
                     /db_xref="GeneID:3253628"
     mRNA            complement(join(585831..586310,586361..586517,
                     586574..586776,586825..587074,587124..587246,
                     587297..587463,587511..587598,587656..587822,
                     587876..587934,587985..588337))
                     /locus_tag="CNA02250"
                     /product="ammonium transporter MEP1, putative"
                     /transcript_id="XM_566614.2"
                     /db_xref="GeneID:3253628"
     CDS             complement(join(585903..586310,586361..586517,
                     586574..586776,586825..587074,587124..587246,
                     587297..587463,587511..587598,587656..587822,
                     587876..587934,587985..588090))
                     /locus_tag="CNA02250"
                     /codon_start=1
                     /product="ammonium transporter MEP1, putative"
                     /protein_id="XP_566614.1"
                     /db_xref="GeneID:3253628"
                     /translation="MVNITYGALLSSSDGAVHFEPLGTDIISTLAGQPTAFDPGDIAW
                     VLTCSALIVFMLPGLGYLYSGLARRKNALSMLFLSLVSLGIVSFQWFFIGYSLVFSET
                     GGSFWGDGRNIGFRQVLERPIPEANGKLPEIVFATFQLMFACLVPAVLLGAAAERSRI
                     LPAMIFMFCWTTLVYDPLAHWIWSANGWANKWGVLDYAGGVPVEIASGTAGLAYSYFI
                     GKRRGYGTDRVLFKPSNVGNVVLGTVFLWVGWLGFNGGSCYCASLKAALAIFNTNLAG
                     SVGGVVWLIMDFRLERKWSMVGYCTGAIAGLVAITPAAGYVGAPAAALIGLVSAAVSN
                     LATRLKVTMRVDDPMDIFAVHALAGIVGVLMTGLFAQSSVAANDGFSDIDGGWLDRHY
                     VQLGKQIAWACVGMAWTFVVTYAIMFFINLIPGCHFRATDEAEIVGMDEVELGEYVAD
                     YAFHQRDLEGEYEAHTLSQCPSATKLHLQEFRHNKDGESSSSSQPKELPPTMPRGGAV
                     VGDLDGDTAVESQHSRSRSRGRSQHRVRIEKEGDNEAMEMSDVRHTKTSDQRQEGSNL
                     EGSYMDHRE"
     gene            588782..590576
                     /locus_tag="CNA02260"
                     /db_xref="GeneID:3253626"
     mRNA            join(588782..589044,589107..589794,589852..589994,
                     590047..590576)
                     /locus_tag="CNA02260"
                     /product="8-amino-7-oxononanoatesynthase, putative"
                     /transcript_id="XM_566616.2"
                     /db_xref="GeneID:3253626"
     mRNA            join(588782..588813,588878..589044,589107..589794,
                     589852..589994,590047..590576)
                     /locus_tag="CNA02260"
                     /product="8-amino-7-oxononanoatesynthase, putative"
                     /transcript_id="XM_024656057.1"
                     /db_xref="GeneID:3253626"
     CDS             join(588931..589044,589107..589794,589852..589994,
                     590047..590445)
                     /locus_tag="CNA02260"
                     /codon_start=1
                     /product="8-amino-7-oxononanoatesynthase, putative"
                     /protein_id="XP_024514129.1"
                     /db_xref="GeneID:3253626"
                     /translation="MTQLDDRLDDFLRGRKQKGRFRSLKEYDTSPHSGLTDFSSNDYL
                     SLTSSESLRSAYLERLANSPQILGSTGSRLLSGCSPAHSALENRLSTLFNSPSALLFN
                     SGWDANVSFFATVPQASDWVICDELVHASVHSGLRSSRVPPEKRLIFPHNSPEGLEKV
                     LQQIARNPSSGHDSTVFLALESLYSMDGDMAPLPLLLDIFEQYVPRTRQCVVVDEAHS
                     TGVYGEHGKGLVYALGEEGGWAPGDGNKRGKSRVDVRLMTFGKAVGCSGAVLLCSPTV
                     RTFLINFARPFIFSTAMPHSTVIALQCVWDLLLGLEGNKRRESLMAIAAYIHSLLNDL
                     LRNTPAEILRLPPNSGAQFTFHIPPHDTESVSSSPLSPILGLLTPTPHALSAFLLEKG
                     FIVRPVVPPTVPPGAERVRICLRASMDKKVIDQLMAALREWVESKMNVGVMRAKL"
     CDS             join(588931..589044,589107..589794,589852..589994,
                     590047..590445)
                     /locus_tag="CNA02260"
                     /codon_start=1
                     /product="8-amino-7-oxononanoatesynthase, putative"
                     /protein_id="XP_566616.1"
                     /db_xref="GeneID:3253626"
                     /translation="MTQLDDRLDDFLRGRKQKGRFRSLKEYDTSPHSGLTDFSSNDYL
                     SLTSSESLRSAYLERLANSPQILGSTGSRLLSGCSPAHSALENRLSTLFNSPSALLFN
                     SGWDANVSFFATVPQASDWVICDELVHASVHSGLRSSRVPPEKRLIFPHNSPEGLEKV
                     LQQIARNPSSGHDSTVFLALESLYSMDGDMAPLPLLLDIFEQYVPRTRQCVVVDEAHS
                     TGVYGEHGKGLVYALGEEGGWAPGDGNKRGKSRVDVRLMTFGKAVGCSGAVLLCSPTV
                     RTFLINFARPFIFSTAMPHSTVIALQCVWDLLLGLEGNKRRESLMAIAAYIHSLLNDL
                     LRNTPAEILRLPPNSGAQFTFHIPPHDTESVSSSPLSPILGLLTPTPHALSAFLLEKG
                     FIVRPVVPPTVPPGAERVRICLRASMDKKVIDQLMAALREWVESKMNVGVMRAKL"
     gene            591171..593929
                     /locus_tag="CNA02270"
                     /db_xref="GeneID:3253624"
     mRNA            join(591171..591246,591322..591543,591606..591742,
                     591795..591875,591928..593434,593487..593929)
                     /locus_tag="CNA02270"
                     /product="3-isopropylmalate dehydratase, putative"
                     /transcript_id="XM_566619.2"
                     /db_xref="GeneID:3253624"
     CDS             join(591332..591543,591606..591742,591795..591875,
                     591928..593434,593487..593838)
                     /locus_tag="CNA02270"
                     /codon_start=1
                     /product="3-isopropylmalate dehydratase, putative"
                     /protein_id="XP_566619.1"
                     /db_xref="GeneID:3253624"
                     /translation="MPAPITTPRTLYDKVFDDHVVHSGEGDTLIYIDRHLVHEVTSPQ
                     AFEGLRNAGRKVRRPDCTLVTVDHNIPTISRKNFKNVNTFIGEADSRAQVAALEDNVK
                     EFGLTYFGMNDKRQGIVHIIGPEQGFTLPGTTVCCGDSHTSTHGAFGALAFGIGTSEV
                     EHILATQTLPQAKSKNMRINVEGTLAEGVSSKDIVLHIIGVIGTAGGTGCVIEFSGST
                     IRALSMEARMSICNMAIEGGARAGMIAPDEITFEYLKGRPLSPREGEEWDKAVEYWKT
                     LKTDPGAKYDIEVEIKAEDIVPTLTWGTSPQDVVPITGVVPNPDDFPEAQRGNIVRAL
                     EYMGLTSGTPMEKVKIDKAFFGSCTNGRIEDMRSAARVILASQKNGGPSKVADGVYAM
                     IVPGSGLVKQQAEAEGLDVIFKKAGFDWREAGCSMCLGMNPDQLKPGERCASTSNRNF
                     EGRQGAGGRTHLMSPAMVAAASLTGYLTDVRTLMGSHANDDGLKITSYFDYLTPVEVP
                     AQPTEPTEETEEGKTPVKAAAAGSAGLPKFNVLRGIAAPMWEANIDTDKIIPKQFLKT
                     LLRTGLGKALFWPLRYDVETNEEIPDFVLNKEPYRHASIIVCTGPNFGCGSSREHAPW
                     ALNDFGIRCVMAPSFGDIFKTNCFKNGMLPLQLPQADLDTLYEDASAGLEITVDLENQ
                     VIVRPNGKPSIPFSVDPFRRHCLINGLDDIGLTLVHRDEIEKFEGKRTAVWPWLDGVG
                     YAKKGQKVIAVPVRKGARKTDW"
     gene            594060..594154
                     /locus_tag="CNA02280"
                     /db_xref="GeneID:3253953"
     tRNA            594060..594154
                     /locus_tag="CNA02280"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:3253953"
     gene            594490..598443
                     /locus_tag="CNA02290"
                     /db_xref="GeneID:3253635"
     mRNA            join(594490..594637,594700..594881,594931..595351,
                     595398..596412,596465..596656,596714..597230,
                     597289..597513,597571..598443)
                     /locus_tag="CNA02290"
                     /product="isoleucine-tRNA ligase, putative"
                     /transcript_id="XM_566621.2"
                     /db_xref="GeneID:3253635"
     CDS             join(594616..594637,594700..594881,594931..595351,
                     595398..596412,596465..596656,596714..597230,
                     597289..597513,597571..598281)
                     /locus_tag="CNA02290"
                     /codon_start=1
                     /product="isoleucine-tRNA ligase, putative"
                     /protein_id="XP_566621.1"
                     /db_xref="GeneID:3253635"
                     /translation="MSFRTHDPSKPIHIPTTEDEVLQYWRDIDAFKTSQKLSEGKPEY
                     SFFDGPPFATGKPHYGHLLAGTIKDIVTRHAHSTGHHVERRFGWDTHGLPVEHEIDKT
                     LNIKGKEDVMAMGIDKYNAACRDIVMRYSNEWKSTVERMGRWIDFETGYKTLDPTFME
                     SVWWVFGQLWKKDQVYRGLRVMPYSTGCTTPLSNFEAGEDYRMTSDPAITVSFPLADD
                     PTTSVLAWTTTPYTLPSNLALCVNPEFTYIKIHDFERDQNFILLESLLGTVYKEYQGG
                     KKPDPKKEPKFKKVGTFLGKDMVGWRYVPMFDYFTEQYEDRAFRIIADTYVTDSDGTG
                     IVHQAPAFGEDDHRICVANEIVRDDEIPPCPIDESGRFTSEVPEHQGKHVKEADSALI
                     KDLQKKGRLITRSDIMHSYPFCWRSGTPLIYRAIPSWFVRVANISDKLVKNNEKTRWV
                     PGAIGEGRFGGWLRNARDWNISRNRYWGTPIPLWVSEDYEEIVCVSSIAELEELSGQK
                     GISDLHRESIDSITIPSKQGKGTLRRIEEVFDCWFESGSMPYAQSHYPFENVERFQKS
                     YPADFISEGIDQTRGWFYTLLVLGTHLFETAPWKNLIVTGLVLAADGKKMSKKLKNYP
                     DPMEVVNKYGADCVRLFLVNSPVVRADNLRFREEGVREILTNVILKWINSLNFYLGQV
                     ELFEQTTGDKFVYDHDAKKSTNVMDRWILATCQTLIQHVETEMAAYRLYTVIPKLLDL
                     ISDLTNWYIRFNRSRLKGSGGVEDTRAALNTLYEALLTLCLTMSSFTPFTCETVYQAL
                     RPTSPAPEDPAQDVRSVHFLPFPKIRAEYFDPIIERQVQRMRAVIDLGRLIRDRKTLK
                     VKMPLKELIIFHHDQEYLDDVRSLESYIAAELNVVNIVYTSEESAVGIKYRATADWPS
                     LGKKLRKDIGKVRSHLPKMSTDECKAFVAEGKIVVNGVELVAGDLVVTRFAEVPTGEV
                     KYDTASDNDVIILLDIRRHPELENMSLLRSLTSRVNKLRKEAGLKPSDKVDIFYEYDA
                     GEEDAIRPAISGNEEYLNKQIGGVPVELSQKGEDKEVLKREVRMKEAEGLGQGERFVL
                     SLALRA"
     gene            complement(598436..601176)
                     /locus_tag="CNA02300"
                     /db_xref="GeneID:3253640"
     mRNA            complement(join(598436..598858,598935..599004,
                     599084..600475,600524..600747,600809..601176))
                     /locus_tag="CNA02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_566623.2"
                     /db_xref="GeneID:3253640"
     CDS             complement(join(598746..598858,598935..599004,
                     599084..600475,600524..600747,600809..601139))
                     /locus_tag="CNA02300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566623.2"
                     /db_xref="GeneID:3253640"
                     /translation="MHSALTPNTAAFLEYISPGDAPTSAPPAALFNNMPVPGRDTPED
                     TPPSASTHDSQLNEHPAPSDDSDSLTPEIALGPADDPANKDTLAGNGANKRKAGRPSA
                     VVDDDDEDASDSDLPSGHEDKKQHGAGRAAAGSASGSGRKGGRKSGGGEGDGKRELNK
                     SERRKEQNRAAQKAFRERREAKVKDLEDKVAELENKAYGTQIENENLRGILKRLQEEN
                     VALKQSAFTFSMPVNSRSSTNSNNGNFSVPAPQNPKPLTPPQSNNDDSLKSVNDVPML
                     AHRHSSTNTVSDNSSESLVSLRSSDRTPPALFSDHFNTYALGAIPVPPPSSSSQPVQK
                     YPSASNGQQSMSSNSNSSGVISPPSADQSEFNALWESLYPNDVGNLLSQNTNQNQGGP
                     FTLLNSQPDSMSFASAGNSMNDLFNFGAPSASISTSARPSVNPAPASVTQSANHITQN
                     LGATGQASDWNRFAFREPTAEASAPNWDVTDNSVNEFLASLSGDTTTDTTANDYLNND
                     DEAFNAQLRKIFGTDNSPSAAFNLPSTSFSPNNYLNMSPSPVMPLSNSQSPQSSDSRS
                     NTNISSGRGNDISMIDSPEYSMGSSRTSVSHESTDLQQGKISAIRSLKEYACKADNEV
                     IHVVDEKGRVIKPSELWMRFGMQHENPTEHLLIDDLCDQMRAKATCKDGKLQLDITDA
                     AVLFQRGEGQPHSYAEKMVKKAANHSS"
     gene            601416..604854
                     /locus_tag="CNA02310"
                     /db_xref="GeneID:3253579"
     mRNA            join(601416..601612,601660..602298,602351..603007,
                     603066..604854)
                     /locus_tag="CNA02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_567149.2"
                     /db_xref="GeneID:3253579"
     CDS             join(601424..601612,601660..602298,602351..603007,
                     603066..604682)
                     /locus_tag="CNA02310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567149.1"
                     /db_xref="GeneID:3253579"
                     /translation="MNNQNQQPPVNLSDPHLQARLALLAAQQQGLADRQPVSQDHIAA
                     MAAAMGSMQGQNRDAIMKQLQALQNSQAHRAKLAAQQTANQQPQPGPSAPSPANQPGL
                     SAPSPITAPSPSNPLHQDSFQHPGMPRSGSGDNLLNQQQQQQQQQQQQQQQQQQQQQQ
                     PFMSQQQRELFLAQQRAHQQQSMAGPSDGSVRPPSQAQPNLPGQPQGQSPRQPLSHVQ
                     QRQNFLKTFMGYFQNIGQQPPPAIFDNGEREGAFKVGDGWMDVIDLLMAVMKAGGIMN
                     AMQQPADSPTWRNLLAVKNIPTTLPYPIPAPKPPNSDPNAPPTMTTDPVQYLTAAYFA
                     YIHGFETHMQKTRQASYARQQAMAIAQGRPPPPPPVMPSLAGFRLPGQAPSPAESWSS
                     AQAQTPAPAVPSLPPPLNTSAQPPPASTAPTPTHPAPSPSDSSTKSSTTSGPPRARKA
                     SSKKEKKDLSVNTNVPSPIDGEAETPTGSSGGKKRKRKNANAPQPETASTPAPPPIVS
                     TPAPEPPAEPTKRARYRVEYRPINFPVQTFAGWEPSMVSSTFPKHSLRQGTRPIHDLA
                     VVDMEAILMGLRSRMPKELGYAVTVLNMLSMSHPEENINGLPLHHLREIFIELLDLTE
                     EAAFGDGGRSGWLKSWHDLNDVKEESAADDKNSCMDNLNKMPFFELERLGRDFDFSVY
                     KDEEEYQWRKEETSGSTGIVLACINMLRNFSMLPDNQELMASYPQMINLLASISDARL
                     CRLPGENCTKIKRPFSIIELARIRRDCVSILVNIGEYVELPRVPSSSSLAIFRLLSTF
                     IASGWESNALSEPVYGPTLSSSIRDVGPPTVVPSIDRALAAFSLLAQPDANREALGSS
                     VPPSELIDMYESLLKLLPVTKRQFEAMHSIEETLGYNETLALCLYSLAFLSPLHVRAS
                     MRNVPGSVPLLTRIIFDTALQKSDYRSNPFGILCRRLCETLGVLNGTVSPAGTVEGPS
                     GMGFGAGGIEGSGWKFASGRVENGWLAGKEEGVLGAILGVKGMSWAALGELDGMVWGG
                     DSI"
     STS             601812..602034
                     /locus_tag="CNA02310"
                     /standard_name="AGC21"
                     /db_xref="UniSTS:470885"
     gene            complement(605010..605104)
                     /locus_tag="CNA02320"
                     /db_xref="GeneID:3253545"
     tRNA            complement(605010..605104)
                     /locus_tag="CNA02320"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:3253545"
     gene            605389..608194
                     /locus_tag="CNA02330"
                     /db_xref="GeneID:3253825"
     mRNA            join(605389..606188,606246..606386,606441..606614,
                     606673..606837,606901..608194)
                     /locus_tag="CNA02330"
                     /product="mRNA-nucleus export-related protein, putative"
                     /transcript_id="XM_567235.2"
                     /db_xref="GeneID:3253825"
     CDS             join(605712..606188,606246..606386,606441..606614,
                     606673..606837,606901..607899)
                     /locus_tag="CNA02330"
                     /codon_start=1
                     /product="mRNA-nucleus export-related protein, putative"
                     /protein_id="XP_567235.1"
                     /db_xref="GeneID:3253825"
                     /translation="MAHYVPTSFKPMRSLVAAAGIQLSPSPSSDHNEGTFETEDGELL
                     LGNIIIDEFPADGDRPPVKGEHFQPPGLFNTSMMPTIVTTDGKLHVELKTKDDKAAIS
                     EKGQGEGLMLPQHVLLETSSAVQAAEDGGDDGEEGDHSLGGDDFWEGLHFVDDDIIRG
                     SRRYFNPEPEDNLEVEATFLATADSRKVCQNCKRPGHQASKCPHIICTTCGAMDEHER
                     RDCPLSKVCYGCGRRGHHKSECPDPISRNKRWAGCERCGSREHTDKNCPTLWRIYTYR
                     SDSGRRETIKLKEKAEGWVKEAIGGDAMEDWCYNCARTGHFGDDCPQRRGSLVRLTAP
                     SAFSREIARRGPFFSAPKSFLPNPTHSRWEDDDPSAIPYTSAYDSFAGSNAGRRGREK
                     EKQQMMARDTDFNDEDDWFSGDRNRNIGKGAGTPRNNPRGGRGGKRPWDSEMRGKEWD
                     RDRYDRERASREFFDRDREPPRSRGQAPPRRRSRSPNRRDGSRDNAVQETAPNSAPPK
                     AVYRPAINIRDRAIDSPSVREGERGAKAGSKALVSRALSGQNSSNSTPRGQRSSNSPS
                     ALPSLLSRIESPTPSNSTSRSRKGRGKEQERDWENEWRRRGNGGGKVANWGKDLDKET
                     EGLSLKKKTKDDISRGSSGQKYYGGYM"
     gene            complement(608241..610902)
                     /locus_tag="CNA02335"
                     /db_xref="GeneID:36392660"
     mRNA            complement(join(608241..608661,608715..608802,
                     608973..609038,609293..609561,609659..610902))
                     /locus_tag="CNA02335"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656058.1"
                     /db_xref="GeneID:36392660"
     CDS             complement(join(608420..608661,608715..608802,
                     608973..609038,609293..609457))
                     /locus_tag="CNA02335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514130.1"
                     /db_xref="GeneID:36392660"
                     /translation="MSYGNPAQEEPVSSSSQLPVPATGQQIATQKPSKASRMLRGPIG
                     RDQILEWQASLCCLTPLGTCFRPQSSGTIYCSIHTCQAINVDRERCGNAVHNPRQSRF
                     CSNGWHVENSKYDNIVEMVTKRKQLDEANAARRKQEMTEQMALFKSQFSPLSSTDKTS
                     SSSNQSSQLFMSNPQTRKQNGFQMRW"
     STS             609669..610502
                     /standard_name="Eco18"
                     /db_xref="UniSTS:470884"
     gene            complement(610961..611814)
                     /locus_tag="CNA02340"
                     /db_xref="GeneID:3253646"
     mRNA            complement(join(610961..611132,611186..611814))
                     /locus_tag="CNA02340"
                     /product="expressed protein"
                     /transcript_id="XM_566625.2"
                     /db_xref="GeneID:3253646"
     CDS             complement(join(611005..611132,611186..611663))
                     /locus_tag="CNA02340"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566625.1"
                     /db_xref="GeneID:3253646"
                     /translation="MLRSQLRLPRVPLQSVYAVPSRPSRRFSHAFPTDVPPLRQRIRP
                     LVPFFIYWTIITSLVVHLMRTRQDTEASLARQQAKITVLSDLIAKLQRGETVDEGEMQ
                     RELEMVGLRERTSATLALDKEMRIVGDVGWRDMLFGKRERTAEDEAKEERVIEEWASV
                     INETANAPPPPSSANSSPRQVEQPQNRAGVAKRAPGSNVYL"
     gene            612000..617216
                     /locus_tag="CNA02350"
                     /db_xref="GeneID:3253678"
     mRNA            join(612000..612411,612498..612593,612655..612734,
                     612786..612793,612849..612988,613185..613805,
                     613872..614019,614075..614281,614395..614604,
                     614675..615101,615155..615225,615270..615411,
                     615465..616101,616152..616240,616304..616829,
                     616889..617216)
                     /locus_tag="CNA02350"
                     /product="Ras guanyl-nucleotide exchange factor, putative"
                     /transcript_id="XM_024656199.1"
                     /db_xref="GeneID:3253678"
     CDS             join(613194..613805,613872..614019,614075..614281,
                     614395..614604,614675..615101,615155..615225,
                     615270..615411,615465..616101,616152..616240,
                     616304..616829,616889..616978)
                     /locus_tag="CNA02350"
                     /codon_start=1
                     /product="Ras guanyl-nucleotide exchange factor, putative"
                     /protein_id="XP_024511860.1"
                     /db_xref="GeneID:3253678"
                     /translation="MHRPNAKQLTLGCLLPPTPSELVSPVTPSPMSPASFHTATAGTP
                     DTLARVTSEEDDRSRYGAKGPDVPPVALPGYQHSLSYLDSLQELNPDPAQAALLQSAR
                     LKLSSKDKEAMRKIRFTMMEQNFSDSASSNSVSPSSPRFPQYSAAGPSKGQELRTRRS
                     ILSKFVVTEPRGDSGEDEDVERLETMKRWQSQPALSRERHCMTNFLSTPACSVDYAIA
                     VVGHEGVGKTTIIAEALRGWGMSNPLSIYSPDGHLIFSCCSQIAAGGKLKTGCKVEFF
                     EMGINALDLTPGAASIWPSSALKVSGAVCCYDARREETLEGLKNCIEQLSATSTPIVI
                     IACKSDPDAELRVIAAHGNSMGEPCNVGLIEVTIKTHEGKLKMRNAVRWLLYKLEQRQ
                     RRQQRQLSALNIAQSLVSGVQAPTAVGSIDVTKSTIGSLASLDSDADCLGDRSMWEQT
                     LSTASKTSEAPLIGQTPGVEEEIREDQKSTSYGVGKLVTPDKERIMNDGSLGCLDNLE
                     ESTRREKKQTGRVQAKHDTIADQIAEGISPVYVALKDLLNRLFTSIVSSQDDAFTRSF
                     FLTYRRFCHPQDLMLEFLKRFREIEDYAVSSDVKNWALLKLTGALVDWTNRYPGDCVS
                     MSTPIIFSEIIILLSKHTFMAHLISDLILVQDALPKTTDPDESWSMRSHDVTSHNVEK
                     SIQVLIDKEGGSKLDDNEEEDEVGSLGHKAASELSASTGSLQLEEVQRQGSGSDSHRV
                     RIPSGVSVLGEEGSLSSEGQHSHTRPAGSSYRMNSMQVSDEVADARWGNALNMVMRME
                     PRVFATELTRMQWELFLDIRPRDVFRHTLGKETGGPVRKSINFFNHLSRWISTIVLAS
                     SKAKHRARVIERFIFIAHQLRRLNNYDSLYAVISGLREASVHRLSASQALIQLSPIAE
                     QDYHSHLKLMDPRSGYTQYRKALQADIDNGRGAIPLLNNILGLVSRLQGVRPNDCREE
                     DGKIQWDKFMRFGEILSMIQECQTRGPMVNGQVGQGFKKVIEETIILSDEDALWERSQ
                     SLENSGGTIGGKMLRRLANLGF"
     gene            complement(617203..619443)
                     /locus_tag="CNA02360"
                     /db_xref="GeneID:3253682"
     mRNA            complement(join(617203..619090,619141..619443))
                     /locus_tag="CNA02360"
                     /product="expressed protein"
                     /transcript_id="XM_566628.2"
                     /db_xref="GeneID:3253682"
     CDS             complement(join(617282..619090,619141..619401))
                     /locus_tag="CNA02360"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566628.1"
                     /db_xref="GeneID:3253682"
                     /translation="MSLSSQTTLISPSAKHTNPPLHRRPSQHARRKSLHAAHPHAHAH
                     AHTHAHGHAHGRRGSEGEAGRRALAAGLAMHTLDQSKKKKQGERPLPRGNRSDTHLPR
                     LTRTDSTMSIASHSSATSNVSRPSAKSRRTTESIQMIDDQGKEVDPNEDEWESGEDVK
                     QTKKGKGKQQEPSSAAMRRTVSDTTSDPKGKRTQSIAEAMARGDLVDIQDPDHRPLLT
                     QRTTGFAGTVQPPDPQVAAEMPHVDHPIITNPIKRVASSKSLVGPISAITSIDTTPDV
                     GLPTEPPRGLQSATSEPKRPSSGPSLRSISGSGLPRDPTDQRDEAQARDKLTDSPSYP
                     FPKMASPTESEQKASPKDDHPEKKIPTASRSQATSSKAARSLRHRPSNSSLRSIQSLR
                     APPHPLNSPISYTGRNAAHESPSRGSYDKRDRVPSMHQPPVPQPQVSYEVAQGQGWDQ
                     IPEEDVQRENAPVSNQSNVDAGTTHSQNLRRSSVASTRSLRSIFAGTLAPPSAASSTP
                     QPHKRLTALEAASAASKRPTTDNPVLYHHSLSHASGSAESCFLISRFLPPKKIRRPKW
                     EVDIHDQERIENGGVGLTNGDYRSAHETLVSTFRELGTGAMHQKRGLPRTASGYSLLP
                     TGLTLSSVAAATGVSNGHQDNQGLGTIKARDGARLEVARGGSGGMTPFEMSVERVLKQ
                     RPGRVTL"
     gene            619689..623370
                     /locus_tag="CNA02370"
                     /db_xref="GeneID:3253690"
     mRNA            join(619689..619915,619965..620123,620176..620391,
                     620448..620575,620628..620725,620787..620797,
                     620846..620962,621013..621165,621222..621327,
                     621396..621725,621778..621904,621961..622321,
                     622376..622545,622610..622828,622892..623370)
                     /locus_tag="CNA02370"
                     /product="saccharopine dehydrogenase (NADP+,
                     L-glutamate-forming), putative"
                     /transcript_id="XM_566629.2"
                     /db_xref="GeneID:3253690"
     CDS             join(619700..619915,619965..620123,620176..620391,
                     620448..620575,620628..620725,620787..620797,
                     620846..620962,621013..621165,621222..621327,
                     621396..621725,621778..621904,621961..622321,
                     622376..622545,622610..622828,622892..623285)
                     /locus_tag="CNA02370"
                     /codon_start=1
                     /product="saccharopine dehydrogenase (NADP+,
                     L-glutamate-forming), putative"
                     /protein_id="XP_566629.1"
                     /db_xref="GeneID:3253690"
                     /translation="MRTLPLTRSPFITRRCLTTLGLRREDPSRIWERRTPLTPHAVQS
                     LLADAKDQLKVEVESCKRRCFPDSLYSDAGAKIVPSLSKDVDVILGIKEPRLSDIRNL
                     VEASKNEGKKRTWMMFSHTHKGQEYNIPLLSAFLHPTQTLIDHELLTAPAPGKDGKPQ
                     LKRVAAFGWFAGAVGAGEALSLTGLALLRRGLATPLLSLSRPYSLGSLAAFKEALKKA
                     GEEVKTSADLKGQEPIVIGVTGAGNVSSGATEMLNELGVVWVGPEDLADLRQSGSPNK
                     IYACAITPASYLQRIEGGIFDKQEYYKSPDKYMSIFAAKIAPHLTTLINGVGWSKGFP
                     RAITRPSLNKLIEKENGKQKLVAVQDITCDKEGGLEFVDQFTTVDNPYFEGPGDILIS
                     AIDILPTELAADASSYFSSALYPYIQGLLFPSGQGDKNDITETLSRAAIVKDGVLQSQ
                     HEWLGEKIEQWKTGGAVAPDSLKQEKLRKGGKKKVLLLGSGLVAGPAVDVFAARPDVH
                     LIIASNNLAEGQSHIRGRPNVEAMALDVADDASMSEIVEEADIVVSLLPAPMHLRVAK
                     HCLDHSRHLVTASYVSPELQALHSQAIEKDVIFLGECGLDPGIDSMAAMRILERAKRE
                     GKQVKSFVSWCGGLPELSASKVPLRYKFSWSPKAVLTAAQNDASYKLEGKHVKIPGNE
                     LLARRFPEVKLWDGLPLEGLANRDSMPYAKKYGLGPAEGLTDLFRGTLRYQGFSSLLE
                     SFRLLGLLRSDPLPGSPKSWTEFLSMTVERELGLSKGLKGEDVSSAVQDLVGEGSKDV
                     IRALKLFSLFPGSDTSLLPLPNLPTPSPIDFFAHLLSRKLAYLPDERDTCLLHHSFTI
                     STPSGDTQKVTASLRHMATPTQSSMSITVGKTLAFAALRIADGEVKVRGVTGPYEPEV
                     WAGVLSSLEGAGVVIEEKWH"
     gene            complement(623351..625280)
                     /locus_tag="CNA02380"
                     /db_xref="GeneID:3253533"
     mRNA            complement(join(623351..623794,623847..624278,
                     624331..625037,625091..625280))
                     /locus_tag="CNA02380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656200.1"
                     /db_xref="GeneID:3253533"
     CDS             complement(join(623439..623794,623847..624278,
                     624331..625037,625091..625233))
                     /locus_tag="CNA02380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511861.1"
                     /db_xref="GeneID:3253533"
                     /translation="MTLPSPLSATYWSTWSPVRPSATVIESVQRDQGEEWIGSWDAVG
                     LYEANDKQPGYQTISLHITTHRLILIPSDSHSPHVPSLQTHLSYVRNTEYYSGFMRSS
                     PKLTLTLGNPQSRDNDPAVESAGTWTCRVCGYVNERKGLGKSGKCGLCGVPYAQAVAS
                     PSVSATPSRAGTPNSSGFTPPSSTADDKEGESKVACPACTFLNSALLRNCEICATPLP
                     RLPQLNTIREKPEKQQVVRLSFRKGGDKEAYKKLSSVLGDKAWEREGRSSAQTTSSNG
                     ERSGAGIDGILQSIDLSAKAQDTHMQTAFADLEALMLRAGEMVRLAQSLNQKLSSQQQ
                     AGASSPTGSPQGQTTEEEATMIRTSLVQLGLATPALTKEMVKNERAYHEGLAKELGGL
                     LTGRDGESGLMVGEGGRGVVALDEVWGLWMRARGVALLSPQALIDTLPYLPNYTSPSI
                     HSLRLPSSLMVLHTPTFSTLSILSRTLSRLEPSFPNSDPFEKSFSLLEFASTESLPIG
                     LAQEFVGLMESQAGLVRDDQAGQGDGGVRWYRDIISP"
     gene            625390..627901
                     /locus_tag="CNA02390"
                     /db_xref="GeneID:3253194"
     mRNA            join(625390..626778,626830..626971,627019..627169,
                     627221..627308,627359..627901)
                     /locus_tag="CNA02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_566631.2"
                     /db_xref="GeneID:3253194"
     CDS             join(626182..626778,626830..626971,627019..627169,
                     627221..627308,627359..627715)
                     /locus_tag="CNA02390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566631.2"
                     /db_xref="GeneID:3253194"
                     /translation="MSETGGNAPVAHQSTFDSRLAYVQSNVPFPSRQTSYPAYNNSSL
                     PAHPASSSSRLNARPDHLHQPSASSAPLLHSEAMTHPGCVLCGLVRSCGSGSNPSSPV
                     LSPQDSTTPLPSSSRTPSLATSFADSGVPGPYHHPFERTQSPAPDGRRTGNRVGGREI
                     VYHDKDITVYKAEGKERLCQGGRHIIIVVNEHLQSVYEFGASDIPLLSHILDTAAQIL
                     NSVAAAGDDLESGKGKEKLHVGFVGSIIKDPQSPHAHLHAHAYLTPIDTKLSGASLWR
                     RNVVFGSLNWWSIEDLRAEIREATSNNRVKTGYEYRQAPIDKVPDAGAAIAPAYALNP
                     TYSDVPSPVSQSKQHALQQQQPQPSSYRPQPGPSSVSKDRLSPLPTHPLEEVGSIESV
                     VSMSTVTPQTSNSGRTSREDKGKGKEQEQAISDWEEVQYGSEGSERLSDRII"
     gene            628190..630409
                     /locus_tag="CNA02400"
                     /db_xref="GeneID:3253633"
     mRNA            join(628190..628399,628502..629249,629308..629508,
                     629559..629749,629801..629970,630026..630079,
                     630133..630409)
                     /locus_tag="CNA02400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567252.2"
                     /db_xref="GeneID:3253633"
     CDS             join(628583..629249,629308..629508,629559..629749,
                     629801..629970,630026..630079,630133..630178)
                     /locus_tag="CNA02400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567252.1"
                     /db_xref="GeneID:3253633"
                     /translation="MLATNLISLVLVLPTLALAGHNSPFNGHSPSRRHHHARAASFAL
                     THASPTSNELLKRTYHDAIEHKMARKRAGKKFAKRGADGSQCRVKGQSYVPTGVSSTS
                     AISSTAASSIASSPSPASTDAIASTSASAVAPDSSASASTSTSDESAPTSSAWIDNQQ
                     NWVDATSSSEQAAATSASSSSPSSSSGTSVVSYAGLTPNGNKAGVSAGDSLPWVASKL
                     GWWYDWSATPSGDCGSAVTVPMLWGGGIADATDASRLVAFEALSQSPSYIIGFEEPDC
                     AAGSGSSGLDVATGIALWDSLIAPKGEAGTILVGPSMCKQAAESGWLGPFMEGVSRKP
                     DIMNIHVNKNSAAGIQLDIDHYWNTYGLPIWVTEFACVDDSTDFVPCTDQDEINSFIN
                     TAVDIFETDSRIAGYAYSNGYGLSENWMMVKDGQLSESGQTYLAAISKYH"
     gene            630663..632003
                     /locus_tag="CNA02405"
                     /db_xref="GeneID:36392661"
     mRNA            join(630663..630764,630843..630962,631027..631083,
                     631265..631313,631383..631504,631558..632003)
                     /locus_tag="CNA02405"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656059.1"
                     /db_xref="GeneID:36392661"
     CDS             join(630714..630764,630843..630962,631027..631083,
                     631265..631313,631383..631504,631558..631908)
                     /locus_tag="CNA02405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514131.1"
                     /db_xref="GeneID:36392661"
                     /translation="MTERQTFDSLEELSTCEISDALIKLGVQTGGYIPDLHLYSPSDG
                     HKLKVVGPAFTVQMVAENVQRENEPPKSKEHFVDACPSGSVLVISAPFIRNAGCWGGL
                     MSTAAKAKGIKGVIIKGGCRDLAEHRELGFPVYANYHTTLGQKSFVRPSLLSVPVDMS
                     PQYYSSPAIVSLYPPSFEYKITVKPGDIIVCDEDGCVAVPPALVEKVVEKGKEGRDVD
                     ENVRKDLEKGKGVKESMAKWRGEDKRGGGKL"
     gene            complement(631337..632665)
                     /locus_tag="CNA02410"
                     /db_xref="GeneID:3253528"
     mRNA            complement(join(631337..632081,632151..632273,
                     632338..632383,632449..632665))
                     /locus_tag="CNA02410"
                     /product="transcriptional elongation regulator, putative"
                     /transcript_id="XM_566632.2"
                     /db_xref="GeneID:3253528"
     CDS             complement(join(632051..632081,632151..632273,
                     632338..632383,632449..632590))
                     /locus_tag="CNA02410"
                     /codon_start=1
                     /product="transcriptional elongation regulator, putative"
                     /protein_id="XP_566632.1"
                     /db_xref="GeneID:3253528"
                     /translation="MSAGKKAQTQPPEDDYVLLESADGYTFVVSRKIACASGMLKSML
                     DEDAAFEESKNKTCRIQQRGVILAKVIEYLAYKVQWSECLAEEVNEDFSDRIDPYIAL
                     ELLTAADFLDC"
     gene            632813..635935
                     /locus_tag="CNA02420"
                     /db_xref="GeneID:3253529"
     mRNA            join(632813..632903,632945..633112,633169..633288,
                     633335..633478,633531..633825,633870..633991,
                     634043..634327,634370..634471,634531..634640,
                     634697..634838,634893..635047,635104..635407,
                     635455..635595,635653..635935)
                     /locus_tag="CNA02420"
                     /product="rsec15, putative"
                     /transcript_id="XM_566633.2"
                     /db_xref="GeneID:3253529"
     CDS             join(632844..632903,632945..633112,633169..633288,
                     633335..633478,633531..633825,633870..633991,
                     634043..634327,634370..634471,634531..634640,
                     634697..634838,634893..635047,635104..635407,
                     635455..635595,635653..635865)
                     /locus_tag="CNA02420"
                     /codon_start=1
                     /product="rsec15, putative"
                     /protein_id="XP_566633.1"
                     /db_xref="GeneID:3253529"
                     /translation="MIRRQRPTFTTSELELQLQQINLDPTSSTTENLEALAPLIKSIQ
                     DTDSEQLYLRSLDNFVEEKEREIEEICQENYEDFVSSVSTLLTIRQGTVHLRRRIGEL
                     DGQMGDVGRALGEKKRALLEQKKVARNMDDAIETLQTCLRLLDLVHRIDEMVREGKYW
                     GALRSLEDLLHLPPPSISQTPFYAHILSSLPSLRLSIKDAVTASTKTWLFDVRESSAK
                     VGKLALEQMALRTRKWRMKREREGGVRLARVGGPLELVHNERVEFDALDNDEIKVDFK
                     PLYHCIHIYEALGQKPELQRSYQEDRKTQATLILTSRLSTTPSTLVNTLPLLMQELVG
                     FFIIEAHVLDTMPDFRTQRDVDELWDEMCRRIVEVMGQGLKGCSEPGVFLSSKTEVLL
                     FVQTLEVYGYNITELNGLLITLFERYSELLLRKFGADFDQIVSDDDNQPMMVNDHEEF
                     DQVAGVCWLAKGEAESLAMQGFPQPMPFSQTYPMCCINIRNFVDQFYQFTDGVAQQHL
                     DVDEVLRRSLDGLLSDHVSKQIAKKLQTMLNLSQIAQVVINLEHFCTACNELESVLMN
                     LRASQRGGPIKLASGASFNSTLSAAQSRIDSIINSKLESFFELAEYNWMPVRPQSTVE
                     EPSTYVFEMITFLTAYVDSVLIGLKEEFKTGAYRNALMRINRWLMDTLTGQEVVRLNE
                     SALASVLADVSFIETEIKRLGKSELDHVFDEVKHTINIILSDAVQAYMEPSIRSMSYP
                     SVKPLSLAMILAKLSKAASSQGGQANMFKAARRRGEADEVARLAGK"
     gene            636040..637620
                     /locus_tag="CNA02430"
                     /db_xref="GeneID:3253638"
     mRNA            join(636040..636196,636266..636340,636426..636699,
                     636760..636865,636940..637007,637059..637620)
                     /locus_tag="CNA02430"
                     /product="expressed protein"
                     /transcript_id="XM_567150.2"
                     /db_xref="GeneID:3253638"
     CDS             join(636106..636196,636266..636340,636426..636699,
                     636760..636865,636940..637007,637059..637572)
                     /locus_tag="CNA02430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567150.1"
                     /db_xref="GeneID:3253638"
                     /translation="MITRRLASTVSVPPETKSPRKIVLVGAGFLGSYVVKALIADPRN
                     RIQIVSRHPQSLHSKLSTLGAQILPPASVDITSPSSTSELRKAFKGASAVVSLAGLLV
                     GSDKQMKALQEDGARRVGEAASEEGVGRVVGVSAIGADLRGVTAYWRTKAKGEDAIRE
                     YHPTATIIRPSLLFGPGDSFFSRFATLAKYLPFLPVFGGGITRFQPVYVGDVARAVEI
                     CCRDDPIVVSQVAGRIIEAGGPDIFTYREMMELVLRYTHLEGRRAIISLPYWLGSVQG
                     FFLEKLPETMFTVTRDQVKQLRNDNIVSPHPPMFAQNFEDLLKAFPSSAPSSAPPGDA
                     GLQSVYDILPTYLGVGKREEGKRTHGRKSASLDEVKGMGKR"
     gene            complement(637623..638191)
                     /locus_tag="CNA02440"
                     /db_xref="GeneID:3253590"
     mRNA            complement(join(637623..637848,637894..637992,
                     638028..638191))
                     /locus_tag="CNA02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_566643.2"
                     /db_xref="GeneID:3253590"
     CDS             complement(join(637770..637848,637894..637992,
                     638028..638185))
                     /locus_tag="CNA02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566643.1"
                     /db_xref="GeneID:3253590"
                     /translation="MTPPPVLDKAPAKSAQLFPYHLPLSPEWAEYSDWYSQTAMTSAA
                     AGMFIKQPIIVWGAFALAVFGYVNQQPLRQPKDATAPLLVLGMALAGVVGSILPKTML
                     APQTQSVPA"
     gene            638285..639598
                     /locus_tag="CNA02450"
                     /db_xref="GeneID:3253595"
     mRNA            join(638285..638348,638409..638638,638691..639598)
                     /locus_tag="CNA02450"
                     /product="aspartate-semialdehyde dehydrogenase, putative"
                     /transcript_id="XM_566645.2"
                     /db_xref="GeneID:3253595"
     CDS             join(638287..638348,638409..638638,638691..639496)
                     /locus_tag="CNA02450"
                     /codon_start=1
                     /product="aspartate-semialdehyde dehydrogenase, putative"
                     /protein_id="XP_566645.1"
                     /db_xref="GeneID:3253595"
                     /translation="MSPRPQIKVGVLGATGTVGQRFIELLAAHPYFALHALGASSRSA
                     GQQYARVVRWKLPSPIPDAVRHMVVHECRPDAPGFAECGVVFSGLDADVAGDIENAFR
                     AADLVVYSNAKNYRRDPLCPLIVPLVNPSHLSIIPYQREQLGLKKGYIVTNANCSTTG
                     IVVPLAALEKAFGPLDTVIVTTLQAISGAGYPGVSSLDIMDNVVPLISGEEDKIEWET
                     NKILGGVTPDNKAFDLHAPKQINVSATCTRVPVIDGHTGCVSVKFARSPPPSVAEVEN
                     AFREYTCDAQHLGVPSAPAQAIVVHDAPDRPQPRLDKNLHNGACVSVGRIRECPVFDI
                     KFVCLIDNVRLGAATSSIINAEIAVEKGLIQ"
     gene            complement(639535..646012)
                     /locus_tag="CNA02460"
                     /db_xref="GeneID:3253511"
     mRNA            complement(join(639535..639668,639719..639951,
                     640005..640077,640139..641188,641248..641359,
                     641424..641848,641899..642070,642126..643231,
                     643285..643342,643395..643522,643570..644740,
                     644799..645078,645140..645397,645588..646012))
                     /locus_tag="CNA02460"
                     /product="kinesin family member 21A, putative"
                     /transcript_id="XM_024656201.1"
                     /db_xref="GeneID:3253511"
     CDS             complement(join(639660..639668,639719..639951,
                     640005..640077,640139..641188,641248..641359,
                     641424..641848,641899..642070,642126..643231,
                     643285..643342,643395..643522,643570..644740,
                     644799..645078,645140..645332))
                     /locus_tag="CNA02460"
                     /codon_start=1
                     /product="kinesin family member 21A, putative"
                     /protein_id="XP_024511863.1"
                     /db_xref="GeneID:3253511"
                     /translation="MSLSRRQSIAPPSPLSPSSITRPNSSAGQSTFGHTRASLSSDAS
                     SIAAGAKETPNTLENRNVKVVLRIRPSDPDDPSIPPRFRSVLVHPTSKSDIRVDVDPA
                     ALTGHGPSISTGGKKYSSFSFDYVLGESAQQTDLYQCTAGESVDEFMKGHNVTFLAYG
                     QTSSGKSYSMGTTGDNIDYSGTEFTPRTGLIPRTVQSIFERAEDNKQKSGPGASWEAR
                     LSFLELYNEEIIDLLSGAGISISIREERDGRIVWSGVREVKVKSLSEVMKLLQEGSTR
                     RKTGETTMNATSSRSHAIFSITLVQKRPSNALSALSALGSETPTRQLRRPSSMIGFPA
                     SGPRSPTLPHSRSGPPSSFSRMTPSRPQSAINPSASTEEFVVITSKFNMVDLAGSERL
                     KRTAAQGDRMKEGISINSGLLALGNVISTLSDPVKSRGHIPYRDSKLTRMLQDSIGGN
                     ALTTMIACISPIEANIGETLNTIKYASRARNIRNSAKVNQVEAGWDDVEYLQNAVLKL
                     RKQVIALEAEGKESRVSEDGLKRSEKLTRRLAELQKEHTELYDRYLAKCSENMRLSSE
                     LKSRGPGDGDALTKFNETVEPVILEYEKVVSALNQQLEELRGEIALMNEMSEERSRLL
                     QDAQERQLQSETYLAELRMRMVKLADRNASSEAYIQDLEAKLKTYADKEDTHILVATE
                     LKKEIAKLRESGTTSAKNVSELEARLTTSEALRENLATQVEKYERDAAIHEKAFRELE
                     AHIAHLEAADHNKRLLEELAQKNSKITELEDQLKAKGQSHFEQKEKELSETVEDEQST
                     QKGLDSKFALSEIPSGSNTGPVAPPCERADASALAVGIDGPKTILDKEMPPSQADRES
                     SQLEQLKKELKELSAKYSESETRIADLTAKISEASLVQGVTDDMVKVSQTTTEELSQT
                     HNQDEDGVGRKGMAVSRAESNSSLDSDEEQTSMRRASLPLLSRSNISVKQGFRGGRGY
                     LVSKGNRPQSLSQELFSAQSLATSPCAMWSQPVTKSLLSSPTVQVRPSSRSSQSLETE
                     LRFVHRVIDERDKELRDREAYILQLEKQLEIAVAHDILSRKTSAKINVEADMPQTPVT
                     SGIQVYPRDVPLPPSPQAHFIPVMSVDMVHISEEDGESSETSKGRDYESSSVGVSPRS
                     VERFKEVADSTNQCKNGDAKVAQQFRIEKLIKDMAEKEASQRRIIEQQFIQIADLQKT
                     IKKLKEKLMEGDPYVVDIGSLWEERDVLIVEKAKQSCPIPSSASFPHSKESFASDAFA
                     LDRLRDEHAAELEALMAGHSQTTDMSQLEFTKRLETCQKEIEDNQITINTLRARIESV
                     EREHRLSLTKWDQASKSKDIAHHDELESLKTMHSEVVASLEAAHTQALETLQAEQDFV
                     SREMESSLSENEEQRRQLKMKADEALFELSRVRDERAVERYNDARQISELSENNARLE
                     NIKVELENANAELMATCAELTRKKTSELEQKSGRKAVVRPPQGPPPTVPLPPTPQGSF
                     AVNGAVHADDVRGSIKLTVSSEQEQGGAKRQSESSEMLNEAGAQAVYDAAVAERDGLE
                     SEMEREREKIKEIEAKLEDEKVKVNNLALDLRASQKMANNLRVHLDEARQETKRSTAA
                     CREHVAELEARREQMGKISQDQRSQRDSLQAAQAQVASLKMQLERAVDNKVGKKGLRC
                     F"
     STS             644859..645642
                     /standard_name="Xba22"
                     /db_xref="UniSTS:470886"
     gene            complement(646269..650594)
                     /locus_tag="CNA02470"
                     /db_xref="GeneID:3253671"
     mRNA            complement(join(646269..646808,646883..647663,
                     647732..647738,647803..648701,648758..649215,
                     649271..649457,649503..649577,649638..649844,
                     649899..650002,650054..650594))
                     /locus_tag="CNA02470"
                     /product="expressed protein"
                     /transcript_id="XM_024656202.1"
                     /db_xref="GeneID:3253671"
     CDS             complement(join(646566..646808,646883..647663,
                     647732..647738,647803..648701,648758..649215,
                     649271..649457,649503..649577,649638..649844,
                     649899..650002,650054..650455))
                     /locus_tag="CNA02470"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512051.1"
                     /db_xref="GeneID:3253671"
                     /translation="MTSKARSKSLSNLHSPSNLFPLGQAPLVYLPDESRLANKRLKEV
                     KPLFSLPKLQEHSSTQDRLLLGLSPEVQQRRSQDHSQVSVSSPFGILEDEPLIVRNES
                     EVHLKYNGDAVDQETLWEKVSPEHTMKLAGSSPLRTWDLDSGNNASVSKSSFLSERSP
                     HDFDSVILSLESSSLLNSPVTLPQAATFESKPLLELLLRATLGTVTTGELMWDKKLSA
                     FVLGERSERVLGLERETLSGFKTNFLTIGTSVRRLELIIDSQSNLPLTSTHHALFHAL
                     GTYLTYIKDRLACAATECHEQGPSRWNSWMLATRHVKQLAETLCGVVRWPTSSPDAHA
                     LPSRASALLTHLHGQFLAILSTSPSQHHPSAIALAYLLSQASAPFLNLLQSWLGFPGT
                     DDEDQSPGSQPWTDLGISRKLVGDAWKYEFSAGRMPGFVPKEARRILYEAGKGLRTLK
                     VATNGLHPLCNIRQAIDIRWIWGDSEKSELRNHLRHIQRQVDHWHRHQLSRSSSNRLT
                     QIPSQKEDETDYMESNERNTPRHEEYALYPRPESDIGDLWSLFNQPPGSQLSLSHPHH
                     SHSEFPLWGPTPLTYLHEFISRHSSPNHPLLPPSCPTLSIFISNQILDPLLAHATLIS
                     TSLVSLYLHDLRFLDHLDVLRAFWLAGDVGFTERVSSALFGKDSAGAGEAVGLGKRAR
                     IRARLGLGEDDDKQDRDSDWGIGLGIGLSERSRWPPGGAELAYALRTTLLNHEDNDRK
                     KSTGSVWQDVGDRVSFAVRELPEEENSGKRARWLNPQAIEALDFLYLSYSPPVAITDI
                     LPHQLMEKYQTIHNLILRLSRVDLVLRTMYWDVIHQFELFNEPHKIGVDLRPSSGLPC
                     YRLQERSTHSLFPKGSIAQRRLQILRFRMTHFVNVFGRYVLDIAIGSNWDAMKRRLER
                     LRKDCTGKAHNRQGTSEEESDEAWVESTLHDEEIDEIAPGGIRRLQSIHSIVLYHNMV
                     LDKICRACLLGPQSGQQVTFKILMVLFGLVLDLGKTVKEVERGVRGWEDGVEKVDEIE
                     KEWHEKEATFLHALERLSLRSTHPKTNTMERDGIDQDLQVLHSSAPETANGGHGNPEG
                     LAGNDLRELWLRLTFKEGGGIAVRGIRKNEDD"
     gene            650743..652049
                     /locus_tag="CNA02480"
                     /db_xref="GeneID:3253539"
     mRNA            join(650743..650932,650984..651200,651253..651349,
                     651394..651855,651915..652049)
                     /locus_tag="CNA02480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566634.1"
                     /db_xref="GeneID:3253539"
     CDS             join(650897..650932,650984..651200,651253..651349,
                     651394..651855,651915..651966)
                     /locus_tag="CNA02480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566634.1"
                     /db_xref="GeneID:3253539"
                     /translation="MSRPEEISPPEIFYGDTEAAKYTANTRIKNIQSQMTERALQLLA
                     LPEDQSAYVLDIGCGSGLSGELLDEEGHVWVGVDIAPSMLEVALEREVEGDLFLQDIG
                     QGFGFRPGTFDGAISISVIQWLLNADSSSHSPPQRLNRFFTTLHACLRNPSRAVFQFY
                     PSSDDQVTMITTAAQRAGFGGGLVVDYPNSRKARKMYLCLMVGQQEIPKALDGDEMDV
                     DEETIGKRRDEIKNERRRRREARRKTKKGNKDVKAKEWILKKKDLYRTRGKEGVPRDS
                     KYTARKRKTYF"
     gene            complement(652111..654177)
                     /locus_tag="CNA02490"
                     /db_xref="GeneID:3253544"
     mRNA            complement(join(652111..652851,652899..653021,
                     653087..653216,653274..653454,653507..653666,
                     653796..653986,654053..654177))
                     /locus_tag="CNA02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_566635.2"
                     /db_xref="GeneID:3253544"
     CDS             complement(join(652776..652851,652899..653021,
                     653087..653216,653274..653454,653507..653666,
                     653796..653986,654053..654055))
                     /locus_tag="CNA02490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566635.1"
                     /db_xref="GeneID:3253544"
                     /translation="MSQPESSVAPPRESYDERAASPLPRDYAEDKYSTRPPPARYDDE
                     LRDDSYSAKGGDTYRSDRPAFEAPRRPAQAPPPVNPNPVLGVFGLSIRTRERDLEDEF
                     MRYGDVEKVVIVYDQRTDRSRGFGFITMRTVDDAARCIEKLNGLSLHGRNIRVDYSAT
                     QKPHSSTPGQYMGAKRPVRDDRYGRGRYDDRRGGYGDRRHDDRRDYYGSSSSRHDDRD
                     GGYRESYGSRRTGDPYEGRSRRDDYSYDKYDKQDKYADYDYDRRSSRRSRYSASPARS
                     TAAPAPEVPRY"
     gene            657166..658714
                     /locus_tag="CNA02500"
                     /db_xref="GeneID:3253543"
     mRNA            join(657166..657632,657703..658226,658285..658714)
                     /locus_tag="CNA02500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566636.2"
                     /db_xref="GeneID:3253543"
     CDS             join(657212..657632,657703..658226,658285..658677)
                     /locus_tag="CNA02500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566636.1"
                     /db_xref="GeneID:3253543"
                     /translation="MPRRSAKYKATARARELYRMATILNHKQLKASLSIPYHALRTSR
                     YLNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLRVNHTEFRKLLCLIKDHPVFVSH
                     GPRKQANPLLQLTVALYRLGHCGCAASTFEIGEQFGVSEGTSAIWTTRVIKAILSLER
                     NNVYWPDENERKAIDRHFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVDFFSYKGRY
                     GFNILGICDHLKRIRYFQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVH
                     SEMISQGEYLLADSAFPAGDWCVPLFKRRRGQNDLDRPEAKFNKKCSSARVKIEHAYG
                     ILKNRWQSLRSLRVKIRNVRDEGVATCWIRACVVLHNLLIDTGDWYNRLDGDADEPDD
                     YIDIERMQERMERVLERHREEEEDEARDARDASNLTRKRVMERMQEIERRDLL"
     gene            complement(658614..660165)
                     /locus_tag="CNA02510"
                     /db_xref="GeneID:3253541"
     mRNA            complement(join(658614..659441,659502..659595,
                     659650..660165))
                     /locus_tag="CNA02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_566637.2"
                     /db_xref="GeneID:3253541"
     CDS             complement(join(658726..659441,659502..659595,
                     659650..660045))
                     /locus_tag="CNA02510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566637.1"
                     /db_xref="GeneID:3253541"
                     /translation="MISRRVTCFFLLEILHIPPLTYFYLRLRSSQQSPIMPPKRQNEN
                     ENQASEATQKKQRNSNKQWATDTNSDGVSAEEHVAVWLSTIPENGRLPNFHNWKTGHE
                     KKDFWSRKCLQYLTDNGCDSRRQFQSVALKINQIVESFTKASQIGTGTGAGAMEIDDE
                     SLLAQRKKVCPFYEILLPVLGDRASVTAHHASSTLHASLNRPDRDLAALDGLIERQRG
                     EMAADDSEDELSGEDGGLFGDGAGEASETESEADAPIIAAIRRESRSSSQPARSSSVL
                     GSVSTPIRAQTQSQRASIRSSKAKAVSADDKMDELVMRQEGNDDRRHQELLAVQERKI
                     SVQEKHHADMMNIAQENVTIARENAATEKMKMLAESWNRKMEMLMRSGKSWEEAKVMV
                     GPEPGAPSL"
     gene            660919..662014
                     /locus_tag="CNA02520"
                     /db_xref="GeneID:3253549"
     mRNA            join(660919..661174,661269..661448,661498..661564,
                     661625..662014)
                     /locus_tag="CNA02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_566638.2"
                     /db_xref="GeneID:3253549"
     CDS             join(661051..661174,661269..661448,661498..661564,
                     661625..661847)
                     /locus_tag="CNA02520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566638.1"
                     /db_xref="GeneID:3253549"
                     /translation="MFARAFILLTAVAGVLADLTVSSPATLIECQPALLSWSGGTAPY
                     YLAIIPGGEASAASLKDFGEQSGTSLTWTVDIASGNSVSLKVTDSTGTINYSSPVTIQ
                     AGSSSSCVSTSTAATGSTESTDSSSSASTADAAASSSSSDSTSASSAASAAASTTSAS
                     ASASTSASSDSGAKGFASVSLIATALFAVTAGAIALW"
     gene            complement(661950..663103)
                     /locus_tag="CNA02530"
                     /db_xref="GeneID:3253547"
     mRNA            complement(join(661950..662177,662239..662639,
                     662699..662934,663030..663103))
                     /locus_tag="CNA02530"
                     /product="Delta-12 fatty acid desaturase, putative"
                     /transcript_id="XM_024656203.1"
                     /db_xref="GeneID:3253547"
     CDS             complement(join(662168..662177,662239..662639,
                     662699..662791))
                     /locus_tag="CNA02530"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511862.1"
                     /db_xref="GeneID:3253547"
                     /translation="MLLLAFVFCSFITFTFLLPGVFGSPTPDTIFLLKESSFTSLGCS
                     KFFTPTSILHQVPSPGACFSRCSPTEVAAYTQIQYGVLCSCGDKEMLQELDVMDPCTG
                     NNWYLYSNKEVDENEVIELEVEGTRELEGFDSAFSRKGRTSEASIPTAKLGMLTFGKQ
                     DRSKILK"
     gene            complement(663206..664943)
                     /locus_tag="CNA02535"
                     /db_xref="GeneID:36392662"
     mRNA            complement(join(663206..663499,663566..663684,
                     663748..663854,663909..664027,664085..664175,
                     664236..664329,664406..664513,664578..664943))
                     /locus_tag="CNA02535"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656060.1"
                     /db_xref="GeneID:36392662"
     CDS             complement(join(663609..663684,663748..663854,
                     663909..664027,664085..664175,664236..664329,
                     664406..664513,664578..664705))
                     /locus_tag="CNA02535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514132.1"
                     /db_xref="GeneID:36392662"
                     /translation="MDHIAASSFNTSTWMPNGLPEHNGAPPPPMNNSSIINGNSEWKY
                     EMRREAQLIIPGLYLGPFQASLNSNKMKQMGITHVLCIRDQKEARLIFPRFPEEFKYM
                     TLDISDHPDQNLITIFPTCRDFVEEALSTGGTVLAHCNGGIALSPAIVVGYLMWKFNW
                     TAEHALAHVQNKRYCVSTMSFQNQFKEYEPIYMAQKMVETAAKRETTTSKRQVEEEDE
                     EGDGYRRKQRYVQGEASDMILD"
     gene            complement(665118..667419)
                     /locus_tag="CNA02540"
                     /db_xref="GeneID:3253557"
     mRNA            complement(join(665118..666336,666404..666481,
                     666534..666564,666625..666843,666894..667064,
                     667127..667419))
                     /locus_tag="CNA02540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566640.2"
                     /db_xref="GeneID:3253557"
     CDS             complement(join(665724..666336,666404..666481,
                     666534..666564,666625..666843,666894..667064,
                     667127..667196))
                     /locus_tag="CNA02540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566640.1"
                     /db_xref="GeneID:3253557"
                     /translation="MKLLPLAVVVASALPSALSWGAAGHEMVATIAQIHLFPSTRAKL
                     CSILPEEANCHLAPVAAWADIVRNRYRGTAPMHYINARNDHPQDHCEFGQHGWQNEDV
                     NVITAIQNFTRLIMDGKGGKDVDIPLRFLVHFIGDSHQPLHLAGRDKGGNGAKFLFEG
                     RERNLHSVWDSGIITKNIRELSNYTSPLPSKHIERCLPGAIFDPYVRWIVWEGIRLWW
                     RDEVDSWISCPATGDPYPHSSQNSIPPSASTIIKDHFRSAASFALSLLPGRLSELAEL
                     SFALPVIETANFEDQTLALTPKILAVKEVNMTFPSCPYHWISPIHQLNCDIVWPSKYT
                     GQPNEPLIELDTDEYLGEIGRQKILEKMMAMAGLRLAKVLNEALAEEGDSVHGVYFGY
                     S"
     gene            667702..669001
                     /locus_tag="CNA02550"
                     /db_xref="GeneID:3253563"
     mRNA            join(667702..667945,668007..668201,668249..668386,
                     668442..668555,668614..669001)
                     /locus_tag="CNA02550"
                     /product="isopentenyl-diphosphate delta-isomerase,
                     putative"
                     /transcript_id="XM_566641.2"
                     /db_xref="GeneID:3253563"
     CDS             join(667774..667945,668007..668201,668249..668386,
                     668442..668555,668614..668792)
                     /locus_tag="CNA02550"
                     /codon_start=1
                     /product="isopentenyl-diphosphate delta-isomerase,
                     putative"
                     /protein_id="XP_566641.1"
                     /db_xref="GeneID:3253563"
                     /translation="MSTTAVETVTTSPATLTTAVNDINLDSYDEEQVRLMEERCILVT
                     PEDKVYGEGSKKVCHLMSNINTGLLHRAFSVFLFRPADGRLLLQKRADEKITFPSMWT
                     NTCCSHPLSIKAELVEEHQAGVKAAAIRKLPQELGIPESQLKPEDFHFLTRIHYLAPS
                     SGVWGEHEIDYILFSTLNVDLDLNPNEVSDAKYVSKSELEAMFTDPSNSFTPWFKLIA
                     RDLLFPWWDEMLAKSRSAGWDEESGVGEVRADVLANGPKINELIRMI"
     gene            complement(668627..670044)
                     /locus_tag="CNA02555"
                     /db_xref="GeneID:36392663"
     mRNA            complement(join(668627..669048,669098..669437,
                     669493..669739,669818..669856,669924..670044))
                     /locus_tag="CNA02555"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656061.1"
                     /db_xref="GeneID:36392663"
     CDS             complement(join(668930..669048,669098..669437,
                     669493..669739,669818..669856,669924..669976))
                     /locus_tag="CNA02555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514133.1"
                     /db_xref="GeneID:36392663"
                     /translation="MQVTPEQLVNEIAKKYNELPKDRRLLVAIAGPPGSGKSTLAYPL
                     ADALNSFILGHPPTNPSHIENPVSSLLAEGNIQQGNDDEVALTIGLDGWHYRREELDD
                     FDDPQDAHWRRGASFTFNLNSYRSFLSLLRIPLYPHPPRNIPFPTFDHASKDPKPSPF
                     PILPGHRIILIEGLYTLLDQPGWRECAAMMDMGVWVDVDENVARKRVIKRNWEAGIVE
                     DVKKCEERVDAVDMKNNEQVRNYLVDPTYIIRSIEGEFISKQNFRFD"
     gene            670164..672283
                     /locus_tag="CNA02560"
                     /db_xref="GeneID:3253571"
     mRNA            join(670164..670388,670443..670587,670640..670818,
                     670872..670973,671035..671232,671291..672283)
                     /locus_tag="CNA02560"
                     /product="expressed protein"
                     /transcript_id="XM_566642.2"
                     /db_xref="GeneID:3253571"
     CDS             join(670236..670388,670443..670587,670640..670818,
                     670872..670973,671035..671232,671291..672040)
                     /locus_tag="CNA02560"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566642.1"
                     /db_xref="GeneID:3253571"
                     /translation="MYSLPTQSLSHINSPSHPSSPQPAAFPSSPSLLRDVGDEQMIWE
                     PIEPIVPDTSQMHYLALDTNILINYLNTVRTLHTLLSASVDRLRLLILIPIKVIQEID
                     GLKHSQKLPYPDSPVDIGRLARLANTWLLETNRIKREGGLSAVRCQSLKERYDRSMIG
                     GKGDDDILDCCMYFDQHGAKVVLWTNDKNLSLKAEANNIQTLGGHPSSLSALLKVSGA
                     DLPSDLWDQAAALDGDAQKSAESPETHKDNSDIHMNDADHLVESCHDFDSLSSPIFDQ
                     SNSGKPKYFADLPPIFSHGSREINQVHTPPQADTVQRRYPLLSNPGQDDDIEIDEEPL
                     SHCSAFSSRTTHSAASTSHASSIHAELSSHRRFARHPSSLMLSSLRISLLSPTLALIS
                     HPSYAPHVSSSPPPSTLPSVSILSTLLSSLTSLDSYLSSQSYPIEHPLRLSLMRGTIA
                     VKTIQKYIEYHENPQANGGTRRIKTNDMLVAVNNLRDTLKDLDVEMGMDVLDDFKGYD
                     "
     gene            complement(672092..674808)
                     /locus_tag="CNA02570"
                     /db_xref="GeneID:3253594"
     mRNA            complement(join(672092..672375,672426..672661,
                     672718..673017,673073..673375,673429..674348,
                     674397..674808))
                     /locus_tag="CNA02570"
                     /product="acetolactate synthase, putative"
                     /transcript_id="XM_566644.2"
                     /db_xref="GeneID:3253594"
     CDS             complement(join(672343..672375,672426..672661,
                     672718..673017,673073..673375,673429..674348,
                     674397..674761))
                     /locus_tag="CNA02570"
                     /codon_start=1
                     /product="acetolactate synthase, putative"
                     /protein_id="XP_566644.1"
                     /db_xref="GeneID:3253594"
                     /translation="MLTRQSRLLRRIPPPNAVLQSGLQRRHRSTDRYSNNIHTSSTQN
                     APAPVYDAPIREKGMTIEAKERVRAHARKIQSSASTAAASPAVRPQPAQHFQAAPQPM
                     PANTPRFESDGQVKNGLDYSFIGLSGGQIFQEMMLRHDVKQVFGYPGGAILPVFDAIY
                     NSPHFDFVLPRHEQGAGHMAEGYARVSGKPGVVLVTSGPGATNVITPMQDALSDGVPM
                     VVFCGQVATNLIGSDAFQEADVVGISRSCTKWNVMVKDIAELPRRINEAFKIATTGRP
                     GPVLVDLPKDVTAAILRTPIPAKSAQPGHSPYLPSNPLNPSSQPSDPLPGDADLITEA
                     AQMINKAKRPIIFAGNGVLSSPEGPKLLKELSDKGRIPVTTTLQGLGAFDERDEKSLH
                     MIGMHGSAYANFAMQEADVLIALGVRFDDRVTGKVDTFAPAAKAAAAEGRGGIIHFEI
                     QPKNINKIVEAQIPVLGDVVASLAELVPQIEAVDRSAWIGRCKATKERYPFTYTPSQE
                     GQKLKPQEVVQELDRQAEALGKEKFIISTGVGQHQMWACQYYRWTEPRSWVSSGGLGT
                     MGFGLPSAIGAKVAAPEKYVIDIDGDASFSMTAMELATASQYDIGVKVLLFNNEFQGM
                     VEQWQDLFYENRYSHTRMTNPDFVKLSESMGTKGLRCTKLEDLPRMMKEFLEYDGKRP
                     IVLECLVSSEHVYPMIPAGKALHEQLLHPLLRNGSE"
     gene            675683..677610
                     /locus_tag="CNA02580"
                     /db_xref="GeneID:3253605"
     mRNA            join(675683..675857,675923..675976,676027..676051,
                     676119..676384,676440..676510,676564..676834,
                     676893..677062,677123..677218,677275..677610)
                     /locus_tag="CNA02580"
                     /product="sorbitol dehydrogenase, putative"
                     /transcript_id="XM_566646.2"
                     /db_xref="GeneID:3253605"
     CDS             join(675744..675857,675923..675976,676027..676051,
                     676119..676384,676440..676510,676564..676834,
                     676893..677062,677123..677218,677275..677458)
                     /locus_tag="CNA02580"
                     /codon_start=1
                     /product="sorbitol dehydrogenase, putative"
                     /protein_id="XP_566646.1"
                     /db_xref="GeneID:3253605"
                     /translation="MPTSLPLESKQPPKPEVFEAKSNLGFMLHSPLKTSFEEQSVPEI
                     GPDEVLVEIKKTGICGSDVHFYNTGKMGLAALTESMCLGHESSGIVVQLGSNIVQQAA
                     RSNVMATARGEAEESNKGTVSNRPLQVGDKVALEPGVTCRMCVDCKGGKYQICEHMIF
                     AAYPPSTGGTLQRYYALPADLVYPLPDNVDLSFGAMMEPLSVATHAVANIGGMRTGWN
                     VLITGAGPVGLLAMAVAKGLGAGKVIAVDINEERLHFAKQYAATDTYIPIPPNEGESR
                     GDHAVRAAEDLLRSTGTPARGPGSIDLVVDATGAETCVLMGLNAIKPGGIYVQIGFGP
                     PNVSVPMFRIVTNEITIRGAWRYGSGDYPLAIDMVARGLVNLKPLLTHTFKFEDALEA
                     FEITKNGRDKNGKGVIKCVIDGPE"
     gene            678038..679147
                     /locus_tag="CNA02590"
                     /db_xref="GeneID:3253517"
     mRNA            join(678038..678064,678121..678123,678222..678271,
                     678319..678338,678442..678542,678632..678986,
                     679079..679147)
                     /locus_tag="CNA02590"
                     /product="expressed protein"
                     /transcript_id="XM_024656204.1"
                     /db_xref="GeneID:3253517"
     CDS             join(678060..678064,678121..678123,678222..678271,
                     678319..678338,678442..678542,678632..678845)
                     /locus_tag="CNA02590"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_024511864.1"
                     /db_xref="GeneID:3253517"
                     /translation="MASTFVNWAKSPAARQYFFSTHFWGPIANWGLPLAALADIANKD
                     EETISGVMSPTLAVYSLIFMRFAWRVQPRNYLLFACHATNAAAQLTQEARFLNYWYFG
                     GKEKKHPVGAKVDDVKEKVQEGVEKVKA"
     gene            complement(678902..680201)
                     /locus_tag="CNA02600"
                     /db_xref="GeneID:3253515"
     mRNA            complement(join(678902..679010,679057..679196,
                     679240..679714,679770..679851,679904..680026,
                     680088..680201))
                     /locus_tag="CNA02600"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_024656205.1"
                     /db_xref="GeneID:3253515"
     CDS             complement(join(678951..679010,679057..679196,
                     679240..679714,679770..679851,679904..679905))
                     /locus_tag="CNA02600"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_024511866.1"
                     /db_xref="GeneID:3253515"
                     /translation="MPSKPQKNVPRKSNTGTPVASEDGVSIAAVIDRLSYADAPRPFK
                     SASFASHLPSRTATSSSTSVRKNAKQILALERERYLGGDGFLSAQHVAMRKRGEKIEL
                     GKKKKGVAKKGNIQNLLKGKMKRDVEEMSGTQEQTPAESRMTSEGTTPTLEEDEDMDV
                     SQKERPATQAPNDHPEDSRPKQEIVTYLTPTAPPSLLPPKKYCDITGLHASYTDPRTK
                     LRYKGLDVWHVVRGLGPGGDQAYLSLRGAQTSLK"
     gene            680386..686795
                     /locus_tag="CNA02610"
                     /db_xref="GeneID:3253513"
     mRNA            join(680386..680621,680679..680711,680770..680906,
                     680957..681063,681128..681165,681219..681632,
                     681680..683321,683385..683650,683697..684094,
                     684157..684738,684791..685697,685757..685897,
                     685947..686000,686051..686145,686202..686287,
                     686340..686359,686413..686481,686546..686563,
                     686614..686795)
                     /locus_tag="CNA02610"
                     /product="conserved expressed protein"
                     /transcript_id="XM_566652.1"
                     /db_xref="GeneID:3253513"
     CDS             join(680540..680621,680679..680711,680770..680906,
                     680957..681063,681128..681165,681219..681632,
                     681680..683321,683385..683650,683697..684094,
                     684157..684738,684791..685697,685757..685897,
                     685947..686000,686051..686145,686202..686287,
                     686340..686359,686413..686481,686546..686563,
                     686614..686720)
                     /locus_tag="CNA02610"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_566652.1"
                     /db_xref="GeneID:3253513"
                     /translation="MPPLTKEELWSSGQDEDVEVNQRALIDKILARYSGEHTIFRELL
                     QNSDDAGAQHVQVKFYTKEGLEALKSDQKPSKLPDAKTALIHSYIVSNDGIPFRTEDW
                     QRLKKIAEGNPDEEKIGAFGVGFYSLFSVCDGPFVESGDKWMAFHWKDGKDKLLARSG
                     HLPKAMDNASSLSGNPWTTFSMTLREPSLLEGPLELARFFVTSITFMRTVKKIEMLVD
                     GISVLEVEKVVKRKERAERGGLHTMAAGGIMTVMNVDVTDMVITAKIMKWLEVAGFSP
                     PPLPSAISQFAKPARGLASMISSSFFGRYSSSPTPPPSSSVREPPSTAEDIMEITTFY
                     RDILIYQGNVKVNVSPAFARELERATKKAAPDRMPASIVYSRGTDDDEAKDLNGKPFK
                     KDVAGVFDGLCPKLDSDMSAKVFIGQPTGQTTGIGGHVASRFIPTVERESIDLVNKHV
                     SHWNRQLLWVAGYLCRLIYELEMQDIADEWIKTSKTDDLGLSRLTARALHVIRFFNFR
                     PTTPSTVVGQEMEASFYGCSKNNQLFPILSEQGVQPVKDVRMPQASISKFLPELPVIS
                     SAVLDQAIRLTGRLHAQRLLVDISYDDVVKQLGKRPLTQGEAVDCLKWWEDMASIEGF
                     NLSLRNRLLDAAIVLRDDGKILPLSMVQTFIRPHSGTISPDMPIPQHTIPYSITKNLR
                     ANSISRVFGWTELNLLQYISFLTNPPMSKPATDPSTDIRSSPEFSEKVLAMLSRSWPN
                     LPSNIQSAISIELKDVECIPTKMGMKKACETYFEGNLLFDDLPIIALSKGTALRGSME
                     KMLLAIGVRKTVDLQLVFSRLIGGGTWSCQDLMRYLVSVKDTLSDEEMKRLRQTAAFP
                     LFVEHPEDGKEPHPVRQKPWQLYEPTEAMKDLGLPVLDWANGKWRSNSDEAKLLFTLG
                     LNRYPPIDALLKIAAGRAPLNQKALEYLLSNHQNHYPTFKSDAYPDIAFIPAINTKGV
                     NILAKPGEVFTNPECAMLGFAVAQPYVASPENAAKLGVQKDPPLEQLVIALTNNLTTD
                     VGAARKIFEYIGTFIGHATPSSVDPLRHTAFIPVQKGAGPSSVVMFKPSQVYFVSGDS
                     EDNLYSSAFTFIDFGLKANMFLRYCGVKSEPSVKDITLLLMKDSQGMLRQAGSSERYL
                     EQLRLIAANWNRLDNQTRSAMKAAPFLLASQRIPMSKKSLSMATQPVIGGDDEYYREW
                     VLCRASEAVLVDRVAYAQYFGQYILSAPEERILEDFYLELGAKPLSSLVESKYISTPL
                     RNHSTSDKALALRQHVLERLAIFLSDRRKSAIYTVDELARENKFRVEEVQSLKVQHLY
                     RKGNKEQIHLQSLYAFASAGKGRSIILTISVTAEPDYYDVASALCEVLFKSQKADEAL
                     LLFSMLTTPLLALRKRGFNVDRILNQQREEKLRLEAEARRNKETVVPHEQGQTEVKTQ
                     NKENSARRASVSGESSGVKGLFSKLSRGSTGRGKEKEVEMPGGMPGGLPESTVQRVAK
                     QNQSSIGGASEGLMNGNKSSGVTGETRHGRSTKRPTDLLNIRATVKKAMDASRPETST
                     LIRDSRQAVNDVSESQDDYCDASVHVDLVMAFDASPQSGMPLQVWCPRDVSHPNDFLR
                     DKMEICVRFARDVLIPICQVFLLRPAVINIFWDHEGPTIAFNRGGTIFCNARYFGAWH
                     NDMCIRGQHKEPWISWYFSIAHELAHNLESAHNASHEFYFSSIAEQYLLSLAALVQER
                     TSFNR"
     gene            complement(686351..687507)
                     /locus_tag="CNA02620"
                     /db_xref="GeneID:3253918"
     mRNA            complement(join(686351..686985,687048..687340,
                     687394..687507))
                     /locus_tag="CNA02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656062.1"
                     /db_xref="GeneID:3253918"
     CDS             complement(join(686827..686985,687048..687340,
                     687394..687439))
                     /locus_tag="CNA02620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514134.1"
                     /db_xref="GeneID:3253918"
                     /translation="MEDPSAPSLVQIPSTGVEFFEYRRRLFMAGLPFPETPTTQPLPA
                     TYLVPEQPPPPLPRPPRQPKHPSVTRIEEALSQEGAEASRDLWEGGMKELAKNLHDGR
                     KFTKGMRLGLVIKILIASWINDGFWPVDPLTGLPEKPPASPLIEGVDLFPEDTLESTQ
                     QSNKS"
     gene            687655..690110
                     /locus_tag="CNA02625"
                     /db_xref="GeneID:36392664"
     mRNA            join(687655..687836,687887..688845,688904..688959,
                     689012..689108,689167..689233,689285..689309,
                     689359..689435,689480..689656,689721..689753,
                     689801..690110)
                     /locus_tag="CNA02625"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656063.1"
                     /db_xref="GeneID:36392664"
     CDS             join(687696..687836,687887..688845,688904..688959,
                     689012..689108,689167..689233,689285..689309,
                     689359..689435,689480..689656,689721..689753,
                     689801..690013)
                     /locus_tag="CNA02625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514135.1"
                     /db_xref="GeneID:36392664"
                     /translation="MATPPVAFLNSQPNTTLSANENHSSGEQPSSKTPLQRQDSLQNT
                     RNFYGVQPDLPLGGSAHLPSSIASRLRGKVIRAQSSSHLSALSQSTSPSSGPLPTASP
                     QRSSIPLPTPRGFLTPKKPAAAQRLEKSKARPLMPAGVSSGASTFDAKISGNSEVEGN
                     DALRAPSPIERHSAFDLPLSQGLRTNSSPAERDSPLHSTLMASETGLTIASHNVRPVI
                     AATSSSQGGRDRSLRHSLTTASSPPRGAPMELSSDNLVRREAGEKPSLTNLKRQSHSR
                     TTFERIRHQNNSSKPNRQRKYMSFENPLSTFILGGHVLIGGDTWYSMGLVLAVLLGIS
                     GVWLGTTGVWMWLHGTEYGLAKGGGVAATIIFVYLFGITTTSFVVTAFRDPGIIPRKL
                     DPDPPMAQVDDWWEAYPRELTVQNGRVSVKYCETCATYRPPRCSHCRLCGNCVDGIDH
                     HCSYLHTCVGKRNYFSFIVLLITTSISDIYIVILSAIHFSLLCHHDNVSFKSALSDSP
                     GAAVSFLLGIIAIIPVLFLLQYHVRLLLFNITTIEQIRANTSKSLFAMPKRPDNPFSS
                     PSLVSNVLLASLARPQFPSWIDASGWKQEDRRKINPALKDWRFGREWA"
     gene            complement(690028..691510)
                     /locus_tag="CNA02630"
                     /db_xref="GeneID:3253227"
     mRNA            complement(join(690028..690380,690431..690532,
                     690592..690711,690769..690966,691037..691510))
                     /locus_tag="CNA02630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656206.1"
                     /db_xref="GeneID:3253227"
     CDS             complement(join(690169..690380,690431..690532,
                     690592..690711,690769..690966,691037..691361))
                     /locus_tag="CNA02630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511868.1"
                     /db_xref="GeneID:3253227"
                     /translation="MSPRFGYIGLGNMGVPIVRNLAKYAAASGFPSISIWNRSSAKYA
                     LVKDAIPDAFYADDVEEVVMKSDIVLSSLIDDKAAEDVYEKMFKATEGRNVIFVDQSS
                     LKAVTSAKLAEQAKSIGATYIASPVFGRPPAAEASKLLIVLSGPANVKSEVKKHLIPA
                     IGDRFVDVGEDVKLASSLKSMGNMVLLGWIELLAEAFTLGDAVGLEPSVFNGFIQQFF
                     PAPPLTAYSNLISKGEFPSGSGFSVNGGLKDARNMMSLGADLGHPCPLPTIQRAHDNL
                     ERAKELGGPDQDWSALAAAVREQAGFSPYREGTNNGQGEKQI"
     gene            691577..693029
                     /locus_tag="CNA02640"
                     /db_xref="GeneID:3253534"
     mRNA            join(691577..691840,691922..692022,692162..692260,
                     692307..692364,692442..692552,692666..693029)
                     /locus_tag="CNA02640"
                     /product="expressed protein"
                     /transcript_id="XM_566656.2"
                     /db_xref="GeneID:3253534"
     CDS             join(691740..691840,691922..692022,692162..692260,
                     692307..692364,692442..692552,692666..692924)
                     /locus_tag="CNA02640"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566656.1"
                     /db_xref="GeneID:3253534"
                     /translation="MIPSPRSFLAGWRPETQTSPDIPPLVAAEIAQEYASLRVPNGCP
                     KGMFLVPTEETLLRWHGVLFLHHGPYSGSILRFTVDFPSNYPQSGPTVRFNSDVFHPL
                     VDARTKIWHPRGNKMQWRPKVDHISRLLHELKSSFSRVTLDLIEEREAVNKHVWSLYQ
                     HSRQTFISLTAQRAVHSASQTVLFPAVYSQSPSSTTPPRRRQTSLNSLSSDDGLGPTE
                     PLINFKEVNLDEKEQLLARLRSAY"
     gene            693424..694654
                     /locus_tag="CNA02645"
                     /db_xref="GeneID:36392665"
     mRNA            join(693424..693665,693722..693731,693800..693916,
                     693965..693992,694058..694176,694226..694654)
                     /locus_tag="CNA02645"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656064.1"
                     /db_xref="GeneID:36392665"
     CDS             join(693525..693665,693722..693731,693800..693916,
                     693965..693992,694058..694176,694226..694419)
                     /locus_tag="CNA02645"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514136.1"
                     /db_xref="GeneID:36392665"
                     /translation="MSLANPVQLLHKPGSTHPSLSDGPDGFDRSWFMGKWGVVWSTLP
                     MWKDKKDVTITYTPVAKRCEAKIVEFEDLVEYKTKSSTNGGKTNTIKGIDTLSPGSNG
                     ATFDWKGKGLLFFVHSHWEVLGYGKDVEQGLEWAVTYFSRTLFTPAGIDIYVRTIPSS
                     SKSQNLTAPEDLLQQLVNEIQNIDVNSIRTLATQGFRVPGSV"
     gene            complement(694347..695928)
                     /locus_tag="CNA02650"
                     /db_xref="GeneID:3254021"
     mRNA            complement(join(694347..694598,694653..694771,
                     694848..694945,695002..695208,695262..695277,
                     695333..695465,695521..695928))
                     /locus_tag="CNA02650"
                     /product="methionyl aminopeptidase, putative"
                     /transcript_id="XM_566657.2"
                     /db_xref="GeneID:3254021"
     CDS             complement(join(694524..694598,694653..694771,
                     694848..694945,695002..695208,695262..695277,
                     695333..695465,695521..695847))
                     /locus_tag="CNA02650"
                     /codon_start=1
                     /product="methionyl aminopeptidase, putative"
                     /protein_id="XP_566657.2"
                     /db_xref="GeneID:3254021"
                     /translation="MFRAPSQILKRAYHPGPSRFGSYPLLPSSSAITSYPEPLPVPEH
                     IRRPQYVPINFFTAPWGEHNIPEMGVDNETEGARIALGSKEEWGVRMACRVAADILKR
                     AGHRIVKPGITTAQVDKAIHEMIIEHGAYPSPLGYSNYPKSCTTSINNVIVHGIPDNR
                     PLHPQDIINIDLTIYLDGYHGDTSATFVLPEVDKLGRELVSATQEALDLGIRVCKPGV
                     QISEIGKVIGEFSKRHGFSVNSQISGHGIGKVFHQPPWIFHDVNSEPGKMMPGDCFTI
                     EPCLVQGVNSRGDIWDDGWTLATRTGARAAQFEHQVLITDDGVEILSI"
     gene            696103..697249
                     /locus_tag="CNA02660"
                     /db_xref="GeneID:3253991"
     mRNA            join(696103..696173,696223..696294,696344..696462,
                     696518..696600,696647..697249)
                     /locus_tag="CNA02660"
                     /product="expressed protein"
                     /transcript_id="XM_566659.2"
                     /db_xref="GeneID:3253991"
     CDS             join(696170..696173,696223..696294,696344..696462,
                     696518..696600,696647..697121)
                     /locus_tag="CNA02660"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566659.1"
                     /db_xref="GeneID:3253991"
                     /translation="MGIFTHSAEDDVLVSASFPETNAFGNVVNGEDNNILIHLINSGS
                     KNYTLVSASASYHDPANHWALVKNATTLKYGVPLVSGANFSAPYHVYSEFRPQELGLT
                     VTVNLAETGTKDLHYITAMNRTVSIVEAPGSWLDFQLIFLYLILGTALTLGGWWAYDS
                     YFAPKSKVKGKKKSGPGPKKVQAVVPGKESVYPEVKPYEEEWIPEQLLKSKQNKLKKR
                     NVDGASSAGEITSGGETSGAEGKGKKRKGKKA"
     gene            697940..699225
                     /locus_tag="CNA02670"
                     /db_xref="GeneID:3253989"
     mRNA            join(697940..698207,698264..698441,698500..698780,
                     698836..698913,698968..699008,699065..699225)
                     /locus_tag="CNA02670"
                     /product="aerobic respiration-related protein, putative"
                     /transcript_id="XM_566661.2"
                     /db_xref="GeneID:3253989"
     CDS             join(698030..698207,698264..698441,698500..698780,
                     698836..698913,698968..699008,699065..699112)
                     /locus_tag="CNA02670"
                     /codon_start=1
                     /product="aerobic respiration-related protein, putative"
                     /protein_id="XP_566661.1"
                     /db_xref="GeneID:3253989"
                     /translation="MSLPLRAARPLLRASTLTAARRISVASAIRPLSRADCGECGCVS
                     SRAFSTTPLRRGSGETDGTLISALAAEHKYELESAAAQPEVPAFIESFKAQGVWNIED
                     TAGSDDIVLTRKFGNETIKLTFQVSDLDATAFDPEYPAAEEDSEGPASGPASITCSLV
                     ITKSAAPGALMVDLETCDEGFEITNVAVYDKALADAKGAEGDWERRSRYMGPQFDHLD
                     ETVQEAFGSYLAERGVDESLADFVLSYCEHKEQKDYVSWIDQVRGFVEQ"
     gene            699381..701219
                     /locus_tag="CNA02680"
                     /db_xref="GeneID:3253999"
     mRNA            join(699381..699884,699933..700074,700121..701041,
                     701112..701219)
                     /locus_tag="CNA02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_566663.1"
                     /db_xref="GeneID:3253999"
     CDS             join(699396..699884,699933..700074,700121..700893)
                     /locus_tag="CNA02680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566663.1"
                     /db_xref="GeneID:3253999"
                     /translation="MSAAADNPHPHIDPSLVALAAQVQAHANAQAQRHVSISIPHRHI
                     PPAATDNHLGLGLPSEALGSALQIDPSLFEIEQVVNDVRRGKIRLGEDRRDEQEPERS
                     VQHPNDTAHHSQHQQQDDHPGEHGGMEGHGGLGDASDGLQMDDEIDPTLREIVNSLTN
                     AQQSSHLNAPGLSHAQAAAAIGAHLTDAEERERLQQSLQASLEDLTHASFGSLFPPNY
                     SNSPSQGFLTLNDHHNIHDTEVDLSNPSLDVNAEVGSSSTSLDASPMADPESSNSVKR
                     GRGRPKGSKNKPKPGPPPPKPPKPPKPPARPKGRPPKQRTPAEQAEYELRKHEKELGI
                     KRQKGRPRKFPGYLVREMRLKKNREEFNELMREYEEKRREEELANLEMAGVDTQIHLG
                     EGPSLASHDHHVHDPHLHGEHHGHHEQHDFSDWSVQDDQTLLDVVGVGHHEMSVGIGE
                     EEQDHHEGMDEVFGIRS"
     gene            complement(701076..702328)
                     /locus_tag="CNA02690"
                     /db_xref="GeneID:3254000"
     mRNA            complement(join(701076..701306,701354..701428,
                     701485..701540,701609..701668,701726..701773,
                     701833..701842,701900..701917,701992..702010,
                     702068..702144,702195..702216,702266..702328))
                     /locus_tag="CNA02690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566665.2"
                     /db_xref="GeneID:3254000"
     CDS             complement(join(701235..701306,701354..701428,
                     701485..701540,701609..701668,701726..701773,
                     701833..701842,701900..701917,701992..702010,
                     702068..702144,702195..702216,702266..702303))
                     /locus_tag="CNA02690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566665.1"
                     /db_xref="GeneID:3254000"
                     /translation="MSELCPPWAPFFGFAGVTSAIVFSTVGAAYGTSKAGIGIAGLGT
                     FRPDLIMKSLIPVVMSGIIAVYGLVVSVLIAGNISPSEPYSLFAGFVHLAAGLACGFT
                     GLAAGYAIGIVGDACVRAYLYESKVFVSMVLILIFAEVIGLYGLIVALILNTAVGEAV
                     CGAN"
     gene            702598..704868
                     /locus_tag="CNA02700"
                     /db_xref="GeneID:3253997"
     mRNA            join(702598..702674,702724..702748,702846..702992,
                     703052..703172,703222..703315,703368..703420,
                     703470..704265,704318..704868)
                     /locus_tag="CNA02700"
                     /product="t-complex protein 1, eta subunit (tcp-1-eta),
                     putative"
                     /transcript_id="XM_566667.2"
                     /db_xref="GeneID:3253997"
     CDS             join(702651..702674,702724..702748,702846..702992,
                     703052..703172,703222..703315,703368..703420,
                     703470..704265,704318..704740)
                     /locus_tag="CNA02700"
                     /codon_start=1
                     /product="t-complex protein 1, eta subunit (tcp-1-eta),
                     putative"
                     /protein_id="XP_566667.1"
                     /db_xref="GeneID:3253997"
                     /translation="MQGRLPQMQPTVVLLREGTDTSQGTPQLLSNISACLAVAQTIAT
                     TLGPRGMDKLIVDDRGLATISNDGATILKLLDVVHPAARTLVDIARAQDAEVGDGTTS
                     VTLLAAEILKEVRPFIEEGVSPHVIIKGLREAKTLAIQKINEIAVTIDKSDPAEFRDL
                     LMQCAATSMSSKLIHSQTPFFSNMVVDAVLSLDQNDLDESLIGIKKVPGGGMQDSKLI
                     KGVAFKKTFSYAGFEQQPKSFKDPKVLCLNVELELKAEKDNAEVRVNEVSEYQAIVDA
                     EWSIIFRKLEAIVATGAKVVLSKLPIGDLATQYFADRDIFCAGRVADGDLKRVVQAVG
                     GSIQSTCSDIEPHHLGQCGSFEEKQIGGERFNLFEGCPQAKTCTLILRGGAEQFIAEV
                     ERSLHDSIMIVKRAIKNNSVVAGGGACEMETSKYLRAHSRTIMGKAQLIVGAVAKALE
                     IIPRQICDNAGLDATDILNKLRMRHAQGETWAGIDVDGEGVQDNMKSFVWEPALVKTN
                     ALSSAIDAACLILSVDETVRNPQSEQPQAGPPMPRGAAQQAMRGRGRGMPRR"
     gene            complement(704861..706669)
                     /locus_tag="CNA02710"
                     /db_xref="GeneID:3254015"
     mRNA            complement(join(704861..705646,705699..706004,
                     706116..706240,706300..706669))
                     /locus_tag="CNA02710"
                     /product="expressed protein"
                     /transcript_id="XM_566669.2"
                     /db_xref="GeneID:3254015"
     CDS             complement(join(705042..705646,705699..706004,
                     706116..706240,706300..706616))
                     /locus_tag="CNA02710"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566669.1"
                     /db_xref="GeneID:3254015"
                     /translation="MSSPAPTYARIRSLSHWATFFNQPDGLFRLPSTQGAAIQHLEID
                     LRFVADHQVETVDPNLQADTPIHLPNVCILTFRGGEYVQEDDLRMDALAEVLLAINPV
                     EVRWLNATEDPSEQLSFATHLVHPAVIAAGEKWSAAGTLRKLVIQGGFPCPNLTAPTP
                     FALTPAATPCPSPGPARTTFGLQDASSKHHPAPFVSGLSALSTIKPKTVDEDRLKGRE
                     ERKRQAEYTLKPRFEYAFGKWSVQELKWRLDGRYTAACVISIITHFIKAISSSFPSAT
                     RHFLVDLPAAVSFTSIPAAVIPDLQSLPEKLELDIRVRDWLSDVGFGSLGDARHARLW
                     DLPAPDDENDHRNGLRTKAEMILLRDGATIVTLEELTQIVKDSSNEKGRGDRSAMSPA
                     DSIASLLSGVTESPTEDENEAVTPHSTGSPFANPTDKTDKKMAGDNDSVRPIETSVVL
                     "
     gene            706769..709293
                     /locus_tag="CNA02720"
                     /db_xref="GeneID:3253996"
     mRNA            join(706769..707373,707454..707602,707655..707704,
                     707770..707785,707841..707936,708001..708305,
                     708363..708524,708588..708707,708767..708963,
                     709018..709293)
                     /locus_tag="CNA02720"
                     /product="expressed protein"
                     /transcript_id="XM_024656207.1"
                     /db_xref="GeneID:3253996"
     CDS             join(707056..707373,707454..707602,707655..707704,
                     707770..707785,707841..707936,708001..708305,
                     708363..708524,708588..708707,708767..708963,
                     709018..709245)
                     /locus_tag="CNA02720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511872.1"
                     /db_xref="GeneID:3253996"
                     /translation="MASVDPAEPSTLEIGSRQPSPPIMKESCDKVASLTSETSTKDKN
                     TLQLQDTRSGHILSDLSTFRKTVLLLTFALANFIDVCNVSGVAIAAAQISWDIGLETS
                     QVVWIITSYSLCFSAFLLFSGRLSDLFPAGLIFESGLFVLGVLSLATSFVTSNKYAFL
                     ILRGLGGIAGSMAVPSSYHLTVHMYPESTEQAAKLALLGLAGGLGNVFGLVLAGLCMK
                     ASYHWFFRVIAILCILSTAVTIIILPHTGSFSVSDGGMQRWKRMDVPGVVLIMGSLIC
                     FMLSLTQGPIDGWRSASFIAPFVLSLPLGIGFFVWEANIPARTAILPSTVWNITNSVI
                     ASLVVLVPMGFWGTSQLLFATYWQTTFNWAPLHVAAAMLPQGLTTLAVGILSQFIPAI
                     ITKPRYGIPIGAILVVAAEVLQIKSNGGGHGKDYWRFLFPAFVIGSAGSMILTFASSV
                     NFVQMCPPEMAGVAGAWTSVLFEIGGAITLAVQAGMEKPDPFTFMDIGAKVYYFIIGW
                     TVVLSGIYVAFYKQPKALAVEHEETRTRIMQTKGDMRV"
     gene            complement(709265..715152)
                     /locus_tag="CNA02730"
                     /db_xref="GeneID:3254006"
     mRNA            complement(join(709265..709656,709711..710080,
                     710142..710257,710317..710391,710441..710594,
                     710647..711153,711204..711347,711403..711422,
                     711482..711555,711607..711744,711804..711910,
                     711965..712018,712081..712259,712326..712800,
                     712866..712906,712963..713007,713059..714351,
                     714444..714619,714711..715152))
                     /locus_tag="CNA02730"
                     /product="expressed protein"
                     /transcript_id="XM_024656208.1"
                     /db_xref="GeneID:3254006"
     CDS             complement(join(709582..709656,709711..710080,
                     710142..710257,710317..710391,710441..710594,
                     710647..711153,711204..711347,711403..711422,
                     711482..711555,711607..711744,711804..711910,
                     711965..712018,712081..712259,712326..712800,
                     712866..712906,712963..713007,713059..714141))
                     /locus_tag="CNA02730"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511874.1"
                     /db_xref="GeneID:3254006"
                     /translation="MNDQSYPTGSNLENHRRGFSSSSLDGRPTEEGVDGRNDRARGGN
                     EHPPALDPHSLPAQYKYHLHHYQGGPSPVATFFPQPVLQPSYNIHPMHLSGQPASYDS
                     SNASFPGNPQSIPYLQGRPNQSRNVLSESTPDATQFIQPVDGRSENMPSLHEASENFT
                     ISQEMIPRHAQASQSPGGPIGTRASIKNSGNESMSLNKAYGHVPHTRLPSSDRNAAGI
                     TFRGPSIAYPQNVPNLSDSGLITGSRATDENQPGSQPGKLDGASSAARGDNMAPVKQQ
                     SEEPLLSWDEMSQAASRPTSSSQKDLQGKGSPDFQSKLNPHMDGGDELIESIEKNKNP
                     DENIDHRKRKRNRTIRSCVPCHNHKRKCDRKRPCGRCIALGLTGSCVYEIDEQRNMND
                     PEVAESERLRRRVAELEQVVRELRQKAPSRHANVSSASATTSLHPAPTTSTASGANAA
                     SPISDNGGIKRRVIVDRFARFKMDEAQAAENVAGMGYIASEVSSQNGAQHVQNEEGLD
                     EDYRGEPYSTHSLPDEEMVYDSGGRPVFLGSSAGKSMLRQLRELAASNEDEKLFSVPE
                     DVAFTGVFPNLRKTFPFTTIWSHENFCVEIIGLLPDQEQSETLWNAWTNGYQAYFSPF
                     HLPTVRSEYAKFFAKSTEDKLNTPLSSLAVFLMVCALGSLLRATAAEILGHPDPEVAM
                     NARSKGEVPRDLKDLTSSRLQSELYLSAAYHALRLCSFMANPTVPVLQCQLLIQVYLL
                     ASERAADAWAIGGNMIKQAIALGLHKDPLSLDPNISMRDAEVRRRLWWSIAGFDTMLA
                     IFFGRPSSITYYTTNFPQDRSDDNLSDAPGSARQLLPPSNVLASETTDQTYHTAYYQL
                     TIPSFELLEGIFHVDRQFSRSALYGWFSPPPHSSMDGGGPKRHTYRHAIRLAEDIRQW
                     YGHLPKGMRVDKEDTAESLSESRPKKQVVQTLGLCIKTWTLIMVIHRPYLRLDPAAYL
                     ESTEFCSQSAHMVLKAFRAMADTPLSWMFWTMSYRAFQAGAVCAFLALRQPGTALAAK
                     CVDDLRGAIALFEDRLSTWCSTHPVQNDLRQGLIQLEKLVTTQRSDIPRHAPAPSYGT
                     NNSPTFGNSQTFSRPASESNYQLASQAHDAPTLNNPIQATNSPLPLGVDGAGMFHGPG
                     GIPYHSESLGMSKNGEAPLYSQHPEQAGSLSTSLSGDFNGPSPLALSRFWASMFGIRM
                     DDTKETSSPDMAWS"
     gene            complement(715715..718062)
                     /locus_tag="CNA02740"
                     /db_xref="GeneID:3253566"
     mRNA            complement(join(715715..716164,716237..716855,
                     716906..717531,717590..717607,717669..717704,
                     717762..717810,717867..718062))
                     /locus_tag="CNA02740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567152.2"
                     /db_xref="GeneID:3253566"
     CDS             complement(join(715929..716164,716237..716855,
                     716906..717531,717590..717607,717669..717704,
                     717762..717810,717867..717908))
                     /locus_tag="CNA02740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567152.1"
                     /db_xref="GeneID:3253566"
                     /translation="MAGQFTPEQSAQLQSEVQVELERREWAEPNDNVMAEYITVLLAN
                     GSSRERVQSEMDDLVGSDFDPAFLDWLFAKSESIVSAGSATQPATTPLEAAETATSAA
                     TPRGNSRLLSSALAPLTSQPEKRKLPDITHDGQNKRPAPEVPVGPRLGAVTPRSPNMP
                     AVSVRGRGMGIRGTSSGGRGTMVNQSPVNGSFIHQQPSQQTQPGFRPRQQMQPGRFNQ
                     QIGNPGMLGMPNQQEMMAQMMMMQANMAQMGQMMSMMVGERQHTPQRQQPSISQSGYQ
                     ASPPVPVKLPPGTKLGSHSISSITPKSSTGPIPDKPTSVALCKFGVGCSNARCPYSHP
                     SPVADEKTGMVLSEEACEKGKDCKDPECIKSHVSPSAVLGDSVGPSRLLCKYQNCNNP
                     SCPFRHEDADGNPVPPPALTKSNKPTVVKAPASSSDDGSVEVINSHRDLLDGQLADGP
                     KMIQCRFGDRCTRADCKFLHPASRSLAKAKKPLQSSHARPSNAAISIAGGLSKSKKFG
                     ADGKQGGLNPDAMEFKPTGHDEEKNGADLNVTL"
     gene            718387..720038
                     /locus_tag="CNA02750"
                     /db_xref="GeneID:3254002"
     mRNA            join(718387..718505,718568..718641,718696..719122,
                     719184..719489,719538..719678,719734..720038)
                     /locus_tag="CNA02750"
                     /product="alpha tubulin, putative"
                     /transcript_id="XM_566675.2"
                     /db_xref="GeneID:3254002"
     CDS             join(718468..718505,718568..718641,718696..719122,
                     719184..719489,719538..719678,719734..719764)
                     /locus_tag="CNA02750"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_566675.1"
                     /db_xref="GeneID:3254002"
                     /translation="MADAKKKQLVYNIIDFLRTSSQDGTIKEDDKESLDVAVQCIAEA
                     FGVDPDSAEDDKAYSIKPASLVSILDVFLKTKAKSFASTSPQSEASLPQSSSDISQTD
                     KIKAESLKTKGNQLMGQKLYDSAIEQYTEAIKLDPNPVYYSNRAAAWGGAGQHEKAVE
                     DAEKALELDPKFTKAYSRLGHAHFSLGNYSDAVRAYENGLELDPDNANMKTALSTAKS
                     KLSELSSRPTAADREPPQNGINGSSGGMPDLASLAGALGGGGGSGSGGMPDLASMMNN
                     PQMMSMAQQMMANGGLERLMQNPALRNMAENMRNGGGMPDFSSLASDPSMRDLAQQFM
                     GGRQ"
     gene            720178..721395
                     /locus_tag="CNA02760"
                     /db_xref="GeneID:3253616"
     mRNA            join(720178..720306,720356..720495,720562..720735,
                     720796..720851,720912..721002,721056..721395)
                     /locus_tag="CNA02760"
                     /product="oligoribonuclease, putative"
                     /transcript_id="XM_024656209.1"
                     /db_xref="GeneID:3253616"
     CDS             join(720262..720306,720356..720495,720562..720735,
                     720796..720851,720912..721002,721056..721194)
                     /locus_tag="CNA02760"
                     /codon_start=1
                     /product="oligoribonuclease, putative"
                     /protein_id="XP_024511876.1"
                     /db_xref="GeneID:3253616"
                     /translation="MASEPLLYDDGPLVWVDCEMTGLDFLNDRIIEIAVIITDGRLNP
                     VDGGISYIIKTPKEVLDNMGDWCREQHGKSGLIQACLDSPYSYDTVVEKVLDYIRRWI
                     PERGAGLLAGSSVHADMRFMLMGMPEVMKHLSYRILDVSSVKEICRRWYPKVRAQEQE
                     SRTTECSHRALDDIRASIHELKFYRDNIFLPLEPVTDGRTSTSQQENIGHKTAL"
     gene            complement(721226..722363)
                     /locus_tag="CNA02770"
                     /db_xref="GeneID:3253689"
     mRNA            complement(join(721226..721408,721479..721605,
                     721670..721675,721735..721765,721834..722023,
                     722077..722363))
                     /locus_tag="CNA02770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656210.1"
                     /db_xref="GeneID:3253689"
     CDS             complement(join(721266..721408,721479..721605,
                     721670..721675,721735..721765,721834..722023,
                     722077..722248))
                     /locus_tag="CNA02770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512052.1"
                     /db_xref="GeneID:3253689"
                     /translation="MSAYGTIATSQPTSSLPVLSFPLPSAGLALVTYPVTGADAPEEL
                     LRYFYTIFSNELESGCTYPQEGPITYEEFLSYFFAATTIIGIIQPVGTNGKVDIPGDL
                     ETAKAERSWEECIGGCYYIKPNYPGRSSHNCNAGFLVPTNHRGKKLGIALGKSYLEYA
                     PRLGYRGSVFNLVYKNNIPSLSIWDQLGFQRVGVIPKAGRLKTGPNGSEEYVDAVIIY
                     KSFV"
     gene            722640..724649
                     /locus_tag="CNA02780"
                     /db_xref="GeneID:3253586"
     mRNA            join(722640..723499,723556..723867,723925..723992,
                     724043..724077,724150..724649)
                     /locus_tag="CNA02780"
                     /product="aminopeptidase, putative"
                     /transcript_id="XM_566679.2"
                     /db_xref="GeneID:3253586"
     CDS             join(722659..723499,723556..723867,723925..723992,
                     724043..724077,724150..724444)
                     /locus_tag="CNA02780"
                     /codon_start=1
                     /product="aminopeptidase, putative"
                     /protein_id="XP_566679.1"
                     /db_xref="GeneID:3253586"
                     /translation="MASLLLPLFFHLLSSLAETAAAGATPSSSPALFVSSDPPAHDTA
                     GCLKTSYYGTYGGAPKEQDHIYLPTAECLLTVSALDAVTSGSIVSVNDLMLGDGDRLV
                     WVGRSGVSHKDSQVVPLIEESWNLISSHSRDIVSESNSRGVGYGTQHVLQKANELHHI
                     RPITLVHQTEHSLLVNVPSSFLPIFDTLLPPHLVPVALPIAPLPISVSGWQSVPKKFA
                     KHLANITEHLSFSPELDRIVSEGIRLNQIRRDVRWLTGEAPSGIESRHSFTSGAVKAA
                     QWISSQVESTGADCSLQYFLSGFAPNVICHYPSTLNSTERVIFSAHYDSRGSFGSTRA
                     PGGDDDGSGTGHLLSLARAISNQGIVFEKAVTLAFFAGEEQGLLGSHAYAEYLNSQNA
                     TVLLQVQADMLGYHAPGEPLQLGLPETIHLPEASYLIGNLSQLYSPELVVGKTAACCS
                     DHQSFVTYGFPATQVFERNGPIVDPMYHNSGDVSQREGYDFEQIVSIAKVTLSALLTV
                     AGYKRVPV"
     gene            724795..726912
                     /locus_tag="CNA02790"
                     /db_xref="GeneID:3253601"
     mRNA            join(724795..724901,724966..725208,725266..725346,
                     725407..726079,726136..726315,726365..726440,
                     726503..726575,726628..726912)
                     /locus_tag="CNA02790"
                     /product="expressed protein"
                     /transcript_id="XM_024656211.1"
                     /db_xref="GeneID:3253601"
     CDS             join(725179..725208,725266..725346,725407..726079,
                     726136..726315,726365..726440,726503..726575,
                     726628..726696)
                     /locus_tag="CNA02790"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511877.1"
                     /db_xref="GeneID:3253601"
                     /translation="MSTILQDWIDLLNAEQHVQVDKLKEHARHGIAAPIRGEVWLYLL
                     GVLSEDKTSEITSLISLDLSYKALSNSIPSHLASLLLKTALVHHTKRFRNETYADLIT
                     SITAEQPIVRETSWTATRPSISGVPKSPGDITTSSLTSPQNSSERQISASQGPATLPP
                     DPTSEEVESFNTIRSQLSRILPKPPSTPPTRHGFLSMLEEVLGKFWNAENLEGRDDEW
                     RKDDAGGFEGSEKDWVYLCTPFVCCLSRPVGVFLGFKSLMERMRAFPPLPVRLASFLT
                     LFRQALPELHSYCEDEQVPYVQVALSWMTTLLAKEMWLGDVLRLWDTYLAAHDMFALH
                     CYVCVAIFSTCKETLEELDGSEAKLMLLDLPPMDVDRLLQDAANLRVTFPLARHADEE
                     E"
     STS             725394..726219
                     /locus_tag="CNA02790"
                     /standard_name="Xba9"
                     /db_xref="UniSTS:470887"
     gene            727023..729248
                     /locus_tag="CNA02800"
                     /db_xref="GeneID:3253585"
     mRNA            join(727023..727099,727300..727459,727520..727640,
                     727698..728431,728483..728626,728678..729248)
                     /locus_tag="CNA02800"
                     /product="zinc-finger protein zpr1, putative"
                     /transcript_id="XM_024656212.1"
                     /db_xref="GeneID:3253585"
     CDS             join(727319..727459,727520..727640,727698..728431,
                     728483..728626,728678..729106)
                     /locus_tag="CNA02800"
                     /codon_start=1
                     /product="zinc-finger protein zpr1, putative"
                     /protein_id="XP_024511879.1"
                     /db_xref="GeneID:3253585"
                     /translation="MSSDKTNLFPTLGEVADRTGKAESLEQEGDDRQMQEIESLCMRC
                     HENGTTRLLLTSIPYFKEIVVSSFRCDHCGHRDTEIQSAGEIQPKGVSYTVHLLTRAD
                     LDRQIVKSNWATITIPDIQLTIPPGRGQINTVEGIIRDTVRDLNISQPVRRVMDPETG
                     KKIDELLEKLRAAIDMEEDDEDDGGVGMDDDVKPVHHEPSNSSSKEEKPFVPFSMIVD
                     DPSGNSYFQFKGSQSDPQWNMRAYSRTFDQNVILGLVARPEDMSEEQPEGVPIVAADH
                     KLSSAEEFESKRNKNVINRDDGTVVPDEIYSFPATCSSCGHQLETLMQQVNIPYFQDI
                     IIMSSNCYACGYRDNEVKSGGSIAPKGKRITLKVEDEEDLSRDMLKSDTAGLSIPEID
                     LVLQPGTLGGRFTTLEGLLNEIYTELSTKVFRAGDSTTAGIGQTDSSAGEDEANFGDF
                     LKGLKECMSAQRQFTLILDDPVSNSYLQNLYAPDPDPNMQIEVYERTFEQNEELGLND
                     MVVEGYNKEAEGTA"
     gene            complement(729516..731326)
                     /locus_tag="CNA02810"
                     /db_xref="GeneID:3253597"
     mRNA            complement(join(729516..729874,729936..730054,
                     730112..730193,730250..730332,730386..730499,
                     730550..730566,730639..730649,730710..730753,
                     731024..731069,731122..731326))
                     /locus_tag="CNA02810"
                     /product="RAS small monomeric GTPase, putative"
                     /transcript_id="XM_566685.2"
                     /db_xref="GeneID:3253597"
     CDS             complement(join(729749..729874,729936..730054,
                     730112..730193,730250..730332,730386..730499,
                     730550..730566,730639..730649,730710..730753,
                     731024..731069,731122..731130))
                     /locus_tag="CNA02810"
                     /codon_start=1
                     /product="RAS small monomeric GTPase, putative"
                     /protein_id="XP_566685.1"
                     /db_xref="GeneID:3253597"
                     /translation="MSKAQFLREYKLVVVGGGGVGKSALTIQFIQSHFVDEYDPTIED
                     SYRKQCIIDEEVALLDVLDTAGQEEYGAMREQYMRTGEGFLLVYSITSRSSFEEVSTF
                     HQQILRVKDKDYFPVVVVANKCDLEYERQVQPHEGRDLAKRFNAQCIETSAKQRVNVD
                     EAFIAVVRAIRRYQKESGPPQAVNAPAKSQMSAVGGRAAEKDDHVDKGCCRGCVVL"
     gene            731534..735157
                     /locus_tag="CNA02820"
                     /db_xref="GeneID:3253523"
     mRNA            join(731534..731984,732035..732257,732308..732908,
                     732962..732987,733049..733557,733609..734958,
                     735008..735157)
                     /locus_tag="CNA02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656213.1"
                     /db_xref="GeneID:3253523"
     CDS             join(731538..731984,732035..732257,732308..732908,
                     732962..732987,733049..733557,733609..733671)
                     /locus_tag="CNA02820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511881.1"
                     /db_xref="GeneID:3253523"
                     /translation="MSLYGGIKFSATNPEDEPEQRETPRPPDADAGSLPPAQSKQRQP
                     PAFSSALKFAPRINKKPLKPPVPTAHVSALPLNPSSADIVRSAEPVLHSRSPAAQDEG
                     DAQLVFGPDGLPLAKAPAMTIGTNKGGYKDRLGNDFSGEKKKKKKKKRKNPQPFFPTF
                     DPEEIYDPNRPNDLGEYQQYRKRAKEERRRKLMEAKRRRAEGLSSDESSYYTDSEEDI
                     APRRDAPKMFAPPKMYSPSASKSTVSEEPETAVNRLPESQPAFGRDQDDRRMDVSRLS
                     PSGDDAYARRVAMTQQAPLHLHHPSQSGDDAYARRAAISQNPPPTTSFIPSSTASSSA
                     APDAYPSSHLTQPPTTTPPPLPVIPNAQAELPQVQAAASASQDFQAMLEERKKAAEAI
                     AAKFKALAGAAQPPSSPAPASASSSAAQLQDVGGGTFAEKMMRKWGHVEGTGLGARGE
                     GIVHALTTEHVAPVANLSQPLSKRALAKQKAAAANAKSRKWVQAPSARGRIVNDNKDE
                     RAKEEKERKGEEGRVICLRGLVGSVEEIDEELVNEIGEECSNYGIVERVVLHLVEPPP
                     PEPEECLRVFVVFSGMAGAWRAIKELDGRFFGGRNIKATYFDETRFDKGDRDGPVL"
     gene            complement(735349..738534)
                     /locus_tag="CNA02830"
                     /db_xref="GeneID:3253263"
     mRNA            complement(join(735349..735701,735759..736714,
                     736768..737197,737253..737446,737502..737868,
                     737923..738360,738412..738534))
                     /locus_tag="CNA02830"
                     /product="heat shock protein, putative"
                     /transcript_id="XM_566689.2"
                     /db_xref="GeneID:3253263"
     CDS             complement(join(735469..735701,735759..736714,
                     736768..737197,737253..737446,737502..737868,
                     737923..738360,738412..738490))
                     /locus_tag="CNA02830"
                     /codon_start=1
                     /product="heat shock protein, putative"
                     /protein_id="XP_566689.1"
                     /db_xref="GeneID:3253263"
                     /translation="MDNFTDKSSEVLKAALDKAAEMANAQVHPLHLISVLWEEPNQPS
                     SGPDQPTLLKAALEHVGGNPTLFNRALMHKINRLPVVDPPPSPPLPLANSFNAVIREA
                     QKLQKDQNDQFVAVDHLLLALLRTDASDMKELLRGTGAEPRALEAEIKRKRGGRKVDS
                     KGAEGQFDALNKYCVDLTALAEQGKLDPVIGRDNEIRRVIRILSRRTKGNPVLIGEPG
                     VGKTAIAEGLAQRIVDRDVPASLISRLLALDMGALMAGAKYKGEYEERVKAVLSEVEK
                     SGDEGTQIILFIDEIHLIMAGKDSSGGMDAANLLKPMLARGKLKVIGATTLNEYREYI
                     EKDSAFERRFAQVIVDEPSVPDTVAIMRGIREKYETHHGVRIMDSALVLAAQLAKQYL
                     TARRLPDSAIDLLDEAASAVKVARETRPEAIDELERKKLGLEVEIHALEREKDEASKE
                     RLEVAKKAIADLEDKLGPLKREYENDKHLGDQIHELRRKIDELRTKADEAERRYDLAT
                     AADIRYHSIPQREQKLQELEQKEAEKGSGQQVAPEMIAEVVARWTGVPVSRLVETEKA
                     KLLRLEKLISKKVIGQPEAVKSVANAIRLNRSGLGNQNRPIASFLLVGPSGTGKTLLA
                     KTLAGVMFNSEDAMVRIDASEYSEKHAISRLIGAGPGYVGHEAGGQLTEAVRRKPYSL
                     ILIDEIEKAAREFHQLFLQVLDDGRLTDGKGRVVDFRNTIVMMTSNVGSMYLNEHPSE
                     GAVDPAVRAKVNGAIAKTFPPEFINRIDDIILYRSLSRADIRKVVDVRLKEIQQRLLD
                     NNRKIKLDVDDPSCEWLAQAGYSPTYGARPMARLIQTEILNPLSRLLLQGRVRDGEVA
                     HITVDLRKNRLVVIPNHEPDVIQPDDSEDEDDSMDIEVEEMD"
     gene            738757..740709
                     /locus_tag="CNA02840"
                     /db_xref="GeneID:3253734"
     mRNA            join(738757..738983,739063..739224,739288..739326,
                     739381..739470,739527..739701,739753..740709)
                     /locus_tag="CNA02840"
                     /product="protein phosphatase inhibitor, putative"
                     /transcript_id="XM_024656214.1"
                     /db_xref="GeneID:3253734"
     CDS             join(738807..738983,739063..739224,739288..739326,
                     739381..739470,739527..739701,739753..740087)
                     /locus_tag="CNA02840"
                     /codon_start=1
                     /product="protein phosphatase inhibitor, putative"
                     /protein_id="XP_024511883.1"
                     /db_xref="GeneID:3253734"
                     /translation="MQPTQTHAAPVRKKPSRPFVSSHHRPADEVDDGIFRVVLITSGS
                     VASIKAPDIVGALVKSPNIDVQVVATKASTYFYSQEDVDNSVRSALNLPDEQIGEHFG
                     VRVWTDEDEWSDWKHVGEPILHIELRRWADLVVIAPCSADLLAKIAGGICDSLATSLL
                     RALSPSTPVIVCPAMNTHMYQHRLTTRHLAVVQEDLEYLVSGPQGAGRLACGDDGPGK
                     MTDWRDIVSLIEGFATMHQGRRAVHHSGHSLDRSSDLPLPPFTEAPPTPGRPPKLSSP
                     VESSSVSMQGGSPAKGPSDDVLTGIADWRSMTNELGGDGTAWNRKWWLG"
     gene            complement(740002..741413)
                     /locus_tag="CNA02845"
                     /db_xref="GeneID:36392666"
     mRNA            complement(join(740002..740300,740358..740721,
                     740779..741164,741220..741413))
                     /locus_tag="CNA02845"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656065.1"
                     /db_xref="GeneID:36392666"
     CDS             complement(join(740167..740300,740358..740721,
                     740779..741164,741220..741394))
                     /locus_tag="CNA02845"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514137.1"
                     /db_xref="GeneID:36392666"
                     /translation="MDPRLAFLRLTADSASSLPIPCSFQNRRPGAAGHVELNYWPPRN
                     RVSKAPDHLLLFILGNPGLLGYYPHFLSHLHSLLPASHAILATSHIGHSTKFPGPTVP
                     LSLSQQVTSKIELVETIRDYLDDWALKEGQNRPKFGLMGHSVGAYMACEVMKELNTEK
                     TRPVHAGYLLFPTLGWIANTWNGWTLWPIFHRPIKPILPYLSPLLRPLFSLVNLPETS
                     QSLLLSPPVLKDVLSLSSDEMRQIKGLDTDWFKTQGTDQTEEREGLFGVWTGGNGDGW
                     VGKDGPLVQECLGGESSERVKILDGVPHAFCLTREHSELVAKIVAGWICPKGFRPETP
                     LIPAEQPQQPLGSNIAPM"
     gene            741590..746263
                     /locus_tag="CNA02850"
                     /db_xref="GeneID:3253723"
     mRNA            join(741590..742285,742336..742399,742460..742462,
                     742518..742577,742631..742843,742891..743146,
                     743197..743993,744047..744200,744250..744297,
                     744348..744489,744538..744683,744740..745027,
                     745081..745409,745459..745501,745556..745692,
                     745753..745896,745963..746263)
                     /locus_tag="CNA02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_566693.2"
                     /db_xref="GeneID:3253723"
     CDS             join(741641..742285,742336..742399,742460..742462,
                     742518..742577,742631..742843,742891..743146,
                     743197..743993,744047..744200,744250..744297,
                     744348..744489,744538..744683,744740..745027,
                     745081..745409,745459..745501,745556..745692,
                     745753..745896,745963..746090)
                     /locus_tag="CNA02850"
                     /codon_start=1
                     /product="DNA repair protein RAD5, putative"
                     /protein_id="XP_566693.1"
                     /db_xref="GeneID:3253723"
                     /translation="MSAEASPETGRFRTKSSPELFFPATDSEGEEQNDVPLTIVHPTQ
                     STSSKFSINIASSSRPQHGITTGDFEATSQTSAHDNVDDDFSIVGHNPASSHPQGTIV
                     APRRKRSLQQAHSHHSSSSSSPVPSAPVIRADFRKGFLGEFVCEGWSLSKGRGYCSPG
                     TKIVIERPKSKSTDVGAPKPGRKDSGPVRLVNGKVVGGVKSKQMTLGSMMAKKVEPAK
                     KVKATTDQIIRFRNERGFEIGRLSIHEAGFLAHLLDTGVIQLSGNVIDCPQNLTTGCT
                     ILLNIKVYLARKAFENFGKHKREEHFSFWKDQRETAMEEAMRLRKDSLRSLFERIGVK
                     PIQSSALSKVTPIQGVLNRQKGPDLEGSRLRSSPSTSTAEEKGKGRAAMPAVDDDGED
                     SGDEAEKLDEKQMNEIDSIYRKAQQGDTRLDEMDPPSTFLYTLRPYQKQALTWMNARE
                     KGDSSVRNESLHPLWEEYLFKKDQLPGEPIEISDDDEQPDSTRKFYWNPYSGELSLKF
                     PTSQNLSRGGILADAMGMGKTCMMASLIHTNREEKPAGNLESQTRDGVEGEIDEEPAS
                     KRIKFKQVTLSNQWRAVPTAPKVESFPRATLVVCPVSLAAQWHDELRKMSQQGSINSY
                     VWYGGDRVDIEALLAGDGKERVDVIVTSYGTLTSEYQKWLRTKDRPNYEGGSLYDHEF
                     LRIVLDEAHNIRNRLAMVSKACYELKGQRRWALTGTPIVNRLEDLYSLLHFLRITPWG
                     NYSFFRSFVTVPFLNQDHKALNVVQYILESCLLRREKTMRDKDGRLIVDLPPKTVEIK
                     VLQFSRAERQIYKFLEERAKKRFIDLDADGRAMSNYTSILAMLMKLRQCVDHPLLVLG
                     KSGEDGELGEKILESGAGNGEGNLRDMIAMYAGGIRAETPEDVDKAYAAKVLKELGEQ
                     EDTPICELCSNEMFDEVLLPCYHRSCQDCIVEWIGTCEDQNKIASCPSCGKGPIKLAD
                     LRSVQRRHKRVNPITDAYPGGRDPNLKSSNDTTVTLGKVDLVTSTKLRALLRQLEEIR
                     QEDPKAKALVFSQFTSFLDLIEATLTKQGIRWLRFDGTMSQAQRANTIEEFGRKTNEP
                     LILLISLKAGGVGLNLTMANYVFLMDTWWNEAIEQQAIDRVHRLGQNKPVYVTRYIIK
                     GTVEKRIMKIQRSKTALVNASLSNGAKTKETTLADIKKIFGMDEEDSEGEVY"
     gene            complement(745784..749573)
                     /locus_tag="CNA02860"
                     /db_xref="GeneID:3253758"
     mRNA            complement(join(745784..746263,746312..746485,
                     746536..746951,746997..747334,747385..747477,
                     747527..747786,747844..748389,748439..748502,
                     748553..748634,748686..748785,748839..749191,
                     749247..749346,749398..749573))
                     /locus_tag="CNA02860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566695.2"
                     /db_xref="GeneID:3253758"
     CDS             complement(join(746168..746263,746312..746485,
                     746536..746951,746997..747334,747385..747477,
                     747527..747786,747844..748389,748439..748502,
                     748553..748634,748686..748785,748839..749191,
                     749247..749346,749398..749505))
                     /locus_tag="CNA02860"
                     /codon_start=1
                     /product="gamma-tubulin complex component 2 (gcp-2),
                     putative"
                     /protein_id="XP_566695.1"
                     /db_xref="GeneID:3253758"
                     /translation="MPSSRPATSSTVPFTPKPRKRASSSKFTFTDKELNQFAGTLASV
                     RKVRPGAILEELEQSGEGSGILHRYESSLHRGNPEAQKRSASARAVENERDRSHFRTR
                     PSSSASITQREYNPSFLRAMSGSRDLLPESDHKGREKVNEPAKIEPVLERPTPMTELS
                     AERRLLDKVPLEVQEAWICEDLLFVLQGVEGVLIRYDEGYDPFDEEQRVKGAKWRVNP
                     LLDASLLSLVKRLLPLASFFTAVEASMELRTAPEYGMVSHALCSGIRAMLKEFRVLTA
                     QLESLFLTSPTFTLQTLYLHLHPTLHTMSLLASLCHALEADQAGQGTDDLSDDDDGLG
                     GMAEELGLGGAGLKGLMKNLKAREGLIGDGGDVLGGEVLGIICEREATMSGDPTASTL
                     HSSLLLHASQPYCKMLIQWIATGHLSDPFDEFMVKESGHITKGVLESDYTDEYWERRY
                     TLRDGAIPGSSKVSARNNTPSISAGVPPPRQGTNRLPGGACIPQFLQPWKHKILLAGK
                     YLNVIRECGIEVKKPGEVDEKEMVTMNDPNFYKRIEDAYIYANKTLLKLMVEEQELIP
                     HLRSMKHFFFLNQSDFLTNFLDLAASELRKPAKSASIIKLQSLLDLAVRNPSSSSSND
                     PFKDDLKVVMQSQGLYDWLLKIVSKTGSLTEEGELDFALGDIHEEEGSKREKERPLIA
                     IDALAFDYSVKFPLSLIISRKTIARYQLIFRFLLHLHHLESALSAMWLEHKSPSWRNN
                     SGNEDIERWKARIFSLRTRMLAFVRQVLAFATGEVLEPNWKALEEKLAKVQTVDQLLR
                     DHVDFLDTCLKQCMLTTSKLLNIYAKLMTTISVFVSYQSSLNSALNKFLVDPIAESDP
                     AKSKLRWTALSKFEINFNHHAKLHLDAVTYNAGSENVALLALVTRLHQITLRI"
     gene            750138..751731
                     /locus_tag="CNA02870"
                     /db_xref="GeneID:3253793"
     mRNA            join(750138..750247,750299..750392,750444..750673,
                     750730..750989,751043..751731)
                     /locus_tag="CNA02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_566697.2"
                     /db_xref="GeneID:3253793"
     CDS             join(750192..750247,750299..750392,750444..750673,
                     750730..750989,751043..751221)
                     /locus_tag="CNA02870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566697.1"
                     /db_xref="GeneID:3253793"
                     /translation="MRAASTFLALAASTSYAVALSTGCTTQLGALALGDLGSCLQLTS
                     LLPVLSSSGSVVDSVNTYLKSLCGSSTPTCSNDTLTSASSSINSGCSSDISDGGTNGA
                     EVTALLALINHYDQAYAAACSTNSSTGDYCVTDTLDTIQDASGSNLTLSSVASILSGT
                     SSDSSNITSMFSSGQLCTQCVSGMYYEALQANSSISDTTIGRALSSECGSDFGQTSPN
                     TTATSTSGDSSAAATSSASSSSGLVSVQYAGLAATAGIVGSVLGAVIIGSTIIL"
     gene            751869..>752973
                     /locus_tag="CNA02875"
                     /db_xref="GeneID:36392667"
     mRNA            join(751869..751962,752030..752230,752309..>752973)
                     /locus_tag="CNA02875"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656066.1"
                     /db_xref="GeneID:36392667"
     CDS             join(752209..752230,752309..752973)
                     /locus_tag="CNA02875"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514138.1"
                     /db_xref="GeneID:36392667"
                     /translation="MGIEIGPLEIVAIASAGVALILLIFASVLYLVRRKSKRQLQSLR
                     DHRPVTSATPLSPSRQSEFNRETFFGFGATGMVSLPHIQAQIASSPSTAQTSLVTPTN
                     SSHNGKKQKLKKARLGDMGHSSPESGRRKSEELVVITYEDGLRKLGIDPSGEVHRPNH
                     ILYPEDYDDTEEIAVFEPQMKGRVDSPRAKLGRDRGAGRVAPPALESTWLPSYYHSSN
                     SGEINDAVYE"
     gene            complement(753010..755873)
                     /locus_tag="CNA02880"
                     /db_xref="GeneID:3253828"
     mRNA            complement(join(753010..753383,753436..753595,
                     753651..753705,753760..753862,753921..754082,
                     754139..754150,754203..754307,754368..754415,
                     754479..754553,754610..754706,754760..754901,
                     754953..755012,755085..755111,755170..755184,
                     755252..755277,755347..755418,755498..755873))
                     /locus_tag="CNA02880"
                     /product="High-affinity nicotinic acid transporter,
                     putative"
                     /transcript_id="XM_024656215.1"
                     /db_xref="GeneID:3253828"
     CDS             complement(join(753165..753383,753436..753595,
                     753651..753705,753760..753862,753921..754082,
                     754139..754150,754203..754307,754368..754415,
                     754479..754553,754610..754706,754760..754901,
                     754953..755012,755085..755111,755170..755184,
                     755252..755277,755347..755418,755498..755658))
                     /locus_tag="CNA02880"
                     /codon_start=1
                     /product="High-affinity nicotinic acid transporter,
                     putative"
                     /protein_id="XP_024511885.1"
                     /db_xref="GeneID:3253828"
                     /translation="MGNMSTFATAATNKAEDCSSEVGISEKGVEAQDLKDVADIEVQV
                     AGIDRAIERRMLRKQDFGLLPVLATVYLFNALDKGNLSNAKTDGLDKDLGLVGNQYYL
                     MITVFYIPLCLCGTPLSIAAKRFSAARVIPLMMIGFGSCSLLSACVTNFGGLFALRFL
                     LGIFESPMLPSVVFYLSQFYTRGELARRVGVFYAASSISGAFSGLLAFGIFQIKSGRL
                     HGWQYLFLIEGAGTVAFAIFAFFWLPRSPATCWFFNEEEKQLSRMRMLRDGTSEIGEK
                     VDFRDAFMPFIKDWRYIVWAFLALGLGVPLASVGNFLPQIVGRLGYSTVKTNLYTVAP
                     NIVGTCFLVLFTQSSDYFRERAIHIVIPLIITMIGFIILGTIDVLNYKGVAYFACFLL
                     CIGSNTPSVLLSTWYSNNSISENKRVVLTGVMVGIANASGLISANIFRAQDEPKYIPA
                     LAASAAFGGFTALLACSFGLYMRIENRRRNFAQGLPKSYGSKDVPTEYLGRGPKDQAF
                     RYMF"
     gene            complement(756703..757498)
                     /locus_tag="CNA02885"
                     /db_xref="GeneID:36392668"
     mRNA            complement(join(756703..756780,756855..756911,
                     756978..757163,757215..757498))
                     /locus_tag="CNA02885"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656067.1"
                     /db_xref="GeneID:36392668"
     CDS             complement(join(756901..756911,756978..757163,
                     757215..757392))
                     /locus_tag="CNA02885"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514139.1"
                     /db_xref="GeneID:36392668"
                     /translation="MISAAPSRFKALLASVYRRPLPRTAQSARHYTNGQKQEEPVIPP
                     INELLSKKSIKNAWAALSTTKKLLFGVVVIIGGAGEYALMKRYILEPAKERKRLRDQD
                     SKLNAQLDLAGGENKNVLPESQ"
     gene            757677..759413
                     /locus_tag="CNA02890"
                     /db_xref="GeneID:3254008"
     mRNA            join(757677..757756,757804..757946,758005..758137,
                     758193..758697,758753..758806,758868..758946,
                     758997..759011,759255..759413)
                     /locus_tag="CNA02890"
                     /product="chaperone activator, putative"
                     /transcript_id="XM_566701.2"
                     /db_xref="GeneID:3254008"
     CDS             join(757709..757756,757804..757946,758005..758137,
                     758193..758697,758753..758806,758868..758946,
                     758997..759011,759255..759273)
                     /locus_tag="CNA02890"
                     /codon_start=1
                     /product="chaperone activator, putative"
                     /protein_id="XP_566701.1"
                     /db_xref="GeneID:3254008"
                     /translation="MEPKPLTAYQQTYHWRNKNCAPFAYDWIKQSLPGLKVDDGQQSA
                     EISSVTSVSGDCDLGQRKGKLLTIYDLEVQASWIGKTKDGNEVKGTLKIPEVSHEAID
                     GVSDYVYEFSITGGSSSASEELLFYIRKSFPPLLSDKFNSFRPALLAAHGSATADAAS
                     APDSGASTPAAYTPAPPTKGADEPINEEQKKEKKSVGATVTVEVKADLQASADDLWGL
                     LTDENKIPMWSRSAAKLSLKAGSPYELFGGNVRGKVITADPPKKLVQTWQVKSPSWPS
                     EHYGTMTLSLSQGSDTTAATFTLDGVPAGTQADVEKALNSFYIQGLKQMGLGTFL"
     gene            complement(759458..761381)
                     /locus_tag="CNA02895"
                     /db_xref="GeneID:36392669"
     mRNA            complement(join(759458..759782,759843..759909,
                     759973..760095,760174..760393,760456..760894,
                     761008..761178,761295..761381))
                     /locus_tag="CNA02895"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656068.1"
                     /db_xref="GeneID:36392669"
     CDS             complement(join(759717..759782,759843..759909,
                     759973..760095,760174..760274))
                     /locus_tag="CNA02895"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514140.1"
                     /db_xref="GeneID:36392669"
                     /translation="MFHFRLGHASPQAELKRLKQASALNPNYNMVIKYLDCLNRLADQ
                     MIPNSNLPIWLIEVQHLITLLQKRVFSRVPLTPVERSALLNFAQYWRSMTRPPYSMGR
                     PEAQIVMITLAEFATR"
     gene            761990..763420
                     /locus_tag="CNA02900"
                     /db_xref="GeneID:3254025"
     mRNA            join(761990..762176,762239..762277,762334..762432,
                     762489..762521,762587..762679,762837..762932,
                     762995..763102,763245..763420)
                     /locus_tag="CNA02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656216.1"
                     /db_xref="GeneID:3254025"
     CDS             join(762172..762176,762239..762277,762334..762432,
                     762489..762521,762587..762679,762837..762932,
                     762995..763102,763245..763323)
                     /locus_tag="CNA02900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511886.1"
                     /db_xref="GeneID:3254025"
                     /translation="MAFNSNPEKTTSCCSTSEAQDKCTCPEGKCECEACPKFTKAPGS
                     GPCDCGVKEKVSTCGCNGSGAACTCPPGQCACDSCPKKAKSVSTCGCGGSGAACSCPP
                     GKCACDNCPKQAQEKVSSCGCNGSGAACSCPPGQCSCSGCPAQAKESPVDQATTCGCQ
                     GVGVACTCPPGQCACDGCPAKAK"
     gene            complement(763759..764417)
                     /locus_tag="CNA02905"
                     /db_xref="GeneID:36392670"
     mRNA            complement(join(763759..763838,763906..763982,
                     764049..764128,764218..764227,764299..764417))
                     /locus_tag="CNA02905"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656069.1"
                     /db_xref="GeneID:36392670"
     CDS             complement(join(763961..763982,764049..764128,
                     764218..764227,764299..764345))
                     /locus_tag="CNA02905"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514141.1"
                     /db_xref="GeneID:36392670"
                     /translation="MPLSDETKDRYNAVLGIAKTVFSVGWIPLIIYIGYRNSSPQPSL
                     IKLITPLA"
     gene            complement(764968..767127)
                     /locus_tag="CNA02910"
                     /db_xref="GeneID:3253437"
     mRNA            complement(join(764968..765108,765164..765264,
                     765316..765597,765658..765942,765993..766215,
                     766259..767127))
                     /locus_tag="CNA02910"
                     /product="Gly-X carboxypeptidase, putative"
                     /transcript_id="XM_566704.2"
                     /db_xref="GeneID:3253437"
     CDS             complement(join(765025..765108,765164..765264,
                     765316..765597,765658..765942,765993..766215,
                     766259..767005))
                     /locus_tag="CNA02910"
                     /codon_start=1
                     /product="Gly-X carboxypeptidase, putative"
                     /protein_id="XP_566704.1"
                     /db_xref="GeneID:3253437"
                     /translation="MSTHEKVYLPTASLGRPSPPRPYGPRLKFLLPLFGIVVFLLYQN
                     SSTVLSKLHACSHSSLDKISDSDKCPVQPNPLNVGEDWNPLTDQAYGELAAKRLSRAV
                     QIPTESFDNLPKDGSDPSFDKHYVFSNFIESEYPKLYQTLKHETVNSHAHLFTWEGSN
                     KSLKPILFMAHTDTVPVLPETLSQWSYPPFEGSITRNATPDTPGTWLWGRGVSDCKNS
                     LLGIYGAVERLVIEGYKPERTIIISNGYDEEIGGIRGSGVIAKILEERYGTEGISFLV
                     DEGFTGVSQDYGALVASLGMAEKGSVNVQIKVETLGGHSSVPPVHTGIGIMSLILAEL
                     EKNPFEPSLVPSTPYFKYLSCMSEHAPEVPKSIKSRIKNPKKWKKLAHDLASSDRILN
                     SFLATTQAIDLISGGVKVNALPEYVEATINYRIAFTSSVNETLEHISQLIVPLAQSLN
                     FTISAFEPPVKRASHFHITLDAPFGFESAPITSSDSKSFELMAGTCKHVFGKDTIVSP
                     SGMFANTDTKQMWNVTKNIYRFTPALLSENVNQHTVDERISLNAHLNTTRFFYKLLRN
                     AEGWDAE"
     gene            767258..771232
                     /locus_tag="CNA02920"
                     /db_xref="GeneID:3253435"
     mRNA            join(767258..767735,767786..767990,768050..768275,
                     768332..768400,768456..768568,768637..768669,
                     768730..768824,768880..769070,769118..769183,
                     769240..769437,769495..769559,769619..769806,
                     769861..769900,769952..770043,770095..770153,
                     770213..770291,770335..770755,770811..770876,
                     770931..770949,771007..771232)
                     /locus_tag="CNA02920"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /transcript_id="XM_024656217.1"
                     /db_xref="GeneID:3253435"
     CDS             join(767287..767735,767786..767990,768050..768275,
                     768332..768400,768456..768568,768637..768669,
                     768730..768824,768880..769070,769118..769183,
                     769240..769437,769495..769559,769619..769806,
                     769861..769900,769952..770043,770095..770153,
                     770213..770291,770335..770755,770811..770876,
                     770931..770949,771007..771101)
                     /locus_tag="CNA02920"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /protein_id="XP_024511887.1"
                     /db_xref="GeneID:3253435"
                     /translation="MGKEDSQRSANHPVTVTPHISSTHDLIQLPLPNTISHNNARSGA
                     SFAVRVTIGTLILLWTLFNIDVVTSPFRQNPSIDSLDDSSAAGYLRGIATKSMKWALP
                     APNHQLHSTYGDLESTEIGEEGIKMSLIPPKLAEKIFLDVPSNDSVAAASKRYTGYAH
                     PAGSGYDYASALTLKNEWEKELGLRVSGPQEFIYDAGSPESQARVKNGMDKLGVWIDT
                     YYPVMNTPVYAAATLLTDPPFHAKLREDIVDGDSDSELRDEVPVFHGLSVSGDVRGNF
                     VYVGYGRKKDFDLLKQRGVDIDGKIVLAKYGGCFRGLKVKAAQEAGATGVIIFTDPGN
                     DGEITEENGYEVYPKGPARQPSSVQRGSVQFLSKYPGDPSTPGEPAYKNASRLEGGNQ
                     PSIPSIPMSYEDVIPFLKALEGKGIHASDLGPDWVGGLGYHGVDYYIGPSDVDLHLVN
                     EVNTRVMPIWNTMAVIPGHITDEVIILGNHRDAWVLGASDPNSGTASQFEVIRGLGTL
                     LRKGWKPLRTIMLASWDAEEYGLIGSTEWAEDFGDWLQTNAAAYLNMDSSASGSNFHA
                     SASPSLALLVRSAAEEVESSSSPSKSVFDTRFDAGNWEQFNMEKLGNHVGLGVPLSEK
                     KGSGIGALGSGSDFTPFLQRYGIASSELGHKGGPKDAVYHYHSIYDSFTWQKKFGDVG
                     FHRHTDAAKVIGLLLLRLADGLILPLNTTQYTRDLEYYLEKVQDVSKIDLRTLEIDFE
                     PLADAIEAAQTASGELDKQRHKALKKLHKLIGKPAHGKYGIFKTMLRGCGWRVEEGKE
                     VDYSLQTWEEGPKEGISSFPHPRLPFPLPTPGRIREIKKVLKEIRIINRKLQNFESGF
                     LSQDGLKDREWYKHKGTAPGLWLGYGATTFPALTEAITIDHSPKLAQKEVHELAKMIN
                     KIAKYLVA"
     gene            771394..773222
                     /locus_tag="CNA02930"
                     /db_xref="GeneID:3253739"
     mRNA            join(771394..771871,771923..772040,772091..772647,
                     772697..772972,773019..773222)
                     /locus_tag="CNA02930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656218.1"
                     /db_xref="GeneID:3253739"
     CDS             join(771449..771871,771923..772040,772091..772647,
                     772697..772972,773019..773186)
                     /locus_tag="CNA02930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512092.1"
                     /db_xref="GeneID:3253739"
                     /translation="MAECLKTLLSVPSAPSFIYLHHPHHSSLSLPLPYSQKHLVKIDT
                     IEHRTPRLLLNGILLRLIGGDTDVGEARTWDEFSLRLKRWWSDKVYLAEGKSKGKQTE
                     TYAKDEAQERSLVLVITHAERLKTVMGNNWPVIVRLAELTGVRSTVVLASSVPWDYVR
                     PPRADAPEPLHVYLPSPSRDEIRTALLPASAHPLYPRFLDLLLSTILPLVTPPIEELH
                     YLSKSLWPLYTSTLPPHYEMTHLGLPYPDPAKPPPKLAVDVKLFTTLQHHITLPLASA
                     VESLLPRQIGHLEFVSALRPHPGKERALPKLPERPLPLAARLLLIAAYCASYNPSKTD
                     SRLFGRGYSANGKRKKGGGMRRTGYGKVRMGKVPQRLLGPKPFPVDRLLSLFFAIYAE
                     HAPRPAELEHLEESSSDDESVPLTWPPTIATDNGKRDRKRKREREQEQAWDDEVEWLM
                     GSTKFWGMLPELESQGLLKRVSPPDRLDNIMLRCEIDYEMAKNLAKDSKLGFTLDDYL
                     YEAIM"
     gene            complement(773179..775223)
                     /locus_tag="CNA02940"
                     /db_xref="GeneID:3253433"
     mRNA            complement(join(773179..774169,774220..774412,
                     774459..774584,774639..774720,774793..774906,
                     774978..775223))
                     /locus_tag="CNA02940"
                     /product="3-hydroxyisobutyryl-CoA hydrolase, putative"
                     /transcript_id="XM_566708.2"
                     /db_xref="GeneID:3253433"
     CDS             complement(join(773254..774169,774220..774412,
                     774459..774584,774639..774720,774793..774906,
                     774978..775097))
                     /locus_tag="CNA02940"
                     /codon_start=1
                     /product="3-hydroxyisobutyryl-CoA hydrolase, putative"
                     /protein_id="XP_566708.1"
                     /db_xref="GeneID:3253433"
                     /translation="MSSTARIQLLQRMSRPTATSRLAVLNRHLSSSAQMAAPREELVL
                     FESQQDTRIYKLNRSAKLNSLNLEMIDSLSSKIKAWRELDSCKVIIGTGDSRAFCAGG
                     DVKQLVLDLKEGKQTAVPFFKSEFQLNWLLARLGKPYVAVIDGVTMGGGGGLSLPAHI
                     RIATPRTIFAMPETKIGYSPDVGSNYYFAQLDGFIGAWLAVTGQEVYGRAAYELGIAT
                     HYVTENNISDIVYQITQHPSPTPANISSLISAYTAPASATSEASSKSSPDGHTPIKGE
                     IRKFLDKTFNKKSIQEIYAALDKSQSDDKLSSEVKEWAAHQKLQMEARSPTGMAVALQ
                     NYRKAREIRRLDRTLLNDISMATAYSGTNRATDDFITGVSAVLIDRSKGPVAWAPKDI
                     NEESLSPQNINSRFFSASSPHVADKPEIEFTPSSASKLDSGRDSTWGQFRKYGLPSEE
                     AVRAAVDGYAPGSGAFALLEEELIEQFVDAQGDVGGTRRDEVIKRVKEVVNACCKKGK
                     DGYLEWTA"
     gene            775791..777242
                     /locus_tag="CNA02950"
                     /db_xref="GeneID:3253431"
     mRNA            join(775791..776092,776192..776294,776363..776441,
                     776489..776853,776906..777242)
                     /locus_tag="CNA02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656219.1"
                     /db_xref="GeneID:3253431"
     CDS             join(775996..776092,776192..776294,776363..776441,
                     776489..776853,776906..776987)
                     /locus_tag="CNA02950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511888.1"
                     /db_xref="GeneID:3253431"
                     /translation="MQSLNALGNRQIASLNADLSRMENGEGGPAIQGQITTTLSALSR
                     LIDDYDSMARKEMVTVARDKANTRVARLKNEHKELKSRFEQAKNESQLKARQDLLGSS
                     SSSSPYPSTASTSVSQRRAPNQSSFAESPFASSDPLFRPNHPPSSREDFALREHTFLQ
                     ESENSIDQYIAQGRAVLGNLVEQKGMLKGTKRRLLDAANTLGMSRETIGWVERRTKQD
                     AWIFGAGATFTLFSFWAIWYYLG"
     gene            777502..781058
                     /locus_tag="CNA02960"
                     /db_xref="GeneID:3253429"
     mRNA            join(777502..778195,778252..778619,778670..778843,
                     778896..779344,779392..779562,779612..779676,
                     779732..780033,780080..780211,780273..780287,
                     780345..780579,780627..781058)
                     /locus_tag="CNA02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656220.1"
                     /db_xref="GeneID:3253429"
     CDS             join(777550..778195,778252..778619,778670..778843,
                     778896..779344,779392..779562,779612..779676,
                     779732..780033,780080..780211,780273..780287,
                     780345..780579,780627..780658)
                     /locus_tag="CNA02960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511890.1"
                     /db_xref="GeneID:3253429"
                     /translation="MSQQVISEVRRDTKSSPGNLSSQSSPRHATFIATNSGQDSDSES
                     QSSRAASEADDDEPNNWDRDRGPDISDNSEGASNHSSNPSTSSFSTDQQFYRPEKATE
                     VGSDSDSDTDHSSIPSQRSSDIEYEDEAEKVPGRQYNSSPSLFIDPSPGVFAISSNES
                     YSVVATETGSQQGSTTLVSSKEERYTLAEDSRYLLAAHSKRDRTVQQVMARFSALYIF
                     PILVAVPLTLLLSLNTILLTPLYNTIPLSLHNVTLYALYTAPPTLLYWAMTLERSARE
                     VVSANVCISLAALNGDLVAVLGRRLGSLMGRLAGPEWGACFAKAILGFGAVGGGLIFA
                     LLCFDHILPITPAKSLAGRIRNLANISARSTAFMLHLWFGQRLLDRRLSGSVMFLTQS
                     PEKAILFITLYLTTIHLFVRPGPSLASSLNGLYGFISVGLGVAPSKRSEISKYTALLP
                     KRAPSFILFLRLPLLVLALRQQIFLRPPGQRTDPYVTAHGELRVLSSEQSFTGRVVVG
                     DNLKDGYRFLRCDHSILGGRWFRERENNGEKTIELGDSIFAVFNLQEVMTLAHRSDEK
                     ESLITTLDLTTDLKVTSEGKEDEEPSRGSRSNRALVIGLGAGITAQGFLRRGFNVDVV
                     EIDPAVFTATEIYFNLSSSHLTSVNLLDGSVFVSELATLSRVNITDPSLDSETLTALE
                     RLPKWDFVVQDCFTGGSVPGEMFTKEFWEDLGEMVAEDGLIAMNFVGLKMSKASKAVL
                     VTLTSVFPQCRAFGDGYEVNQGPNDITNMVVFCTKTYSPILTFRRPRPSDVHRSPLRS
                     HVFSTFLPNEIQLDSIISEEDYHDTLMTLRRGDTKRLDYWQKETAIATWRAMQNILTP
                     EMWMAY"
     gene            complement(780335..782263)
                     /locus_tag="CNA02970"
                     /db_xref="GeneID:3254028"
     mRNA            complement(join(780335..780611,780660..780887,
                     780943..781240,781295..781380,781434..781605,
                     781653..782012,782060..782142,782187..782263))
                     /locus_tag="CNA02970"
                     /product="expressed protein"
                     /transcript_id="XM_024656221.1"
                     /db_xref="GeneID:3254028"
     CDS             complement(join(780784..780887,780943..781240,
                     781295..781380,781434..781605,781653..782012,
                     782060..782142,782187..782238))
                     /locus_tag="CNA02970"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512053.1"
                     /db_xref="GeneID:3254028"
                     /translation="MAHYQISPGRAVGIFHLGDTLWHVLDLLRTRKNEYPKFSLSWDP
                     QHPHESAVVIHLPSLTLYFPHPSQTLTLISFPSLAFSNITLTFETQLLYAPEQPLTRA
                     KVGRIFGPTFADEGRGLVFPGIKFEMSSEGKGGREDLVRRLDVNGKEGERLSLPGQLI
                     SCNVQPNKGVVLSIAEEEPLEIILGQTTAQDLLLDLGHPLRKFWKEDDRLEKMWGGTS
                     EPGYCFWNYFQYGLDFLISPQFKVHKILCYSNIPGTPLFQRYARCPWTVSTSSGTLNL
                     TSSVAAFHSSLFPKPSQYEEEIDEQKRSTSDKTRKASKSGAGSTKKKRSGEPPVMVLD
                     RVVEGGLDGVMNVGESRLIGYEGLIIEEDQLSGGICSVLVWRNEGVQSLS"
     gene            783277..784267
                     /locus_tag="CNA02980"
                     /db_xref="GeneID:3253427"
     mRNA            join(783277..783676,783730..783966,784035..784267)
                     /locus_tag="CNA02980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566714.1"
                     /db_xref="GeneID:3253427"
     CDS             join(783332..783676,783730..783966,784035..784115)
                     /locus_tag="CNA02980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566714.1"
                     /db_xref="GeneID:3253427"
                     /translation="MLSSRAFSPRTIFNRAALSPLAISTRFFASPTTSSMAGNTSVAD
                     AVKHDHRELEEYYDQIIKATDADTKTRYQNLFTWELARHSVGEELVVYPALEKYVDGG
                     KALADRDREEHQKVKEMLYKFQQLSPSDSEFEPTIKKLMSDLAEHIKEEETEDLVKLE
                     QAVPSSESSSLAASFKRTKMFAPTRSHPSAPDKPPFETVAGLLAAPLDKLGDVFRKFP
                     NE"
     gene            784741..786376
                     /locus_tag="CNA02990"
                     /db_xref="GeneID:3253425"
     mRNA            join(784741..785135,785185..785206,785259..785919,
                     785970..786376)
                     /locus_tag="CNA02990"
                     /product="expressed protein"
                     /transcript_id="XM_566716.2"
                     /db_xref="GeneID:3253425"
     CDS             join(784778..785135,785185..785206,785259..785919,
                     785970..786080)
                     /locus_tag="CNA02990"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566716.1"
                     /db_xref="GeneID:3253425"
                     /translation="MTTPTAQSQPVTFSSAQDENSAIAQSLAARRRRSLASILRDFRI
                     RQSAHKTTGDRVVEEESEEEEEEEDEYDHPERINTLDLEAYKRAMGDMIKMEQSGEVI
                     DPDSIETEAAGLEFVWDVLFENQRGIYLLGTAYYSSNTLLPKDPSTFTRPDRTAPITS
                     SFALADPSQNPTVQPVKSSKKYLRKVKAKSSTPTQSNKTSYTLETYQPPSPEWEYLTP
                     WMVNMRTGTDELGWRYNAWFRKKGWSSHAGNLGWWGWVRRREWVRLRVRKPRRKEEDK
                     PSEKIYRTPSYKLEDLLNGEVSGNALRILKLMGELGVDRERLELWKSWLDGIQKGGQV
                     WNRLQELLADREASTLLHRQFIHLPSYQKFMDLLSDHSLSTSPAHSDTP"
     gene            complement(785533..786917)
                     /locus_tag="CNA03000"
                     /db_xref="GeneID:3253423"
     mRNA            complement(join(785533..785630,785708..785779,
                     785837..785889,785941..786338,786392..786497,
                     786555..786619,786685..786780,786834..786917))
                     /locus_tag="CNA03000"
                     /product="DNA repair-related protein, putative"
                     /transcript_id="XM_024656222.1"
                     /db_xref="GeneID:3253423"
     CDS             complement(join(786049..786338,786392..786497,
                     786555..786619,786685..786780,786834..786846))
                     /locus_tag="CNA03000"
                     /codon_start=1
                     /product="DNA repair-related protein, putative"
                     /protein_id="XP_024511893.1"
                     /db_xref="GeneID:3253423"
                     /translation="MTSFVFVTGNANKLREVKAILAAGDSGIEVTSQSVDVPELQGTT
                     QEIAIAKCKVAAEKLGTACVTEDTALCFEALNGLPGPYIKDFLANIGHEGLNTLLNGF
                     PTTRATALCTFAYSPGPGEEPILFEGRTEGNIVPARGSKVFGWDPIFQPLEGGGRTYA
                     EMDGEEKNKISHRYRALEKLRAYLSEQAK"
     gene            787055..789018
                     /locus_tag="CNA03010"
                     /db_xref="GeneID:3253421"
     mRNA            join(787055..787766,787817..788298,788352..789018)
                     /locus_tag="CNA03010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566720.2"
                     /db_xref="GeneID:3253421"
     CDS             join(787596..787766,787817..788298,788352..788394)
                     /locus_tag="CNA03010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566720.1"
                     /db_xref="GeneID:3253421"
                     /translation="MSTSSTPSRQRTIVNWMNTSLVAPLEGWERGCFGVGTRGRGGRR
                     RPHAKFEGLGGNQSSPAPQAAAEGPLTPHNLRILCVNKWISQPTSSTPTDLRLLRSTK
                     FSPYFDNCVGALDGTHIRTTVRGEEAKRSWRNRYSYISTNVLAACDFSLRFVYVRPGY
                     EGSANDQNVLNNALEDNFVIPKDRFYLADAGYGAHPGLRLPFRGVRYHLKEWGRANTR
                     PRSKEELYNLRHA"
     gene            complement(789024..792221)
                     /locus_tag="CNA03020"
                     /db_xref="GeneID:3253419"
     mRNA            complement(join(789024..789405,789471..790021,
                     790089..791476,791546..791833,791905..791998,
                     792047..792078,792134..792221))
                     /locus_tag="CNA03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656223.1"
                     /db_xref="GeneID:3253419"
     CDS             complement(join(790590..791476,791546..791833,
                     791905..791998,792047..792078,792134..792170))
                     /locus_tag="CNA03020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511895.1"
                     /db_xref="GeneID:3253419"
                     /translation="MAKKSHNPAEAYRKQLKAKELKKNKEARQKARETQTVKKDTREL
                     ETEIRSLKAENNPANKKKIQELESELQYVSKLKEKYVSEHPEEHDRIYNIRRKTEQDQ
                     DGEGEGSGSGKQLYDERGRLRNPKRSVYYDPVYNPFGVPPPGMPYRERTAEEEESEED
                     ESDDDIVMPEGPPPDSDEEGDGDDSDDSDDIPLPEGPPPEPQAILPVPPLPSGPPLPP
                     SGSGFFPPSAGYRPPHHFAYGVPPPPPPSFRPPMPPRPHAPNVAHNRPPVPVQDPLSN
                     KPTIPYQAHKMAHALPTRPSGPSGTGVSTSASPKPIPVAASSDAKAPITQSAGVPGAS
                     GEISAAPVLRDLRKETTAFVPRGVRRRKAGPGGSSNGAGGMTVNAAPGAGEIDEDGDE
                     IKRPKLAEGEGLLGKLSGVLGGAHGVLGKNGSEEKRDVDDDYQKFLEGLGDIG"
     gene            792392..793238
                     /locus_tag="CNA03030"
                     /db_xref="GeneID:3253417"
     mRNA            join(792392..792573,792677..792749,792819..793004,
                     793092..793238)
                     /locus_tag="CNA03030"
                     /product="arp2/3 complex 16 kda subunit (p16-arc),
                     putative"
                     /transcript_id="XM_566724.2"
                     /db_xref="GeneID:3253417"
     CDS             join(792419..792573,792677..792749,792819..793004,
                     793092..793154)
                     /locus_tag="CNA03030"
                     /codon_start=1
                     /product="arp2/3 complex 16 kda subunit (p16-arc),
                     putative"
                     /protein_id="XP_566724.1"
                     /db_xref="GeneID:3253417"
                     /translation="MSDYAFRKIDIDALDEDVLLPSDLYDPDPRGPDGVLEDAKRRSA
                     DVRGLVSRGDVAGALSTILTDPPYGDGVDEAKSLTTSSLLLILNSTRSADIPTMIKNL
                     DQVQQDRLMAYLYKGMAVLAQGGEVSGSVLLTWHEKLTEVAGVGCIVRVMTDRKTL"
     gene            complement(793270..794435)
                     /locus_tag="CNA03040"
                     /db_xref="GeneID:3253415"
     mRNA            complement(join(793270..793458,793518..793665,
                     793717..793957,794014..794349,794389..794435))
                     /locus_tag="CNA03040"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_566726.2"
                     /db_xref="GeneID:3253415"
     CDS             complement(join(793392..793458,793518..793665,
                     793717..793957,794014..794349,794389..794394))
                     /locus_tag="CNA03040"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_566726.1"
                     /db_xref="GeneID:3253415"
                     /translation="MNPQTYPAVNPYPPTQAAPSAGPGSGFPPKSGLAGMTPHSMSST
                     PVPNMAPGAGVRGGLPEERNVAQLVRENTNVWARKWQGLLDRSTPHVLERWLVTLGLF
                     LLFALNVILRQGWYIVCYALAIYILNLFLAFLQPRFDPSLAEDLAADDVEEGAPGLPG
                     AGPAKTPGGLKGLLNGFSNGEEDEEFRPFIRRLPEFKFWYSATKANAIALLCTITRAT
                     DVPVYWPILLVYFFTLFGLTMRRQIQHMIKYRYVPFDLGKKARYGRK"
     gene            794573..797283
                     /locus_tag="CNA03050"
                     /db_xref="GeneID:3253413"
     mRNA            join(794573..794938,794988..795152,795219..795477,
                     795532..796168,796228..796589,796641..796758,
                     796820..797283)
                     /locus_tag="CNA03050"
                     /product="ubiquitin-protein ligase, putative"
                     /transcript_id="XM_024656224.1"
                     /db_xref="GeneID:3253413"
     CDS             join(794578..794938,794988..795152,795219..795477,
                     795532..796168,796228..796589,796641..796758,
                     796820..797158)
                     /locus_tag="CNA03050"
                     /codon_start=1
                     /product="ubiquitin-protein ligase, putative"
                     /protein_id="XP_024511897.1"
                     /db_xref="GeneID:3253413"
                     /translation="MNTHLAARLQHLASSYPPHTALFYARIWHTLAPTTDSNHDSLHA
                     LALAFLQAAEPYSAIHLVRDHTGLDNLDLDLEIRFERTDKVCGGCAMIVARCCEKLGR
                     YSEGQAVLARALKRGANINLALPAPSSNAATAYLLLANLSHKGKSPETAIENYRKALD
                     EDPWMWEAFTNLCDVGAPPPIESLFPAGAGLSLSRHASRSSRPPLSPNIHRQKSPIEP
                     APGVLRLHQAQAGAGNSGGLFTPDVEGIGGKTGLGMMGNPSSWDSSSIIGDTTFAVPE
                     QPTKRPFPSFMSTATSFLPSSLRGGTSTPAGSDSPPKLPTMKRPRGKDPVKRPVETPQ
                     SQMSSGLPLAKELRPNGAKYEDSDAPRRSSRLKTTTSKPAPKIPRDPHATRSRSVTSS
                     NSNNEVPSPPSLTSQDAILQREADEYLKDIVKKCARVYKSLSRYQCQQAIKEVDALPG
                     ELKTSPWAMEILGRAFYEIANYAMARRAFTFLQQQEPYRIQSMEQLSTLLWHLTDLPA
                     LSHLSQSLISISRSSPQAWIAVGNCFSLQKDHDEAMRCFRRATQVDEGCAYAWTLCGY
                     EAVEMEEYERAMAFYRTAIRTDARHYNAWYGMGLVYLKTDRPRYAEHHFRRAVEINPT
                     NPVLLCCVGMALEKSDDVVQALHFYERASKYAPTSAMVQFKRIRALVALQRYDEAISA
                     LVPLTHSAPDEANVFFLLGKCLLKKERRQEATVAFTNARELEPKLEGVINAVLAANGE
                     EGEDEE"
     gene            797323..802325
                     /locus_tag="CNA03060"
                     /db_xref="GeneID:3253411"
     mRNA            join(797323..797645,797699..797836,797915..797970,
                     798027..798217,798275..798987,798989..800475,
                     800530..800656,800716..800961,801014..801240,
                     801303..801568,801638..802325)
                     /locus_tag="CNA03060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656225.1"
                     /db_xref="GeneID:3253411"
     CDS             join(797390..797645,797699..797836,797915..797970,
                     798027..798217,798275..798987,798989..800475,
                     800530..800656,800716..800961,801014..801240,
                     801303..801568,801638..802241)
                     /locus_tag="CNA03060"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511899.1"
                     /db_xref="GeneID:3253411"
                     /translation="MQNSVPPATFRRINSLPLSHSHSPTPTDNASSGWVTTTSSWTSS
                     TKDPPSTLDVLSKGGGPLAWTEVRHRLQEGEHVDVDGEGNNVGHCSQAVILSCLHLAH
                     EMALREVGMYAWTVPAVKDPTGSMMKIMKQYEKQIKAMSRHADLRCRSVPDPSKLSIQ
                     HHLQKARQAAGLNSYVAVIYSGHGIQEPPTEAGELWCYDKNFEECLQSGCGPSEYIPI
                     LLFDLLTWAGASTCYVWDCKNAGRFIRAAKTEAEEIDSQLRTAAAQNPSVAETQPATY
                     AKRQIHFAACSTEQVLPKVKGLPDDLFTACLTTPLRIALLFHNLQCFPLTRKNAEKAT
                     IKSPAYMDGLWENMSQSLKDRLWSELTAILHTIAWQTLDGSEYQKLFGKSGDVVNNIA
                     SGFLLSQRVLGAFKVTPESVPSIPSSVSNHALWTTWDLILDNLFEQLPKYFDDAHPNV
                     TWEKDLKLVSFMADQLESITTAGQSLLFTETPKSGMMPGLTRLPIICRASMTEEFRVQ
                     ACSALDACLNALDARGLARAVQGGALDVAVELLALQDERIKDQVISIWSSLVKYDSCV
                     LALAKEGLTADRLTDVPAVKFFLIVLQENLAHDKLSPDAGDSGPDTQEDCSDFNLVPT
                     VQIAAVLSTIANFVVGRSAPRFVSRSLNMANIMLHSSCDLIRQWGALLAAEVLGSLSI
                     SDEERLSEELKGELLRMVDSGNVENRAAGIYALSRWLPVGDEWGASELEGILELSDHL
                     VKHSKVEGSPLVRRELAEVFIQILKSAKGFTAMALWTQLLGYALDARRQDISVAEKAI
                     INLGMNLKMAPKQKLLLNRIAAILSAVCVQRYDPDPMVAKIVHQPLCKALDMLRSQSQ
                     ESKKDANVWSEIQSATFLSSKNKPEWTNEMFETILAASERVKELYQGTSSGNDPCRFT
                     AERPQHAKEAKSRKRVNHGLFERNKRALQAHITQARRKAEITSHDSSPIKSTSSGDTW
                     TMRHRVLEDSLVIAEQQVGLPWKWSMKDIICPDPWTTLTFHSFHSTVMSCNRDHDLLM
                     WDWNSSRKIGHVKLNLASHTSITSARFVNELHEQIVILAEICNGDIHILAGPQDASRI
                     KPIASFQALNMHSSRNMLVEDEDHRRLVTTWFRQSGKLCVGGASEVINVWDCPAERCV
                     QVLETKANVPVTTLITEPVSGNLVIGGQADGMVQLFDLRQCRRTSVLSWKADLPGLSI
                     QQEDMRLFNTKKDGVAKMGVILGESKHVTSACFNGLINVHDIRNLSQSAASVLAHPDG
                     IASASFQPHSGLMSTVSLLNKPPLNSSKGTIMSVTPAYSHSSTQSKLSTALSHFHLRS
                     RSNSSPKIRPSYTMNNNITLHPSAASIRSSANWSLHRTSLGSCNPVTVESISFDSQPA
                     DVMAQGFRPYTVMHPLRPFLGIGFGETCYLRGCGVGKGDDTDSGSYTFLREQAKYGVL
                     "
     gene            complement(802024..803833)
                     /locus_tag="CNA03065"
                     /db_xref="GeneID:36392671"
     mRNA            complement(join(802024..802463,802525..802670,
                     802726..803313,803364..803676,803737..803833))
                     /locus_tag="CNA03065"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656070.1"
                     /db_xref="GeneID:36392671"
     CDS             complement(join(802401..802463,802525..802670,
                     802726..803313,803364..803676,803737..803769))
                     /locus_tag="CNA03065"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514142.1"
                     /db_xref="GeneID:36392671"
                     /translation="MHPHHTPLLSLHQVVLDYVITNAYASTAKSLSQSCASGRGASPS
                     GDTAMPSDLKTGSKSDANGDQKTNGEADGMDVDVEMDGSDDNANSGEDSNKNLDRGPA
                     LDEQALDMIERRREILEYILSGSIDKAVELLDRHFPLVLSCSEPMPSNYGAATNGATS
                     NGTATPKSRLSSSGGPLHSESSINHSVPVLNSSVHPDHIRLNLQIQRFIESFRQMNPS
                     SPSSPSSSTSSPANSQTFNGGSGVTLTHALSAAHGLHSEAKKLPAEVRAIYLQEIKDV
                     GALFAYENAEMSPLKGFLEQSRRVKLAEQVNKAILRSEGRAPQSQLEEYSKRLEVYYK
                     VLEGNEIDPTPPWTAKDGLAKEHLAAYWKYHDIKNFNLHDFASLSW"
     gene            complement(805134..809468)
                     /locus_tag="CNA03070"
                     /db_xref="GeneID:3253409"
     mRNA            complement(join(805134..805654,805708..807161,
                     807211..807828,807879..808085,808134..808640,
                     808690..808956,809015..809323,809378..809468))
                     /locus_tag="CNA03070"
                     /product="expressed protein"
                     /transcript_id="XM_024656071.1"
                     /db_xref="GeneID:3253409"
     CDS             complement(join(805236..805654,805708..807161,
                     807211..807828,807879..808085,808134..808640,
                     808690..808956,809015..809175))
                     /locus_tag="CNA03070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514143.1"
                     /db_xref="GeneID:3253409"
                     /translation="MGEIPLAGPSRPRRRNNTESDGISIRVAALQKQNATLVGVAANE
                     SGKTRPPPASPSRSRPHSSLPSRPDIDDDYYRGISGPMPSSLTSNLEFNDADGLGVAG
                     SSRPRRKDYAAVNGASSRAATLPKHGAAVKDEGETQQLPTSPSRPHSRPHPSLPTRPR
                     RDNEFSRGASGSSTNKVLFDPTKLHEVRRVEPGSTKKLFDPVAHDPRSFTSLATPPSL
                     PDTESAPSTSTTAKRLLRRAAPGTGSGSGQSGSSKHTWEIDADRERERRRRREGSERG
                     STLSGKKKDSDARSKGSKSSEGSESFKDRERGKGKNDTGVKPILKKIHDEIKELEQEL
                     IEIHRKMAQDPEAGISALSSRKMDSRTPKSPSDDAVAWVQLISKHKQLADLHDHFLTT
                     LFDPLVPSSYHQLSIKYNIPSRLWQTAFFLILEQLRHAWVSHHPSALDLLTDVVYDAY
                     RFYSELLENQALSGLRGAWIEALGDLARYRMTIASHVADIDPRKETERIRDQRQGADD
                     DNDQDPEGKPPLSGASIGAEVAQNWDVEDKETWRVTARDWYTMGITEKPGEGRLHHHL
                     ALLCRDMKGQEGRALHHFVKSLVVTHEFSTSRETILPLFDTALQSQRSLPEATAMDLF
                     IRLHGMLFTRISLDSFPDVMSRYVERLEEDARLDGVSRKATISQVDWMIMGVVNIAGV
                     LQYGSASGIIRKALAQEGAERRKAQAQNADDEEGEDVGENLEEVNGISKDTELVSLPA
                     SVAESDLPITFTHALFLTFAVFGFSLAHPNRIQGFHQVLNPYIIIVLTFLATLFRQPH
                     VGVHLLPYVPWQLLADFINSANLSLVEEKRLANGAPLPEDWLIRGSEWVGRRVYERGF
                     WKGKSPSGRGSSGLLQAQPRSGERFQSEMDVLLSNFDASVDIQEGVVDEAEGTDLTDG
                     PAAVNQRRWKRVAWAVGVLAKSVEGFEIRDGKVYVEGTLQEKVKERERRKEEEERRER
                     EVLERKRQEREKEEKLLGLEMGEESDDQELVDLRRKLQDLKAQAGVQVSRKSRKAASN
                     ILDVVAGYTMLIFDTNILLDSLELVNRIVESGQWSVVVPLPVVTELDGLSKEHGALGA
                     AARAAVALLEERIRTHALCLKIQTTKGNYLSDLLIRTEQIDSSTYASSEAIARTMDDR
                     IVHIASFAQEHFVDRTILLAMPRPEKGATKVLLISNDRNLRLKAKARGVEVANEKELG
                     VVLARV"
     gene            809729..811979
                     /locus_tag="CNA03090"
                     /db_xref="GeneID:3253405"
     mRNA            join(809729..809863,809939..809972,810023..810078,
                     810135..810265,810329..810345,810387..810986,
                     811040..811182,811233..811380,811435..811586,
                     811639..811979)
                     /locus_tag="CNA03090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566736.2"
                     /db_xref="GeneID:3253405"
     CDS             join(809802..809863,809939..809972,810023..810078,
                     810135..810265,810329..810345,810387..810986,
                     811040..811182,811233..811380,811435..811586,
                     811639..811768)
                     /locus_tag="CNA03090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566736.1"
                     /db_xref="GeneID:3253405"
                     /translation="MVKDTQLYDLLEVQPDATDIQLKKAYRKLAIKYHPDKNPAPEAA
                     EKFKDIGEAYQILSDPDSRAFYDKVGKDAMNRPEGGNIDPQEIFSQIFGGEAFFDYIG
                     EIALVKDFTTTMDVVMSPEEKAEMEAAAKADAEASAEATEPSSKTSAAASAAAASAAA
                     DPLGQSAAGAANEAAQAEVGVSGENQALALHSSASGTNTPTGKADGEADAVGAAKKPE
                     SSKKGKPKLTPEQKAQLEALEKKQDEEKQKRIETLQDRLVQRIRPFVDAKNPGDINDA
                     ETKAFENRIRIEAEDLKLESFGVEMLHTIGQVYITKAGNFLKSKKFFGGGFFGRLKEK
                     GGMMKEGWNLLGSAVGVQSAMAEMERLEAKGDASQEEIEALAQELSSKMLLTTWRATR
                     WEVINVLNVVVDRVLYEQGIHKDMALRRAKAIMTIGGIFKAVEADESDDERRELERLV
                     MNAGKKKKEEKEKKGWFSRSHAHKPEATTPDKEEGPKVTA"
     gene            complement(811892..812800)
                     /locus_tag="CNA03093"
                     /db_xref="GeneID:36392672"
     mRNA            complement(join(811892..812168,812261..812800))
                     /locus_tag="CNA03093"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656072.1"
                     /db_xref="GeneID:36392672"
     CDS             complement(join(811936..812168,812261..812498))
                     /locus_tag="CNA03093"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514144.1"
                     /db_xref="GeneID:36392672"
                     /translation="MLADNLNHSFNPISLGGTFLLLAPRLVHSQPLNDWKNKLIKDLT
                     QPLETRGLLSRGDESYSEKAEGWCNDNPSECKAVVSTLSIFGLFLVIFVLFKCYRRRK
                     RRQAVARDSLEQTEAKAAQDALEQRVEERFFHRQREMKLRHDMEMLGLSNDKGK"
     gene            complement(812976..813720)
                     /locus_tag="CNA03095"
                     /db_xref="GeneID:36392673"
     mRNA            complement(join(812976..813278,813330..813386,
                     813438..813720))
                     /locus_tag="CNA03095"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656073.1"
                     /db_xref="GeneID:36392673"
     CDS             complement(join(813118..813278,813330..813386,
                     813438..813606))
                     /locus_tag="CNA03095"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514145.1"
                     /db_xref="GeneID:36392673"
                     /translation="MSRPSIEMNLPPSLLNFYQKQQEYAGLQALREASADLVARAEKL
                     AEMSNIMADGGEAIGGVLRNWPHVFSILSLFTAQMEKASGDHSRQEDEDEEPLPCLVR
                     LAYGGETASVESSAPTTTTASDKTKQ"
     gene            813868..818294
                     /locus_tag="CNA03100"
                     /db_xref="GeneID:3253403"
     mRNA            join(813868..813982,814033..814090,814153..814210,
                     814274..814368,814425..814531,814585..815358,
                     815415..816933,817002..817484,817550..817632,
                     817699..818294)
                     /locus_tag="CNA03100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566738.2"
                     /db_xref="GeneID:3253403"
     CDS             join(813930..813982,814033..814090,814153..814210,
                     814274..814368,814425..814531,814585..815358,
                     815415..816933,817002..817484,817550..817632,
                     817699..818248)
                     /locus_tag="CNA03100"
                     /codon_start=1
                     /product="single-stranded DNA specific
                     endodeoxyribonuclease, putative"
                     /protein_id="XP_566738.2"
                     /db_xref="GeneID:3253403"
                     /translation="MGVKGLWSLLNPVARPVQIESMEGKRLAIDSSIWLYQFQATMRD
                     KDGRVLVNAHVLGFLRRINKLLFHGIKPVFVFDGGAPALKRSTIAERKRKKTGAAANH
                     AKVAEKLFAAQMRREAVKAAQVAQEQKEAKASAEAAAEYARRYPDEAGEQIAEGAVYL
                     EDLEGRAGPSRPRSPGPAQTEGVDPSAVPTDPEKRRKYFKKHDPYRLPAAEMPTVSTS
                     DRPDARLATEEELKQFIDEVHPEDIDIESAEFRALPTEVQYEIIGDLRIRSRQQSHRR
                     LADMLRAAPTPLDFSKAQIKHLSQRNALTQQLLTVTDMVGKAHLTIPVRIAAERNREY
                     VLVKKDETEGGGWALGIREGSKEKPIEVEPAEPKTESEHESDIEPLSPPPQAAMDQDL
                     REYRRQQVLEAIAARYAPKRQARAPLDVAVKPFGPSRTASSKPLFDVDGEEEEGEEEV
                     VPTANDEALALALQQEELGDDETEVDEDLAKALALSRREAERKSRSENEGFRVVDVGK
                     DELTEEEDGDMEEVELVPSGTVTPAQVDIEAEDSEDEDEFEEVDTPSTTLSSSRVSLG
                     ASIAPGMETPEIVTIHPNSTRMIDPIVMDDDDDDDDDKGEPLVMSMFKEKRASVYLPP
                     LASDLPERAAQSSGEQAPPAITSRSQISQSTAVPVRPKALQKLNSAVNVPSPLRNVAQ
                     PKSSPKSSPISVDDVSVPAGAPDLPFTVEATDPTEIRGAPSPDMIPPRSPPSPELYGS
                     GSLERPHFLERPSPRSPVMYNEMDDEDGSEADEKDETRSTYSWSPSPTPPPRPLRTTE
                     SDVSLNTVASPSPALIAAPRDDDEDDGDLAPADVAAESDDYARFVASIKNRDLNEVRG
                     EIDDEIRVLNSENRVAMRDSDEITQSMIAQIQTLLRHFGIPYITAPMEAEAQCAKLAQ
                     LGLVDGIITDDSDVFLFGGVQCFKNIFNDAKYAECFLLADVERELMLTRERLISLAYF
                     LGSDYTLGLPGIGPVMGLEILANFPGERGLYDFKEWWGRVQKGNDTEEESGTKWRKSF
                     KKRFLKSIYLTADWPDPLVREAYLYPTVDESEEPFHWGFPRLSALRTFLHEELSWSIS
                     KVDDELTPIVQRISLRGKHGALNKQGTLDPFFDMSAGAGHYAPRKRGMNVSKRLMGVI
                     KQFKEAEIRMSKGEDLDVDAILADEEKEKKRKAKGKRKMDEKEAGDDEKEEGRNSSSN
                     KRKKTSARGRRRAGTASSVGDSVASSEGGSRSTSTSGRGRGGSRARGRARGKGQE"
     gene            complement(818337..819109)
                     /locus_tag="CNA03110"
                     /db_xref="GeneID:3253401"
     mRNA            complement(join(818337..818524,818605..818682,
                     818769..818863,818943..819109))
                     /locus_tag="CNA03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_566740.2"
                     /db_xref="GeneID:3253401"
     CDS             complement(join(818366..818524,818605..818682,
                     818769..818863,818943..819090))
                     /locus_tag="CNA03110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566740.2"
                     /db_xref="GeneID:3253401"
                     /translation="MFAPALLRTARPAASRIAPIASRLASSSTKLTIANENFPLPTGE
                     EVDPQLNGYPQLPNVSLQNRYPFGWWDIQERKNFGEVVHESEDVLGMWGPDVHKTSWQ
                     SALLQLCTAFGLVGAVSYVLIKTRPERPVTARDYPYGGLEKELGGINVARKEQVDEE"
     gene            819487..821708
                     /locus_tag="CNA03120"
                     /db_xref="GeneID:3253399"
     mRNA            join(819487..820865,820935..821082,821203..821708)
                     /locus_tag="CNA03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_566742.2"
                     /db_xref="GeneID:3253399"
     CDS             join(819687..820865,820935..821082,821203..821465)
                     /locus_tag="CNA03120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566742.2"
                     /db_xref="GeneID:3253399"
                     /translation="MPPPSGEIRRKAPRRRRIPAASTEASKKKRAGKIPGTAASTPQA
                     ASDDDSVSQAGSKRAASVLDDDDETSLAGSVSSSRAGSLAPGRAKRAKTSRGPRVATI
                     ALTDVEPEEMVGSPVTEEMTMGDLATVLVSEGRVSSRAIKIDEFRRAEMLKKKEVAQK
                     RAEETWKRNQIKRRKVRAAQNKDRAKRREEIRKQGGDEKDVSPDEMDSDEEFEVAPER
                     LTPPRSSSEEAGERAAAGFGQGDEEDGAVDSDVQDVAVDNGPLDEEDQAFENMFGDNA
                     RPNSLAPEDNAVIANEEEEDAATAALRAAGFTVTDDPVSPRSNDDGWGGPGGAEEFDV
                     ADYRLALQEKRLREFREREEEDGDVVEVDDETRFVNSATYGKNRKSQRWSKMETELFY
                     EILGETGENYTLMKAYFPGRDIRSLRLKGARENKVNPEKMTAAIMARKPLDKDYLAKS
                     AGYDASRSWDKEEALFEEAKADVERLRKLDSEQPLGKDVEDLDEQSGDMMEADDDDGL
                     QRIEEMDVEEEEGKSEDGNDE"
     gene            complement(821630..823910)
                     /locus_tag="CNA03130"
                     /db_xref="GeneID:3253390"
     mRNA            complement(join(821630..822158,822232..822278,
                     822335..822643,822701..822945,822999..823173,
                     823242..823274,823379..823447,823507..823910))
                     /locus_tag="CNA03130"
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_566754.2"
                     /db_xref="GeneID:3253390"
     CDS             complement(join(821812..822158,822232..822278,
                     822335..822643,822701..822945,822999..823173,
                     823242..823274,823379..823447,823507..823757))
                     /locus_tag="CNA03130"
                     /codon_start=1
                     /product="anon-23da protein, putative"
                     /protein_id="XP_566754.2"
                     /db_xref="GeneID:3253390"
                     /translation="MDPAFHPPFSLPNLYQTLPFGTCCAIFILWAVHHILCQRYAPIT
                     ITGPTRREEVGAHGETTEELVHKWCKSLKEGFTASWWLPNGHAQTIYSGLADFSMDDH
                     VTYQRQLLRLPDGGTIGVDVYPPLTTELADDAPVIVVNHGLTGGSHESYVRNLVVWLT
                     KPIAEGGLGGRAAVVNFRGCASTPLTSPHLYCSGNTIDNHTATTYLASLFPDAPLLGV
                     GFSLGAAVMTRYLGEQGDKSRLRAAVVLYCPLELKAMSAKLDSAHLFPRLYSLTMARK
                     ILKSISPHLLPPSPLSSPSSPLHVNIPEILSLSSSVKYKWTLRASKVTELVVTKVGGS
                     APCFPFEGMDQFLEWACPSGWIGRIKRPTLAISALDDPIVSGDCLPYSAVRASSHMIL
                     AGVAQGGHLGSFDSPSPFGPDRHRRWHVRPTIEFLRGVIKDLPKSASEQKLGRVQVEE
                     REDGWSWAGEVGWKLVGEEEECGWVGNGICESEMDGAGASV"
     gene            complement(824566..829205)
                     /locus_tag="CNA03140"
                     /db_xref="GeneID:3253389"
     mRNA            complement(join(824566..824865,825009..825118,
                     825169..825328,825383..825531,825588..825691,
                     825760..826444,826501..827908,827963..828084,
                     828143..828471,828571..828630,828982..829205))
                     /locus_tag="CNA03140"
                     /product="protein phosphatase 2A regulatory B subunit,
                     putative"
                     /transcript_id="XM_024656226.1"
                     /db_xref="GeneID:3253389"
     CDS             complement(join(824660..824865,825009..825118,
                     825169..825328,825383..825531,825588..825691,
                     825760..826444,826501..827908,827963..828084,
                     828143..828306))
                     /locus_tag="CNA03140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511907.1"
                     /db_xref="GeneID:3253389"
                     /translation="MAETGVQHFLRNAPNNGDTDNPEKSSACPVLPDNQQPVFEFEKP
                     SKELRISCDTCRIKKIKCPGERPTCRNCEQKGRPCTYPTAVRRRGPDKNPGARMKNKV
                     QRAKQSRKIQGRDEDPSQSTSLTKGIDLHQLASPPPKLLPKPPTHDIPIAQDAQETRL
                     HLITQRLPILSQSPPISVPPQPSDQSTLHSTVGFRSSDSISSTLFNPESSKDMLLAQT
                     RPLHVPKATPSLSVQSLGPQPLQSIIDQAITPEIEHLALNTQSQLIPQSDPSPTEPSG
                     QSLFNLTQQQFQQKIPLRVTPLPTYDQSSFIPISAIPQDVATYNFFSAEANLSDTTKR
                     EPQAFFAHTDLVNIGSAPSQSPFLPNHTSLCDSSSLESLFSPHITKSDINSCVKRPET
                     NTGVETWDGQPSSRGTEIAGLLPVKDVAIADGSLTCDQLPYATAGGTTGFSSLALFND
                     GLVQPSEGPYGLSQIRDTKDGISKTVPAWNGFPPGSLDQSYVPFTATGILTQGVHSQD
                     LKRKAEDPPPEESEYEIYTPPGNIQAAMDGWWNWILAHYDKDKHTAMQSVVRACNSFF
                     ANAHIWLNFFNKSLFFSSLFSQASDSNTLEYKATSLRAAPHVLLSILSLVTLLQKGHT
                     PEGQQLALLFQREAQSILNYCISAGSQDPSLVAAAIVIATFEMQPHVEHTTDRLVAAV
                     LMLDGIGLSVFSSRLDADDVRVSTSITGLPRLTHSNVLATTAREREVQLEPSITKWAQ
                     VPAWANHWSAGDIWKEEMRRMLWAASSISATLSLWLFMVGKSSYNLEISHPERFRLFF
                     PGEMAVIEAGDGEQGKTTPWALYHRLISLWHFIVNNQPLNGVCKLDVVRELQAVEDDI
                     QIFIDAGVLKIYIWQSADWAMFIRRVLGVMDSQALRRWFRNEITFFKALAGDRPGVPG
                     VRQRPLYAWWYVMQVSSALELSRMRKEFWEDSDLIYNMTLAGLDQVIKYWNCQNVLGP
                     YFVYLQHKYRTVLEERQRLLHAEAQGRVQDLYLEQLKILRAEAEGQFAKIQNISEYRN
                     SKLYY"
     gene            831531..833123
                     /locus_tag="CNA03150"
                     /db_xref="GeneID:3253388"
     mRNA            join(831531..831586,831675..831881,831935..832193,
                     832246..832800,832857..833123)
                     /locus_tag="CNA03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656227.1"
                     /db_xref="GeneID:3253388"
     CDS             join(831759..831881,831935..832193,832246..832800,
                     832857..832933)
                     /locus_tag="CNA03150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511908.1"
                     /db_xref="GeneID:3253388"
                     /translation="MRLPLDIYLDDTRSSATPSLYSPSDSEEERNSAVLTSRSQRLPT
                     SKQRRASNVSRKRRREKSSSEDVFAVEHILARSLSKWRNPESNKYEYRYLVRWENYQP
                     KDDTWEGRSGLMEGSKQLLEEFENRGYQPFTILASKSAASKPTMYLVRYGVVSDSILP
                     SPLYEKVWHSASQINRVGGVPKAVVKNAIDKYEETERLEEGKGLARGGSPRTLQLQKD
                     RCILDILERKEEGDEDPPTVIFHVRWRDKWKLKEEWMNYERIVFTFEEDGKQFLMKWE
                     EKRGYVKPTKVTTVRLVEKPDNMKRPATSSHAKERQPMTEYELERLKNIEANKELMRQ
                     LGL"
     gene            833732..836275
                     /locus_tag="CNA03160"
                     /db_xref="GeneID:3253387"
     mRNA            join(833732..833774,833825..833885,833946..833998,
                     834056..834068,834124..834189,834244..834347,
                     834402..834571,834621..835831,835881..836275)
                     /locus_tag="CNA03160"
                     /product="heat shock protein sks2 (heat shock cognate
                     protein hsc1), putative"
                     /transcript_id="XM_566757.1"
                     /db_xref="GeneID:3253387"
     CDS             join(833846..833885,833946..833998,834056..834068,
                     834124..834189,834244..834347,834402..834571,
                     834621..835831,835881..836068)
                     /locus_tag="CNA03160"
                     /codon_start=1
                     /product="heat shock protein sks2 (heat shock cognate
                     protein hsc1), putative"
                     /protein_id="XP_566757.1"
                     /db_xref="GeneID:3253387"
                     /translation="MSAEDVFEGAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPS
                     YVAFTEGERLIGDAAKNQSAMNPLNTIFDAKRLIGRRYDDADVKKDMKHWPFSVIDKD
                     GSPYVEVDYLNEKKTFSPQEISAMVLTKMKEIAEAKIGKTVKKAVVTVPAYFNDSQRL
                     ATKDAGAIAGLEVLRIINEPTAAAIAYGLDEKTEEERNVLIFDLGGGTFDVSLLTIQG
                     KVFSVKATAGDTHLGGEDFDNNLLEHFKAEFKRKTKLDISDDARALRRLRSACERAKR
                     TLSSVTQTTVEVDSLYQGNDFSSNITRARFEEINAVAFKSTVDPVEKVLKDSKIPAAK
                     VDDIVLVGGSTRIPKIQSLVSEYFGGRQLNKSINPDEAVAYGAAVQAAVLTGQTSDKT
                     ADLLLLDVAPLSLGVAMQGDVFGVVLPRNTPIPSNKSRVFTTVEDNQTTVMFPVYEGE
                     RTQCKDNRLLGEFELSGIPPMPRGQAELVCTFEVDANGLLKVSAQDRASGRKAQITIQ
                     NSVGRLSSEEIQAMIKDAEQFKNADKDFSARHEAKSDLEAYLHTCEQSISAPELSMKI
                     KRGARAAVESEIAKALEKLEQEDATADELKKAQLGVKRAMQKAMASAR"
     STS             836265..837044
                     /standard_name="Pst12"
                     /db_xref="UniSTS:470888"
     gene            complement(836319..838137)
                     /locus_tag="CNA03170"
                     /db_xref="GeneID:3253386"
     mRNA            complement(join(836319..836601,836663..837207,
                     837281..837454,837522..837899,837976..838137))
                     /locus_tag="CNA03170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566758.1"
                     /db_xref="GeneID:3253386"
     CDS             complement(join(836427..836601,836663..837207,
                     837281..837454,837522..837827))
                     /locus_tag="CNA03170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566758.1"
                     /db_xref="GeneID:3253386"
                     /translation="MSDLPLPQFYAHSLVPLAPIFDDTLSLSSPEAQSTLSIALDKLY
                     LIQRMLTSLGAFSENESVSEASNGQLLFMSIGWAIGSCEEKRNPGSMPERREALLKAE
                     YAFQAFVELLSSYGILSSQEASEYSVGNRAGLPNDPAKRREAKINQYKKEKELREKIN
                     AAISRRKQVSASTPVSFLISLLPEPPAEASTVQSTQARDVNEDDMAEESRETIINVLR
                     LLYSLALSSMASMKMELDILSSAPPVDPSQGIPHTDLRQGGRGENDDTWRLDQLPTSL
                     ARSSDLISSKGKVLRPFTILPSDTGVAQREKLKAGVFKQSWRLPTMTIDEYLDIERQR
                     GNVITGGGQASYDKPTDSELLELDSEMDGTLHAEQQAEHKREKDEKWAQYTDDNPKGY
                     GNTTNKG"
     STS             839311..840879
                     /standard_name="ha2998"
                     /db_xref="UniSTS:515619"
     gene            839316..842782
                     /locus_tag="CNA03180"
                     /db_xref="GeneID:3253385"
     mRNA            join(839316..839735,839935..840717,840781..841817,
                     841876..842083,842152..842782)
                     /locus_tag="CNA03180"
                     /product="expressed protein"
                     /transcript_id="XM_566759.2"
                     /db_xref="GeneID:3253385"
     CDS             join(839562..839735,839935..840717,840781..841817,
                     841876..842083,842152..842439)
                     /locus_tag="CNA03180"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566759.1"
                     /db_xref="GeneID:3253385"
                     /translation="MTGNCSVPAYSDGPLPNVTDGNHEVLRSMSIGKRKLGLENGTEG
                     RMDPDEHGNRGLSEPPSSHTQSTNATMSPHPVLTASSALSMSRGSPYSSTTTTASETR
                     GQHPLAQPPLNANGSNSPSPLPLDFTPIPLAQITNLRKSLSRRRSSYPPATTPGALDS
                     LFSWSASGTPKADLSSLLDSLPGLGEGVDGNKGTGWTPGSNAWEQFIDPSSDIVESTD
                     VLTSMDSQTLRKLQLSASRVVNAPPAAPQSDEAKGNSAPAAPQLSNVLRPPPPTPGKR
                     NIQQSHESEWRSALASVIQIDGVGDVPVLKILQEVWKRGGGDSVTALCLWPSIIVALA
                     IPADSGPDFRVPNPSAQSAMSLQQLYNLTIRHWEPAIFSGLLGHFASGNMPSPAALPA
                     DRAFQSQHYGPSTPMRDTDLSQWINLTPGAWSAQHDPFIGSTGQSNLFKPQAPEDAGF
                     PFPLTSGLKAGEKAEDVGRKSLANGVAEEDQMGQSIAEILARMEEEQDGDGPVSVAED
                     EIQTHSQPSRMSFTELGSQRLNPVDQSFHLPTPETTSSESPNNHNAHNNKIAFSPPTS
                     MSSPFVSAGSTGSVVPTNNESGPGPTKCSAHVKTRPTQVPIPPVDFIPPPPMCMFFNP
                     SFENLQDGKSGVWRGDLEVRGRGGGKFSVLVIGESGMDHLWQSHLWPQSLSYPLKPNN
                     SDECYTSSMIPVSHLAREGLVPITMGMVLCNEPADRIDPYVKMVHGLHAEGVAFHLPC
                     ENPRLPVVFLPTKFHANDPLLRLGVAFMGKAGLPYPSAPLSAPRARRHTYDLGATSRE
                     EPKNKKRRQSASTGIKPKSGSRRNSKEKEGQ"
     gene            842925..844003
                     /locus_tag="CNA03190"
                     /db_xref="GeneID:3253754"
     mRNA            join(842925..842947,842993..843130,843181..843358,
                     843413..844003)
                     /locus_tag="CNA03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_567237.2"
                     /db_xref="GeneID:3253754"
     CDS             join(842930..842947,842993..843130,843181..843358,
                     843413..843963)
                     /locus_tag="CNA03190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567237.1"
                     /db_xref="GeneID:3253754"
                     /translation="MASPAARLLRAPRVPAAVLAASLAVSSADLAADDGAAPSSSVRP
                     GRSPSGEKLPIYPTPQHNPAITLVETHNPLVPYITQSRESVSSVLGDARNYVQSGVSK
                     WITFERSVEREVKSVLPPDEALNPGLIYVLVAGLSGSVLSRTRSLPVRFLAPPLFTLL
                     AFPYFLPKTSHNIRQYLSNLEDKHLPEFAAKHDHFVQTGIAHWGMLWGRIEDATGDAR
                     EWGHRAVEGVERTTGLRLGEAVSKVEKEKERLVEQERQRAVAVPAQKYETVGYVVEQK
                     PVAEIVAPMEPPKEKKLV"
     gene            complement(843942..845039)
                     /locus_tag="CNA03200"
                     /db_xref="GeneID:3253766"
     mRNA            complement(join(843942..844133,844186..844287,
                     844341..844598,844664..844729,844776..844802,
                     844855..845039))
                     /locus_tag="CNA03200"
                     /product="ubiquitin-dependent protein catabolism-related
                     protein, putative"
                     /transcript_id="XM_024656228.1"
                     /db_xref="GeneID:3253766"
     CDS             complement(join(844020..844133,844186..844287,
                     844341..844598,844664..844729,844776..844802,
                     844855..844998))
                     /locus_tag="CNA03200"
                     /codon_start=1
                     /product="ubiquitin-dependent protein catabolism-related
                     protein, putative"
                     /protein_id="XP_024512093.1"
                     /db_xref="GeneID:3253766"
                     /translation="MPQELVFPPPEEPSILSLPLPHAEAYPGEPREYALALIQRKDAI
                     QKEIDVLNDVLSSHGATASTSLLDNEGYPRGDLDIYAIRHARSSLVRLQNDRQTVTDL
                     LATALHDAFAISSPASEQQPNGSVSLPSSQANGYSARTRETPWPARAIAKVNTVTVNS
                     PASEAGLKAQDVIYSFAGINHTSPGGLQAIGTAVAQSEGIPLPLLIMRGQERLQLTLT
                     PRSGWGGRGSLGCHILPA"
     gene            845175..846896
                     /locus_tag="CNA03210"
                     /db_xref="GeneID:3253937"
     mRNA            join(845175..845296,845353..845616,845686..845749,
                     845806..845812,845869..846062,846131..846896)
                     /locus_tag="CNA03210"
                     /product="3'(2'),5'-bisphosphate nucleotidase, putative"
                     /transcript_id="XM_024656229.1"
                     /db_xref="GeneID:3253937"
     CDS             join(845217..845296,845353..845616,845686..845749,
                     845806..845812,845869..846062,846131..846598)
                     /locus_tag="CNA03210"
                     /codon_start=1
                     /product="3'(2'),5'-bisphosphate nucleotidase, putative"
                     /protein_id="XP_024512054.1"
                     /db_xref="GeneID:3253937"
                     /translation="MASQLPFTRLVQETQIGILSVLRACYLTKNVQDTLVTKDTLLKS
                     DKSPVTVADLSAQSLISLHLLAHFQDPIIGEEDTSELRVNEPLRQRVVGLVNGGFEKE
                     EGWGKDKTFSEDEILSAIDAGSAKGGNKGRFWTIDPVDGTSGFIRHQQYAVCLALIVD
                     GVVELGVIGCPNLGPEPAKIGEEIIPNGKGVLMVAVRGQGSWSRPLDSATYTKLNLPP
                     TPPASNPLTFLESVESGHSAHSIQARIGALLDVQRPSLRMDSQAKYTCLSRGEGGVYL
                     RIPTKYVGGKIYEERIWDHAPGALLIHESGGICTDMWGKELNFGVGRTLKENDGIVAA
                     GKDIHPKAVEAVKKAIEEAQVENK"
     gene            complement(846209..848092)
                     /locus_tag="CNA03220"
                     /db_xref="GeneID:3253384"
     mRNA            complement(join(846209..847026,847094..847647,
                     847702..847827,847885..847909,847976..848092))
                     /locus_tag="CNA03220"
                     /product="expressed protein"
                     /transcript_id="XM_024656230.1"
                     /db_xref="GeneID:3253384"
     CDS             complement(join(846664..847026,847094..847647,
                     847702..847827,847885..847909,847976..848026))
                     /locus_tag="CNA03220"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511909.1"
                     /db_xref="GeneID:3253384"
                     /translation="MDSDLRLDEIKCGSASEIMMAVRYSTSPPGPTFIPSLDDVLLEY
                     RPHDGHSSLRRGDLIELVGPSGSGKTTLLTFLLMITLLPAVLPPPLSTVVLGGKGGYA
                     QVFQPYTHRPIMLSLRRSIEAHIRSLAPEAQDDLIEDVIKESTSRLSVWRGRPRWKDL
                     ALGLKGIVVELSPYPARSERRPGALDLVAIDGFADGYYPHLWADEERGRKQHGDGANI
                     VGPDALGVRQVMEVIGQIRKDLGSVVAISVQGLRTTRETQPFYLPHLPTPYPNPFSIS
                     KSGPVSRSNPTYWPLNIQITLLGRARGLQLPGDITLIDALRSKAREKKENGEVGQNGK
                     YEGLVRLVNMDGGILGKREGAKFHFHIGENGLQVWTDP"
     gene            848246..848341
                     /locus_tag="CNA03230"
                     /db_xref="GeneID:3253960"
     tRNA            848246..848341
                     /locus_tag="CNA03230"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3253960"
     gene            complement(848588..851241)
                     /locus_tag="CNA03240"
                     /db_xref="GeneID:3253383"
     mRNA            complement(join(848588..849602,849662..850790,
                     850848..851241))
                     /locus_tag="CNA03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_566761.2"
                     /db_xref="GeneID:3253383"
     CDS             complement(join(848844..849602,849662..850790,
                     850848..851008))
                     /locus_tag="CNA03240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566761.2"
                     /db_xref="GeneID:3253383"
                     /translation="MAALGPSAPISAVPTSKFQRMLVYKAAEWYGLKAVAGPEASMVV
                     GVLGPLNEKSATLRLSDLVPAAPSPTQKFRIMQRAPAPGERPDLAASSDAQSTADGRA
                     SKWKTLEEREAAYAAAREKIYGKGGDVEESPSISKTEGEPPSRAAAALEDDIDPVPRR
                     RYPAGGQFEVVYPSLYHPPKGSHTPSPAPGMADQYQQNPYGYQQAMGYNYQMDMNGYP
                     LAGQMPSGYTQQQRQPQQGFAMQSYMDSQYNMSQQQAYTVPGWQPQAGGAYPQMTPNQ
                     QYSLMQAQQSGQWQYQQMVSQPMPMIPQGMPYPAGPAFGYPSQPLQPQLQPPQAVRPA
                     MYPSLVQPSPQRPLPQPYSSASSSISSHSYHDGSRPHSRGSTTSTKSAASSVRLGAMY
                     PAAQGPGAGYRQKGMKQQGLNGMTSLGTEDKRTRGHSPSQSSTTTTASSHSSRRTSSI
                     NVPPPSQHQLPQRPDWAANNVPYHPSPIIPNPSISDASAHQAIALGPNTAEFPPLLRS
                     STAAEPMQVERAKMRPMNGGGVWNGAAPSASMSNPLLPGQVVPSAEPRVSILPCPRAH
                     SDTQIPQCQPPQSNNDDPDFPRRAPCKTAPTLYDPSAPRLAVSQPVSQGSRPSSPGVN
                     QDDTAFAGEADRGQGLLSPEEVIEAKLAAVSLSAGVSIGPPPSKQPQTASYAKIVQRD
                     "
     gene            complement(851505..853175)
                     /locus_tag="CNA03250"
                     /db_xref="GeneID:3253382"
     mRNA            complement(join(851505..851725,851776..852240,
                     852300..852747,852844..853175))
                     /locus_tag="CNA03250"
                     /product="hst3 protein, putative"
                     /transcript_id="XM_566762.2"
                     /db_xref="GeneID:3253382"
     CDS             complement(join(851628..851725,851776..852240,
                     852300..852747,852844..853002))
                     /locus_tag="CNA03250"
                     /codon_start=1
                     /product="hst3 protein, putative"
                     /protein_id="XP_566762.1"
                     /db_xref="GeneID:3253382"
                     /translation="MPPSLALDHLLCSTDHADFSARRQLSDVSIAVAKARRIVTVSGA
                     GISCSSGIPDFRSEGGLYSLVKEKYPDAFFTGKDLFSAGTFANPQSTSIFYTFIAELF
                     HCCASAQPTRTHHFIRKLEQKGKLLRSYTQNIDGFERRMGLESGGRGKGLKKKETRNV
                     ELHGDLGRVRCVLCFSDFEACDEWVEMFREGEAPDCPACWKRCESRINRSARATSVGR
                     LRPSIVLYDEPHPLGDDIGQLTAYDVSRRPDLLLIMGTSLKVHGLKRLVKDFAKAVHG
                     GKKRGLVVFVNATPPSKEWEGIIDVHIEGETDKWVEKVEEEWRRVKPGDWEVQTTLDS
                     EVVSVVKTGKPKGKTKAATPKGKALAKRDTNRLSPPPRLKASLRSQAIAASSETS"
     gene            853475..853569
                     /locus_tag="CNA03260"
                     /db_xref="GeneID:3253961"
     tRNA            853475..853569
                     /locus_tag="CNA03260"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3253961"
     gene            853611..855354
                     /locus_tag="CNA03265"
                     /db_xref="GeneID:36392674"
     mRNA            join(853611..854111,854170..854291,854355..854462,
                     854581..854703,854761..855354)
                     /locus_tag="CNA03265"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656074.1"
                     /db_xref="GeneID:36392674"
     CDS             join(854627..854703,854761..855040)
                     /locus_tag="CNA03265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514146.1"
                     /db_xref="GeneID:36392674"
                     /translation="MSRPAFFCGMIFITPLTALSYLFTSTTASIIYIALSWDLKRRAS
                     CMAKCSGSTTFVAKNQTSPIRGFFDGIITNASRLVSGVLLLGWSHQALVQQFRQTHLH
                     KAQYPKEHVLAEELTY"
     gene            855458..855550
                     /locus_tag="CNA03270"
                     /db_xref="GeneID:3253955"
     tRNA            855458..855550
                     /locus_tag="CNA03270"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3253955"
     gene            855950..859042
                     /locus_tag="CNA03280"
                     /db_xref="GeneID:3253516"
     mRNA            join(855950..856710,856759..857382,857435..857746,
                     857798..858058,858110..858233,858291..858324,
                     858390..858538,858599..859042)
                     /locus_tag="CNA03280"
                     /product="transcriptional activator gcn5, putative"
                     /transcript_id="XM_024656231.1"
                     /db_xref="GeneID:3253516"
     CDS             join(856030..856710,856759..857382,857435..857746,
                     857798..858058,858110..858233,858291..858324,
                     858390..858538,858599..858795)
                     /locus_tag="CNA03280"
                     /codon_start=1
                     /product="transcriptional activator gcn5, putative"
                     /protein_id="XP_024511865.1"
                     /db_xref="GeneID:3253516"
                     /translation="MAPKQRRATNSKAKATPTSVTSPPDQSSPVRSRGGSSSLSPIRS
                     PQENSDLEDNNERHPGTNGSGLKAEDEGSTDLLDRDGDLEEVHACPDSITFRYPSSVP
                     DFTILSPREKAFKVARFLHCTAPSCACTGLEPPAGRTIRITKHDSSNEDEDDEDEDDD
                     VSMEDSENPLDFEDKKDEWRTKEGWWRICGKCGHGWESGGHVWADDVPPKERTRRGKV
                     VGRIEEILEDENKLVEFPTPQPESISSLLKQLHEFVPPPAGKTTISALPPPVDLSTPD
                     DDTQEDNSDGERPRKRRRQASESTHSDIEGEQHRGQGKKKQGKGPAKGAKPRVPRTVV
                     RGAHGFIPMATDPDGNQHVEGHLPISAGGTGADETFEEEEEEEEELSTAKRPELDETE
                     RRRRTEIKVKEKEREEELVSRLAAGVNPEDAGGAVEIWEGIELQKLPLRPAAIEQANR
                     EIMLPVVSSRNPTPVATILLVGLKNVFQRQLPKMPREYITRLVLDKNHISMAIVKRGY
                     RVVGGICYRPFEARGFAEIVFCAVDSSEQIKGYGSHLMNSLKDHVRKAHPTINVFLTY
                     ADNYAVGYFKKQGFTKEISYPRERWVGYIKDYEGGTIMQGRMLPKVKYMEVHQMLADQ
                     KAAIIAKIKTLTKSHIIHPGLQIFKERQPDEEIKLTKEQVPGLAESGWNPDLDDIVRQ
                     PKRNPYHVLLQHVLNDLQNEPSAWPFVKPVDSSVVADYYDVIKDPMDLSTMEYKLENN
                     HYESIEGFVADVKLMCANCRQYNGEKSTYTKQANLLEKALDRILKKRKSVLAD"
     gene            complement(859293..861534)
                     /locus_tag="CNA03290"
                     /db_xref="GeneID:3253514"
     mRNA            complement(join(859293..860196,860247..860442,
                     860494..861123,861176..861219,861256..861534))
                     /locus_tag="CNA03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656232.1"
                     /db_xref="GeneID:3253514"
     CDS             complement(join(859417..860196,860247..860442,
                     860494..861123,861176..861219,861256..861354))
                     /locus_tag="CNA03290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511867.1"
                     /db_xref="GeneID:3253514"
                     /translation="MSVSPHKSGTFSPVSEGVEAYVLLTIDHANVKQVFEGEEMDLAK
                     GQLSVQCVSLPIPPEIGHQTANPFAPSPSDPPVPTQDFWLVLHVGATFELVATPGQMF
                     KPYVQGDKITYEMTSKDIPGASLLFSTPYPTSGSDLESLQSLESLLHQYGCLAPETTA
                     LSGISTARNTGQPSQTAPDELRGKLVLVNEDNGEIIGEMDQQLELQEDSKIAQESKLN
                     PVVLDFEQFREGQEALRVKVKTIPEKDLDDWLLRGANSLSHGILSFGEWTSRQMLSGA
                     DLYIKNTTPRTEPVQFGPQTKEGFLKVHSASVKTATVTKSTLNRLHGVIQGAVEKTYT
                     HGFQPAKDAYQRYNRSTPPLPPRPSQNSMDKPNIPPSRPIGDSKATDLTSSLPPDAPG
                     ALSEGKAIDYPSHSQSLIAEKETLNPPSYETSQQKEAQQQSTSMVAAGDQPKKKQGLL
                     SRVVLASEVVLTSLEATAHDVLNSGTVAASSAAGHKFGKDAGELTALIGGSVKNVAVV
                     YIDVAGTGRKAILKSTAKGIIKTRLQSGETVELQAEGQGNGMKAGEAESKNGDIVVGM
                     AELGTQTSGTLTPSKK"
     gene            complement(862472..864877)
                     /locus_tag="CNA03300"
                     /db_xref="GeneID:3253512"
     mRNA            complement(join(862472..862916,862986..863234,
                     863283..863412,863462..863684,863747..864005,
                     864048..864217,864278..864877))
                     /locus_tag="CNA03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_566653.1"
                     /db_xref="GeneID:3253512"
     CDS             complement(join(862592..862916,862986..863234,
                     863283..863412,863462..863684,863747..864005,
                     864048..864217,864278..864502))
                     /locus_tag="CNA03300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566653.1"
                     /db_xref="GeneID:3253512"
                     /translation="MWTNVLSVFIFATFFARSTRALSSWYTEPGGTPTGSVDGDKVRG
                     VNLGGWFILENWMMPSFFEESIVRDTYLNDEWSFCLVLGQDECLARLQQHWDTYITED
                     DFKRFANYSLNTVRIPMGYWAWTTPEDYEPYIQGQLPYLERALNWSSWYGLDVMMDLH
                     GLPGGANGQDNQGYKGPIEFQLNSTNMDRAMEALANMTQYVTAEKFDGVVKAIELTNE
                     PYILEYSSRGMDFYTLADFYVKGYQVVRANENIIDGANEVMVVIHDAFQPLLNWKYFW
                     GEESLGLNWTNYALDTHIYDAFGGADQKSYQEHLDTICALSASIAEAQQYFPVIVGEF
                     ALGVNTYCVDYQSCWGLTMDEVIANFTSTYEASLFLRQFWEVQSDVYELGAGWIFWSV
                     HHELAGPWSWTQSAAQNWIPMDPSEKIWPFDSDASSYCLDTFNPLEGDQNLPYFPLYA
                     NNYTNIDISSVKPVRLNVNPASNSTVASATSSSTTSSSQSSTASPSSSSSESGSFYTA
                     PLPSSLVLLLMVVAVSHL"
     gene            865129..867534
                     /locus_tag="CNA03310"
                     /db_xref="GeneID:3253259"
     mRNA            join(865129..865608,865657..865941,865988..866380,
                     866430..867166,867225..867534)
                     /locus_tag="CNA03310"
                     /product="protein-nucleus import-related protein,
                     putative"
                     /transcript_id="XM_566655.2"
                     /db_xref="GeneID:3253259"
     CDS             join(865170..865608,865657..865941,865988..866380,
                     866430..867166,867225..867500)
                     /locus_tag="CNA03310"
                     /codon_start=1
                     /product="protein-nucleus import-related protein,
                     putative"
                     /protein_id="XP_566655.1"
                     /db_xref="GeneID:3253259"
                     /translation="MSSRTRGKRAAVASPQASISAIEPTPRTRRVRRGQPDLEEYEEL
                     AHSNVEDDGGEEDAEGEDAEDAEEDDDEEFMTVPEPPKRSRGRPKGSTNKRKAPVEDG
                     DTDLDQGDEDDETRSKRRGRESVSYKEIPIDDKMDGDEDEASTPAAVTTPRRRGRPPK
                     RPVDDDDDDDKNDSSYKKEKIPGGSGRGGFSVKGAAAAAARARWEKVRRERAERGEDD
                     TPKSARRSTGTKKHAVGPPADYKMGATVSIKNEEYTVGDDELIIPDDPKGDTKIDAAG
                     RLLGDREYKLVTFTSVERRNPERIYALTIDAARACGYSDSLAFLRRYPTVLKLSCTAG
                     ERVKLIDLGRISGNLKHRQVTMVAMRNVFKVMGAKVIKNGRHVVDDYYEDEAAAKCAE
                     NGIEPGSIVQDEEYVPSANVNSERALRSAPGESSRSLAHLSTFYTVGGPTTHFAGNGV
                     DPWTDSGWGNKRSRLRTAGVTEEDWMLRTAEEARAVDEQLRKYREERLKLLEGVDAMR
                     GWVFAAENATEGMMGKSEPTGETADVFRAPVPMESKKSGLSHEVTMEDVEDGEQSTSA
                     EEALENEDADVHQAAVEDKEAVIIEEPGKLTSKYNWGLGKSWQPGAVRAAYEPHTNMP
                     HIPLFTQPTIAFLAQASPYPVLSSSTGTQHLHFVQSTITGSAARGLASVEYVLETDED
                     SQTQQRLTMVEEAEKWERRMRAKKHVA"
     gene            complement(867496..868808)
                     /locus_tag="CNA03320"
                     /db_xref="GeneID:3254018"
     mRNA            complement(join(867496..867820,867886..868041,
                     868092..868321,868369..868406,868470..868808))
                     /locus_tag="CNA03320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656233.1"
                     /db_xref="GeneID:3254018"
     CDS             complement(join(867564..867820,867886..868041,
                     868092..868321,868369..868406,868470..868691))
                     /locus_tag="CNA03320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511869.1"
                     /db_xref="GeneID:3254018"
                     /translation="MLLPLVRHVSKSLTKQRCFAAWGRTISTTPEPHAYLRPLLSTTA
                     DAKLPELDKVMTLMLNRPATKNALTVQMVSEMREALATLNPADSRLLLIQSSNPSLFC
                     SGADLRERRTMSPMQVSNFLDNLRQLLAELEALPIPTVAVIDGYALGGGAELALGCDL
                     RVGGDNTKIALPETKLGIIPGAGGTQRLTRIVGMAKSKELIFTGRHVQGPEAERIGLL
                     NIYASSPSSPFEAALILARQILTSAPLALAAAKRAISSAPELSLEAGLDLERAVYNGL
                     LDTDDRQEGLKAFAEKRRADFRGR"
     gene            869013..870078
                     /locus_tag="CNA03330"
                     /db_xref="GeneID:3254022"
     mRNA            join(869013..869055,869124..869143,869221..869378,
                     869588..869679,869735..869794,869853..870078)
                     /locus_tag="CNA03330"
                     /product="ubiquitin-carboxy extension protein fusion,
                     putative"
                     /transcript_id="XM_566660.2"
                     /db_xref="GeneID:3254022"
     CDS             join(869124..869143,869221..869378,869588..869679,
                     869735..869794,869853..869912)
                     /locus_tag="CNA03330"
                     /codon_start=1
                     /product="ubiquitin-carboxy extension protein fusion,
                     putative"
                     /protein_id="XP_566660.1"
                     /db_xref="GeneID:3254022"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKQICRKCYAR
                     LPPRATNCRKRKCGHSSQIRPKKALKK"
     gene            870978..872564
                     /locus_tag="CNA03340"
                     /db_xref="GeneID:3254009"
     mRNA            join(870978..871174,871237..871258,871310..871347,
                     871399..871509,871565..871754,871813..872564)
                     /locus_tag="CNA03340"
                     /product="expressed protein"
                     /transcript_id="XM_566662.2"
                     /db_xref="GeneID:3254009"
     CDS             join(871125..871174,871237..871258,871310..871347,
                     871399..871509,871565..871754,871813..872475)
                     /locus_tag="CNA03340"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566662.1"
                     /db_xref="GeneID:3254009"
                     /translation="MAQQVEEIEQDLSHIHWSWPEAIAANPARSLATPDLAMDYFAYS
                     PFWDAKSNNNVLRTQRRIENPAYGHAEEKVELNAFMSGFEYVVAHSQPPDLFVIHRRE
                     VESSGKRDRVTGAWFILHEKIYQCPTLFDVMSTRLKNATSLISKTLSTLSENRPPANP
                     RTTTLWRSIPSVTSNQPDGTQPSSLDQAEKPDEGKKDDSLNGSSPLDGSDGKASPAGP
                     DWHLFHALQATRASLVSLETLAKTPTQTTDPREELNNIEIAMDNQFGGQNQSLSGKGP
                     NVKGGAAAVKNISVPFVPKHSAGHATSTTGLTPSIWGGSASLGVSTAAVPAREAGGSP
                     LKWPGGDKSAPIAGATLAGQTGR"
     gene            complement(872535..875803)
                     /locus_tag="CNA03350"
                     /db_xref="GeneID:3254029"
     mRNA            complement(join(872535..872921,872979..873037,
                     873085..873167,873210..873286,873334..873403,
                     873457..873681,873732..873942,874003..874229,
                     874284..874387,874433..874763,874814..874900,
                     874949..875076,875126..875196,875245..875395,
                     875456..875601,875652..875803))
                     /locus_tag="CNA03350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656234.1"
                     /db_xref="GeneID:3254029"
     CDS             complement(join(872577..872921,872979..873037,
                     873085..873167,873210..873286,873334..873403,
                     873457..873681,873732..873942,874003..874229,
                     874284..874387,874433..874763,874814..874900,
                     874949..875076,875126..875196,875245..875395,
                     875456..875601,875652..875745))
                     /locus_tag="CNA03350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511870.1"
                     /db_xref="GeneID:3254029"
                     /translation="MPSSSTQLSTGHASAAASTSAMDRLAKEFPDAESLGRHKQIQAK
                     LQLEAMEIREEIARLKAELKRDQDPGKMSVIQSEIGQLMLQINVIREKAAEAEAIVKG
                     ITSDIQRLDVAKSNLTTTIQTLERWAMLRQAHQQLSQLLPTRRYKEISQALAAVMELL
                     GPLKPLSTIPTVSHLFKSAENDRKTVQEKVAVEMDAFFKQDPNKPIDKRTISEVCLAV
                     DVLGGDFRNHIIERYLQLQLAEYRRIFRATDEAGQLDNVPRRYAWFRRVLKHHDEEDA
                     MLFPDTWQVTRLLVANFSECTRSDLANVLAKQTPAVNVLLDALQGTLDFEGGMSRKFG
                     MPFEEVISLSLRGGTSKWVISSVFDKYLSVYVDAQDRAISDMLSAYRGLKSRSSVEGA
                     IQEETDAPAPTILPSSTELFYFYGQQLEQCEKYSKGETMKKLSQVFAKWLRIYADDVL
                     LAGLKPVRKSLEGRDSLQEVKTACMVLNTAEYCLNTSLQLEERLKDKIDSKFREEISF
                     QDERQTFSSVMSTCITTILRELETACEPAFAAVLKTPWMHLENVSGRSAYVVDLVGSI
                     KQVAEAVRGRVESKKYIRNFADKAVGVVITKFTQSVIKSRPLKKIGAEQILLDVQAVK
                     ACLLDLPEPHPENSTTIYTKYVTKNTGQLETMLKVILAPDDPPEGFVQNYCLLIGDRS
                     FTNFQKILDLKGTPRTDQQRLLDIFLSVTSTNSELSDTSFLTHIDMDPPTSVDISRTV
                     ISPVGSSASLFSPTSGVAGLPGLLRSGSTDGAERSETPKAFGEFRRLVNFATRRDNIN
                     TTPH"
     gene            875867..876865
                     /locus_tag="CNA03360"
                     /db_xref="GeneID:3254013"
     mRNA            join(875867..875970,876027..876225,876278..876392,
                     876457..876559,876611..876865)
                     /locus_tag="CNA03360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566666.2"
                     /db_xref="GeneID:3254013"
     CDS             join(875907..875970,876027..876225,876278..876392,
                     876457..876559,876611..876702)
                     /locus_tag="CNA03360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566666.1"
                     /db_xref="GeneID:3254013"
                     /translation="MGAFDPAITYDRSTYIETDTGNKVSRKALIAGATNIVLGGKSII
                     QTSSILRGDLRRSAAGQHVVISVGRYCLIGEGAVIRPPGKMYKGTFTFYPLRIADFTH
                     IGPNCIVEAAQIGSCVEIGEGSIIGKFVVIKDLAVILPNTVLPEGTVVASMSVWGGNP
                     GRMIDTLPETYQETMEAKCKSYYQRFRPAH"
     gene            complement(876825..879456)
                     /locus_tag="CNA03370"
                     /db_xref="GeneID:3254012"
     mRNA            complement(join(876825..877578,877644..877994,
                     878054..878118,878177..878726,878798..878911,
                     878983..879102,879166..879456))
                     /locus_tag="CNA03370"
                     /product="expressed protein"
                     /transcript_id="XM_024656235.1"
                     /db_xref="GeneID:3254012"
     CDS             complement(join(876964..877578,877644..877994,
                     878054..878118,878177..878726,878798..878911,
                     878983..879102,879166..879357))
                     /locus_tag="CNA03370"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512055.1"
                     /db_xref="GeneID:3254012"
                     /translation="MALSRPLPPHRKRIPSITPRIAPNLTTEDNAWDSLRDKSDDQLR
                     AITRNDLVQALRGEWDLKDKMVGKIEMLENNRDKLERDIGELSRAMATLQSRFDESLN
                     EQGRMEADLVERNALLDRLRKRVSETERQIREAQKRYADQETAFEAERRAFQAQEAHL
                     RARINSLLSTPHKTAVAPAIAAQRREDGTISSLKDEIASLKLSCTTLRAKNSTLTQDI
                     QELKNLNNALQEDNEAWELFLRERTLNGDIREKDGLLNADQLQDRYERHEPEPLNEGL
                     LLESPLSRRGKIASDNGYSPLNGRNLASELGIFQEEREPGYLKKDINTEALENEIKQL
                     KDTNKALNLYCSKIIDRIIAQEGFEHILSVDYKTGPAGSRNVSAIQTPLKHNAAPFAQ
                     AFNAEMTSQASASSQDSASSKDKRGRPLSMIMARTFSGAAEKTPVVEEVLLPSPLTTS
                     VEPSRATVAKQEKRARRGFSLDFRSFGFGGVTSPGSPRPALRPLTLASRAISSTSPPL
                     QQEKGATTGRKLEPTEEDEEDKRERHRMEATLKLMGISKSADTSNVQDTMTKTPDNGK
                     SPWSRLYSTICSTEHIYVVGNSNPAAAQAALKEYDRREAVRMESLAQGKSEAVYTTPP
                     GVGIPRRRSSSREKMMMSVGSVNTLWSMGSSSRPTSMDITRNGK"
     gene            complement(879501..881786)
                     /locus_tag="CNA03380"
                     /db_xref="GeneID:3254014"
     mRNA            complement(join(879501..880170,880209..880233,
                     880285..880383,880436..880588,880640..880985,
                     881039..881109,881150..881276,881314..881340,
                     881402..881628,881685..881786))
                     /locus_tag="CNA03380"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_566668.2"
                     /db_xref="GeneID:3254014"
     CDS             complement(join(879578..880170,880209..880233,
                     880285..880383,880436..880588,880640..880985,
                     881039..881109,881150..881276,881314..881340,
                     881402..881628,881685..881750))
                     /locus_tag="CNA03380"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_566668.2"
                     /db_xref="GeneID:3254014"
                     /translation="MFWDSLFTELSDVVGAPTDQLKLIFSLLVAFPLGSIFVRLPSAH
                     PNVAHLFSIAISTVFLVPLLGLGGGMLHMLFSSLGTYAIVNGMKDKNMPWVVFAFVMG
                     HLLFNHIKRSVLGLPASTIEITGSQMVLVMKLSTFAWNVHDGKVKEEELDANQLATRL
                     IQIPSLVAFLGYCFFFPSVLVGPSFDYATYDALIHKRLYSSPPAGSSPEQAKATKRRI
                     PYGRKRVAYLHLVIGLFFLGVYALYGDKYSYENVLSPIWTGWGWTRKFGFVQLAGLLA
                     RTKYYAVWSLSEGACILTGIGFNGYDPKTGRTLWNRVRNINIKGIETAESFKILFDSW
                     NCRTNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSL
                     GRQFRRYVRPYFLPPSETAQPGPPKRVYDLIGWISVQSTLNYLVAPFLLLNFKDSIGA
                     WNRMYWYGHVAVIISICFMSFGGRKALKRGLDKRKPRITPSVKVSPPSPPVDSTPPPP
                     PEDEMDSTDLRWVKHDLDNPEYQDSGEGVAMGVAIRDHGFLDKWIQGEETPGDTPGGT
                     PKNEKDDPLRK"
     gene            881884..883674
                     /locus_tag="CNA03390"
                     /db_xref="GeneID:3254010"
     mRNA            join(881884..881966,882005..882274,882326..882427,
                     882478..882697,882764..883029,883086..883161,
                     883212..883465,883524..883674)
                     /locus_tag="CNA03390"
                     /product="O-sialoglycoprotein endopeptidase, putative"
                     /transcript_id="XM_024656236.1"
                     /db_xref="GeneID:3254010"
     CDS             join(881939..881966,882005..882274,882326..882427,
                     882478..882697,882764..883029,883086..883161,
                     883212..883350)
                     /locus_tag="CNA03390"
                     /codon_start=1
                     /product="O-sialoglycoprotein endopeptidase, putative"
                     /protein_id="XP_024511871.1"
                     /db_xref="GeneID:3254010"
                     /translation="MKQSPLHRPSRPLLALGIEGSANKLGCGIISHSPSPTGGPTLVM
                     VLSNVRHTYITPPGEGFLPSDTARHHREWVVKVIEEAVRKAGVRMGDLDCIAFTKGPG
                     MGTPLQVGALVARTLSLLHNIPLVGVNHCVGHIEMGRQITSSHNPIVLYVSGGNTQVI
                     AYSQQRYRIFGETLDIAIGNCLDRFARVIGLRNDPSPGYNIEKEAKKGKRLVQLPYGT
                     KGMDVSLAGILHSVEAYTKDKRYRSWDQVNDVEEDIITPYDLCFSLQETTFAMLVEIT
                     ERAMAHVGAKDVLIVGGVGCNLRLQEMMGIMASERGGRVFATDESFCIDNGIMIAQAG
                     LLAFRMGNTMPLEKTGVTQRYRTDAVHVAWRA"
     gene            complement(883359..889457)
                     /locus_tag="CNA03400"
                     /db_xref="GeneID:3253993"
     mRNA            complement(join(883359..883588,883656..883702,
                     883756..883998,884049..884125,884175..885371,
                     885423..885503,885555..886652,886700..886949,
                     886997..888876,888949..889457))
                     /locus_tag="CNA03400"
                     /product="two-component sensor molecule, putative"
                     /transcript_id="XM_024656237.1"
                     /db_xref="GeneID:3253993"
     CDS             complement(join(883575..883588,883656..883702,
                     883756..883998,884049..884125,884175..885371,
                     885423..885503,885555..886652,886700..886949,
                     886997..888873))
                     /locus_tag="CNA03400"
                     /codon_start=1
                     /product="two-component sensor molecule, putative"
                     /protein_id="XP_024511873.1"
                     /db_xref="GeneID:3253993"
                     /translation="MSRTPISPRPNSNPRVPPSSAAFLQHLHSDPSSHHITLSGHRVS
                     GLSLSPQSLTGEGDLLDINGTSEPSISPSLHSHLSPVSSGTSSGPSPLGSVGRAPSKR
                     ARPKTAPSRNDEWPLGRSYETSPDLPPLIPPQADEHLRSSPVGDLCTNAMTMDEGLVD
                     AMEALSTSGEPKSYLIGRSESLAGTAESHTGPSKPSPASMNWSTFAQAYAHGLFDPNR
                     VPNPPTPNETPTEFQSARSSPGQKYSSLPLNHKYSMPTVPHNRSGSSSENYSSKSSKD
                     SVSTNASSAPSTSSASASGKQMSMAASLAARKKAYELENIRSKPSGLALNTDKLSLPS
                     YSLAAATVRMASTSILNDLAPLSMPSPERELTDPLASVVSFDSSSTKKDSARSDPGSS
                     RFPLHHSVSSAANPYTSSLRLPTIQASPVTTPLEGPHRPKGKDRSPPRARHGIVNSRI
                     PSASAPLEKTAEAESSTDYFGAVAVAAVSPQETDSSSTATDPTPTGPSLELRKTTPLR
                     SNSVVPEPSPRQQKDPLPPLVTPSDLNRIYDQYGWLPAPLPPDEAARRRALYRFSILH
                     SAPDINFNRIAHMTKLVFNPKAVLITLIDSDTQWFKSQSGFTVEQGGRISSFCAHTIL
                     PRTDEPFVVLDTSSDWRFENNPNVVGPNSIRFYAGAPLRTADGFNVGALCILDDKPRT
                     EFPPRSRLILKEFAAVTMREMELWRDKLQLRVRDKIQTSMEKFTRECLEMDSASPTSD
                     AETVNKMEHVYSRAAQLVCSTIGLDGCFILDISQIEMVQTNTPTGKKSTYRANPYGAA
                     ENTSPVLERSESFGPVNPFPVLAAVPTAKSTRALTPYEHEKLSDFMQNHHDGRIFEGA
                     APQWIRYMFPQSFRYGMAVPIYGVDQQPFAMICAYTANPEKQFLEGYELQFLRAIGVI
                     ILSAVLRRRMALADKTKSILISSVSHELRTPLHGILAAAELLSDTQLDSNQLSFLKTV
                     QTCGNSLIETVNHVLDFTKLSGTQSCKGSPSDLGKVNLAALVEQTVEGCWIGQRARFF
                     MGDSDIGSFYAPPAPTSIVPKSKRALVGEELSHVETVVDIDMREKGWMVRCEKGGLRR
                     VLMNLVGNSFKFTKNGYIQVSLREMPHEPGSKTIPVEMTVVDTGKGIGKDFLKDQLFH
                     PFSQENPLQTGTGLGLAIVNTIVRSDSVNGKVDVWSAEGVGTEIKVTFDVEVVDDDDG
                     QPSISSSSSVVSATSTFGHGLSVSFVGFNPKHQGHMLSCEVFTRYVNYWYFSIEDQQR
                     ADILIVNELEELVNHPMAAQKPILLLSVQRGFESTALAEKINRGGGFCQVVYKPVGPS
                     ALQKALNAAVHWIEERDSSDKSDILGGNVTGINLEGNSYRPSISRGSSGESHESHSTI
                     SELSNARFNQQSSINSRLPLQRRRSEENEQAPRRPSMAPRGMTYHSSRKMQRSSNDSA
                     GSTPSQVPPSPTSSIPTIPLADGGVMLKAATVSAEAPRKEKMGRVMVVEDNVINRRVL
                     GAFLKKRGFEYAEAVDGQAGVELFENAPPNYWDVILMDISMPIMNGHQATRAIRRIEA
                     TRRNSLSDIPIVPPPGKPVTISSQKAVQARVKIFALTGLATPDDKREAFWSGVDGYLV
                     KPVSLSSLDIIFKKIGF"
     gene            890301..892555
                     /locus_tag="CNA03410"
                     /db_xref="GeneID:3253641"
     mRNA            join(890301..890437,890492..890522,890595..890695,
                     890744..890870,890920..891120,891174..891252,
                     891307..891466,891528..891635,891694..891873,
                     891930..892555)
                     /locus_tag="CNA03410"
                     /product="expressed protein"
                     /transcript_id="XM_567253.2"
                     /db_xref="GeneID:3253641"
     CDS             join(890408..890437,890492..890522,890595..890695,
                     890744..890870,890920..891120,891174..891252,
                     891307..891466,891528..891635,891694..891873,
                     891930..892487)
                     /locus_tag="CNA03410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567253.1"
                     /db_xref="GeneID:3253641"
                     /translation="MEDRLHSLSKGVFVIPFEPAALNEEDREDTHSSTRDTLDRLYET
                     TLQIYEDAGAEYEQEKTNEQLDDIADWLERYKATAFLQLPQRTNRLPVAILQNASSSL
                     PDRITSLDATSYTLLGRDAPDVAAALRSIAIGFTGDTLGSGRKSSQASIDEVENWWQA
                     NGKGLPLMLYIQDAQTIPASVLSEITYILALHAGLPIRLLLSVPSAAVFLSSWGHIEP
                     SSVDVSILRSGRSRRGAGGIDAIIRSSSEAPFKISDDLAEELRSNETLLGGGIAAAMK
                     TLKWLLLHHSLSSPLALLVEKTKNSEQERVMQSLLNAVKSSPVNPSIPRRDLFELNPH
                     PDMFSVLNPAPRTSILHSLSDPQDILPFFAASAPEKPSPNHHKSAKRKAVSASMDNEK
                     RRKTGELEKLKINEEDQVLELKRLQTLFELWKSAGKTVNLWDWLDSFQGEDERGSEEN
                     KEANSAQVGSEQTDKDENIDKESRNEAPKRAAQEENRLHATFIRFVEEARMLGLIRAR
                     GKGRKADEVIKSVGLV"
     gene            892786..894674
                     /locus_tag="CNA03420"
                     /db_xref="GeneID:3254027"
     mRNA            join(892786..892897,892981..893021,893092..893119,
                     893189..893268,893328..893817,893864..894024,
                     894077..894674)
                     /locus_tag="CNA03420"
                     /product="Hob1p, putative"
                     /transcript_id="XM_566674.2"
                     /db_xref="GeneID:3254027"
     CDS             join(892869..892897,892981..893021,893092..893119,
                     893189..893268,893328..893817,893864..894024,
                     894077..894549)
                     /locus_tag="CNA03420"
                     /codon_start=1
                     /product="Hob1p, putative"
                     /protein_id="XP_566674.1"
                     /db_xref="GeneID:3254027"
                     /translation="MKGFTKALQRTPHNLTTRIGLAKKSTDPEFNDYERKFAAVEAAC
                     QKMHKDSVVFRDSVSNLLASGSSFSGSLATLFSPMGAEYNLAAKHPQAETTVQNITIY
                     QTLMEEVRETLLPELELIESRIVGPCKELVEICKKIRKTISKREHKLIDYDRHNNSLN
                     KLREKKEKSLSDEKNLFKVEQDFELASGEYEHYNNLLKSELPHFLGMATRFIDPLFHS
                     FYYMQLNVYYIMMEKLQSFADGKYDLTRKDIEDIYLEQRGDAAERIEELQITKRIIST
                     AKLLQQRRSASGSSTPGRANSFASRTTSHTLGRKTSTDSYGSYSAAEKKTFSPPPPQS
                     HAVSAPPPYTAPAAGVATTGTVGKKAPPPPPPMKPKASYNNVKYATAIFDYEAQAEGD
                     LSFRAGDRIEIVEQTESAEDWWTGRLNGVTGVFPGNYTQVE"
     gene            895255..897336
                     /locus_tag="CNA03430"
                     /db_xref="GeneID:3254005"
     mRNA            join(895255..895723,895780..895827,895878..895988,
                     896036..896235,896283..896519,896572..896814,
                     896865..897069,897131..897336)
                     /locus_tag="CNA03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656238.1"
                     /db_xref="GeneID:3254005"
     CDS             join(895393..895723,895780..895827,895878..895988,
                     896036..896235,896283..896519,896572..896814,
                     896865..897011)
                     /locus_tag="CNA03430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511875.1"
                     /db_xref="GeneID:3254005"
                     /translation="MSSTSPTASFRPNQRSSQSYHPQISTSTASSTASQAFSDRAPVS
                     IARRPSRATHPPMAPPRPLTHDEALEALRAFLKERSSYDVFPVSFRLIVLDTQLKVKK
                     ALDVMLLYGVVSAPLWNTSSAQFAGMFTVQDVIHLIQYYYHTSSWEGATADVEQFRLQ
                     SIRDIEKVLHVPPPPLLYVHPLRPLYDACRYLIRTHARRLPLIDKDPQTNGEVVISVL
                     TQYRVLKFIAMNCRDITQYLTASVQELGIGTYVSPNPDPSNTNKFWPIAAATMKTTVF
                     DVVHMFSEQGISAVPIVDDQGKVLNLYETVDVITLVRNGAYTSLDLTIAQALKQRAVD
                     FAGVVTCSPKDSLSAIFSLIKIRRVHRLVVVAGQDDEQPGRLVGVISLSDIMRALIGN
                     DIPLGGAGVGAMGVDRALREEGEEGVFARSEGSKSAGTSTEGQSTE"
     gene            complement(897476..898258)
                     /locus_tag="CNA03440"
                     /pseudo
                     /db_xref="GeneID:3253931"
     gene            898792..900261
                     /locus_tag="CNA03450"
                     /db_xref="GeneID:3253580"
     mRNA            join(898792..899799,899847..900261)
                     /locus_tag="CNA03450"
                     /product="expressed protein"
                     /transcript_id="XM_566678.2"
                     /db_xref="GeneID:3253580"
     CDS             join(899033..899799,899847..900135)
                     /locus_tag="CNA03450"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566678.1"
                     /db_xref="GeneID:3253580"
                     /translation="MRFTWLLVVAVGIVLSLADSAYCHAHGSGHFPKASRQRHHLQPR
                     PLLSPEQRHDHATLLLPRSNSTAISSNATNAVEASAEPSLPTRPSTVLTAPPSPVPTP
                     LDLSISTSLSSSCMLYLASLVSSETFLYCLPFSLLLTTSTAYSSIVAKALASGNYTTL
                     NDLVAYTSSPQPSIDQCVTFMSGVMTALTSKSNCASDISKNVPVAIKTKWGVGNYQVM
                     REAESLVNEDTGVFCYIEAVASERPDDLYLWGLPGGISLPSSSRPSCTDCSASLLNTY
                     ESYLSNTTTLNSTVINAAVKRINEACGSSFVNFGKDTQASGDSSCVAVKFIAGLKGAV
                     AFASIVAWMLIVYIDLN"
     gene            900470..902538
                     /locus_tag="CNA03460"
                     /db_xref="GeneID:3253569"
     mRNA            join(900470..900844,900892..901479,901532..901634,
                     901690..902041,902089..902202,902247..902538)
                     /locus_tag="CNA03460"
                     /product="tRNA isopentenyltransferase, putative"
                     /transcript_id="XM_566680.2"
                     /db_xref="GeneID:3253569"
     CDS             join(900482..900844,900892..901479,901532..901634,
                     901690..902041,902089..902202,902247..902382)
                     /locus_tag="CNA03460"
                     /codon_start=1
                     /product="tRNA isopentenyltransferase, putative"
                     /protein_id="XP_566680.1"
                     /db_xref="GeneID:3253569"
                     /translation="MLNFIRSLQLFIRSQMTSQRPIVAVIGTTGVGKSQLAVSLAQSF
                     SLSRAPRLGMNNNENKTHPAVVLSADSMQLYTGLDVITNKVTVEEMGGIEHWGLNMVT
                     PGEDTSWEVGKWCNEANAKITTLPVDVLPIICGGTHYFIQHFLFPPPELSFVRDGEIK
                     SQAKDPMSVRWTPPGPRPPIPENLSPELLALLDTFWLTEPTWPSTSGSSVTERNPGPS
                     KSSRPTTREDEHLLALHRLLETIDPKESQRWHWRDGRKVRRSLERWWERGGTVDSVPS
                     SNGLEEPKGREARFRTLIFWVYEPMETLRPRLDRRVDKMLENGLLDEISELREIAQRI
                     YGSTDATDHTEGIFQAIGYKEFASLPLPSPNPQSHPLFPTMVDRTKVSTQQYAKSQLK
                     WIKKQFLPAVREARSLGGEVEVYVVPGGETGVPLATEILHKFLKREKVPSNLEVGHVN
                     AKELLHSLEENGIVPNTADRQSINARKICEVCSTPNNPCSVLLREWDQHTKTRAHKHN
                     ANPIKMDKAEWIARQKAMGEERKTERQRLKQESMAVGLDQKAD"
     gene            complement(901816..904105)
                     /locus_tag="CNA03470"
                     /db_xref="GeneID:3253551"
     mRNA            complement(join(901816..902409,902465..902591,
                     902656..902775,902835..903019,903080..903161,
                     903222..903279,903325..903681,903741..903839,
                     903887..904105))
                     /locus_tag="CNA03470"
                     /product="ribonuclease H, putative"
                     /transcript_id="XM_024656239.1"
                     /db_xref="GeneID:3253551"
     CDS             complement(join(902529..902591,902656..902775,
                     902835..903019,903080..903161,903222..903279,
                     903325..903681,903741..903839,903887..903888))
                     /locus_tag="CNA03470"
                     /codon_start=1
                     /product="ribonuclease H, putative"
                     /protein_id="XP_024511878.1"
                     /db_xref="GeneID:3253551"
                     /translation="MAPKPGFYAVATGRHPGVYKTWPAAEEQVKGFPSAKYKKFATEQ
                     EAKDFVTAAGDALPSQPPPIGKRKRAEMEDSKAPPVDTHFQATSPATVASPASLPPKL
                     QKIAQQGFSFTKSVPHYLVVYTDGSAKGNGQVGSRAGAGVWWGSRGEASKQNWAERVP
                     GEPQTNNRGELLAVIRAIERCPFPDIPLEIRCDSQYTISCMTIWLPKWMNNNFRNSYK
                     QEVINTDLIKHLLVLLRRRGAAGRVKFKYVPAHSGVEGNEAADRLARTGGALPFVSDE
                     SNWLDPEDEVVPCDSETNPTEVELEIDEDWLMTAEELAALEQQLV"
     gene            complement(904431..906324)
                     /locus_tag="CNA03480"
                     /db_xref="GeneID:3253909"
     mRNA            complement(join(904431..904743,904793..905203,
                     905267..905677,905743..905875,905955..906061,
                     906117..906219,906267..906324))
                     /locus_tag="CNA03480"
                     /product="D-lactaldehyde dehydrogenase, putative"
                     /transcript_id="XM_567157.2"
                     /db_xref="GeneID:3253909"
     CDS             complement(join(904648..904743,904793..905203,
                     905267..905677,905743..905875,905955..906061,
                     906117..906219,906267..906280))
                     /locus_tag="CNA03480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567157.1"
                     /db_xref="GeneID:3253909"
                     /translation="MSWFGSNKSSSNSPAGVTNFWPATSYNSGFGELTESDTAWLNAS
                     NQGFQTETNVWYSVLEDGSLLMVQVIWSYLGIFLIPATTQMTFKHYNPTTKKAVWKSV
                     HASNAKFDKQSCKSDLFEIRHSGSPTEGETYNITASLEKDVQITVEYTRPADTPGFKL
                     GSGPDGGISAFGKDRAKREGYVVHRFHPFIHSSGTLVINGQAVDAKGEGIFIHAIQGM
                     RPNLVASRWNFCFFSTAPGQDEEKLGSVRAFQMEFETTDDFGPKGAKSGRTKVNIGAI
                     YCSKTAPVPFLITGQTHAPPSDSTYPAPSQDISSATHLNPVHDSETGYSVPSGLEFKW
                     QGDRRDGQGKAGATLVIEKAGKVPGEGGLIEKVDVLAEIPYVIKKGLTAVTGTNAYIY
                     QYHNPATLEVNLDEEVIPVKGFVFNEATFISP"
     gene            complement(906477..907634)
                     /locus_tag="CNA03490"
                     /db_xref="GeneID:3253621"
     mRNA            complement(join(906477..907052,907110..907413,
                     907462..907521,907569..907634))
                     /locus_tag="CNA03490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656240.1"
                     /db_xref="GeneID:3253621"
     CDS             complement(join(906527..907052,907110..907413,
                     907462..907521,907569..907593))
                     /locus_tag="CNA03490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511880.1"
                     /db_xref="GeneID:3253621"
                     /translation="MYDGPTRGGTRGGQGDFRWSAVANDKHRENYLGHSINAPVGRWS
                     KNKDIHWYNRDISEDDTAKAARERAEEVRRIKQQEDDALAAALGYAVPKRDTDGEGTG
                     ANDIPVKKSEKDDEIARLEKEERKREKALRREQRALKRAEKEIKREEKERHRHRRSES
                     RRHHHDDEDSPRHYEREQERIRARRHHDRYDEGDKDDWRSQDRENRERDYTSDRHARD
                     HRLRQREDERRQGELPYSNDRGKERDRYRDRREERPRYHLEDDMPRRKYERSRTRSKS
                     PRRDHRSSERHVGEVLDANPMREGLERR"
     gene            907759..910394
                     /locus_tag="CNA03500"
                     /db_xref="GeneID:3253261"
     mRNA            join(907759..907926,907989..908225,908281..908403,
                     908455..908577,908633..908755,908803..908931,
                     908980..909354,909401..909523,909573..909691,
                     909747..910394)
                     /locus_tag="CNA03500"
                     /product="beta-catenin, putative"
                     /transcript_id="XM_566686.2"
                     /db_xref="GeneID:3253261"
     CDS             join(907815..907926,907989..908225,908281..908403,
                     908455..908577,908633..908755,908803..908931,
                     908980..909354,909401..909523,909573..909691,
                     909747..910175)
                     /locus_tag="CNA03500"
                     /codon_start=1
                     /product="beta-catenin, putative"
                     /protein_id="XP_566686.2"
                     /db_xref="GeneID:3253261"
                     /translation="MGSALSSCCSPRRKNAYEPLLLETEREAVADLLQYLENRSTTNF
                     FAGSPLAALTTLSFSENVDLQRSAALAFAEITEKEVREVGRDTLDPVLYLLSSHDPEV
                     QRAASAALGNLAVNAENKLLVVSLGGLEPLIRQMLSPNVEVQCNAVGCITNLATHDEN
                     KTQIAKSGALVPLTRLAKSKDMRVQRNATGALLNMTHSDENRQQLVAAGAIPVLVSLL
                     NSPDTDVQYYCTTALSNIAVDAANRKKLAQSEPKLVQSLVQLMDSQSLKVQCQAALAL
                     RNLASDSKYQLEIVKFGGLKPLLRLLHSSYLPLILSAAACVRNVSIHPANESPIIESG
                     FLQPLIELLSFDENEEVQCHAISTLRNLAASSEKNKGAIVEAGAVEKIKSLVLTVPLA
                     VQSEMTACVAVLALSDDLKPQLLEMGICEVLIPLTNSPSVEVQGNSAAALGNLSSKAA
                     EDYAPFNAVWNKPDGGLHAYLVRFLSSADITFQHIAVWTIVQLLEAEDEQLTNNIRSS
                     PILISSIRQLAKSPPPSRAGGAPRHDPNDPSAGSSEDEFEDGLTDQEGEGEIVSLARR
                     ILDLTEVGEEGDEFGERAGRNVPVGSHGQAPGQGQTSQVGSMGSEHAALRASVHRALS
                     GGGRDR"
     gene            910501..911855
                     /locus_tag="CNA03510"
                     /db_xref="GeneID:3253230"
     mRNA            join(910501..910716,910777..910811,910875..910946,
                     911001..911116,911176..911442,911497..911855)
                     /locus_tag="CNA03510"
                     /product="prostatic steroid 5-alpha-reductase type I,
                     putative"
                     /transcript_id="XM_024656241.1"
                     /db_xref="GeneID:3253230"
     CDS             join(910578..910716,910777..910811,910875..910946,
                     911001..911116,911176..911442,911497..911785)
                     /locus_tag="CNA03510"
                     /codon_start=1
                     /product="prostatic steroid 5-alpha-reductase type I,
                     putative"
                     /protein_id="XP_024511882.1"
                     /db_xref="GeneID:3253230"
                     /translation="MLPPKNFFPSLIIFHLFPLHSPVTFFGLIDAPFGRFSRKTSRLN
                     LNGNLSWAIMELVSPITFLTTIVNSSHPSLNRPSRILSGLYLAHYAHRAIISPLILSP
                     KRSPLHITVVLAAMLFNLLNGYLLAVGLAFYPPKEIGWQFVLGVAGWAIGFFGNVYHD
                     EMLNDLRRPPTKRIVMSHLPEDDASKLERYKVPRGGLFEWVSFPNYLCEWLEWTCWSF
                     AANPYPFISVPALPYLLRAPEYRNSHTVLSIISNFYWPSWLLAPSWAFVLAEVTSMLP
                     RAMRGHAWYKEKFGNKYPKSRKAAIPGIL"
     gene            complement(911823..913268)
                     /locus_tag="CNA03520"
                     /db_xref="GeneID:3253525"
     mRNA            complement(join(911823..912381,912440..913029,
                     913084..913268))
                     /locus_tag="CNA03520"
                     /product="expressed protein"
                     /transcript_id="XM_566690.2"
                     /db_xref="GeneID:3253525"
     CDS             complement(join(911855..912381,912440..913029,
                     913084..913187))
                     /locus_tag="CNA03520"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566690.1"
                     /db_xref="GeneID:3253525"
                     /translation="MDQLSAEQAQALWEAGGFLIITDLPEGSEFGIDGTFHTVRKFSG
                     IKFLPPGFHFIAWSPPPSSTTAGPSVIPIRQAFVRNFSAKERYAVHYDKDTENISLPE
                     NGTVISDDNLKTLDKELAPYPFERFEAWKSLTSHITPTILQSVIGPDGKVDGLMPVID
                     QEEDTLTRDMREKLEEIKRRSQNFGFTKSLMFVRFSLKKSWRDGAVGEEVTVYSKDKS
                     WLLGNVIDEQLDRNPTALLGHLQLSFIFFLQISSYSSLLAYQRILALLCQSSSFLISP
                     STFLSPPKRNPNAHVGEGMKIIYKELLKTLRVEIEALPDGVFDTELPEMDVFYLDQLE
                     SLRKNLASAIWGEVEEGTTWTELERQSFKSLWNALRDSAWKKWKWDIDELSHRVDEED
                     EDEEGEYAPVVIEI"
     gene            complement(913491..914413)
                     /locus_tag="CNA03523"
                     /db_xref="GeneID:36392675"
     mRNA            complement(join(913491..913810,913869..913996,
                     914069..914179,914235..914413))
                     /locus_tag="CNA03523"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656075.1"
                     /db_xref="GeneID:36392675"
     CDS             complement(join(913559..913810,913869..913996,
                     914069..914179,914235..914304))
                     /locus_tag="CNA03523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514147.1"
                     /db_xref="GeneID:36392675"
                     /translation="MSSNSPKREKLDVESPQDREARLGQLLQTITSTSNRSQESTPMN
                     PLNPLPSRPHGVPESDVISRVRAFLPQFQASNDALLAQARENPDSVDIEKGQSGQYIS
                     MDLGLGVFDAPENPKGDMGPVIATQPPASLTRQQEDVDEEADSDSDGDDDVDGTESSS
                     SESESEDEANGKVELNAKDKQESKKT"
     gene            914499..915533
                     /locus_tag="CNA03525"
                     /db_xref="GeneID:36392676"
     mRNA            join(914499..914838,914888..915133,915187..915533)
                     /locus_tag="CNA03525"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656076.1"
                     /db_xref="GeneID:36392676"
     CDS             join(914565..914838,914888..915133,915187..915515)
                     /locus_tag="CNA03525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514148.1"
                     /db_xref="GeneID:36392676"
                     /translation="MGMTRPLIRQAKSLASFTPTNLQSHLSNHPVLPLHLPSLTSAWP
                     ALTNWKLENGLQRLREKIGEGRVAEIELGKKGRSYLHKEWQQIHMPFGLFLDAFIFNL
                     IPSSSPAELPTAYLAQSDLLDSTPQLLDDVPALTHFYQGKEKSLYRRTIWIGPNGSFT
                     PFHKDPYVGIYSQIVGRKTFHLLPPDAFPYLDLSPIPRHANTSQIPVPVSRIISGVSP
                     NEDVQDLPQGTMQKCKEQLEKAFSIPGACQVNVAAGDSVLIPEGWWHAAEGVDGPGVG
                     VNAWFR"
     gene            complement(915591..916595)
                     /locus_tag="CNA03530"
                     /db_xref="GeneID:3253728"
     mRNA            complement(join(915591..915820,915933..916176,
                     916234..916339,916398..916443,916497..916595))
                     /locus_tag="CNA03530"
                     /product="succinate dehydrogenase (ubiquinone), putative"
                     /transcript_id="XM_566692.2"
                     /db_xref="GeneID:3253728"
     CDS             complement(join(915732..915820,915933..916176,
                     916234..916339,916398..916443,916497..916545))
                     /locus_tag="CNA03530"
                     /codon_start=1
                     /product="succinate dehydrogenase (ubiquinone), putative"
                     /protein_id="XP_566692.2"
                     /db_xref="GeneID:3253728"
                     /translation="MSTSILRNSLARAVHKPSILRTTPGLMLAQRRLASTESVTAAES
                     IALLNSQRQHRPTSPHLAIYQPQLTWYLSSLHRITGVAFGGALYLSAMAYLLHPLVPV
                     IDSAHLIQLVHDLPGWFKGSAKFIIALPFTFHCYNGLRHLNWDIGKALTIKGVYRTGY
                     AVLGATVLSSLYLAFFI"
     gene            complement(916766..918236)
                     /locus_tag="CNA03540"
                     /db_xref="GeneID:3253642"
     mRNA            complement(join(916766..916997,917058..918018,
                     918089..918236))
                     /locus_tag="CNA03540"
                     /product="expressed protein"
                     /transcript_id="XM_567254.2"
                     /db_xref="GeneID:3253642"
     CDS             complement(join(916790..916997,917058..917926))
                     /locus_tag="CNA03540"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567254.1"
                     /db_xref="GeneID:3253642"
                     /translation="MTSSSRPATSIARLPPEIQLQIIHMLKQISSIPELINLLCTCRF
                     ILAECESGLYERVELSSSAAASFFKGFDLEENKERCFFVRSIEDQDQSNHTTVSQPRK
                     TMLQKLELFGNVKAMRFDDAESIIATSEAVMELKRYQKSISTSEIATQDPCGPYNILF
                     PQLRRISFGPSSLPKVCRDGLSWGAILDTLGSAWPDNPSLCFHLSPNSLDTYGRIAGY
                     LETRVKSLVLHQGYPSDLILLDKPSGIHAEQVTMYLKPHQIKGTYTCWEDHHWSIVNF
                     CKKYFGERRARHFVDPNSVHSPIFTFVNISGNLDDIREDIGRQLREMELEDGLVEAVQ
                     NKMRLVGVGDVREGGCEVCGTWDT"
     gene            complement(918679..920491)
                     /locus_tag="CNA03550"
                     /db_xref="GeneID:3253716"
     mRNA            complement(join(918679..919744,919798..919889,
                     919941..920110,920162..920491))
                     /locus_tag="CNA03550"
                     /product="expressed protein"
                     /transcript_id="XM_566694.2"
                     /db_xref="GeneID:3253716"
     CDS             complement(join(918739..919744,919798..919889,
                     919941..920110,920162..920483))
                     /locus_tag="CNA03550"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566694.1"
                     /db_xref="GeneID:3253716"
                     /translation="MPKRKSNPSDHLPNPPPPLSSLDAALDLLVCDTFTRLNSVAAKF
                     EACAGVKLNDGVVKARWEEAVSRYWVIKSMDELTCGAKKMEVKEGTAEADRDGMEQNG
                     VDGNQVGERADSNGRPLPASYPGAVVTHSLTPEEEHEWRKWTPKAGDVVLVDTFEDGL
                     WPAKIIDKKIFFQGRTVPRGNHFFPVRIYNEDMPPSITVKSRLIPFHLRANPPLMAST
                     ALLSAYHHAANPTTFDMLASARETLAAHNRLHPCVIDEESKARFKAEKEAWNKQVNWV
                     MGERRVEKLRSTAEEREKRLREVARSTSTPVYESQGCADPCEEEMGSLFGCPKKRRTV
                     PRNENSVNASSDPCLTIFGPTTPTFPRTPPRSAASSVASYIRPSLSNTIRPSSPRRTP
                     TREKRRVHAFVSDLSPASRRTYTPPKILPSGDETAPPSFGSATLLSEVKAGKFDFVSP
                     LGPVKRGKLSSNPETIASSTSSTTSKPHSGRSGSLEIVREEEEEDGWTVVQRRGRRAG
                     SEPVRQTMEAEEKTSVDDMEL"
     gene            920639..925951
                     /locus_tag="CNA03560"
                     /db_xref="GeneID:3253755"
     mRNA            join(920639..920736,920773..920999,921052..921166,
                     921220..921404,921451..921511,921564..921965,
                     922015..923964,924014..924028,924087..924150,
                     924205..924346,924397..924790,924852..924961,
                     925023..925063,925120..925179,925239..925419,
                     925473..925634,925690..925951)
                     /locus_tag="CNA03560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656242.1"
                     /db_xref="GeneID:3253755"
     CDS             join(920709..920736,920773..920999,921052..921166,
                     921220..921404,921451..921511,921564..921965,
                     922015..923964,924014..924028,924087..924150,
                     924205..924346,924397..924790,924852..924961,
                     925023..925063,925120..925179,925239..925419,
                     925473..925634,925690..925914)
                     /locus_tag="CNA03560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511884.1"
                     /db_xref="GeneID:3253755"
                     /translation="MAKKKLSLKPQNRGFATTSLPKKAAPPPAPPPADSPPAPPPQAP
                     PSSSPPPADWEHEEGAEEAALQSLVDRLQDKAEKEVARIVKAIEYDSRLAASFPKLDI
                     NQAIRDTALELALEEEKAACQDTDHPPVVTFPSTTVSDSDKGLLRYFVAYHVLQNLGF
                     RQERIEQCLLQGIKEGEGWEEALEWMWLHLSEDECLQRGEYERTTEPSITENQESLVP
                     AIEPDVEPIAQPAQSSRPTRTALQATDASTEARTTAHKSLFQSQDTSDTESDSGTEDE
                     YHINEQWAKLQLELDTLRMASGEGKKGKKGKGNQVILETPEIRRLKDKIGKVEKEYMF
                     TRKNADAILKVLRNQRDVAAIAAKFKGASIQDADQTETDSPSGNTQGDSIVEEKTNLM
                     DGSSDEEGDLFGGMLDEPTTLPGTPAETSTSTHITVRSMPIPKQMSFAGTIPKNVLKA
                     ALAKQTKQVVISYVNLSGASRAARAGLEIGWQGGGRKVWKMDDIACDDMVEAENYVST
                     LALSDLEAEKTVAGVNWRTMPPSYRELWEELKVKRQEREDESRRGIWKMIKGIWDKKA
                     VEATAEKNDTSKPSTSNTPIDPPARPAKEKEDVIIQKLQDDFAKRKESSAYQTMLTQR
                     NTLPIASFRDQIISTLDTNQILVFSGETGCGKSTQLPSFILEDQLARGKPCKIVVTEP
                     RRISAISLAQRVSQELGDAPGAVGTSSSLVGYSIRLESKTSANTRLSFVTNGIALRML
                     ESGSSGSSRGTAFDEVTHIIVDEVHERSIESDFLLIVLKNLCEARKDLKVVLMSATVD
                     AEKISAFFGGCPFMSVPGRTFPVTVQYLEDAVELAGWHIDGSSPYAIRGKKFKPASQM
                     VEWNEEGAKSDSDPDDEDEETAFNPAKLSSNKYSAQTVDTINILDSRLIPYDLIVLLL
                     EKICFEAADYVPFSQATLVFMPGLAEIRKLNDMLLAHPKFGSTDFVVWPLHSSISSEG
                     QSAVFKRPPEGVRKIVISTNIAETGVTIPDITCVIDTGKQREMRYDEKRQLSRFVESY
                     VARSNAKQRRGRAGRVQEGLAFHLFTKARHDTQLPDHPIPEMLRLSLQDLALRIKILK
                     VPLGKTVESVLLQALDPPSSINIQRAIASLVEVKALTPNEEITPLGRLLSKLPMDVHL
                     GKFLLVAAMLGCLDPALTIAATLNSKSPFVTPFGFESQARAAKRSFAIGNNDFFTIAN
                     VFASWRRASDNPHFVRTFCKKNFVSHQNLQQIEELRQQLLAYLIDTSFVDATPAQRQA
                     ISQGRFSRGVRTKFVPVPPELNINGEDLKVVGAALVSGLYPKLLALDASGGMKTITNQ
                     QPVAIHPSSVNFKVHKGEFGSNYLAYFTIMHSKRLYAWETGPVDDAALALLCGDIADF
                     KVSASSFILDRKIKYSLSPKTSIAIKLIREQFYQVMSLRFRGKKLSDNQQRWFELGLK
                     CLAAGLQDEEAAKICVV"
     gene            complement(925938..926797)
                     /locus_tag="CNA03570"
                     /db_xref="GeneID:3253787"
     mRNA            complement(join(925938..926235,926295..926493,
                     926592..926797))
                     /locus_tag="CNA03570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656243.1"
                     /db_xref="GeneID:3253787"
     CDS             complement(join(926112..926235,926295..926493,
                     926592..926781))
                     /locus_tag="CNA03570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512094.1"
                     /db_xref="GeneID:3253787"
                     /translation="MSTAQRSPPSRTSTLTLTQTHTTPTDTPPQTVLHLRAGASTERR
                     VVWTEETVDNEGLGKKKSKICCIYHKPRAFDESSSDESSSDGSSSETDRRPSRGSNSH
                     RHRLKDDPNVEEEESSESDGGAGDGRARPLRKPRRHHHSHKCDHSDHAHKPNKYDVQP
                     NGTGKGKEKS"
     gene            926933..928344
                     /locus_tag="CNA03580"
                     /db_xref="GeneID:3253799"
     mRNA            join(926933..926986,927039..927288,927357..927745,
                     927804..927891,927941..928157,928216..928344)
                     /locus_tag="CNA03580"
                     /product="porphobilinogen synthase, putative"
                     /transcript_id="XM_566698.2"
                     /db_xref="GeneID:3253799"
     CDS             join(926937..926986,927039..927288,927357..927745,
                     927804..927891,927941..928157,928216..928274)
                     /locus_tag="CNA03580"
                     /codon_start=1
                     /product="porphobilinogen synthase, putative"
                     /protein_id="XP_566698.1"
                     /db_xref="GeneID:3253799"
                     /translation="MSHQRTAHFQVPPLQISSVLHGGIHHPTLRTWQANGRNLTKSML
                     IYPIFISDDPDAEQEVATLPGQKRWGINKLEAFLKPLVEKGLKSVILFGVPVTMEKDP
                     RGSAADDESTPVIQALKLLTNVFPQLMLCVDVCLCEYTSHGHCGILSSLPNPAHSNAP
                     TLDAEASAQRIAEVAVAYAKAGAHCVAPSDMMDGRIRAIKYGLMQVGLANRCALMSYS
                     AKFASGLYGPFRDAAGSAPSFGNRKCYQLPPNARSLARRAIQRDASEGADILMVKPAL
                     PYLDIISDCAQYAPDHPTACYQVSGEYAMVVAGAEKGIYDLREMAFETTESMVRAGAS
                     IILTYFTPQFLDWLDE"
     gene            complement(928342..931842)
                     /locus_tag="CNA03590"
                     /db_xref="GeneID:3253885"
     mRNA            complement(join(928342..928749,928810..928931,
                     928992..929330,929384..929582,929643..929816,
                     929874..929930,929989..930159,930210..930321,
                     930370..931842))
                     /locus_tag="CNA03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656244.1"
                     /db_xref="GeneID:3253885"
     CDS             complement(join(928453..928749,928810..928931,
                     928992..929330,929384..929582,929643..929816,
                     929874..929930,929989..930159,930210..930321,
                     930370..931715))
                     /locus_tag="CNA03590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512087.1"
                     /db_xref="GeneID:3253885"
                     /translation="MHSSSPTAPLSDINRVAVTSTKLARRTYGRRSNAHKEKRKIGAT
                     EWERSETPDVDFSDNGHGEDELHLSRSKRRNVEIGSPGNKERSRNLSNDTQPQNQAND
                     SAVHITSSLSPTPPSRSPTPPSRSTSPSPQVKGTAVFEPERLKSGWTRPRLMARARTQ
                     QYNHGSGASSESPILSSESSAPASNRYTTRNCGRPLSPSLVNRREISELFSGFSSGAS
                     SHASVKSGDLQPVPPSSGGFHATSSARAGGLRRMLTKTQSLGVSEPSTPSKQDRRDDH
                     EAGPASSRIVTAPSTPPRSALRRTQSMPSSPAEPSPQGVDIDSAFAVHPQIMQHPGSG
                     GRAKKTYGKVRTILVELSRGPEDGDQSSYDTMSQGDESQLQASYVELRQRYEVDNTIQ
                     HTSRSASLLQDMLQARAPETVSDMRSRGENRRFIDELGYLFDGISDPAANKSFQRSSA
                     MDILQNMLDEYWLSKMKICGQVDKAWDCFTGAGEDEVMESACLVFLCILFVSGSGLEY
                     VVHNDSQKSVSLLLKLIKAREGPLDLSYKPKITNSISKLRTICEKLKDNWKISRSSTR
                     YWASCVLNAICQSTMWAATGIDFEKEKALTNMLEVLKEEIKGVSDHFDLYEKGLDLQP
                     DERSLDLGYLDHCLRAILSLTEHSSTLREELLNSPQEVAQVLVDITLATTHLALTHDS
                     NRSEASWCSLHAVQILAQLGTASGQWAIAVMECEAGPICLARVILKRVDLVRNAKDAH
                     EKYLTGQRTVLEKEEGAKVTRPSINEPEISEEELLCYALALFTTSVLADKSFAFKIAH
                     TNIQSDCAGVHACLRRCRCTSALPLGLHFAHLYNQYSNSNDDPLASILKGNLALLLSK
                     IIGVSAEIEGEVIQPLFGHSRAAKLDGLIQSLRELGELQSMMQNTFRRLMPGGLSMEG
                     GDEGDGSENTDVVLETIRGVKSLL"
     gene            complement(932373..937544)
                     /locus_tag="CNA03600"
                     /db_xref="GeneID:3253862"
     mRNA            complement(join(932373..932608,932665..932781,
                     932835..933119,933169..933405,933454..933627,
                     933682..933794,933847..934378,934434..934817,
                     934867..935182,935233..935326,935390..935580,
                     935627..935853,935908..936102,936153..936235,
                     936287..936384,936438..936583,936636..936705,
                     936756..936868,936919..937137,937193..937544))
                     /locus_tag="CNA03600"
                     /product="DNA topoisomerase II, putative"
                     /transcript_id="XM_566700.2"
                     /db_xref="GeneID:3253862"
     CDS             complement(join(932507..932608,932665..932781,
                     932835..933119,933169..933405,933454..933627,
                     933682..933794,933847..934378,934434..934817,
                     934867..935182,935233..935326,935390..935580,
                     935627..935853,935908..936102,936153..936235,
                     936287..936384,936438..936583,936636..936705,
                     936756..936868,936919..937137,937193..937315))
                     /locus_tag="CNA03600"
                     /codon_start=1
                     /product="DNA topoisomerase II, putative"
                     /protein_id="XP_566700.1"
                     /db_xref="GeneID:3253862"
                     /translation="MSDSEFDDFRIDDDGSESDYYVAPSKGKKAAVPKKKAPAAKAPA
                     AKKAAPKKINKAPLASKKHPNESLSDAGSDTVCSPPKKKTKADDDDGDFGTESSAKAP
                     TSNKNASEVYQKLSQREHVLKRPDTYIGSVEAITQPMWILNPETKTMVHRPITFVPGF
                     LKIFDEILVNASDNKINDPTMDSIKVVIDREKNAISVYNNGRGIPVEMHTKEGVMIPE
                     LIFGHLLAGSNFDDDQKKLTGGRNGYGAKLANIYSHEFIVETADKVNSKKYKQIFSNN
                     MSKKGTPKITDNKKGEEWTKITFKPDLERFGMNGIDDDTNALLMKRVYDMAGTVKDVK
                     VFLNDERIKVKNFKQYVEMYLNASTTATSEAAGGAAVTKPPIIYEVANKRWEVAFALS
                     DGEFKQVSFTNSIATTKGGTHVDMIATQLANKLMDQIKKKNKAAPVKPFQIKNHMWIF
                     VNALIENPAFDSQTKENLTLKSSAFGSKCELSEEFIKKVAKTGIIDNVLNWARFKQDQ
                     ILKKTDGTKRSRISGIVKLEDANNAGGRNSKNCTLILTEGDSAKALAVSGLAVVGRDE
                     YGVFPLRGKLLNVREAGHDQIVKNVEIQHIKQILGLKHNQDYATADSLRYGHLMIMTD
                     QDHDGSHIKGLIINFLDHFYPSLLRIPNFLVEFITPIVKVWKGKKEISFYTMPQYEEW
                     KAQNNNGRGWESKYYKGLGTSTSADAKKYFSDLDKHRLAFETMQPEDRQLIDMAFNKK
                     KADDRKEWLRQFKPGTYLDHDVQSLPISDFVNKELILFSMADNIRSIPSVADGLKPGQ
                     RKVLFGCFKRNLTKEIKVAQLAGYVSEKTAYHHGEASLTSTIVGLAQNFVGSNNINLL
                     DPNGQFGTRLAGGKDAASARYIFTNLPRMTRAIFHPADDGLLNYLVEDGMSIEPDYFM
                     PTVPMVLINGADGIGTGWSTAIPNYNPVDIVENLRRMMRGEEPEKMTPWFRGFKGFIE
                     RIDQDKYKVSGIIEKINDTTLEITELPIRRWTQDFKEMLEEMTTGTDKVPQTIKDYEE
                     HHTDTTVHFRVHMTEKNLADAEKEGFDKRFKLTTSLGTGNMVCFDLNGKIKKYASPEE
                     ILEEFFHKRLEFYGHRKQHLADELNRQFERLSNQARFVHMIITKELVVSGKRRPDIVA
                     ELRSLKFKPFPKKERAKEEGENEAAEEEEDGDEGQASDYDYLLGMAIWSLTSEKVEKL
                     LAERDAKEQELIELLKLSPNNIWDRDLDNFLAEWQLALEADIADAKGSKPKAKAAAIK
                     ATQKPKKRAM"
     gene            938878..942381
                     /locus_tag="CNA03610"
                     /pseudo
                     /db_xref="GeneID:3254026"
     gene            947935..949689
                     /locus_tag="CNA03620"
                     /pseudo
                     /db_xref="GeneID:3253963"
     gene            950292..952208
                     /locus_tag="CNA03630"
                     /pseudo
                     /db_xref="GeneID:3253958"
     gene            complement(952224..958559)
                     /locus_tag="CNA03640"
                     /pseudo
                     /db_xref="GeneID:3253938"
     gene            958687..963360
                     /locus_tag="CNA03650"
                     /pseudo
                     /db_xref="GeneID:3253965"
     gene            complement(963349..968886)
                     /locus_tag="CNA03660"
                     /pseudo
                     /db_xref="GeneID:3253939"
     gene            complement(970224..972053)
                     /locus_tag="CNA03670"
                     /pseudo
                     /db_xref="GeneID:3253941"
     gene            972606..978104
                     /locus_tag="CNA03680"
                     /pseudo
                     /db_xref="GeneID:3253969"
     gene            complement(978965..986773)
                     /locus_tag="CNA03690"
                     /pseudo
                     /db_xref="GeneID:3253972"
     gene            988630..991902
                     /locus_tag="CNA03700"
                     /pseudo
                     /db_xref="GeneID:3253967"
     gene            992764..993699
                     /locus_tag="CNA03710"
                     /pseudo
                     /db_xref="GeneID:3253973"
     gene            998056..1003420
                     /locus_tag="CNA03720"
                     /db_xref="GeneID:3253992"
     mRNA            join(998056..998396,998461..998990,999043..999084,
                     999134..999243,999291..999496,999552..999842,
                     999887..1000062,1000109..1000172,1000224..1000550,
                     1000600..1000729,1000784..1001005,1001061..1001309,
                     1001357..1001440,1001501..1001615,1001663..1001736,
                     1001789..1001801,1001856..1002001,1002052..1002166,
                     1002217..1002260,1002315..1002548,1002601..1002743,
                     1002796..1002821,1002869..1003052,1003102..1003191,
                     1003235..1003420)
                     /locus_tag="CNA03720"
                     /product="asparagine-tRNA ligase, putative"
                     /transcript_id="XM_566703.2"
                     /db_xref="GeneID:3253992"
     CDS             join(998182..998396,998461..998990,999043..999084,
                     999134..999243,999291..999496,999552..999842,
                     999887..1000062,1000109..1000172,1000224..1000550,
                     1000600..1000729,1000784..1001005,1001061..1001309,
                     1001357..1001440,1001501..1001615,1001663..1001736,
                     1001789..1001801,1001856..1002001,1002052..1002166,
                     1002217..1002260,1002315..1002548,1002601..1002743,
                     1002796..1002821,1002869..1003052,1003102..1003191,
                     1003235..1003385)
                     /locus_tag="CNA03720"
                     /codon_start=1
                     /product="calcium transporting ATPase, putative"
                     /protein_id="XP_566703.1"
                     /db_xref="GeneID:3253992"
                     /translation="MPAQQQDPFDDLLGSDSPPAPPRNDIFHEGRHIDFFHQGSSTAR
                     APAAISQRGSSPDSVNQATYALDPFFDDDDEYGPAVSNSYSGYLAPHPSSALHSSQPL
                     GRSDPSLLESSMPLANAGAMPAGFSGPMDDNDVKGYQASSSTAYAAEDPFRDDEGPSA
                     YAFTAPGASSGWTQPRRSRWQMFRDDYLTDVDWSFGVNQLLRRRSKFDGVPREIALNE
                     PEENRLKGFERNSVTTGKYGPITFLPKFLLSEFSRSANLFFLFTACIQQVPNVSPTGH
                     WTTIVPLGVVIIASAFKEIKEDFKRHASDRSLNNNLAQVLVDQQFQLRPWRRLRVGDI
                     VRLEANSFIPADIVLISSSEPEGLCYVETANLDGETNLKIKQAHPSTASLTNPHSVSL
                     LRGHILSEPPNSSLYTYDGTFHLSSAHPGSAPTKIPVGPNQMLLRGAQLRNTGWVYGV
                     IVNAGHETKLMRNATEAPVKRTAVERQVNRQILYLFLLLIVLSLVSTIGSSIRTWLFD
                     KNAWYLRLGDESKNKARQFIEDILTFIILYNNLIPISLIMTMEVVKFQQASLINSDLD
                     MYYAPTDTPALCRTSSLVEELGQIAYIFSDKTGTLTRNEMEFRECTIFGTMYAQTVDD
                     NKRDQGQKTFDSLRHRAQEDSQEGHVIREFLSLLSICHTVIPEEHDGKMVYQASSPDE
                     AALVAGAEMLGYRFQTRKPKSVFIDVNGETQEWEILNVCEFNSSRKRMSTVVRGPDGT
                     IKLYTKGADTVIFERLAPKQEFSEPTLVHLEDYATEGLRTLCLAYRDISEEEYSSWSA
                     LYNNAASQMSGRAEALDKAAEVIEQNLQLLGATAVEDKLQDGVPDAIHTLQQAGIKIW
                     VLTGDRQETAINIGLSCRLISESMNLVIVNTETAVETSELLNKRLFAIKNQRLGGDTE
                     ELALIIDGKSLTYALEKDCSDVFLELAIMCKAVICCRVSPLQKALVVKLVKRSTDAPL
                     LAIGDGANDVSMIQAAHVGVGISGVEGLQAARSADIAISQFRFLRKLLLVHGSWSYQR
                     LTKLILYSFYKNITFALTLFWYSWFNDYSGQIAFEGWSMSYYNVVFTILPPLVIGIFD
                     QFVSARMLDRYPQLYHLGQQNYFFTPIRFFYWVGNAFYHSVLLFAFSVLVFYNDLLAT
                     DGKNSGLWVWGTTLYLAVLLTVLGKAALISDVWTKYTLAAIPGSFIFTMIALPLYAII
                     APLLNFSLEYTGIVPRLWADPVFYFVLLLFPIICLLRDYVWKYYRRTYHPASYHIVQE
                     IQKFSLSDYRPRQEQFQKAIKKVRATQRMRRQRGFAFSQTETNNQDQARLIRAYDTSV
                     ARPSGY"
     gene            complement(1003182..1005168)
                     /locus_tag="CNA03725"
                     /db_xref="GeneID:36392677"
     mRNA            complement(join(1003182..1003532,1003590..1003723,
                     1003783..1003882,1003935..1003980,1004033..1004118,
                     1004172..1004278,1004339..1004404,1004452..1004820,
                     1004867..1004926,1004976..1005061,1005108..1005168))
                     /locus_tag="CNA03725"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656077.1"
                     /db_xref="GeneID:36392677"
     CDS             complement(join(1003461..1003532,1003590..1003723,
                     1003783..1003882,1003935..1003980,1004033..1004118,
                     1004172..1004278,1004339..1004404,1004452..1004820,
                     1004867..1004926,1004976..1005061,1005108..1005148))
                     /locus_tag="CNA03725"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514149.1"
                     /db_xref="GeneID:36392677"
                     /translation="MPRPPTPLSALPLQRNLRTALTSAGYTTIEDIATISPDDLSTEL
                     GIDVLQAEDAIQQTRQWLSNAPPDGPPSVLPQHFQAHVQSTTAADLLSTSDLPHFSTF
                     SSSLDALIGHLCSSTDALPTRGEESNQRGSIVPGMSIEISGPPGGGKSSLALAIAMSA
                     RLSPGNLTNSVRADDQSEKGEVLLIDTEGSMTSERLFKAAQRIHGNTDTKSFLKGFYL
                     VRIFSQAQMIAFIYTLSDWLESHPKVNLVVIDTLSFHFRQPGLDLAARRKIMDLCKQT
                     INHATALRRCAVIVCNQLATKLFTAENKPASFGTSDRAVLMPQLGDWWTTNKTLRLVV
                     FRGGSGDEFRYVYASMSGSSKNIPWAAFDISKDGLPCDVPELIFQSCSQASLPS"
     gene            1005345..1006415
                     /locus_tag="CNA03730"
                     /db_xref="GeneID:3253436"
     mRNA            join(1005345..1005393,1005438..1005622,1005676..1005783,
                     1005843..1005938,1005991..1006087,1006147..1006241,
                     1006297..1006415)
                     /locus_tag="CNA03730"
                     /product="proteasome subunit beta type 3, putative"
                     /transcript_id="XM_566705.2"
                     /db_xref="GeneID:3253436"
     CDS             join(1005391..1005393,1005438..1005622,1005676..1005783,
                     1005843..1005938,1005991..1006087,1006147..1006241,
                     1006297..1006345)
                     /locus_tag="CNA03730"
                     /codon_start=1
                     /product="proteasome subunit beta type 3, putative"
                     /protein_id="XP_566705.1"
                     /db_xref="GeneID:3253436"
                     /translation="MSVMELNGGSVVAMIGKDCVAIASDLRLGNQQVGIAANFDKVFP
                     INDKLYCGLPGLATDVYTLREHLRFRVNMYRMKEEREITPKTFTHLLSSTLYEKRFGP
                     FFLEPVVAGLPTPTSLEPHPRPYISTMDTIGCITTPKDFAVAGTAADKLYGIAEGLWE
                     PDLEPEDLFETISQTLLSAVDRDALSGWGAVVNIITHDKVITRTLRARMD"
     gene            1006721..1010553
                     /locus_tag="CNA03740"
                     /db_xref="GeneID:3253434"
     mRNA            join(1006721..1006934,1006996..1007700,1007760..1009367,
                     1009421..1010250,1010303..1010553)
                     /locus_tag="CNA03740"
                     /product="eukaryotic initiation factor 4F subunit P130,
                     putative"
                     /transcript_id="XM_566707.2"
                     /db_xref="GeneID:3253434"
     CDS             join(1006773..1006934,1006996..1007700,1007760..1009367,
                     1009421..1010250,1010303..1010510)
                     /locus_tag="CNA03740"
                     /codon_start=1
                     /product="eukaryotic initiation factor 4F subunit P130,
                     putative"
                     /protein_id="XP_566707.2"
                     /db_xref="GeneID:3253434"
                     /translation="MPPQPAPARQNGVPQQPIPRPPVPQQGIPAHFPVPNQPPAQYPI
                     MAYPPQSGFYAGYNPYEQQQNFGMPPQWAPQHHPQNQFPGGYSARPVSPPSGTAPFQP
                     AQQSFIHNSPFPGGSGPNGPQTPLRPSGPALNGHQQTSSNASQTSAPSTPNFSLSGAS
                     ATFTPRRSAAIKISRPDGTEFDLKKEALKVSSTTVSPAPTSPASTPHTPATPNSELKN
                     VKVDTPKKPVFGLPVTVKIERPEEKAARLLEEAKREKIRAQEEKEENERKERLEKKAK
                     EEEEKKAKDAAEKAEQANSAGEPTNTEVNGSVEEVISGAPSSVSSPALGAGLPPKPVS
                     VVNGANALPATLNLASASPPVVSEPSSASVSALSSARPIEDIHAISYPGSLKSPNPQL
                     NVSAEPRKFRYDREFLMQFMNICKDKPESLPPLEEIGLEADGGSGFGSRGSRGGRSSQ
                     GPSSRTGSTGLGIGGVNRATMGSFSMGQFGSGSGSGSLRNSTSEQRYRASLPGRSSSQ
                     GGPGGLPSLSGLPSMGLSSSRGGESRGSQRGSKRVPQSSQPSTPAAAPIPISENAWTR
                     KRLGGDSEGTPAYIERKVKALLNKLTEEMFDPISKQILEWANKSANETDGLTLKLVIK
                     LIFEKATDEAHWSSMYAKLCRLLHDEISNDVSDTIDGQVISGRSLFRRYLLGRCQVDF
                     EAGWKAREDTAVAAAAKKDEDEAKQEKAKAEDGGEEKEADLMSDEYYAAQKAKRRGLG
                     LIQLIGELFKREIVANRVISQCLLKLLSNVNDPDEEDIESACKLLATVGAAYDRAARE
                     NLNKAFDVLNQMMKIESLPSRIKFMIMDLNDLRREGWKSRKNQSGVMTIAEIHEQNAK
                     EKTAAAAAARESLSRGGSRSGNRRDGTQPGEWQSVSSNPRSISRPTDFSNIGRNISSS
                     SVTPSFGPSSVFANRKGKAATASNAPSPTSRPSSANMFSALHEAQESESPAERRTSTD
                     EGEAPQRKKLNLAPRTKPLASEDDAREEGEEARSEEEAAGPELSEGDIKSKIDLDMKE
                     LWGDKDQGGSRNPADVAEYFSSLPESRRPLLAARLLDDLFRISKLKDAEVVAKGWKVS
                     LEQQAVSSEVLKQALEARMPTLDDEAIDFPNAYDAVALLTRSLSLSDDDVSALGDKIE
                     VDGTPRVTPKQKLEKALAKLNEQA"
     gene            1010713..1013279
                     /locus_tag="CNA03750"
                     /db_xref="GeneID:3253896"
     mRNA            join(1010713..1010813,1010878..1010969,1011008..1011126,
                     1011164..1011205,1011260..1013279)
                     /locus_tag="CNA03750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567158.2"
                     /db_xref="GeneID:3253896"
     CDS             join(1010773..1010813,1010878..1010969,1011008..1011126,
                     1011164..1011205,1011260..1013194)
                     /locus_tag="CNA03750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567158.1"
                     /db_xref="GeneID:3253896"
                     /translation="MFASNNDPSSPDTRMIAFQTLLDGSETALEKSVDIELLRKLCAT
                     GIPSHPPHLRPLAYSLLLELLPLDKHQWKGTMRAQRRRYYNLMQTFMRELEAQPNSSS
                     SGTDNILNGISGDIKNLKSPFWHRPVSYRPSSPLRPVNSKVIRRSEGSNKEQEIEESF
                     SDSEEEFEEPILNRRAVFERLEVLSAARHATSVQKGPLNNITVQSPVSSVESTVLSPQ
                     ITLSFDPTPMPSPSGITRSPKLIQSAPQPMIDEQAPSSITLLSPRPLQSTIDSPAAPV
                     KGALLHPDSNREALIRLLYVFCQSNPQWRYRSSFVDIGAALYLIYAGGTKSDLDYVEE
                     QTFWALSALAGDTSELLSDEGMDSALDRFERRLHWVNPALSKILRDRNVEPVLYAQRW
                     LSSFFTLDVPPTRIPLLFDIIVSARLSSPEEQPKVDLIMDIGVAMVSLLKDEIVYPNH
                     LKVSHGMWDNAVEEDEDSSDAMVRVLTLLRSYPLERAGDLPAVLEEASDLQETRLLSL
                     QRGIDPDQIPLPPRKPVSVKNLRDQAATNSSWGKAVGSLWSSISATSISAVKSAPAPL
                     SSTLDSSSGRSPVTDRRRSDSVTSSVSAIQERFASLSKHFSPTSSPKQSEDEPVNLPR
                     PLLLSGSTRSVSRSYRGDSTPSSSPRASPSMDKSLSPSNEFRSPPNRSLPSRQSPGGL
                     YKIGNNYRNRHPLRTAPTLAQRIHAGADHLWRSESAIDEKEMRKVDDNAHDDESSGWR
                     SV"
     gene            complement(1013335..>1016158)
                     /locus_tag="CNA03760"
                     /db_xref="GeneID:3253432"
     mRNA            complement(join(1013335..1013665,1013706..1014011,
                     1014057..1014741,1014795..1014874,1014914..1015986,
                     1016026..>1016158))
                     /locus_tag="CNA03760"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase,
                     putative"
                     /transcript_id="XM_566709.2"
                     /db_xref="GeneID:3253432"
     CDS             complement(join(1013414..1013665,1013706..1014011,
                     1014057..1014741,1014795..1014874,1014914..1015986,
                     1016026..1016158))
                     /locus_tag="CNA03760"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase,
                     putative"
                     /protein_id="XP_566709.1"
                     /db_xref="GeneID:3253432"
                     /translation="MSTASLPDTQRSLPHPPPDPAAPQLTAHWTRHDEGDGEVDVLRI
                     KSSSPRINPFHLLSHPDSLSSLPPLPPSLQTIAAGPGNSDTRQPPVHITKVSANEVEL
                     KSHSPEPSNYRNIIGKVSGVFKRNSHNSDADFAPSPVIMQGPPPSPPLSEGGLDESVI
                     MSDNTDETPVYHSAAAPVSENGPTIATGFTSEPSEMSPTVLAPPIPFSTRRVSSSSTS
                     SRAGSLTLVRSGRLAPQRDGESPGKGKDLPLLPHESDPNLERRDSAGSLLAPTPQLYR
                     RSTVGSSNFPSAPRSPLTNAHTAFTSPSSTPPPSGPPSAKGDLLDSAILAQEEHIRRE
                     RIERLERRQKKASTTSDSDPEPKIEEKPKEKPREKEKEETKVLVGNLIGEDHVNYVLM
                     YNMLTGIRIGVSRCQAKIKRPISDDDYTARHKFSFDIVGNELTPSAKYDFKFKDYAPW
                     VFRELRDEHFHLDPADYLLSLTAKYILSELGSPGKSGSFFYFSRDYRFIIKTIAHSEH
                     KFLRSILKDYHQHVKENPHTLLSRFYGLHRVKLPRGPKIHFVIMNNLFPPHRDIHETY
                     DLKGSSFGREYPEERAAQNPRATLKDKNWVNRGRTLEFGPEKRALLTEQLRRDMEFLK
                     RIKVMDYSLLVGIHNMERGNRDNLRKNQLSVFHPEVTTTKRKPSTKQGPSEASNVRKV
                     VRRSDPKSLDVTSQLPSEDSADRRHFIFYQDEGGFRATNEANQPLDTIYYLGVIDICT
                     PYSSLKKIEHFWKSMTEDRHTISCVDPVFYGQRFYNFLRSVMRGGDKSLRPVGLEQVE
                     PSEKPEVGQDMDNSEMPIGGASDTQDTTVQDGPQPSIVGHLKTD"
     gene            1016373..1018527
                     /locus_tag="CNA03770"
                     /db_xref="GeneID:3253430"
     mRNA            join(1016373..1016895,1016963..1017106,1017146..1017772,
                     1017832..1018007,1018079..1018527)
                     /locus_tag="CNA03770"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_024656245.1"
                     /db_xref="GeneID:3253430"
     CDS             join(1016379..1016895,1016963..1017106,1017146..1017612)
                     /locus_tag="CNA03770"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_024511889.1"
                     /db_xref="GeneID:3253430"
                     /translation="MAAPRIAHLAHKSVLELSGPDAQKFLKGLSCKDVEYLAGGYSGF
                     LNASGRVLHTAFVFPRSKNSYLITHESPEDHPAPLTSLLPPFKLRSKVRIKDVTSQWD
                     AWSAWGSDLQGGPSPIRTWKMGSGGASESHWDWEGGVRDLGLRDDEVGCWDLRAGWPH
                     MGRQLLIPKGEKPSLATSHDLGNMDDYELHRMLLGVPEGPTEILPGHALPLESCMDIH
                     GGVDFRKGCFLGQELTVRTYHTGATRKRILPVRLIPLDQTSSSSISDLLSSSPQQSLD
                     EVSTPLDITYHPPSSSATRKPRSAGKILSLHNAVGLALVRLEMAERCWWSGDILRSSV
                     SQWLDSGAGRLTTQVNGKEWGVYVGQGEAYAAALEHMSSSS"
     gene            complement(1017581..1019117)
                     /locus_tag="CNA03780"
                     /db_xref="GeneID:3253428"
     mRNA            complement(join(1017581..1017878,1017937..1018062,
                     1018116..1018297,1018368..1018474,1018548..1018620,
                     1018662..1018715,1018773..1018978,1019030..1019117))
                     /locus_tag="CNA03780"
                     /product="protein monoubiquitination-related protein,
                     putative"
                     /transcript_id="XM_024656246.1"
                     /db_xref="GeneID:3253428"
     CDS             complement(join(1017607..1017878,1017937..1018062,
                     1018116..1018297,1018368..1018474,1018548..1018620,
                     1018662..1018715,1018773..1018978,1019030..1019056))
                     /locus_tag="CNA03780"
                     /codon_start=1
                     /product="protein monoubiquitination-related protein,
                     putative"
                     /protein_id="XP_024511891.1"
                     /db_xref="GeneID:3253428"
                     /translation="MPDIKLKNQPFDVAFHPKEPVVFSSLLTGQVCAWSYDDATGETS
                     SSWSVRPSKRTARALSIEENGDEIWMGGKSGSLFQLSTRDGSMTRERDSAHECPINRV
                     YCVNRNLVATGDDDGVIKLWDPRQADSIRTYSQHFDYISDFTYFDDKRQLVATSGDGH
                     LSVIDIRSNKSTPLTVSEDQEDELLSIVPIKGGQKAIVGSGLGILSVWNRQMGWADSV
                     DRIPGHPASIDAIVALTPDIIATGSEDGMIRVIQVLPHKFLGVVATHEEFPVERIRLD
                     RNNKWLGSVSHDECLKLTDVEDLFEDSDEDDEMEEDEPDSDEEKSKKKKKDNGMKDMS
                     RGQAENDGSFFADL"
     gene            1019261..1022157
                     /locus_tag="CNA03790"
                     /db_xref="GeneID:3253426"
     mRNA            join(1019261..1019659,1019697..1019977,1020017..1022157)
                     /locus_tag="CNA03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_566715.2"
                     /db_xref="GeneID:3253426"
     CDS             join(1019314..1019659,1019697..1019977,1020017..1021747)
                     /locus_tag="CNA03790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566715.1"
                     /db_xref="GeneID:3253426"
                     /translation="MDALRVARVDNVTIQYFLPPTAPDQKPTPCTQIGQLHLTPHHLI
                     FSHTPSTAYEPEIWIPYPLITRLTRLPQTINGLYPLQVETKTFESYVLHFTKDRDGGA
                     EEVWQSVKDCSVKSSVEQLYAFFYVPPSPGTGWTVFNHRTEFARQGLGTRTKAWRFTD
                     INKDYSFSPTYPSKLVVPSRISDSTLMYAGKYRSKARIPALTYLHWANNASITRSSQP
                     MVGIKNSRSSQDERLVECIFSSHLFLDNAYSSAPVFGATSTNLIIDARPTTNAMANVA
                     MGAGTENMENYKLGKKAYLGIDNIHVMRNSLKMVVEAIREANLKPSVPLNRALLRKSN
                     WLRHISTILDGALIIVRNIHLNASHVLIHCSDGWDRTGQLSAVAQICLDPYYRTFDGF
                     KVLVEKDWLAFGHKFLDRSGHLSSEKYFMVTENDDETEEEGVSAQRAAQAFFASVQKQ
                     FTSTSHLKEISPVFHQFLDCVRQIQRQFPERFEFNEQYLLDIYRHLYTCQFGTFLFNN
                     ERERQGNTSPSRKSFVEQTSSVWDYLDSPSEREKHINSLYDASLDSNQSRDAGADQGV
                     LFYDPKDVRFWFRLFGRGDEEMNGSALTLNQPQGVDIIGPIGGDQVEDMAAGEILRGA
                     SPVSAPSTHAAPSQSRPWNWSQLSGNALNAVHSAAREIKSISQDALSQIRAEANELDK
                     ESWQQEGKGKNSEPTPLTESVSLPEANPWSAEARPSPFTPPPRPNSQVSRTTQNPWAA
                     MPDTVTSLSHLTLDSKAPDSPANDAGAKERAEEKQQKAWDPLGAL"
     gene            complement(1021736..1022975)
                     /locus_tag="CNA03795"
                     /db_xref="GeneID:36392678"
     mRNA            complement(join(1021736..1022167,1022229..1022298,
                     1022348..1022553,1022592..1022661,1022718..1022975))
                     /locus_tag="CNA03795"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656078.1"
                     /db_xref="GeneID:36392678"
     CDS             complement(join(1021773..1022167,1022229..1022298,
                     1022348..1022553,1022592..1022661,1022718..1022924))
                     /locus_tag="CNA03795"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514150.1"
                     /db_xref="GeneID:36392678"
                     /translation="MTSAANSSNYFAVARNDDQQAIHSQEAASSAPDEHEQLDTTSIR
                     ALRIAAAVERSKTEYKPEHAYTERLWLQPGSYKSQRPTTNSQLDRQRLEYMASSLYFA
                     DPPDYHGALELVLLKFDASPKAKSLGGLSRELLDIGLKSAVKCGDKSSAKSLADSSKS
                     IWKGQFAGIAASAADAYMSAGLYQDAVKPLLISMSVFGIHYPIAYRLSKALKAIQEER
                     EEHLTATSYFQQLVDRAVEWRKPAFQRPIFSDDEGVTRGQGVRSDHDELAGQALDTRA
                     VALELYLDAEGEKALEGSWKRLSKGLDVDVQPEVSVREL"
     gene            1023080..1025108
                     /locus_tag="CNA03800"
                     /db_xref="GeneID:3253424"
     mRNA            join(1023080..1023786,1023824..1024138,1024192..1024335,
                     1024416..1024591,1024661..1024801,1024904..1025108)
                     /locus_tag="CNA03800"
                     /product="conjugation with cellular fusion-related
                     protein, putative"
                     /transcript_id="XM_024656247.1"
                     /db_xref="GeneID:3253424"
     CDS             join(1023102..1023786,1023824..1024138,1024192..1024335,
                     1024416..1024591,1024661..1024738)
                     /locus_tag="CNA03800"
                     /codon_start=1
                     /product="conjugation with cellular fusion-related
                     protein, putative"
                     /protein_id="XP_024511892.1"
                     /db_xref="GeneID:3253424"
                     /translation="MAHPGALSRNTPEASLPRSYPESSDNARKSAAVPSANADAATAR
                     RLPALPNGPHSFRTDTSTPAGELDSAYEQTATRRRRAGTRSERPSTQPNTDSKGQRTS
                     SRTAHPRKPHEPRLPSAKDVRRAPASSMYFYPAPCYGSPPNQALRAHTGTLVGERIWV
                     IGGVDKQTCFRDVACFDTESFMWSTLETQGERFPPLRAHTTTLVGDKLFIFGGGDGPS
                     YSNDVWILDTTTHRFSRPSFSPDLPLPPPRRAHSTVLYQHYLIVFGGGNGQTALNDVW
                     ALDVSDPNALTWTEWKTKGDIPQKKGYHTANLIGDKMVVFGGSDGHASFADVHVLNLK
                     TCVWTLINTDIKHNRLSHTSTQVGSYLFVIGGHNGQAYAQDVLLFNLVTLQWEMKLPR
                     GVFPPGRGYHVALLHDARIFLSGGYNGETVFDDFWILDLSASAYLPQVTTFQVDENLY
                     KRSITESSSLWQTHL"
     gene            complement(1025168..1028244)
                     /locus_tag="CNA03810"
                     /db_xref="GeneID:3253422"
     mRNA            complement(join(1025168..1025477,1025525..1025600,
                     1025663..1025825,1025880..1025948,1026005..1026077,
                     1026140..1026452,1026506..1026567,1026632..1026858,
                     1026913..1027018,1027076..1027123,1027179..1027210,
                     1027263..1027362,1027415..1027723,1027798..1028000,
                     1028059..1028086,1028154..1028244))
                     /locus_tag="CNA03810"
                     /product="1,4-alpha-glucan branching enzyme, putative"
                     /transcript_id="XM_566719.2"
                     /db_xref="GeneID:3253422"
     CDS             complement(join(1025263..1025477,1025525..1025600,
                     1025663..1025825,1025880..1025948,1026005..1026077,
                     1026140..1026452,1026506..1026567,1026632..1026858,
                     1026913..1027018,1027076..1027123,1027179..1027210,
                     1027263..1027362,1027415..1027723,1027798..1028000,
                     1028059..1028086,1028154..1028178))
                     /locus_tag="CNA03810"
                     /codon_start=1
                     /product="1,4-alpha-glucan branching enzyme, putative"
                     /protein_id="XP_566719.1"
                     /db_xref="GeneID:3253422"
                     /translation="MTAVSLSDGTAVLKTDPWLEPFSGALRERYAAYQKQRTIIEEHE
                     GGLAEFSKGYKSMGFQIDKNGGVRYREWASNATEARLIGEFNNWSHTANPMTKSPFGV
                     WECYVPPVSPGVCAIPHDSMVKISMTLPGGESIDRIPTWITRVTQDLNISPIYDGRFW
                     NPPKEQQYQFKHGHSTRPVEGLKIYEAHVGISSPNMRVTTYKEFEVDVLPKIKQLGYN
                     CIQMMAIMEHAYYASFGYQVTNFFAASSRFGTPEELKSLVDKAHELGLTVLLDVVHSH
                     ASKNILDGINMYDGSDHLYFHEGGRGRHDQWDSRLFNYGQHEVLRFLLSNLRFWMDIY
                     MFDGFRFDGVTSMMYKHHGIGSGFSGGYHEYFGDSVDLEAMVYLMLANAMLHETYPHV
                     VTIAEDVSGMPTLCRPVAEGGVGFDYRLSMAIPDMWIKLLKEYTDDQWEMGQIVHNLT
                     NRRHLEKSVAYAESHDQALVGDKTLAFWLMDKEMYDFMSDLSPLTPIIDRGLALHKMI
                     RFIVHTLGGEAYLNFEGNEFGHPEWMDFPREGNGNSFAHARRQFNLVDDKLLRYKYLY
                     EFDVAMNWLEDKYKWLNSPQAYVSLKHEGDKMIVFERAGLLFIFNFHPTQSFTDYRVG
                     VDTAGEYKVILTSDETRFGGHNRIDMGGRYFTTPMEWNGRKNWLQVYSPSRTVLVLGL
                     "
     gene            1028573..1029490
                     /locus_tag="CNA03820"
                     /db_xref="GeneID:3253420"
     mRNA            join(1028573..1028604,1028670..1028915,1028970..1029490)
                     /locus_tag="CNA03820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656248.1"
                     /db_xref="GeneID:3253420"
     gene            complement(1028712..1031291)
                     /locus_tag="CNA03830"
                     /db_xref="GeneID:3253877"
     mRNA            complement(join(1028712..1029973,1030023..1030434,
                     1030485..1030606,1030667..1030694,1030762..1030784,
                     1030841..1030933,1031015..1031291))
                     /locus_tag="CNA03830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567159.2"
                     /db_xref="GeneID:3253877"
     CDS             join(1028733..1028915,1028970..1029248)
                     /locus_tag="CNA03820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511894.1"
                     /db_xref="GeneID:3253420"
                     /translation="MPNYYDELEIEDFAWDPVARVFHYPCPCGDRFEISKGQLRDGEE
                     IAICPSCSLIVRVIYDYLDWEDYVTTDDEDDGGSVDTPLSNTSPDPAYPVVVGSAEVE
                     SQSKTASSAVSSQKEECTSLSDRLAGLQVESGKEDDPVQEHKREDSSDVLH"
     CDS             complement(join(1029326..1029973,1030023..1030434,
                     1030485..1030606,1030667..1030694,1030762..1030784,
                     1030841..1030933,1031015..1031152))
                     /locus_tag="CNA03830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567159.1"
                     /db_xref="GeneID:3253877"
                     /translation="MSDDAEVTNNKKTTKSTLLDGNHIFPPFYACYLLRSKATANSNR
                     TYVGSTPDPPRRIRQHNGELKQGAWSTSRHRPWEMQMIVYGFPSKLAALQFEWAWQKP
                     ELSRHLRIRGEDQEYYHIFTKDARRNWVERKVCVAYALISLTPFNRLPLHVRFFNHET
                     HGIWQSIHEQAGVNTIQRGKSRAKPVNPLHLLSQSVAPAVTIILDLGGVSGTSGKRRE
                     CTKGVMSHEGPIDVKDVEFRQGFGVRGKWLEIRKRILSGQDLCCHLCQERIAFNDHLT
                     FSICPLAESQDCFCITHLICLAKHFQDEAPVEDRRAPSQPKILPYQGLCPNCKRTVQW
                     GQHIRACYARKEQVEKAEKAEKAEKAEKAEKAEKAEKAEKAEKAEKAGRKVRQREMKT
                     KKGDQSNGTVAQPESIYSATPVHTTFGLSNASATLIDPSMPARSMKSKDVGGEGIRHS
                     THTDDSDGIISVYSETEDESESEPEWEIFEAEMMALS"
     gene            complement(1031572..1034255)
                     /locus_tag="CNA03840"
                     /db_xref="GeneID:3253859"
     mRNA            complement(join(1031572..1031851,1031917..1032146,
                     1032197..1032253,1032309..1032391,1032443..1032647,
                     1032698..1032962,1033009..1033220,1033261..1033501,
                     1033555..1034104,1034157..1034255))
                     /locus_tag="CNA03840"
                     /product="protein serine/threonine kinase, putative"
                     /transcript_id="XM_024656249.1"
                     /db_xref="GeneID:3253859"
     CDS             complement(join(1031767..1031851,1031917..1032146,
                     1032197..1032253,1032309..1032391,1032443..1032647,
                     1032698..1032962,1033009..1033220,1033261..1033501,
                     1033555..1033727))
                     /locus_tag="CNA03840"
                     /codon_start=1
                     /product="protein serine/threonine kinase, putative"
                     /protein_id="XP_024512056.1"
                     /db_xref="GeneID:3253859"
                     /translation="MFQKVSDKFHRKQQSTTLPGKTQQVPNPTSPVLAKANSQAQQAY
                     SLPQDHSPMEGIQRDSPPIQQPMATEKAPIVGSSASTSLPTLSVQDGTLPLTPGAQGM
                     QTGTIDGHRQLQSPVSRSSSAGEDKMREKARDAQEQAAQSQANLHHATQQARVAAINA
                     AATQAALETAAQLPATARVPVSGGGVEQGQARRKTAGRYALSDFLIERTLGTGSFGRV
                     HLVRSRHNGRFYAVKVLNKEKVIKMKQVEHTNSEREMLVRVRHPFLVNLWGTFQDVNN
                     LYMVMDFVAGGELFSLLRKSQRFPNSVAKFYAAEVALALDYLHSLDIIYRDLKPENLL
                     LGADGHVKVTNFGFAKYVPDITWTLCGTPDYLAPEVVQSKGYNKSVDWYALGVLIFEM
                     LAGYPPFFTEDGNPMKLYEKIIAGKVRYPTYFDALAKELLKNLLIGDLTKRYGNLRAG
                     SSDIFAHGWFAEVDWDKLYRREIPAPYVPKIDGEGDASQFDRYQEADVSAYGKVGNGP
                     YDHFFTEF"
     gene            1034445..1036463
                     /locus_tag="CNA03850"
                     /db_xref="GeneID:3253418"
     mRNA            join(1034445..1034891,1034952..1035067,1035118..1035212,
                     1035272..1035384,1035421..1035698,1035747..1035760,
                     1035819..1035929,1035982..1036267,1036321..1036463)
                     /locus_tag="CNA03850"
                     /product="pyruvate dehydrogenase (acetyl-transferring),
                     putative"
                     /transcript_id="XM_566723.2"
                     /db_xref="GeneID:3253418"
     CDS             join(1034649..1034891,1034952..1035067,1035118..1035212,
                     1035272..1035384,1035421..1035698,1035747..1035760,
                     1035819..1035929,1035982..1036267,1036321..1036408)
                     /locus_tag="CNA03850"
                     /codon_start=1
                     /product="pyruvate dehydrogenase (acetyl-transferring),
                     putative"
                     /protein_id="XP_566723.1"
                     /db_xref="GeneID:3253418"
                     /translation="MTLLTGSRITQSFLLTVKTRKPQCLCLLQSEQGKRMSTNHAAVH
                     KGKPPPSRSAPAIIDMQSTTEEPPLGESELFLRTRDEALNTPGMKFADGHGLKGPTGK
                     GRQTRKMNLYQAIRDALGTALAKNPKSFVFGEDVETGVFRCTTGLVDEFGKRRVFNTP
                     LTEQGIAGFGIGLASVGGCAIAEIQFGDYIFPAFDQLVNEAAKQRYASGGSYPPVGGS
                     LTIRAPIGSVGHGGLYHSQSPEGFFLGAAGLKIVIPRSPIQAKGLLLAAIRDPSPTLF
                     FEPKILYRAAVEEVPIDDYTIPLGQAEVIRKGADLTVVSYGTPLHICLRAINMLQQPP
                     SSILGSLPPGLRPPQPAPSIELIDLRTINPLPLEDLVSAVRKTGRLVIVHEAGRSGSV
                     GNNIAGEVGRRAFEYLEAPVGVVSGWDTPVPLSFERFYQPDVIRVFDKLVETLSY"
     gene            complement(1036458..1037846)
                     /locus_tag="CNA03860"
                     /db_xref="GeneID:3253416"
     mRNA            complement(join(1036458..1036667,1036725..1036947,
                     1037008..1037104,1037175..1037229,1037296..1037846))
                     /locus_tag="CNA03860"
                     /product="actin filament organization-related protein,
                     putative"
                     /transcript_id="XM_566725.2"
                     /db_xref="GeneID:3253416"
     CDS             complement(join(1036587..1036667,1036725..1036947,
                     1037008..1037104,1037175..1037229,1037296..1037670))
                     /locus_tag="CNA03860"
                     /codon_start=1
                     /product="actin filament organization-related protein,
                     putative"
                     /protein_id="XP_566725.1"
                     /db_xref="GeneID:3253416"
                     /translation="MATQQPAQAFASHLINQTLSSIALLESLSLINSADASLIRQKLP
                     SPTGPFPSLSPPSPSNSFANLTIAQSSPTSSWTVQHARDDNSSNSPSNSMQPSASAPA
                     LPPRQRSEPAERRAKALWDFSGTEADDLQFRSGDTIIIDEEVNEQWSRGRVIPNGHSA
                     PLPRSGLFPSNYVEQLPPVQNNAPPPPQIPYYQPPPPGPQSMVPYQPPQQGYYGQKPP
                     MHAMPPQQQVQGGVMVQQDTQHKPRFGKLGSQLGTAAVTGVGFGAGSAVGSGIINSIF
                     "
     gene            complement(1038490..1041468)
                     /locus_tag="CNA03870"
                     /db_xref="GeneID:3253414"
     mRNA            complement(join(1038490..1038698,1038789..1038887,
                     1038947..1039088,1039152..1039335,1039399..1039630,
                     1039937..1040130,1040239..1041157,1041234..1041468))
                     /locus_tag="CNA03870"
                     /product="transformer-2-beta isoform 3, putative"
                     /transcript_id="XM_024656250.1"
                     /db_xref="GeneID:3253414"
     CDS             complement(join(1038608..1038698,1038789..1038887,
                     1038947..1039088,1039152..1039335,1039399..1039630,
                     1039937..1040130,1040239..1040241))
                     /locus_tag="CNA03870"
                     /codon_start=1
                     /product="transformer-2-beta isoform 3, putative"
                     /protein_id="XP_024511896.1"
                     /db_xref="GeneID:3253414"
                     /translation="MAFSAAYVPSSPGPGEYNPPYPGYIIYSSTVRPPFSQGSPTTIS
                     WERNFEKFICENDAKSHKWDELMTFNSYAVRSPSPSDSRSSDAIPSKSPPRSSHVFSK
                     VKSTNILGVFGLSVRTTERDLQDEFSRHGEIEKVVIVYDQRTGRSRGFGFITMRSIED
                     ATQCINKLNGFTIHGRNIRVDYSATPKPHDPTPGQYLGPKTTTISDERLLSRCGRYDD
                     FLEMDGSLHGASHRHHFNRSKGRYDIRDDQMLDKNMIRRRRLEDAYYRGRHDRREAHE
                     YRYRRTSLSPRRNTYETSSSRRGRDAAYESGCSDSSRY"
     gene            1041717..1043345
                     /locus_tag="CNA03880"
                     /db_xref="GeneID:3253412"
     mRNA            join(1041717..1041954,1042044..1042077,1042133..1042231,
                     1042305..1042324,1042396..1042409,1042475..1042544,
                     1042609..1042782,1042829..1042950,1043040..1043345)
                     /locus_tag="CNA03880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656251.1"
                     /db_xref="GeneID:3253412"
     CDS             join(1041935..1041954,1042044..1042077,1042133..1042231,
                     1042305..1042324,1042396..1042409,1042475..1042544,
                     1042609..1042782,1042829..1042835)
                     /locus_tag="CNA03880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511898.1"
                     /db_xref="GeneID:3253412"
                     /translation="MPWQKTFSLPPNRKGMHLVTNEVIQQCREGLKNVDIGIFTLHCL
                     HTSAGLTLNENCDRTVRTDMDMALDTIVPESLPWEHTDEGPDDSVSHLKTSLIGNSIT
                     VPISKGKLVLGTWQGIYLAEFRHNGAGWGGQGQGRKVVATILP"
     gene            complement(1042369..1044768)
                     /locus_tag="CNA03890"
                     /db_xref="GeneID:3253410"
     mRNA            complement(join(1042369..1042780,1042848..1043210,
                     1043264..1043432,1043496..1043595,1043649..1043880,
                     1043950..1044050,1044104..1044270,1044328..1044392,
                     1044446..1044768))
                     /locus_tag="CNA03890"
                     /product="cell division cycle protein 91, putative"
                     /transcript_id="XM_024656252.1"
                     /db_xref="GeneID:3253410"
     CDS             complement(join(1042894..1043210,1043264..1043432,
                     1043496..1043595,1043649..1043880,1043950..1044050,
                     1044104..1044270,1044328..1044392,1044446..1044605))
                     /locus_tag="CNA03890"
                     /codon_start=1
                     /product="cell division cycle protein 91, putative"
                     /protein_id="XP_024511900.1"
                     /db_xref="GeneID:3253410"
                     /translation="MSYLERLCSHKISHSEVYIVGAVLRMALFSLPEVVIALQRRPEL
                     STPLTSFRSIQEGVFIYEHGTSPYSGGTFYHSPIYLVLFSHVIPISSICLTAAFWTLA
                     DLWGAWSLVKISQARNQKRCARDALVAAVYLLNPYSLLTCIARSTTTLDNAVLLGALS
                     AAAAGKTTFSLISLAVAVHTSFYPIILLPPIVILLGKINTEQPKKSLVLQSLLLFAAL
                     TIAIGVFNFVILGDNWIWKSLGTSLEVTNLTPNVGMWWYFFTEMFDHFRTFFLGVFQL
                     HTVIYIAPICIRMVDRPLDAILLLLAIFVTWKSFPALGDMGLCAGLIGCFPDILANLR
                     HPLFSLTVHLYTSILLPLLHSLWLLTGTGNANFFYAATMVYGLNASLIIVDMLGASMR
                     VEVKKRVALEGADDQSGTQDKKECTDDVCENWEARKWHVVQFTK"
     gene            complement(1045007..1050301)
                     /locus_tag="CNA03900"
                     /db_xref="GeneID:3253408"
     mRNA            complement(join(1045007..1045352,1045403..1046250,
                     1046303..1048066,1048122..1048817,1048871..1049559,
                     1049614..1049911,1050047..1050301))
                     /locus_tag="CNA03900"
                     /product="eukaryotic initiation factor 4F subunit P130,
                     putative"
                     /transcript_id="XM_566733.2"
                     /db_xref="GeneID:3253408"
     CDS             complement(join(1045136..1045352,1045403..1046250,
                     1046303..1048066,1048122..1048817,1048871..1049559,
                     1049614..1049884))
                     /locus_tag="CNA03900"
                     /codon_start=1
                     /product="eukaryotic initiation factor 4F subunit P130,
                     putative"
                     /protein_id="XP_566733.1"
                     /db_xref="GeneID:3253408"
                     /translation="MSQNTSPTVNGDNKTSAPGSIASVWARGPPSAVSSTSASKNQSG
                     VNTPSQEGAGLPNITSVSSSAAISIRNAHSRQNSLLVGPGGVDIKKGNIAFGTVDSPN
                     TALSSSPAAPSTTGGHLADAVKSFGSIDADGNSDPDVVKTRRTSSLSNPIGPVQEKKL
                     SVHSLFTSKAPAQAPLGSSPSRPAMSPPQPHQQPIPHIRRQSMGQGGPGFQSQVPVGS
                     PSFTSGPPMRPPMVMPNQPRSPVANPNVPHGQYAPMPPLHVQQGFRPPQQGMGTQQPP
                     VRPNGMGTQGMARPMMGPGQYGMHPGPQGPQYPVMGYPPQGGFYPGYGPYDQQPHYGS
                     PQWAQQQQNQSFNANFGPGPMSPRSGPSQISSAPSQSPLPPQGVPLGSGGPSPIPTPP
                     NRPPNLMAGHQHSASIPATPIPSTPSRPMQANVPPPFLSGAASVFTPRGASKAVKIAR
                     EDGTAVNMKEVAEAASKAVSSGAHTPESAAQPSKDDAPRRKPGLPVIVRLESEEQKKK
                     RVAEEEREAKLKFMEEKEEQERRERLEKKIKEDEERQAKEAAEKAEAEKKAKEEEEKK
                     KLDEAYAAEALAAKKLAEEKEATAKAAKEQTEAAEREKLAAHAATQEARDKAEEQRRE
                     LLSTPVTPAAVSPVESPALGAGLPAKPVAAISGAMKTLPTAPELASTSVATINETPSA
                     SASALSSARPINDLSSITYPATLKSPDPRLNVDAEPGKFRYDREFLMQFMAVCREKPD
                     TLPPLEDIGLEVDGGSGFGGRSSRGGSRASMGPSSRSAPGGAGLGISGSNRSAFPGQG
                     MGQFGSMGQFGSGAGPIRSTSEQRYRASLSNRTPSSLSGLPSLGISGSRTGANRGSQR
                     GSKRAPQSSQVPTSATAPIPISENAWTRTRLGGDAQGTPAYIERKVKALLNKLTEEKF
                     DPISLQILEWANKSANETDGLTLKLVIKLIFEKATDEAHWSAMYAKLCKLLHDEISPE
                     VSDTIDGKPVAGRALFRRYLLGRCQVDFEAGWKAREDTAVAAAAKKEEDGAKQEEAKD
                     DKDKEAVLMSDEYYAAQKAKRRGLGLVQLIGELFKREMISNRVIKECLLKLLSNTTDP
                     DEEDIESACKLLTTIGAAYDRVAPENLSKAFDMLSKMMQVESLSSRIKFMIMDVFDLR
                     RNGWKSKKNQTSVMTIAQIHEQNAKEKSAASTAVSKESISRGGSRSGRDRHEGSQPGE
                     WQSVSAGPRSLNRPTDFSNMGRNISSGGTAPSFGPTSIFNTRKGKAGTPTNVTPPMSR
                     QPSSANMFSALNDTQENELVSAERRTSTDNGESAPQRKRLNLAPRTKPVEGEGENKDE
                     GAEEEPHGDRVDEHDLSEEEARAKIDLDMKELWGEKDQGGSRNPEDIADYFSALPVSR
                     RPLLAERLLNDIFRISRLKDAEIVAKGWKTALLQQSVSADVLRQSLEHRMPTLDDESI
                     DFPSAYEAIALLVRNVSLSQEDINAMVGRIEVEGTPRITPPQKMEKALRKVDEAGSLA
                     "
     STS             1046582..1047437
                     /standard_name="Xho10"
                     /db_xref="UniSTS:470889"
     gene            1050488..1052378
                     /locus_tag="CNA03910"
                     /db_xref="GeneID:3253406"
     mRNA            join(1050488..1051581,1051636..1052378)
                     /locus_tag="CNA03910"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_566735.2"
                     /db_xref="GeneID:3253406"
     CDS             join(1050542..1051581,1051636..1052323)
                     /locus_tag="CNA03910"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_566735.1"
                     /db_xref="GeneID:3253406"
                     /translation="MSLRLFLSRVPPSQQLPSKLLPQLSLRRAQSSSSDSRPPHPAVQ
                     QSFEALASDLLATPSTLSSSGLKRSAPEAPRTFIKSPSLPPVQLSRNPYAGQYAISED
                     DLDDPFETEIAVEEPKGLAVPPRRRRLAGRQSSATARPQRIINLSPHDTVSVYPDFIS
                     LTSHGRTGVITNARLLDACHCKKCRDPSTRQMNTTTGEAVRESKIARITRGNSVRKGG
                     IRKDGLVVSWGEGVKHMSFFPLHRLRSMLERDMGTVYRSPSFVHQTWDGESLSLTNLR
                     FQYSDLSESLLKVLEQLQVYGIVVIEGVPTDPTDDKECMLRKVTDMIGKIRNTFYGET
                     WDVKSVKQSKNIAYTNLNLGLHMDLLYFSSPPRFQALHCLRNKVEGGSSYFVDSFRTV
                     SDLPRDQFEFLQKINITYQYDNDNHYFRYRHPIISSDFVRGRNNRHAAVNWSPPFRAA
                     AEALDFPQHDFVAAAKHEQKVLQAIADFEERLSDPRYRYEFTMQEGDLVLFDNRRVLH
                     ARTAFRDKKDMEVEEEERVEQKSEMESDKEPTRWLKGCYLDGEAVWDKLATLRKQSLE
                     RRAASVGVQ"
     gene            1052585..1052656
                     /locus_tag="CNA03920"
                     /db_xref="GeneID:3253962"
     tRNA            1052585..1052656
                     /locus_tag="CNA03920"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3253962"
     gene            complement(1052936..1055335)
                     /locus_tag="CNA03930"
                     /db_xref="GeneID:3253404"
     mRNA            complement(join(1052936..1053375,1053449..1053514,
                     1053610..1055335))
                     /locus_tag="CNA03930"
                     /product="RING zinc finger protein, putative"
                     /transcript_id="XM_566737.2"
                     /db_xref="GeneID:3253404"
     CDS             complement(join(1053244..1053375,1053449..1053514,
                     1053610..1055325))
                     /locus_tag="CNA03930"
                     /codon_start=1
                     /product="RING zinc finger protein, putative"
                     /protein_id="XP_566737.1"
                     /db_xref="GeneID:3253404"
                     /translation="MQAASPAPGPRATPPVLSPPPAALPLPLSIPHTLCQLPSPGSPL
                     GPAPAPPADAFTPSSASSPGRRSVYDDLQHYNPVPPFVDHTEDEMLREDYNRLRARRT
                     SSNLSSSPAATNSPSSLSMQRRSLGDSGQRLPPDFVPSPVPPHLNPVPPYLDYIEDEM
                     LRDDHVRVRSSARGSSIGPFPSEHVPPAFPTNNIGPSHASSPSPSSASIISPSSRHQL
                     AGSEEPNDRWSRDRLADLRRAMLASQSHDNRPSPWVQAWGRAPDEPLNAEVNDRYWDA
                     EYPAEYIERPSQRSSSSSLRPSPATTHMGGRGRQALNRDINETVGRRLGSLRPIQMAN
                     PSFPLETSTNTLRRREVPHGPQEGRAAAPPPAEGNLWGELERDSRSSSSFSESAPPSA
                     DGDSGTTTPTQESVFRAYGSSNHGEDEDGDFDENDEDDDEDYDDENENGDSEMLNPDI
                     MREVYNLLTARPVPPMAMFSGPGMAEPIELIHAHVHSHVSSFGRVFRQRPPRQSLEEL
                     RLSPQMDDNTVQKTLMSAVKGLKYLSDGKKRRMAMGMLENITWAEFGEREGMVRDEYC
                     SVCHDEYEDTTEISITPCKHMYHKDCLSTWLNTPKISSCPMCRRDLALLAAFANMTSS
                     KTVNEAIPYWYRV"
     gene            1055480..1058780
                     /locus_tag="CNA03940"
                     /db_xref="GeneID:3253402"
     mRNA            join(1055480..1055562,1055600..1055881,1055931..1056039,
                     1056098..1056669,1056721..1056775,1056834..1058071,
                     1058185..1058780)
                     /locus_tag="CNA03940"
                     /product="kinase, putative"
                     /transcript_id="XM_024656253.1"
                     /db_xref="GeneID:3253402"
     CDS             join(1055485..1055562,1055600..1055881,1055931..1056039,
                     1056098..1056669,1056721..1056775,1056834..1058071,
                     1058185..1058658)
                     /locus_tag="CNA03940"
                     /codon_start=1
                     /product="kinase, putative"
                     /protein_id="XP_024511901.1"
                     /db_xref="GeneID:3253402"
                     /translation="MPPSEGRYLAALPAQHKDAAPDTLYQKLEIVGKGAYGAVYRGKH
                     IATGHIVALKIINLDTEDDDVADIQKEISLLQQLMLGGSNSGGPPPNVIKYYGSLMQG
                     PRVWIIMEYAEGGSIRTLSRAQPLKELHICLVIREVLLALAFLHKNGVIHRDIKAANI
                     LLTTQPHRILLCDFGVAALLQSSTSKRSTFVGTPYWMAPEVVTEGRMYDAKADIWSLG
                     ITLLEMAYGEPPMSGQPAARAVMLLGDKRMRAPRLEGDHWSKEMRDFVVGCLNEEPAD
                     RLSAEELSKSKWIKQQSKTPLTAMNDLIARYQAWKESGGQRQSLAAGVGANVDDDDDD
                     FDRHPADGDWAFDTVRSRASILLGKQQSEDNASSNLSPPTTHPAPAPQSLRRLFHDES
                     STDPDPFKSFAHQQPPTPQTTEGSDTIKQTGRFPSPEQEDLPPLVDTDSPPATPGKNE
                     LDGQTIRQARLGRDGRSPTPLMITTGYSPSPSSNTLSAASTATYYPIETPQEHTPIAR
                     TDAGVPSPRRIRNKISLDNLSLTPTSKTQPAAEERSKSSGGMRRPSASDAREGLRGFQ
                     FPLMTKSGPGPTPITTASMSTSTNTPTSTQPPAAGKLFPPPLNRNHSAAPAYPFADPT
                     TTSTTTTTSPTGTSSPGFGGLAFGPRPPMMRQASVAVMEGRAASQSQSQAQAQALALA
                     LAHTQTHQQQQQQQQQQQQQQGSTSPPTPKKAVALGAPNSIGLGRPGVSAAAAAAAAA
                     AASATAAGGGGGQGMMIRSRSGSKAEDGHPVGLRDLLKLSPAVPDMPDLLPPSPSVAN
                     TPHKFFPSPSPLAQTTHAHAEPSAASAASASATASAAFSFPTLASAPMSAAPSQRSLL
                     PAGTIPASAPPGLATQPNAFAPVHATMGPPIRPLDLSMLESDDVFDELGRMVDDMQSW
                     FGCVESGLEELLATGVDVQNA"
     STS             1057871..1058159
                     /locus_tag="CNA03940"
                     /standard_name="CTG17"
                     /db_xref="UniSTS:470890"
     gene            complement(1058751..1061683)
                     /locus_tag="CNA03950"
                     /db_xref="GeneID:3253400"
     mRNA            complement(join(1058751..1060216,1060263..1061513,
                     1061563..1061683))
                     /locus_tag="CNA03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_566741.2"
                     /db_xref="GeneID:3253400"
     CDS             complement(join(1058812..1060216,1060263..1061513,
                     1061563..1061603))
                     /locus_tag="CNA03950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566741.1"
                     /db_xref="GeneID:3253400"
                     /translation="MSPSTTYQKARLSLAMLGLNGLPLDEYLSQLPRLPDTPKDSKRI
                     DDIPEGIVSHSISQYSTPDLPTSESQVEVDKGSRDSLRVPGSRVKVDSPLEKHPIILN
                     SSIEEVGDSSISPDALHVGPHYEKVTCDQSTSQSPFASTLIEQSVNPQAAPAPRLSAS
                     FRLPNMGDISLIGECSLFGGASSVGDDSLEYELSDIRPKRDTINRSTSDPFMMKRQRD
                     INPASQHLGQSTLLPTSPAKQAHLLASTNSLHRVEPPWCGNDSTMTTSSNGSNDTVTE
                     SRSASPTRSSTVKAQSLPRSNALRGFPTSKTRRTFPASSSGNSLAAVGEEESELLINL
                     DKSTLLPISPQKTAYLLRDEEMIARETLDEGPSYMLTIPPATISRAAAGCIGHDGDRT
                     MDVRDLMAKVGKPKRASGTEESFVDLLHAEDDMFAKMDMTMLGADETMVMPATLRPRQ
                     ASPSKIVAQAQATTKATLPTSRTSHTLSILDDNQAQEQKPITLSRSKSLSKVAEIIQR
                     VKADKLAAASASRLGSPPKTASVARTYKTSSTSTATPAAPRVRGKVAPHTTGSRRISL
                     SAGGVPISCSASQKSIDLPRPRPTHARPISTHSTLSSANQNVSARQTITAAPTETCAA
                     RIVNRNPQATLTARVPRASIVPSSRTEVKNRSGSVSSSVSTAATVSRAPNSRPSIAAP
                     RTITRSHTTEGLSAAGARVPRASVAASSRPAGLPLPGTGPTARSATANTPASTATRAR
                     LSRAFGSDATSATNRLSRPATSTLASATSKTLKLSSGPSVISARSSATSTDRLKSRAL
                     STPASAGTRQSTLPISRALPTPRSATDAARNSSKPPATTIDLPKARVGSTLRRPSTSR
                     VPAGGPGKNSAPPGSGSNLAALRSRLDELQAKQKERSAARCL"
     gene            complement(1062299..1065145)
                     /locus_tag="CNA03960"
                     /db_xref="GeneID:3253802"
     mRNA            complement(join(1062299..1062815,1062868..1063384,
                     1063434..1063526,1063583..1063958,1064010..1064146,
                     1064192..1064600,1064653..1064682,1064743..1065145))
                     /locus_tag="CNA03960"
                     /product="glyoxal oxidase precursor, putative"
                     /transcript_id="XM_567162.2"
                     /db_xref="GeneID:3253802"
     CDS             complement(join(1062558..1062815,1062868..1063384,
                     1063434..1063526,1063583..1063958,1064010..1064146,
                     1064192..1064600,1064653..1064682,1064743..1064917))
                     /locus_tag="CNA03960"
                     /codon_start=1
                     /product="glyoxal oxidase precursor, putative"
                     /protein_id="XP_567162.1"
                     /db_xref="GeneID:3253802"
                     /translation="MYSAILLSLLPLLAAAHGGPSRNLPNRAFSQQQVRDGVTPGGYQ
                     IVGDSGVSAQMLFLGTETTAYILDKAENNSLQVTNDDGLTHPAWGTSYDLTTNKATAM
                     QVSSNTFCAAGLSMATGEWAVFGGNQPVTYGGVATKDNPSIPNDFMDTDGGAAIRLLT
                     PCDDGSCKWQEGGDELTMTSKRWYPTVELLGDGSLIVLGGDGNGGYVSTFAQNNPTYE
                     FYPKTDNQSHYMDFLNYTVPVNLFPLTWLMPGGKLFMQAAYKTILYDLDAQQETPLPD
                     MPYAVRVYPASAATALLPLTPANNYSATVLFCGGSAANFNLSSDGGAQFNVTAVPADN
                     TCVRISPEDEKPTYEDDDYMLEGRSMGQFIFMPDGKMWMGNGVAMGTAGYGDEGYSIG
                     QSYGQEPLYQPAIYDPSAPAGSRWSREGLGMSTQERMYHSSAILLADSSILVSGSNPN
                     KDATSEKWPTSYSVEQWYPLWYNEQRPEPSSSWPSSLSYGGEYFNVSYTPSNSSSNSD
                     NTKVVVIRTGFSTHAMNMGQRYLELNSTYTKDEASGEVTLYVSQMPPNANIFQPGPAM
                     IFLVVDGIPSQGKIIMVGSGKIETQPISEVAVLPATSVIPAQTNSSSSDNAAGTSTTS
                     SGSSQGTSASQNVDSGATAGLRARFATVFGSAVVGLALLL"
     gene            complement(1065436..1067839)
                     /locus_tag="CNA03970"
                     /db_xref="GeneID:3253817"
     mRNA            complement(join(1065436..1066334,1066385..1066440,
                     1066487..1066555,1066604..1066671,1066729..1066804,
                     1066854..1067140,1067188..1067278,1067327..1067450,
                     1067612..1067839))
                     /locus_tag="CNA03970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567161.2"
                     /db_xref="GeneID:3253817"
     CDS             complement(join(1066202..1066334,1066385..1066440,
                     1066487..1066555,1066604..1066671,1066729..1066804,
                     1066854..1067140,1067188..1067278,1067327..1067450,
                     1067612..1067637))
                     /locus_tag="CNA03970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567161.1"
                     /db_xref="GeneID:3253817"
                     /translation="MSLSSDLDKQIEQLKRCETIPESAVKELCTKAKEILMEEGNVQY
                     VDSPVTICGDIHGQFFDLMELFKIGGFCPETNYIFMGDFVDRGFYSVETFLLLLLLKV
                     RYPDRITLIRGNHESRQITQVYGFYDECQRKYGSSNVWRYCCDVFDYLSLGCVVDGRV
                     FCVHGGLSPAVHRLDQIRVIDRRQEVPHEGPMCDLLWSDPDEEIQGWGMSPRGAGFLF
                     GRDVVEQFNHANDIELVARAHQLVMEGYKLMFDRRIVTVWSAPNYCYRCGNTASVLEL
                     DENLRQEYKTFDAAPPDARSIPQKRPMTHEYFL"
     gene            1068046..1069848
                     /locus_tag="CNA03990"
                     /db_xref="GeneID:3253397"
     mRNA            join(1068046..1068526,1068580..1069002,1069061..1069429,
                     1069478..1069848)
                     /locus_tag="CNA03990"
                     /product="expressed protein"
                     /transcript_id="XM_566744.2"
                     /db_xref="GeneID:3253397"
     CDS             join(1068284..1068526,1068580..1069002,1069061..1069429,
                     1069478..1069537)
                     /locus_tag="CNA03990"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566744.1"
                     /db_xref="GeneID:3253397"
                     /translation="MLLRSSHRHLLRTAFTISRSKPLHKPILPSSTMSQGVGYSSLTE
                     QVTSAAAAASRTVSDLVNKYTVHDIAKTGFGEGTNDFYNAARPSYPAGALQVIHSSLP
                     SHPLKIVEPGSGTGIFSRLLLAPPNPTYPSFSIDTLVAVEPSEGMRNSWWKALEKAGL
                     GKREENEGGKGEKKVGTVDGGFDSFGGAREYGVTEVQNGQGGVDGVVIAQAWHWCPDY
                     DKALREIAAYLRPNAPLILIWNLEANNPQWQADLREAYQGYDLGSPQYYKGLWRKMFE
                     TPAYKELFDSSEEHTIPWSVGITEDGMLDRLFSKSYLTEQHLNGERREEFIRKIRDIV
                     RQAPHEWIDKEKGTFKYDYNTDIVICRRKA"
     gene            complement(1069598..1072776)
                     /locus_tag="CNA04000"
                     /db_xref="GeneID:3253396"
     mRNA            complement(join(1069598..1070028,1070082..1070147,
                     1070197..1071044,1071094..1071164,1071210..1071311,
                     1071364..1071499,1071549..1071669,1071726..1071814,
                     1071860..1071868,1071918..1072279,1072364..1072469,
                     1072530..1072776))
                     /locus_tag="CNA04000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656255.1"
                     /db_xref="GeneID:3253396"
     mRNA            complement(join(1069598..1070028,1070082..1070147,
                     1070197..1071044,1071094..1071164,1071210..1071311,
                     1071364..1071499,1071549..1071669,1071726..1071868,
                     1071918..1072279,1072364..1072469,1072530..1072776))
                     /locus_tag="CNA04000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656254.1"
                     /db_xref="GeneID:3253396"
     CDS             complement(join(1069816..1070028,1070082..1070147,
                     1070197..1071044,1071094..1071164,1071210..1071311,
                     1071364..1071499,1071549..1071669,1071726..1071814,
                     1071860..1071868,1071918..1072279,1072364..1072469,
                     1072530..1072686))
                     /locus_tag="CNA04000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511903.1"
                     /db_xref="GeneID:3253396"
                     /translation="MSTPAMATHAPQTNPTPAIVSEKVPLNTQALPKIVFAGRTGRIL
                     CVADIRGDYHELNRLIREHDATAVIHTGDFGFMTAESVDRMNDKILRHLIQYSPLLPP
                     AARTQLLAIPLSAGRSALINQLNNSSVHFPLSQFPHLLSGAINFPVPVFTTWGLVEDV
                     NVIEKFRTGEYGVQNLAILDEATSRLVEVGGVKLRLLGLGGTVADHKLFDYGEGHGSI
                     AGAQGTMWTTALQIGELIDTAQRTFNPDETRLFVSTTPTSRNGLMTLVSNAIKADLTI
                     SCGLHFRYPVSYNEYSIHPDFESYRRKMQRAKDDFKGLFDQVRDRVFGSLDDKQTALL
                     HKTLSAIENVPIADDGMWANTWHWSLSDAGFGNMLLSITDSRVSAETKSSGVNFAHRT
                     GKGPAPPTGSTISSAPSGLNSVKSLSSRPGPGPIGARPLPAQGVPSASGPHGAHGAPG
                     AFLSQGRAPVRPGMGPGFSARPPPGPRNTRQFGSNPASSMGGLSQSQMFAQAQAQAAV
                     SGKTAAAASLTNGKKDEKNEKPEGEKGMNVEEKKEKLAANGNAAPDKIKDTDEKEEKD
                     AKPIEKNEDKEKSQDENPWGEDKEEKKGSNPWADDISDEGEKKDEDKTEFTEDAKPKR
                     YSLYIKGLPTPTTEEELKAVVGESGQKAIQVKIIFDQFTKQQKDFGYLDFDSEEVMNE
                     ALKASTGTIRDTPVNVSISKPTVPRYNNRQFGGPGGRGRGGFRGRGRGFGSAGPRRER
                     GEREGSGSGNATAGGEKKA"
     CDS             complement(join(1069816..1070028,1070082..1070147,
                     1070197..1071044,1071094..1071164,1071210..1071311,
                     1071364..1071499,1071549..1071669,1071726..1071868,
                     1071918..1072279,1072364..1072469,1072530..1072686))
                     /locus_tag="CNA04000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511902.1"
                     /db_xref="GeneID:3253396"
                     /translation="MSTPAMATHAPQTNPTPAIVSEKVPLNTQALPKIVFAGRTGRIL
                     CVADIRGDYHELNRLIREHDATAVIHTGDFGFMTAESVDRMNDKILRHLIQYSPLLPP
                     AARTQLLAIPLSAGRSALINQLNNSSVHFPLSQFPHLLSGAINFPVPVFTTWGLVEDV
                     NVIEKFRTGEYGVQNLAILDEATSRLVEVGGVKLRLLGLGGTVADHKLFDYGAFYSKI
                     SKTTEQLPGEGHGSIAGAQGTMWTTALQIGELIDTAQRTFNPDETRLFVSTTPTSRNG
                     LMTLVSNAIKADLTISCGLHFRYPVSYNEYSIHPDFESYRRKMQRAKDDFKGLFDQVR
                     DRVFGSLDDKQTALLHKTLSAIENVPIADDGMWANTWHWSLSDAGFGNMLLSITDSRV
                     SAETKSSGVNFAHRTGKGPAPPTGSTISSAPSGLNSVKSLSSRPGPGPIGARPLPAQG
                     VPSASGPHGAHGAPGAFLSQGRAPVRPGMGPGFSARPPPGPRNTRQFGSNPASSMGGL
                     SQSQMFAQAQAQAAVSGKTAAAASLTNGKKDEKNEKPEGEKGMNVEEKKEKLAANGNA
                     APDKIKDTDEKEEKDAKPIEKNEDKEKSQDENPWGEDKEEKKGSNPWADDISDEGEKK
                     DEDKTEFTEDAKPKRYSLYIKGLPTPTTEEELKAVVGESGQKAIQVKIIFDQFTKQQK
                     DFGYLDFDSEEVMNEALKASTGTIRDTPVNVSISKPTVPRYNNRQFGGPGGRGRGGFR
                     GRGRGFGSAGPRRERGEREGSGSGNATAGGEKKA"
     gene            1072876..1074700
                     /locus_tag="CNA04010"
                     /db_xref="GeneID:3253395"
     mRNA            join(1072876..1072937,1072998..1073828,1073876..1073978,
                     1074032..1074213,1074260..1074323,1074378..1074538,
                     1074586..1074700)
                     /locus_tag="CNA04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_566747.2"
                     /db_xref="GeneID:3253395"
     CDS             join(1072924..1072937,1072998..1073828,1073876..1073978,
                     1074032..1074213,1074260..1074323,1074378..1074538,
                     1074586..1074664)
                     /locus_tag="CNA04010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566747.1"
                     /db_xref="GeneID:3253395"
                     /translation="MSFGGFKFGNSSTTAPATGSAPTTSSPFSFGNTSTSNAQPAAGA
                     SNTGGGMFGGFGQNQQQQPQQPAGGGSSLFGSFGAKPAAPAAGTTGTGGGLFGGASGQ
                     QQQPPSGGGGLFGSTTQPQQQAQQSGSGLFGSTTQPQQQQQQTGGLFGSTMQPAQQSS
                     GLFGSTVQKPAGSGLFGSTTQPTQQSTGIGLFGSTAQTAQQPASTGLFGSTTQQQQPS
                     TSLFGQSTAQLGGSSLFGQTTQPPQNQQQELKTSANPGANTGADKTTKFSDLPEAAQK
                     YIEQLDTAIKNQKSIASTLQTEPLGRAIWQTSLDVKSATEEYSSISHTLKSLKNSISQ
                     LRDKMIDQSRDVERIKEIWDIYTSGEGRMGQIRLGAYKEFPHEFFSKVANSMEERVTR
                     YKKTITQLNRVVASLSSDSQTSSPQVIAQTINNHQQAILALAAQLDQLQVRMNGLKAE
                     FTADWRDKTGSVRDPFEMAREERNVKV"
     gene            complement(1074046..1075787)
                     /locus_tag="CNA04015"
                     /db_xref="GeneID:36392679"
     mRNA            complement(join(1074046..1074138,1074197..1074635,
                     1074724..1074745,1074804..1075787))
                     /locus_tag="CNA04015"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656079.1"
                     /db_xref="GeneID:36392679"
     CDS             complement(1074860..1075696)
                     /locus_tag="CNA04015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514151.1"
                     /db_xref="GeneID:36392679"
                     /translation="MPTEVTPSPHQLAVNAAFYHGWSSMPSSGPAQASDLLPIRHIPG
                     SVMPNGLRNPWAHYHGETYAPSAHVAAVQGEHRFAGSDSYVGGGGSMIEGRAMSFAGG
                     GGGSVIAPSSVSLGGYREDDGWNGSMGRVHAGHAPDMSSTAGAISYVTPVGGAGGWLN
                     QPASWGNHARMTPTVVAALAGSEVVHPVYGQSPSYSPIGGHHRSSSVPSSRRRNSVVE
                     DCSPCHSYVKSGHTRRTSTPVPIHAGSPMRRMKELPCDQGLKRSGSRRRIRRYSGTNY
                     PE"
     gene            complement(1076587..1079033)
                     /locus_tag="CNA04020"
                     /db_xref="GeneID:3253394"
     mRNA            complement(join(1076587..1077780,1077831..1077998,
                     1078047..1078314,1078372..1078670,1078738..1079033))
                     /locus_tag="CNA04020"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_566748.2"
                     /db_xref="GeneID:3253394"
     CDS             complement(join(1076680..1077780,1077831..1077998,
                     1078047..1078314,1078372..1078670,1078738..1078938))
                     /locus_tag="CNA04020"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_566748.1"
                     /db_xref="GeneID:3253394"
                     /translation="MPAAVRERSPSSPSGRAAKKSRNNTEHAVLSSINHPSAEQVAAY
                     REKYVNAAPFKHAVLSDLLSDDLLEGVVEESKKFGMRGEEGSLPGWGWEQKETDIYKI
                     HQTPDLSSLSPEHLPDETLEALPLLTRLKDALYSQEFRNLVRQVTGCGPLSGTKTDLS
                     AALYTKGSHLLLHDDSISTRLISYILYLPYSIEEAPESQNVALQRSTNGKFLKGWDPA
                     WGGSLELFSVETGEEVGPPSVKRFAKVSATWGQIVFFEVQPGRSYHSVEEVVIDEGRR
                     RFSVSGWFHRPVEGEEGYAPIDKEKEQKQLSSLAQITAAPSMPFTPYNTTPPPGLKPS
                     DIAFLSNYLSPSYLTVATLERLSGQFVEASEIVLHNFLQPELAAKLKAETEGVDKKDQ
                     ASYEGLLPPQELGEGDGWIIQGPSSKHRYLNLTSLTTSTPIVQSIHNVLFPSEAFRAW
                     LSVVSSLAPTGHRNEARRFRNGLDYTLANGEGKDGDARLDVSLGMTWWADVPAGSDEE
                     DALVENGGWEAYLAAPDEDEDPTVYQSSVAKKAVKEHSQEPKEPNGKKVEEKSKPQAN
                     GSSEKKDGPSISIGGQELEFDPDQFSPSDFDSDSEAGDEDDGPLLTQPVAFNKLLLVL
                     RDPGVMKFVKYLGANAPGSRWDVSGEFEVGVLEEEPAEDGAPEAEGSGEGKADA"
     gene            1079204..1080733
                     /locus_tag="CNA04025"
                     /db_xref="GeneID:36392680"
     mRNA            join(1079204..1079313,1079386..1079456,1079502..1079523,
                     1079564..1079747,1079797..1080031,1080086..1080467,
                     1080525..1080733)
                     /locus_tag="CNA04025"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656080.1"
                     /db_xref="GeneID:36392680"
     CDS             join(1079250..1079313,1079386..1079456,1079502..1079523,
                     1079564..1079747,1079797..1080031,1080086..1080467,
                     1080525..1080694)
                     /locus_tag="CNA04025"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514152.1"
                     /db_xref="GeneID:36392680"
                     /translation="MQAFQQPSQQSLAGRGRVATLGMFIIDHFEVHDEDGNPVPADEE
                     AIGGGGIFAMIGARQFLPPTHCSLLVDKGEDFPDKFVHDLESLGKEMVWFRHREGKTT
                     RALNIYSGRRIGEGHQSFKYLSPQLQITPRDLVLPPSPFATPVPPEWIHVVCGVPRML
                     DIVDELEFLEKQRHSSTGLSLIKSRLVWEPLPFSCVPEELNNMVSLSSRIAVFSPNLL
                     ELQSILSIPHSSPPAHSHVELAAQQFQTLLLNRSSGSQIPSIFVRAGELGAYTLSSNW
                     TGWIPAFWTEADQDKIVDVTGGGNSFLGGLVAGLLISDGDIRTASIYASTAASFAIQQ
                     RGPPCLQQLNGEERWNGEVVWDRLNEMARRVSQQEGVDRRS"
     gene            1080985..1083082
                     /locus_tag="CNA04030"
                     /db_xref="GeneID:3253393"
     mRNA            join(1080985..1081118,1081185..1081830,1081889..1082030,
                     1082082..1082218,1082274..1082409,1082465..1082556,
                     1082621..1082749,1082805..1083082)
                     /locus_tag="CNA04030"
                     /product="cell division cycle 2, putative"
                     /transcript_id="XM_024656256.1"
                     /db_xref="GeneID:3253393"
     CDS             join(1081058..1081118,1081185..1081830,1081889..1082030,
                     1082082..1082218,1082274..1082409,1082465..1082556,
                     1082621..1082749,1082805..1082961)
                     /locus_tag="CNA04030"
                     /codon_start=1
                     /product="cell division cycle 2, putative"
                     /protein_id="XP_024511904.1"
                     /db_xref="GeneID:3253393"
                     /translation="MDSEGRNTAPLQPSPASPSRHQSPLAENQGSSSSISKGKKKSLL
                     DGEAHNGESPSSPGPISIKRRLVRPKKIRQSHGDVSPPTSVDPQMRQETLAFAEPEPL
                     KPARSPSLRQSSKSPSRHPSPAASTPSFADAPLPPPPRSRFAPPRSSHPPLVSCRSVY
                     NYTRLNHIEEGTYGVVFRARCNDTGEIYALKKLKLDEEKQGFPITSLREVMALMISGG
                     HENVVGIREIVVGDTLNQVFIVMPFIEHDLKTLLADMPHPFLQSEVKTIMLQLLSAVA
                     HCHANWILHRDLKTSNLLMNNRGQIKVADFGLARKFGDPLGEMTQLVVTLWYRSPELL
                     LGGKEYTTAVDIWSIGCIFAELMQGEPLFPGRGEIDQINRIFQLLGRPNDESWPGYST
                     LPLVQKINPIGPMFSTLRQKFKHLTYEGHNLLSSLLCYDPERRITAEEALKHPYFSEH
                     PLPKHPDLFSSFPSQAAGERKHKSLISPSAPVREDRMAKDSLADLDSFV"
     gene            complement(1082974..1085813)
                     /locus_tag="CNA04040"
                     /db_xref="GeneID:3253392"
     mRNA            complement(join(1082974..1083213,1083264..1083789,
                     1083847..1083967,1084014..1085201,1085252..1085360,
                     1085414..1085469,1085533..1085571,1085661..1085813))
                     /locus_tag="CNA04040"
                     /product="f-box/wd-repeat protein lin-23, putative"
                     /transcript_id="XM_024656257.1"
                     /db_xref="GeneID:3253392"
     CDS             complement(join(1083046..1083213,1083264..1083789,
                     1083847..1083967,1084014..1085201,1085252..1085360,
                     1085414..1085469,1085533..1085571,1085661..1085751))
                     /locus_tag="CNA04040"
                     /codon_start=1
                     /product="f-box/wd-repeat protein lin-23, putative"
                     /protein_id="XP_024511905.1"
                     /db_xref="GeneID:3253392"
                     /translation="MPGSPPLQRHVSTKAELLQKALTLPLELRRELATSLLWSMPRNE
                     VLALNERLNMMLQKDIVGLLPPELAFLILSRLDLGDILKCSSVSRTWRNLCNKQALWA
                     LLCATNSPPIRPLPISWAELTTQYSLPPPTDDIEDPTFDISLSDDRLSNHYDVIDGQG
                     GMGGGGGIDPLGMSGGLRWNVWERGGAGSGEGLPVHLQRSAVNVQEFKKKEEPPITSH
                     LAVPSANPQANFKHLYIVHHILEQRMKTPRPIGMANYMPSPPEEVKVNMPSLPPVPRP
                     RTIDAISSIKYGGLPGHSEAVYSLSLISHSMRINMLQACPDCHVQLAPPSNLSGITEG
                     QFRLSVMETLSGAGTSPRRKLPNLSQAGGTRDLVTGRDWLLSGSRDKTLRLWQLSPAP
                     RVVKIFHGGHTGSVLTHAIVKVPCLPFISSPQSRFSKLEIGSSAKEAKERVKVMAVSG
                     GSDGKICLWDVEGGNGEPEKCVKAHEDSVLCVRADDERIVSCSKDKTIRLFSIHTLEP
                     LLVIGGTADLYLHRGAVNAVGLSKDYIISASGDKTLRVWSIKTGALLACIEGHHRGIA
                     SIDFSPLPPSPINLPDGQIFRGLIVTGSSDASIRTFHLIEDRIPDLQNLKMGHSMVTS
                     ATDGSEDGYSQANTYGIPTELTGEGHKVILVPQGSFFSPCICPPGLSRMEGGVCRRCF
                     NRGHLDLVRTVHFGKGVILSGSYDATVKVWSPTGEIIADLHGAHTGRVFSVVGDRMRI
                     VSSGLDCRINIWDFSEGLDTSFVAP"
     gene            complement(1086022..1087860)
                     /locus_tag="CNA04050"
                     /db_xref="GeneID:3253391"
     mRNA            complement(join(1086022..1086366,1086423..1086825,
                     1086880..1087234,1087520..1087714,1087800..1087860))
                     /locus_tag="CNA04050"
                     /product="elongation factor 1-gamma (ef-1-gamma),
                     putative"
                     /transcript_id="XM_566751.1"
                     /db_xref="GeneID:3253391"
     CDS             complement(join(1086088..1086366,1086423..1086825,
                     1086880..1087234,1087520..1087714,1087800..1087827))
                     /locus_tag="CNA04050"
                     /codon_start=1
                     /product="elongation factor 1-gamma (ef-1-gamma),
                     putative"
                     /protein_id="XP_566751.1"
                     /db_xref="GeneID:3253391"
                     /translation="MAPKLTGFPGNSRVRRVLSVAALAGVELEHDKSFTFASEWKTPE
                     FLEKNPFGFLPVLELEDGTTLRECAAIAEYIAEIGSNKNLIPSDPKLKAIVHSYQATA
                     DQEIFIPGGLANAMLYGKAPYHKAVFQTLVERVTGRLNVIDSILAKRTFLVGERVTLA
                     DIFVVTAVTNIFTTWFDAPARAKVPNLLRFVETIINHPKLKEIFTPIEFSEKAPAPQP
                     PVNKDQKKKEEPKPKAEKAPKAPKAKEEDEEEEPAVPAEPKAKNPLDDLPKSAFNLEE
                     WKRQYSNLDTRGANGSLAWFYEKFDKEGFSIWRVDFKYNEELTQVFMSSNQVGGFFNR
                     LEASRKYLFGSVGVLGKANDSVITGVLVLRGQDAEPVVNVAPDWESYSFKKLNLDNAD
                     DKAFFEGAMAWDLVENGREWADGKNFK"
     gene            complement(1088160..1090149)
                     /locus_tag="CNA04060"
                     /db_xref="GeneID:3253248"
     mRNA            complement(join(1088160..1088657,1088712..1089382,
                     1089436..1089686,1089747..1089855,1090030..1090149))
                     /locus_tag="CNA04060"
                     /product="methionine adenosyltransferase, putative"
                     /transcript_id="XM_566752.1"
                     /db_xref="GeneID:3253248"
     CDS             complement(join(1088551..1088657,1088712..1089382,
                     1089436..1089686,1089747..1089855,1090030..1090085))
                     /locus_tag="CNA04060"
                     /codon_start=1
                     /product="methionine adenosyltransferase, putative"
                     /protein_id="XP_566752.1"
                     /db_xref="GeneID:3253248"
                     /translation="MTAVNVNGNAPATELAPGHFLFTSESVGEGHPDKICDQVSDAIL
                     DACLAEDPFSKVACETAAKTGMIMVFGEITTRAQIDYQKVIRDTIKKIGYDSSEKGFD
                     YKTCNVLVAIEQQSPDIAQGLDHGALEKIGAGDQGIMFGYATDETPEMMPLTIMLAHK
                     LNAAMAIARRDGSMGWLRPDSKTQVTVEYKKGEDGAMVPLRVDTVVISTQHAEEITTE
                     QLREEILEKIIKKVIPKNLLDDRVIYHIQPSGRFVIGGPQGDAGLTGRKIIVDTYGGW
                     GAHGGGAFSGKDWSKVDRSAAYTARWIAKSLVAAGLARRALVQLSYAIGVAEPLSIFV
                     DTYGTGKKSDAELVEVIRQNFDLRPGLIVQALNLQQPQYLKTAAYGHFGNPAYSWEQP
                     KQLNF"
     gene            complement(1090249..1092590)
                     /locus_tag="CNA04063"
                     /db_xref="GeneID:36392681"
     mRNA            complement(join(1090249..1090479,1090540..1090560,
                     1090677..1091192,1091241..1091316,1091364..1091469,
                     1091523..1091601,1091657..1091799,1091854..1091966,
                     1092019..1092108,1092166..1092590))
                     /locus_tag="CNA04063"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656081.1"
                     /db_xref="GeneID:36392681"
     CDS             complement(join(1090820..1091192,1091241..1091316,
                     1091364..1091469,1091523..1091601,1091657..1091799,
                     1091854..1091966,1092019..1092108,1092166..1092451))
                     /locus_tag="CNA04063"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514153.1"
                     /db_xref="GeneID:36392681"
                     /translation="MTDDGLKQLLIYKSYRGPQYIRTTVTRHYSITMLISRLIPRPTL
                     GTIPMAIRSLPKTTFGPAWKFSQPIRMQSNRGPRIADVLENLNDLKKQHGPRYDELVV
                     STRALLNGLRDSQSLDQLIQDRPVNVDYRDVLRAVYSLAPNGESSEPCLKLNDLEKVI
                     PPYSNAVVWFMIYDLVTKKFVPRLEALDDKWKAMVKFNRIHGFGKIRARAFAEEGIET
                     LNDLMIAEGGRFSISGAQKLAIQYHEEMDVMIPRAEVEEFDGIIKDALRREDPKLNFA
                     IMGSYRRGENLSSDIDVVVWHESYVKKEKEKKRARKADPNSLMSKIVAALVSANIISP
                     ANIFSQGERKVLALTQLPKANSLHRQIDLRLCPIESLPYMLLGNTGDGKLMKIMRWRA
                     IQRGWVLNEYAMGERDGVSISHSKCRIYK"
     gene            1092825..1093461
                     /locus_tag="CNA04065"
                     /db_xref="GeneID:36392682"
     mRNA            join(1092825..1092930,1092981..1093108,1093184..1093461)
                     /locus_tag="CNA04065"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656082.1"
                     /db_xref="GeneID:36392682"
     CDS             join(1092983..1093108,1093184..1093345)
                     /locus_tag="CNA04065"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514154.1"
                     /db_xref="GeneID:36392682"
                     /translation="MSKGTRFLTLAVPLLLLYILALYHIVPTPLLPTELADDILPVLP
                     WWLLVSFGAYSLTSLGLGLVRFHDCPEAYESLLSEISQARNELRNAGVAVD"
     gene            complement(1093401..1094496)
                     /locus_tag="CNA04070"
                     /db_xref="GeneID:3253247"
     mRNA            complement(join(1093401..1093609,1093668..1093820,
                     1093886..1094007,1094062..1094239,1094322..1094496))
                     /locus_tag="CNA04070"
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /transcript_id="XM_024656258.1"
                     /db_xref="GeneID:3253247"
     CDS             complement(join(1093535..1093609,1093668..1093820,
                     1093886..1094007,1094062..1094239,1094322..1094432))
                     /locus_tag="CNA04070"
                     /codon_start=1
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /protein_id="XP_024511906.1"
                     /db_xref="GeneID:3253247"
                     /translation="MKSVNRWLYGPTPEEKVRSWQTKLRQQERQLDKEIRNLETATQR
                     SRIELKQLAKKNDVKSAKILAREVVRANKQRDRLESSKARIKSVNMQLQHQLSMVKVT
                     GAFQKSTEIMKTTNALVKLPQLSATMREMSMEMMKSGIMEEMMEETLDSVDDEEIEEE
                     ADAEVDKVLYELTDGKLGQAGAVGAALPAEEEEENEEEMQRMRKEMQELLSS"
     gene            1094668..1098725
                     /locus_tag="CNA04080"
                     /db_xref="GeneID:3253381"
     mRNA            join(1094668..1094764,1094812..1094948,1095004..1095221,
                     1095276..1095358,1095406..1095746,1095792..1096012,
                     1096064..1096176,1096227..1096606,1096663..1097796,
                     1097849..1097930,1097989..1098542,1098596..1098725)
                     /locus_tag="CNA04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656259.1"
                     /db_xref="GeneID:3253381"
     CDS             join(1094722..1094764,1094812..1094948,1095004..1095221,
                     1095276..1095358,1095406..1095746,1095792..1096012,
                     1096064..1096176,1096227..1096606,1096663..1097796,
                     1097849..1097930,1097989..1098542,1098596..1098631)
                     /locus_tag="CNA04080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511910.1"
                     /db_xref="GeneID:3253381"
                     /translation="MWLLTVVGEILGQKHYTFALQQQKSYTFGRNKDCDIAFPNNLRV
                     KPEEGTLEILEWDYTNRHSRPDIKWRPKPKKNGDYGTIVAVGKRPETPNGSLNKGDYD
                     ILPINNEKGSGVFVDELNVTGISFADDIWFFLEWRDLCLLYGKMMDEPDPIRNTLKSY
                     CISWTTTFDTSDPPQYVLLDTYRNNWEARYAVCCGIPILLPSFLALLQSRLTINWRKT
                     ADAFCSFKFPLPGEDEAEYRPKNHQSIRFSSSIWLPDRRRRTLYRGWHVLLLREQIQP
                     REAFMYKALGADLQEVIVEGNPPKTSSDVEEYLADWLSYVDTHGGRKKGLVAYSGKVK
                     DMTDAKIIEDTCERLKVNCASVASAFGAVLNGGVHQFLEGVDNKHNRHAARGSITAIT
                     PAASSSVPSPAADPFRRLTETPTPALTPTPPSEPTVTSVVAESSNAPGVPSTFSDETT
                     PPVPFEPPRLSRRRTAYTKPIIADATPVPVASSEPQHVAVNADGTEEAVDEWRPPPVA
                     VLRRPQRRTVGKGARNTPTSAPAPAQPLATPQFNGTDTHVTSLDPHPSFAPNSMPSQE
                     EDSPGVAPGPSRAGLSDFPSSTQQNTMPPIQTLPRPSRRYGTTSSIARPQAAPSRVAF
                     EETVEEEEDDRLKKLYEKTRKQGFGPASLAKKVRTADRGGDVEMEDTQISSAASMTDR
                     ERYKAPSEILHIDEEPEEEEEEQDLFAQTMRRSKRPASAAGLSATQGTAPEVRSKDIG
                     GRDSQDLMPPPAQRRRIQSPSPSPEPGPSEDQAPRRAAPSQNRFDFQDAIPQPMTRDE
                     QFLRVVAERKKAKAAIDNLDKSFDSMLRIPKAQTESEADKPDYSVLDEVPPPKAGNYI
                     AVMRTNSLFRKDLGQTKERENVEDGRPNFKKFKRKNVPRRAPLKMVLTTSVVDPSKYE
                     EPEPYWPTQKKTQKKSQAQSGSLSDPEEDDRPLLPRHKPRLLVEDDNEGDGDVKFMAT
                     GQAAAGRRGTQRNQIRDNRVTLGTSAQRTKGGESVASDTYDDQAARSDVSKTTHSKAA
                     TKATAARGRNKLLVEDNDTTIDWASSPSTAKGGKSSFESSGTATLDENPSSTARKGTQ
                     KRKALAVDVDDDEGGFGNFGKRRRR"
     gene            complement(1098699..1100482)
                     /locus_tag="CNA04090"
                     /db_xref="GeneID:3253379"
     mRNA            complement(join(1098699..1099032,1099085..1099646,
                     1099699..1099781,1099833..1100076,1100129..1100265,
                     1100315..1100482))
                     /locus_tag="CNA04090"
                     /product="expressed protein"
                     /transcript_id="XM_566765.2"
                     /db_xref="GeneID:3253379"
     CDS             complement(join(1099549..1099646,1099699..1099781,
                     1099833..1100076,1100129..1100265,1100315..1100424))
                     /locus_tag="CNA04090"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566765.1"
                     /db_xref="GeneID:3253379"
                     /translation="MEQQQPNHDMREDQQDYSFSEQNVSQEMSEEGWRALAKIVRDVN
                     PNLSPDEELGDLAAAEAAVNAKDAERTEIVDKLRDELRQLSRQHSQAAAAAQRPPSHP
                     SPAEHEANVRSLEQQQFSIAKQLNEEQAAVAKKEVELGKWKTAKEDIEKVEIGEGDWA
                     DGKVIRLKLFSEAGFSLVSAKDGSNVTKVLIRNDAKEDVHSVVVDNSRPKVYTANLIW
                     SLASD"
     gene            1100700..1102643
                     /locus_tag="CNA04100"
                     /db_xref="GeneID:3253377"
     mRNA            join(1100700..1100856,1101017..1101257,1101389..1101898,
                     1101955..1102247,1102318..1102643)
                     /locus_tag="CNA04100"
                     /product="choline-phosphate cytidylyltransferase,
                     putative"
                     /transcript_id="XM_566767.2"
                     /db_xref="GeneID:3253377"
     CDS             join(1100754..1100856,1101017..1101257,1101389..1101898,
                     1101955..1102247,1102318..1102532)
                     /locus_tag="CNA04100"
                     /codon_start=1
                     /product="choline-phosphate cytidylyltransferase,
                     putative"
                     /protein_id="XP_566767.1"
                     /db_xref="GeneID:3253377"
                     /translation="MSANPPAQKRHNRNRLGERRVNRDPSSSRDASEEDNDNVENSFS
                     DVGSMNSYHAEALSTTSTIDSPTRMPPPALPPHSSSGSPSTTQAGRRSYQQRRVEELN
                     GEGSQSEGLDSPTYDGDVESSSTIGGAPAHHQHTHFRRPSFPAPVPTSETPHPAAHIV
                     QRQPTPKASQIGFSAADYPAVPTPKATYVRPSDVPVAPSVALEECARSPPTTSWIQSP
                     NSAGGPPKMYARAVERTEEDIKGFVERAIHGRGQEDGVERWWKTNPPPEGKVVRVYAD
                     GVYDLFHFGHALQLRQAKLSFPQVHLMVGVCSDVLCAQHKSAPAMTHAERCEAVRHCR
                     WADEVIPDAPWVVDQAFLDKHQIDYIAHDEEVYPSKDHEDVYAFAKKEGRFVPTRRTP
                     AISTSDLLERIVRGYRDGFFDSKLEKNGHPELLAADVDWDSSASMEKREKRKAAHHHK
                     VKK"
     STS             1102175..1102976
                     /standard_name="Pst9"
                     /db_xref="UniSTS:470891"
     gene            complement(1104158..1106876)
                     /locus_tag="CNA04110"
                     /db_xref="GeneID:3253375"
     mRNA            complement(join(1104158..1104338,1104412..1104482,
                     1104539..1106236,1106298..1106876))
                     /locus_tag="CNA04110"
                     /product="ER organization and biogenesis-related protein,
                     putative"
                     /transcript_id="XM_566769.2"
                     /db_xref="GeneID:3253375"
     CDS             complement(join(1104317..1104338,1104412..1104482,
                     1104539..1106236,1106298..1106771))
                     /locus_tag="CNA04110"
                     /codon_start=1
                     /product="ER organization and biogenesis-related protein,
                     putative"
                     /protein_id="XP_566769.2"
                     /db_xref="GeneID:3253375"
                     /translation="MTMAQKQAAIAEERRRRDEAQRKQFEADGAFWENLGSRSSAATS
                     ASSRSNHGTFWDQYGDDGDLLSAGSNPVSQPRSHAHSPAPLPPAHTDPFDFDAFENTL
                     NGSAKAALASEASNSGETSAIRTPVSNVDLWDGDGNDDDLLGELGRPAASKPAQTKST
                     LPRTPQEPPPASPPPHIVGQIVEMGFAPTQARQALAKTSTGTDVQEALELLLGSGQGQ
                     GHAPGNAGPSGSWDDHLPEADDDRIEYERRKRQEAEKERRRRRRAGPSRDSVKARTTE
                     EQERDAAAAAANAQEQAERILAQASEIGQSMFNKATSFWNTSKERAIKVYEEQRKALE
                     AAERGEDQKKKDTRPKWMQENEGWKDERSRQVRGGFKDSDDEQEIGPSIPAPRREQRP
                     ARQEGIADLLSGNDHHPAHRPTSRPTSRPASRAAPSPKPAAPPLPRRPLISATPLQLE
                     SSAAHKTKGNDHFKLGRFTEAESCYSSAIAALPKDNLFLIPLLNNRATTRLKLGDAVN
                     AATDCTAVIDLVGISYHPGKEAPLPAEYADIKLGDGLSKALVKRAQAWEMGEKWKAAL
                     EDWERVMGLDPVLLGGTNAAASTRNMAAQGARRAKKMMQSGGNVAAAAPAVVSSPAPS
                     TPAADVNRSAAVADLRKAAQALEAEEEARLFHKDNVDAKIANWKSGKETNLRALIASL
                     DTVLWDDIVKEGGLKVGMHELVTDKQVKIKYMKVIARLHPDKLNTQNTTVEQRMLANG
                     AFGVLSDAWQAFNQ"
     gene            complement(1107116..1109185)
                     /locus_tag="CNA04120"
                     /db_xref="GeneID:3253373"
     mRNA            complement(join(1107116..1107218,1107275..1107605,
                     1107655..1107815,1107871..1107999,1108058..1108351,
                     1108415..1109185))
                     /locus_tag="CNA04120"
                     /product="Type 2C Protein Phosphatase, putative"
                     /transcript_id="XM_566771.2"
                     /db_xref="GeneID:3253373"
     CDS             complement(join(1107194..1107218,1107275..1107605,
                     1107655..1107815,1107871..1107999,1108058..1108351,
                     1108415..1109169))
                     /locus_tag="CNA04120"
                     /codon_start=1
                     /product="Type 2C Protein Phosphatase, putative"
                     /protein_id="XP_566771.1"
                     /db_xref="GeneID:3253373"
                     /translation="MLSPHHARPYSTPSARPPSVKTTAFVSIALLTSAYLLYRHESES
                     APGKHAVSPSSLLSGGKPTFQLSIRSGRGGVQTYEFERKPDDQVERELRAHEVSRRID
                     RKGNPVVRWDNNWLGSNEPCEDRWATDLVRRDGAAGGAVGKAVNFWTRWYRGDSIPSE
                     SAPAEEDEAARGKHDLMLFSIMDGHAGDATSRLLQKSLHPTISMALAGLQRGNVPPRH
                     NVWERWAGYLNPWYWLGTDTVWTPENVSKTIQNAFVQLDDNICQTPLKLLPTLSSPST
                     SSPTPRETLVALAQPAAAGACAISTLVDSENDDLYVAVTGDCRAVAGWEGEDGKWRCD
                     VLSEDQMGDNPKEIERMRSEHPASERDTVIRNGRVQGGLQPTRAFGDAVYKWTNAQAA
                     QIADAFRAQGERPRPGRPWNYTPPYVTARPEVTYRKLNAHTGEKLRFIVLATDGLWDR
                     ITSEESTLLLASYLSHPSHAPLPKSALPRRFPLAPPPPREKRPYPAQDLPAPTGEAAS
                     DTWVYEGDANAATHLIRNSLAGGDVKTRAELVSLGGKVSRWMRDDITVTVVFFGDS"
     gene            1108955..1110670
                     /locus_tag="CNA04130"
                     /db_xref="GeneID:3253371"
     mRNA            join(1108955..1110263,1110333..1110405,1110468..1110670)
                     /locus_tag="CNA04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_566773.2"
                     /db_xref="GeneID:3253371"
     CDS             join(1109247..1110263,1110333..1110405,1110468..1110601)
                     /locus_tag="CNA04130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566773.1"
                     /db_xref="GeneID:3253371"
                     /translation="MGLLAVLAFTQGLATFSQVLLGLPAALALLGPASFLLLSLLYTA
                     HHLLYATLRLALKNTPLAPLVSVAAVLSPAISAALALLTLYFYLAPPAPGATLAHCLV
                     NILPFAYAQLLRWVSPLFTLLEGISTLLVIQVAGRVGKGWADEEDRDEGLEWRTVVAL
                     VAAALVYCAGLAGVVKTFPSLPFPAFLLGAALTAVLFLSLIGFSLKRTNVLETSLVFV
                     YVVYSAWLSGVEAEMPSGTFGSSSSSFPPPSPLRQSHPLPSTVGPSVNSLLSYALHAA
                     VPSFITVSETLPPHLVLSLIYRVTVLHLAAKIVPVLRRASMGWDDRDEREGFWDGRTL
                     GDEPANMRITTVFLSYRRAILIAVYTHLLLLDGGSQTWWRWVNIALLLSVWSLELLLD
                     AEGDDTDSVTRWKVD"
     gene            complement(1110644..1112882)
                     /locus_tag="CNA04140"
                     /db_xref="GeneID:3253369"
     mRNA            complement(join(1110644..1111913,1111967..1112046,
                     1112106..1112455,1112523..1112882))
                     /locus_tag="CNA04140"
                     /product="tRNA dihydrouridine synthase, putative"
                     /transcript_id="XM_566775.2"
                     /db_xref="GeneID:3253369"
     CDS             complement(join(1110706..1111913,1111967..1112046,
                     1112106..1112455,1112523..1112717))
                     /locus_tag="CNA04140"
                     /codon_start=1
                     /product="tRNA dihydrouridine synthase, putative"
                     /protein_id="XP_566775.1"
                     /db_xref="GeneID:3253369"
                     /translation="MSVAAQVVSSEGPQSVGDELQTKKQFPTFPAPGKPTHEKLGGYD
                     FYRSIGSPKFVVAPMVDQSELAWRLLSRSPLPPALAGPSETVTTPQGKAYIRHPGGAH
                     VCYTPMIHAKVFVDAKGEGGRNGDGQFCLSLDEEGGEGTIGGVEGGDRPLIVQFCAND
                     PDILLAAAKKVEHRCDAVDINFGCPQGIAKRGHYGSFLQDEWELIHKLISTLHENLSV
                     PVTAKFRIFPDLDKTIAYARMMEAAGAQILTCHGRTREMKGQNTGLADWEYIREVKKA
                     VKVPVFANGNILYREDVDRCMEVTGCDGVMTAEGNLSNPAIFMPPEHPHAHPPITVLA
                     HRYLDIVEALDTPTAGSAIKAHLFRLLKPVLDTDEELRVQIATCRWSDGMDGFREIIR
                     DIERRCAPVREALGADWRPPTVDPKTGYRSLPMFAAQPQIRAKPVSTEIGGHEDMVSR
                     PVSPGKEGEGRMFDTPNITTAPASSVPGTVLFSRSHRHTSLGQTERCVHSDCTGVAAT
                     RCPTRACITHCRILRAVEAGYTREEAEAEGAKGGLVGMGCDAHEEKVRARKEREARKR
                     KGREMAKEKAKERKKEEKAKEEREKSKEKVGMTEEEVSFAAGLA"
     gene            1112989..1113890
                     /locus_tag="CNA04145"
                     /db_xref="GeneID:36392683"
     mRNA            1112989..1113890
                     /locus_tag="CNA04145"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656083.1"
                     /db_xref="GeneID:36392683"
     CDS             1113013..1113750
                     /locus_tag="CNA04145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514155.1"
                     /db_xref="GeneID:36392683"
                     /translation="MASCLAASSSFGSRLHRTVCVLCPGVARGFSSSSIGCWRQDSPS
                     DRFSGTARGARGGVIGEKAPKEKVDAPEALPNPPKSKKARHRPLLRPPSHPVQTLPSS
                     SAPTPQHTPHTPSLPEAVAHKPHGPWQPTKKLTFSAMAGLRALHTLDPERFSRAFLSR
                     KFGISHEAVTRILKSKFRGQKIDGIEGLDGVMGLLNEEASEEAPPGGLGQPDLRGTKW
                     DKAPETSERVSPVPAIMRAYRQSRRSR"
     gene            complement(1113762..1117895)
                     /locus_tag="CNA04150"
                     /db_xref="GeneID:3253552"
     mRNA            complement(join(1113762..1113925,1113976..1114041,
                     1114090..1114815,1114862..1115350,1115402..1115725,
                     1115728..1116665,1116711..1116788,1116838..1116847,
                     1116901..1117895))
                     /locus_tag="CNA04150"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_024656260.1"
                     /db_xref="GeneID:3253552"
     CDS             complement(join(1113899..1113925,1113976..1114041,
                     1114090..1114815,1114862..1115350,1115402..1115725,
                     1115728..1116665,1116711..1116788,1116838..1116847,
                     1116901..1117818))
                     /locus_tag="CNA04150"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_024512058.1"
                     /db_xref="GeneID:3253552"
                     /translation="MILIRHKSCSLASLVGLTLPRATCRAPQQYRSSSSAAIPPADQE
                     EHQSKPLTGSARLFADAEAEEKVTSNASNRDHLRMTQGPVWTGDESPADAVLRMLVDA
                     HKPLRNEGGVKHNAADEKIKGWMKGLQLEPILGPGPSLPPEEAQEIALESVEKENAHR
                     TKIPPHLHRPWHSTYTGEYQTAETPKVKYGAFTNKRTDGDSLTNLLELQLPPNADSKT
                     RAKVKAARKSTMFMGRLDKAREGALDYKLGLGVDDAHVVETGEEGEVSEEGQTFKGNR
                     QIKGSSVLGAQRGSASGMKAWAGLVEDRILRAREAGFFNNASGKGKPIVADPEARNPH
                     IERGELFMNRIIKRQGALPPWIELQNLLDSNLRSFRATLLTTYKTQLVRNIISTNALH
                     PLPPLHAIPDRDEAWEAREFKFHQENVKQINDLVRRMNAQAPSPARRHLITLEGELNR
                     IRGNMLKNEVWEEIKRRAEESINMPYQRERSGLAAFIFEGENWTKLKNATNRSFGTVA
                     VSGTAPLANANVSGLEGSSKGYSGDPTGDHSSGPSSYSGRDPRPLRLVVMAGVGVGVI
                     IYLRRRPVKNDSAHLNPFHHHLQPTPTPQPDIVASSPSEPPLTFIRIIEIYILEPIGT
                     FFRFLHLACLFVPVILLSPMLLVGPGKRRRSRSGRPISEEEQSWGAIWWYGFLVKQME
                     RAGPSFIKLGQWAASRADLFPAELCEKMSKLHSNGRPHSLGYTKKVMEAAFGMGFDDI
                     FEEFDEEPIGCGAIAQVYKAKLQSKILTDTKLDGLPRSTESDTASVAIKVIHPRVRKI
                     IRRDIAVMSIFAKFVNAFPGMQWFSLPEEVQVFGEMMNSQLDLRVEASNLDKFLHNFG
                     KRGRRVTFPTPIKLGDGKEELEEEMKDILVEEFEDALPLKFFLQNGGGPYDHKIANIG
                     LDAFLEMLLIDNWTHGDLHPGNIMVRFYKPTTTDYLSPLLHAFGKNPTPSTDASVASH
                     DNLVHTLAAVSRDREKWLNKLDELHQDGYEPQLIFIDAGLVTSLDSKNRANFLDLFQA
                     VAEFDGYKAGKLMIERCRTPDFAIDEETFALKMQHIVLSVKSKTFSLAKIKISDILTD
                     VLKAVRQHHVKMEGDFVNTVISILLLEGIGRQLDPDMDLFKSALPILRQLGKQMGTRE
                     AIQATPTGNILAMIKLWVWVEARQVAGEVSTLDEWMKYDRLTPSI"
     gene            complement(1119099..1122225)
                     /locus_tag="CNA04160"
                     /db_xref="GeneID:3253367"
     mRNA            complement(join(1119099..1119375,1119436..1119584,
                     1119641..1119907,1119960..1120031,1120104..1120283,
                     1120334..1120521,1120575..1120664,1120713..1120769,
                     1120830..1120901,1120952..1120982,1121035..1122225))
                     /locus_tag="CNA04160"
                     /product="transporter, putative"
                     /transcript_id="XM_024656261.1"
                     /db_xref="GeneID:3253367"
     CDS             complement(join(1119335..1119375,1119436..1119584,
                     1119641..1119907,1119960..1120031,1120104..1120283,
                     1120334..1120521,1120575..1120664,1120713..1120769,
                     1120830..1120901,1120952..1120982,1121035..1121852))
                     /locus_tag="CNA04160"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_024511914.1"
                     /db_xref="GeneID:3253367"
                     /translation="MSSEQANTAIQPVFEARPVNRRTESSTSIEAVTSNRMTMASSSA
                     TLCQLGEHDDKPSMPDAEHPPAIPEQASGYSKSEKSQVPTRQSSTKHAHPHSHSHQHQ
                     GATPPPVPAPDVVSVFDPASIGGGGPLKRIETQRSERYAEEMREREAREADKSEKKSG
                     ILRRWSTVSRRRPVMIMPPHTHRHSEDEVSPVDDDRDPRHERSSSNISNQTLAITPTP
                     GEREKCDFSDDKEEGRCEAEKHMQEEEVEEHVYPDGGYGWVVLGACCCLAGCTMGWGM
                     NWGVFQEYYLDSVYPNVNTSVLSLAGTLCAFMMNATAFISGRYGDRYGFKRVLYCSAV
                     ITWLGLFLAGWSTKLWQTILTQGILTGFGQGLSLPLFMSLPSQWFYRRRGLASGLAIG
                     GAGLGGGTTTLICRELLTRVGYRKTLWILACINLFCMSLSTFLIRTRPSSPEGKATGK
                     GPWIDWAVVKTSSFWSLVIGLVVSTTGYAMPFNFTAQWTRLHFPNLNPILLALPVTLL
                     GYTVCVGRALIGLIADLLGPMNTFILCFFLSGVVQLCLWLTASSFASVLVFAIMFGLV
                     APGYMGIIPQIIVQLFGPTNLATNVGILLLFNGPGNLMGGPIGGALYDASGRTSFKYM
                     IITGGCLQIAGGLIICWARFKTSRKWLKKI"
     gene            complement(1122817..1124403)
                     /locus_tag="CNA04170"
                     /db_xref="GeneID:3253365"
     mRNA            complement(join(1122817..1123036,1123094..1123180,
                     1123234..1123480,1123530..1123627,1123681..1123709,
                     1123759..1123933,1123989..1124403))
                     /locus_tag="CNA04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656262.1"
                     /db_xref="GeneID:3253365"
     CDS             complement(join(1122849..1123036,1123094..1123180,
                     1123234..1123480,1123530..1123627,1123681..1123709,
                     1123759..1123933,1123989..1124313))
                     /locus_tag="CNA04170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511915.1"
                     /db_xref="GeneID:3253365"
                     /translation="MDMDSAHLDSSLLTLAFRLIKAAQTAAPSVLADLLAEGAPAWFQ
                     DDDLGWSCLHYAAERKEPECLEVLLQGGAVWNAVDKWGRTAGEICLSLGDEEGWSIIR
                     NEGIRSEMLHHALSGTSSPDATNNIVLRAEDKTSAGDNLVFLKSKLTWDVGKDGKERV
                     LDADGNGVMMGWEEPLMVEHVKRLTEEHPKAELGAEGMSILNVGFGLGIVDRLFQECD
                     PKPSHHTIIEAHPQVLEYIHKKGVHLLPNVRILQGRWQDWLLDGEKVGDVLSGTPDGM
                     GFDAIFVDTFAEGYEDLKAFFEVIPDILNADNGRFSFWNGLGATNPTIYAVSSSLAEL
                     HLEDVGLQVEWHDVLIPESMREEVWKGVRRRYWDLPGYRLPIAKMSLI"
     gene            1124451..1125642
                     /locus_tag="CNA04180"
                     /db_xref="GeneID:3253363"
     mRNA            join(1124451..1124901,1124949..1125281,1125348..1125642)
                     /locus_tag="CNA04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656263.1"
                     /db_xref="GeneID:3253363"
     CDS             join(1124547..1124901,1124949..1125281,1125348..1125496)
                     /locus_tag="CNA04180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511916.1"
                     /db_xref="GeneID:3253363"
                     /translation="MEDRQQPYRRPTKRRRLPQSGPLSSSASTSASPPALSPTLDKGK
                     GRAIHDLGLEEDPYDKDCTVEVSTNDSEDEVEEGNLIEDDQGGSSSRGKQAWAMRKAR
                     RVERLREAEKYIHIPPMPPPSNPTSDLLQAIHHHASHFYTSTSLLIPPKKRQRAAPWA
                     SKKRVEVLKDSLLSKGHAQGIESLVNERGEFVSVAREEKVDGGDIRGPRGKYKVRDMY
                     RAIEGEGLMAIGIILQEYVIRTLREIGYQPGEGSQAGIESKGDNEAQGGNEEEENGGP
                     ER"
     gene            complement(1125609..1128715)
                     /locus_tag="CNA04190"
                     /db_xref="GeneID:3253361"
     mRNA            complement(join(1125610..1125812,1125867..1126477,
                     1126531..1126617,1126669..1126694,1126742..1126806,
                     1126859..1126921,1126973..1127236,1127287..1127415,
                     1127463..1127816,1127872..1128001,1128054..1128283,
                     1128363..1128715))
                     /locus_tag="CNA04190"
                     /product="palmitoyltransferase, putative"
                     /transcript_id="XM_566783.2"
                     /db_xref="GeneID:3253361"
     CDS             complement(join(1125651..1125812,1125867..1126477,
                     1126531..1126617,1126669..1126694,1126742..1126806,
                     1126859..1126921,1126973..1127236,1127287..1127415,
                     1127463..1127816,1127872..1128001,1128054..1128283,
                     1128363..1128572))
                     /locus_tag="CNA04190"
                     /codon_start=1
                     /product="palmitoyltransferase, putative"
                     /protein_id="XP_566783.1"
                     /db_xref="GeneID:3253361"
                     /translation="MDQEMTTVASPDIRVKATSPDSNRAVLEQSIVLSDSGRLDEGSS
                     IRGGELERDSQEVGRETVREPLMCHDLDIHALAQRGDTAAIAAMLQENPSLNLSARDA
                     QDVTPLHWAAINAHMGTCRLLIDSGADIDAIGGELKATPLQWAARNGHLYVVHLLISR
                     GADPNIHDSQGFNTLHLITHSSAVMPLLYMLHQPVAIDEKDTDGHTALMWAAYQGDAL
                     SVDLLIRHGASVNSTDNAGMTPLHWAAVKGNKVSIMHLVEAGASLDAKEEAGKTPRDM
                     AEELRGLVPFQKGLEEAGWSIDGVKMEGKLGPRNTILAIFLLPIAVLWLIFSTFKWLP
                     VYVGVPFAIAEFMGMQYTVVLVLLGHIKAQDKVSTSNYFASIITASLIWVGYCWISRF
                     AVNTPGYAFSNLGFIIMFVGCCWTFWTAIVTDPGFVPKGQQDAEIKEVLEDLVDAGRL
                     NGTNFCIVCMARKPLRSKHCRTCNRCVARFDHHCPWIWNCVGAKNHRSFLLFVLFLIG
                     GIILFIRLTIAYIQQNAPEYIPTPNPGLTTCDISTTLCQAGDFDPFLLCMALWSTLQL
                     TWTSVLAISHLWQVSRQMTTFEVSNLGRYGFMGGRGGQSLRDQSGAMLKQAAAVGAGI
                     GMSGAGEEAAGPPGAEAGPEGNALLPPPGGHVHGPQCRHGDHARGHSHGVLHICGALW
                     KTLTGPLMTILGLDRFTKGKALGGMKRAGRDQNPFDMGMVKNCIDFWLPDNDVDYMTV
                     YEIPPGGWRAYRRKLAMDKRVPGGKGRYEVVSEQEV"
     gene            complement(1128911..1129704)
                     /locus_tag="CNA04200"
                     /db_xref="GeneID:3253668"
     mRNA            complement(join(1128911..1129227,1129276..1129383,
                     1129438..1129704))
                     /locus_tag="CNA04200"
                     /product="ubiquitin-protein ligase, putative"
                     /transcript_id="XM_024656264.1"
                     /db_xref="GeneID:3253668"
     CDS             complement(join(1129046..1129227,1129276..1129383,
                     1129438..1129642))
                     /locus_tag="CNA04200"
                     /codon_start=1
                     /product="ubiquitin-protein ligase, putative"
                     /protein_id="XP_024512059.1"
                     /db_xref="GeneID:3253668"
                     /translation="MKVEINSYRAVAYWIWDVSDEPHKLYHYAPPDEVGLDDDDDQDV
                     CGICQAAFESTCPDCKIPGDDCPLIWGECTHVFHMHCLLKWIGQKEDESQQQCPMDRR
                     PWVTADRKPDKQPAASPGQVVQYDHLEHGHASQLDERLTGARGATTRGAHAQVESSME
                     VDEQ"
     gene            1129873..1131045
                     /locus_tag="CNA04210"
                     /db_xref="GeneID:3253693"
     mRNA            join(1129873..1129913,1129973..1130060,1130118..1130549,
                     1130614..1131045)
                     /locus_tag="CNA04210"
                     /product="expressed protein"
                     /transcript_id="XM_567163.2"
                     /db_xref="GeneID:3253693"
     CDS             join(1129900..1129913,1129973..1130060,1130118..1130549,
                     1130614..1130997)
                     /locus_tag="CNA04210"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567163.1"
                     /db_xref="GeneID:3253693"
                     /translation="MGFTLLLQWSCTPPAGRAVSLADVVCARVLESYGHNPPSRLGLQ
                     VRTYRAQFPLSPTTDDNNQDNNNQVSRYLTIISNLMPPAQPGEAKTNAPIIKDDTAYL
                     FLDDRSSTATGGESEHVNRATETSTAAHSSDPIPLQMDEEGKRFRCVAVRPSTAVIPM
                     LQSLLSPFVMGLTKAARTTASQTSSTPVPTSLPGSTLLMTVLTFNALLSPQPPVILRL
                     YILPNQSASSIFLEGEYAGSVDGKSEEEIEGEVKKYLESCLITDLLGERRWIDCSRGQ
                     ENWRAWDDAERNKCAMLTLAKTLRQGNFI"
     gene            complement(1131019..1135301)
                     /locus_tag="CNA04220"
                     /db_xref="GeneID:3253380"
     mRNA            complement(join(1131019..1131226,1131279..1131343,
                     1131400..1131621,1131675..1131803,1131845..1131886,
                     1131938..1132255,1132310..1132603,1132656..1132739,
                     1132794..1132999,1133047..1133218,1133269..1133350,
                     1133399..1133655,1133714..1133886,1133948..1134135,
                     1134186..1134350,1134404..1134609,1134667..1134802,
                     1134857..1134915,1134975..1135106,1135172..1135301))
                     /locus_tag="CNA04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656265.1"
                     /db_xref="GeneID:3253380"
     CDS             complement(join(1131127..1131226,1131279..1131343,
                     1131400..1131621,1131675..1131803,1131845..1131886,
                     1131938..1132255,1132310..1132603,1132656..1132739,
                     1132794..1132999,1133047..1133218,1133269..1133350,
                     1133399..1133655,1133714..1133886,1133948..1134135,
                     1134186..1134350,1134404..1134609,1134667..1134802,
                     1134857..1134915,1134975..1135106,1135172..1135264))
                     /locus_tag="CNA04220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511911.1"
                     /db_xref="GeneID:3253380"
                     /translation="MESLTMDEESPTPSLVSFPVLPQSDLTQVAQTILQLFDPATSSN
                     PAQAKYLQSELQKIQGTPEAWGLIAGLANHEDTNVRFFGAHTAQVKISRDWDTLPQEL
                     HQGLLALLLETLSGAINPKNPHSYQPGNAVVVRKIFGSLASLLLRLEFTIFSHPIHTV
                     IQSMQYAFSQADTQSIGVNLALRLRLLELEWCAICVEEMGRAGLAEQRRAAIRRHVES
                     DLKVVVRTVIRSMNGDNASSTDERLREAEAACKCVESWIDWGLGADELNEVLPVLYNL
                     LPLPAACSAVVEVLSESIFKYGKGTKILTEPLISWATGPSGQSILGLTEEDPSEEAVA
                     FAKLVAALVEHSSEWLVAHIQESQVQTFLGMVLRITGWKGIAGVEENISELTLPIYSL
                     LQEALMDSDLFQAPHQTHPAWLIAKQFFAELVSVTRRKVRWPGEGEVPHGDTLGGLEK
                     DDREAFSRWRRDAGEVVVGAYYVLREEMMQNLTQTAAQQIQDGASWQDVEATLHCIRY
                     SSEAVPLGEDQSLPVLFGEQALGLLTQRPIGGLGEDRLRLTVVCLIQSYEEWFKFHPT
                     HLAPCLSYLVPSLTSRNHSISRSAADALKALCDMCRKKLVEHIGAFSELHGKIGDMGS
                     EEQSKVIQGISSVIQALPPKEAIGPVEAIVNPIIDRMQAAVSTSRTNALEAQPLLIQT
                     INSLTACLKGLSPSDDEIFDAVDGEDQKEEEVKRVRGDERMARLREKTFVAIEGVVGV
                     WNGDSEIADAISSLLKHVSPNPPTLISLPPLPLLSLVTLACSRAPSALWFTLASTVIL
                     SISAPPSFLIKKKDLAAREDEAMRAREEQEKWETVGQCGGRLVEIAQGLFQGEGMKEN
                     PDIVEGWFKFCHSFAERYPGVLLRLQPHQVESYIQLGLAGLRLHERFSLKSASDFFVA
                     LLSKTRFPSPLEAIFDPLLVAFGPSLLHALILSAGSEGPRSVIPNLAELLAGLVTRVS
                     GDVMSAWLEGVLSIDGFPDPRATLESKKKLKTAVLKSRTARRMREALHEFALVSRGLE
                     GTTYGNATAI"
     gene            1135517..1137029
                     /locus_tag="CNA04230"
                     /db_xref="GeneID:3253378"
     mRNA            join(1135517..1135910,1135974..1136370,1136423..1137029)
                     /locus_tag="CNA04230"
                     /product="general RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_566766.2"
                     /db_xref="GeneID:3253378"
     CDS             join(1135562..1135910,1135974..1136370,1136423..1136996)
                     /locus_tag="CNA04230"
                     /codon_start=1
                     /product="general RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_566766.1"
                     /db_xref="GeneID:3253378"
                     /translation="MSSNFYTSSHNRYWLLTRPSLLESRQTDLKYCTSRQLYCLFIFF
                     SQLIQKLGKRLLLRQIPIATACVFFKRFYFKNSLCETNPYLVLAACIYVAAKVEETPV
                     HIKSVVSEAKLVFHEHNIKMFPAETNKLGEMEFYLLEDLDFHLVVFHPYRALLHLTGR
                     ESADMGKFEKSRVQEDMEIRKKEGDAKKMREEEAKKASSKGQQPTVGQALEKEGERLE
                     EAEETRIRRLMSRGTGEGMMEVDEGVLQISWFILNDSYRTDAPLLYPPYIIALSAIYI
                     AFCLTSMSNSSARTRASSTQRPELLQSASINEGLNLLPPPKNAAEFLAGFQVSLPMLF
                     GCVQEIIGLYPVWEAFEPTVMRNSQAQAKTGNAAAPVPAATGTKTGQNNDLVQDKKDK
                     FGLEEAESLVRKMIEERMIDLGHPDNAGVEKASGTGPSNVAGKKRAR"
     gene            complement(1137059..1139199)
                     /locus_tag="CNA04240"
                     /db_xref="GeneID:3253376"
     mRNA            complement(join(1137059..1137324,1137382..1137783,
                     1137836..1138504,1138555..1138710,1138760..1138828,
                     1138888..1139199))
                     /locus_tag="CNA04240"
                     /product="IMP dehydrogenase, putative"
                     /transcript_id="XM_566768.2"
                     /db_xref="GeneID:3253376"
     CDS             complement(join(1137201..1137324,1137382..1137783,
                     1137836..1138504,1138555..1138710,1138760..1138828,
                     1138888..1139102))
                     /locus_tag="CNA04240"
                     /codon_start=1
                     /product="IMP dehydrogenase, putative"
                     /protein_id="XP_566768.1"
                     /db_xref="GeneID:3253376"
                     /translation="MADTNPNAPPRSDSLLNPADALKYLEEYPRGDGLSLQELMDSRK
                     NGGLTYNDFLVLPGHISFPASDVSLQSRATKNIVLNTPFLSSPMDTVTEDRMAIALAL
                     HGGLGIIHHNCSAEEQAAMVRRVKKYENGFITDPLCLGPDATVGDVLEIKAKFGFCGV
                     PITETGAPNSKLLGIVTGRDVQFQDAETPIKSVMTTEVVTGSSPITLEKANSLLRETK
                     KGKLPIVDSNGHLVSLVARSDLLKNQNYPYASKVPESKQLYCGAAIGTRPGDKDRLKL
                     LAEAGLDVVVLDSSQGDSVYQIEFIKWIKQTYPKIEIIAGNVVTREQAAQLIAAGADG
                     LRIGMGSGSICITQEVMAVGRPQGTAVYAVAEFASRFGIPCIADGGIGNIGHIAKALA
                     LGASAVMMGGLLAGTTESPGEYFYHEGKRVKVYRGMGSIEAMEHTQRGSASGKRSILN
                     LDNAATARYFSEADAVKVAQGVSGDVADKGSINKFVPYLFTGLQHSFQDAGVKSVSEL
                     HSCARSGSLRFELRTASAQLEGGVHGLNSYTKRLFA"
     gene            1140333..1142306
                     /locus_tag="CNA04250"
                     /db_xref="GeneID:3253374"
     mRNA            join(1140333..1140828,1140882..1141187,1141238..1142306)
                     /locus_tag="CNA04250"
                     /product="cyclin, putative"
                     /transcript_id="XM_566770.2"
                     /db_xref="GeneID:3253374"
     CDS             join(1140723..1140828,1140882..1141187,1141238..1142106)
                     /locus_tag="CNA04250"
                     /codon_start=1
                     /product="cyclin, putative"
                     /protein_id="XP_566770.1"
                     /db_xref="GeneID:3253374"
                     /translation="MPSRNPIHPASLCRLSTHNKPLVECLRTRVRSEFLAHVAEQTCS
                     VIRISPSAPSTPSTSYLPTPPASPSGEHYDEDGKPSEWWQAPNGTEDDLDVDLPELQE
                     FIRGLVVQSNVQMPTLSVTLVYLERLREKLPAVATGMKCTRHRVFLAVLICAAKYLND
                     SSPKNMHWQKYGKFFSLAEVNLMEKQLLYLLDYNLRVEEDELVRHLEGFGPSVLAPAT
                     SSAPSSVSVQAAPDQLRVPAVIPRTKTSPSASSRLRTGPNKSRSTNFERPFNPTADIA
                     SHHSRPVDLQRSHTNEHIGSSCQPRSYRPAPIHIPRAITCSSSPGSASSSASSVLYGD
                     IPTPGLGRDSSDAGDSPQAARTPDEGRWGRYGYGGVPVPVSVPGRLYKMSCEPTIVGL
                     SSASPVACVKSPIGTEKQREGLLKRAGRTFKRII"
     gene            complement(1142280..1145024)
                     /locus_tag="CNA04260"
                     /db_xref="GeneID:3253372"
     mRNA            complement(join(1142280..1142358,1142413..1142824,
                     1142879..1143711,1143784..1143908,1143966..1144058,
                     1144121..1144770,1144844..1145024))
                     /locus_tag="CNA04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656266.1"
                     /db_xref="GeneID:3253372"
     CDS             complement(join(1142577..1142824,1142879..1143711,
                     1143784..1143908,1143966..1144058,1144121..1144770,
                     1144844..1144853))
                     /locus_tag="CNA04260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511912.1"
                     /db_xref="GeneID:3253372"
                     /translation="MINVLARYLTLSFIFRDGRAALPPPLPRRPPVVNRRRRNAFRPP
                     VPEKALQISWLSSRTLKKRCFRYDDHIVLLLLAWSRDIKHGACDSPLQRHHHDSTSIS
                     IYIYWFSTPTLHSSSFLVPSLLSFFIDHTLTSHHHFSIMPIKAVNREREYLLQAQEDP
                     SVKLEQSHTTPLPKLQLLIACFVRVTEPIAFMACFPYINQMLLDTGVVDDPRKTGFYA
                     GLIESMFAVAELLTVFQWGTASDRWGRKPVLLIGCAGAALSSILFGFATTFPMMVLTR
                     VINGLANGNVAVLKSVIGELCDETNQSVAFSFFPLSMAIGTILASAIGGYFPRITDRY
                     PKLGQTIPILDRYPYLLPCLVAAIFPLISGLVAWIWMEETLPPKTKGMQVEDQSQSRS
                     QVHHAHSHTTVHYSSTDEGDTRVEGATDHHNTWAPPGHIDDHEDDAPVSFRDLLTPDI
                     NALMTSFGLLQLQGISFLGLLPLFCFTPVPSGGLSFPSGKIGLAMSIRGVSTIAVQLF
                     AFPWLSKRIGTVKLYKMLVILFIPAFVLLPFCNVMARSGRDAWVWIGLSGSMVLYAIG
                     NMAFACNLIMVNDAAPNRRSLGAINGWSQAVSSLMRAIGPGTSSALFALSVDKHVMEG
                     QLIWVVLSVLSVVSAMAALMLKNHHRKV"
     gene            1145091..1145803
                     /locus_tag="CNA04265"
                     /db_xref="GeneID:36392684"
     mRNA            join(1145091..1145308,1145364..1145379,1145451..1145467,
                     1145516..1145534,1145592..1145803)
                     /locus_tag="CNA04265"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024656084.1"
                     /db_xref="GeneID:36392684"
     CDS             join(1145301..1145308,1145364..1145379,1145451..1145467,
                     1145516..1145534,1145592..1145684)
                     /locus_tag="CNA04265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514156.1"
                     /db_xref="GeneID:36392684"
                     /translation="MNRIPVVLNIDEIEYLLDQLPPPDKEEDPVITKLREKLKLSLQE
                     VRKNAE"
     gene            1146887..1151215
                     /locus_tag="CNA04270"
                     /db_xref="GeneID:3253370"
     mRNA            join(1146887..1147367,1147563..1147757,1147853..1147933,
                     1148081..1148301,1148358..1149969,1150022..1150972,
                     1151020..1151215)
                     /locus_tag="CNA04270"
                     /product="HMG1, putative"
                     /transcript_id="XM_024656267.1"
                     /db_xref="GeneID:3253370"
     CDS             join(1147883..1147933,1148081..1148301,1148358..1149969,
                     1150022..1150918)
                     /locus_tag="CNA04270"
                     /codon_start=1
                     /product="HMG1, putative"
                     /protein_id="XP_024511913.1"
                     /db_xref="GeneID:3253370"
                     /translation="MQSTNAPVNGGVSQQWQSAMQGMYSGAQQRPTSNSKPYNAPDAN
                     GMPAKKDDANQSMYSVNTENGYPAYQQQGYGTLGGLGQYGYNSAGLGGLSAAYGGATS
                     STAGATNGRRTSGQRMMTPPPHPSSVATNTSPSARYYTGQEGEAGRHASPYQPASAPP
                     QILSHQFNAMTNSPQTAQGYPQYQYNQQSHQQNPTQWAGYPTYGQSQAQARNNMSGRL
                     STTPAIPQNSALGDSSARQQPTSMYDYTTHALQQWPASDLSKVPSAHQNSWQNAQSLS
                     RLTQAQSPALGQTQPSSASQPTSSTSSTQNASPAVPQSGWQGYPSIPSIPPHTLGGGH
                     LMSGQPYGWGHTQQWGGYYGAQQPSQAPQGTPAHRPPLNNFPTGSTSSAPAESLPTGR
                     KRMSKDKGKTAKEKEENRSHFEDYHGLGKRSAEAVVEEIPGEDKKESKKKKGKEEKEK
                     PVPKAKSHLHPPKQAPSSWQLFFADELAKAKAAEPESRSPGGTSHPQKLNVAQIAKEA
                     GVAYANLSEERKKYYAERVKEHREIYAKELAAWQATLTPEDIRAENAFRAQQRKEGKS
                     RKGNIKDPNAPKKPLSAYFLFLKAIRENSDIRAQVWGTEAETTKQSVMAAEKWRSLTD
                     DEKRPYLEQAEHDKQTYETARKQYEEDSAARARGEDVPIRAVEAPASPPKPPASILRS
                     IHGGQAPVTKSSPSVTDSAPHPAPHSDLEPGITSLGKSPSPNPPSEPSLAQFHTSPRS
                     VPHYDPSLEVDDFQGFSDPLNMDLSGLDGIDVGSMEVGAGGDSEQPWDELQKLIGTED
                     VYSSAKLQPAAHIVPDASTAARVAPASGFESTDISVAPSYAEAKNETQQETSLNGTPE
                     GNGNESKVRHIAEAAEGELAVLPALGENTAQKNQGGLEVMVGAGEARRHNKNLSTESG
                     QAAADAPVVDGV"
     gene            complement(1151680..1153626)
                     /locus_tag="CNA04280"
                     /db_xref="GeneID:3253368"
     mRNA            complement(join(1151680..1151800,1151856..1152586,
                     1152644..1152732,1152780..1153349,1153398..1153509,
                     1153564..1153626))
                     /locus_tag="CNA04280"
                     /product="t-complex protein 1, beta subunit (tcp-1-beta),
                     putative"
                     /transcript_id="XM_566776.2"
                     /db_xref="GeneID:3253368"
     CDS             complement(join(1151752..1151800,1151856..1152586,
                     1152644..1152732,1152780..1153349,1153398..1153509,
                     1153564..1153584))
                     /locus_tag="CNA04280"
                     /codon_start=1
                     /product="t-complex protein 1, beta subunit (tcp-1-beta),
                     putative"
                     /protein_id="XP_566776.1"
                     /db_xref="GeneID:3253368"
                     /translation="MNVFADEATEERGENARLSSFVGAMALGDLVKSTLGPKGMNKIL
                     QSASNSTITVTNDGATILKSIHLDNPAAKILVNISKVQDDEVGDGTTSVCVLASELLR
                     EAEKLVTVQKIHPQTVAEGYRIASRAALQALEASAVDNKNDNAKFREDLFNIARTTLS
                     SKVLAQDKDYFANLAVDAVLRLKGSTDLEHIQIIKKVGGKLTDSYLDEGFILDKTIAT
                     NSPKRIENAKILIANTSMDTDKIKIFGARVRVDGTGKLAELERAEKEKMKAKVQAIAS
                     HGITCFVNRQLIYNYPESLLAEAGIMSIEHADFEGVERLALVTGGDIASTFDAPEKVK
                     IGRCDVIEEIMIGEDKLIKFSGVAAGEACTVVLRGATSQMVEEAERSLHDALSVLSQT
                     VKETRVTLGGGCAEMLMSCQVEEAARTVKGKKALAVEGFARALRQMPTIIADNGGYDS
                     SDLVTKLRAAHYEGQSDAGLDMDKGEIGSMRQLGITESFKLKKQVVVSASEAAEMILR
                     VDNILRSAPRRREAH"
     gene            1153779..1155229
                     /locus_tag="CNA04290"
                     /db_xref="GeneID:3253366"
     mRNA            join(1153779..1153986,1154041..1154140,1154187..1154537,
                     1154587..1155229)
                     /locus_tag="CNA04290"
                     /product="vacuolar ATP synthase subunit d, putative"
                     /transcript_id="XM_566778.1"
                     /db_xref="GeneID:3253366"
     CDS             join(1153966..1153986,1154041..1154140,1154187..1154537,
                     1154587..1155185)
                     /locus_tag="CNA04290"
                     /codon_start=1
                     /product="vacuolar ATP synthase subunit d, putative"
                     /protein_id="XP_566778.1"
                     /db_xref="GeneID:3253366"
                     /translation="MEALGFNMSSGYLEGVVRGYKGALLTQSNYHNLTQCENLEDFRL
                     QLSSTDYGSFLANEPLPLSTSTIADKATEKLVAEFHYLRTNAVEPLATFMDYITYAYM
                     IDNVILLTLGTLHERDTHELLERCHPLGVFDTMPALCVATNVEELYHSVLVETPLAPY
                     FQDCLSAQDLDDLNIEIIRNSLYKSYLEDFHKFCQTLPAPTSEIMSRILAFEADRRTL
                     NITINSFGTELSKEQRARLFPSIGRLFPEGNNALARADDIDAVVAAVDHIAEYKAFFD
                     KAGVTSGGGAGTDEASSSLEDEFFKHDVDLNKQSFLQQFQYAVFYSFVKLKEQEVRNL
                     TWIAECIAQDAKDRVNDYIPVF"
     gene            complement(1155915..1158710)
                     /locus_tag="CNA04300"
                     /db_xref="GeneID:3253364"
     mRNA            complement(join(1155915..1156906,1156958..1157136,
                     1157189..1157513,1157563..1158193,1158246..1158710))
                     /locus_tag="CNA04300"
                     /product="art-4 protein, putative"
                     /transcript_id="XM_566780.2"
                     /db_xref="GeneID:3253364"
     CDS             complement(join(1157020..1157136,1157189..1157513,
                     1157563..1158193,1158246..1158657))
                     /locus_tag="CNA04300"
                     /codon_start=1
                     /product="art-4 protein, putative"
                     /protein_id="XP_566780.1"
                     /db_xref="GeneID:3253364"
                     /translation="MVLSYSAIAKPTADTPKVISMTASKQVFPEAFEALPAPAAEESQ
                     ELESQPEALAQASSSTIEAPISSEDRKVIQHLILDAGPLLSLTPLRHLATSFHTTPMV
                     LAELRDPKAREHWERLALTGVNVKVESPTAEAMAQVTAFAKKTGDFAVLSQTDLSVAA
                     LTYQYEVMVNGVKRIRTEPPQAKKPSAKGKEKEKDTKQAEKKDEEVQENKNEKEGKPE
                     EEDVEVEEAIQSLSQIIIEPSTKSELSVNDVSTTNRSHTQTSVPASAHAEDPESEGEW
                     INPTNLSTHRSRDLGLITPSGSTAKPPAVACMTGDYAVQNILLGMRLGLVGEGGKKIG
                     KVKSWVLRCHACFKVCKDPSKRFCPSCGNATLLRTSVSTSAKTGEQRVHLKQNFQYRT
                     RGTIYSIPDPKMGRAKGQQKGGSGLILREDQREWQDAMRGDRIKKEKEERKAAKGALE
                     GWNDPDWLPEMITVGMSGKGRSGGHNMPSIGHGRKNPNQAKRRR"
     gene            1158924..1160461
                     /locus_tag="CNA04310"
                     /db_xref="GeneID:3253362"
     mRNA            join(1158924..1158985,1159033..1159067,1159127..1159300,
                     1159352..1159555,1159611..1159935,1159983..1160090,
                     1160140..1160461)
                     /locus_tag="CNA04310"
                     /product="3-isopropylmalate dehydrogenase, putative"
                     /transcript_id="XM_566782.2"
                     /db_xref="GeneID:3253362"
     CDS             join(1158972..1158985,1159033..1159067,1159127..1159300,
                     1159352..1159555,1159611..1159935,1159983..1160090,
                     1160140..1160401)
                     /locus_tag="CNA04310"
                     /codon_start=1
                     /product="3-isopropylmalate dehydrogenase, putative"
                     /protein_id="XP_566782.1"
                     /db_xref="GeneID:3253362"
                     /translation="MADKTFKITVLPGDGIGPEVVAEAVRVLETIVNHSDLKLDLKSY
                     DFGGAAIDNHGVPLPDETLKACKEADAVLMGSVGGPKWGVGPVRPEQGILKLRKELGL
                     YANIRPANFASESLLKRSPLKEDTARGTDIIVLRELIGGIYFGERQETNDEGVAWDQC
                     IYSKPEIERITRVAAQIALAAEPPLPITSVDKANVLATSRLWRKTVSELMAKEYPQLK
                     LEHQLVDSAAMIMIANPRKLNGVLLTENMFGDILSDESSVIPGSLGLLPSASLAGAPD
                     AKSTTMGLYEPIHGSAPDIAGQGIANPIGTILSAAMMLRYSLGKGREAALIEQAVQKV
                     LDSAESGGFDYRTKDLGGQRSTKEVGDKVVEVLKGLLGA"
     gene            1160633..1162755
                     /locus_tag="CNA04320"
                     /db_xref="GeneID:3253360"
     mRNA            join(1160633..1160842,1160902..1161102,1161161..1161363,
                     1161422..1161724,1161787..1162755)
                     /locus_tag="CNA04320"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_566784.2"
                     /db_xref="GeneID:3253360"
     CDS             join(1160722..1160842,1160902..1161102,1161161..1161363,
                     1161422..1161724,1161787..1162530)
                     /locus_tag="CNA04320"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_566784.1"
                     /db_xref="GeneID:3253360"
                     /translation="MTCTIHPSLPETDTHKDYARFYFDTTNVPDKRIVGLLACQRDPL
                     LRILRTKVHAAREADITSPPPPKGKAKQKKGAAFTSEQNVALKEESKGKLWEVELLDT
                     IIFPEGGGQPSDTGVMRLLDPNGGVSHTFPIEMCLRRKLDSVHLIRIPSGIEIDLREG
                     REVEVEADWDRRIDQMSIHTSQHLLSAILETHLSLPTLSWSMQPYPSIEPAYVELPRA
                     LTPEEAMGIERLCGEAIKQCKKIWVDFTIQGDDVGKENIGAGSVGTREMRGLPKDYDG
                     GVIRHINIQDTDRNACCGTQSPNTSLLSLLHVIPPTLSNSSKPSPTKLYFLSGPRAIL
                     ALQQASRTLSAAAKAVGYGRADLVERLERAEVARKDTADSLKGLRTELAKLVGEQAVK
                     AGKEGKSVTLVEREEKGTHDFDWLGLVGATYLESFSASGQNTDGKTPPSPLIILTSSI
                     TPASTTSQTLLLIQSPDNDLAKYVNEKIKTALAGRVKGGGARGRYMSKIDGKWGKIEK
                     DALAKVIDDLRADRV"
     gene            1162770..1165557
                     /locus_tag="CNA04330"
                     /db_xref="GeneID:3253750"
     mRNA            join(1162770..1162866,1162928..1162993,1163062..1163145,
                     1163193..1163298,1163351..1163391,1163444..1163486,
                     1163540..1163705,1163769..1163913,1163965..1164019,
                     1164068..1164158,1164217..1164320,1164379..1164461,
                     1164766..1164837,1164917..1164938,1165138..1165557)
                     /locus_tag="CNA04330"
                     /product="Isovaleryl-CoA dehydrogenase 2, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_567164.2"
                     /db_xref="GeneID:3253750"
     CDS             join(1162789..1162866,1162928..1162993,1163062..1163145,
                     1163193..1163298,1163351..1163391,1163444..1163486,
                     1163540..1163705,1163769..1163913,1163965..1164019,
                     1164068..1164158,1164217..1164320,1164379..1164461,
                     1164766..1164837,1164917..1164938,1165138..1165256)
                     /locus_tag="CNA04330"
                     /codon_start=1
                     /product="Isovaleryl-CoA dehydrogenase 2, mitochondrial
                     precursor, putative"
                     /protein_id="XP_567164.2"
                     /db_xref="GeneID:3253750"
                     /translation="MYITRARMMLPKAHACSRLLCSSSRLGTRRRYSSYNTAVAGLTE
                     AQEEFRSVVQHFAQKEIAPRAAEIDRTNKLPQDIFPKLGEMGLLGVTVPERWGGLGLG
                     YLEHTIAMEEISRASASVALSYGAHSNLLVNQLVRWGTEKQLSKYLPPLLTGKHIGSL
                     AMSEPNAGSDVVSMRTSATRSDEGEGWIMNGSKCWITNAPVSSTFLIYAKSDTNVAPS
                     KGMTAFLVEKGWKGFEVGEGLDKFGMRGSPTAELFFDNVKIPEENVLGKVGNGALVLM
                     SGLDLERLVLSGGPLGIMQAALDMALEYTHERKQFGKQIGTFQLMQGKLADMYTKLSA
                     SRAYVYAVARACDAGMISRRDCAGAILYSSDRAVEVAIEAQQCLGGNGYINDYPAGRL
                     VRDSRLYTVGAGTQEIRRMLIGREFNEALSGL"
     gene            1165683..1167642
                     /locus_tag="CNA04340"
                     /db_xref="GeneID:3253656"
     mRNA            join(1165683..1165800,1165868..1166232,1166287..1166384,
                     1166441..1166548,1166611..1166811,1167124..1167642)
                     /locus_tag="CNA04340"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_024656268.1"
                     /db_xref="GeneID:3253656"
     mRNA            join(1165683..1165800,1165868..1166232,1166287..1166384,
                     1166441..1166548,1166611..1166868)
                     /locus_tag="CNA04340"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_024656085.1"
                     /db_xref="GeneID:3253656"
     CDS             join(1165795..1165800,1165868..1166232,1166287..1166384,
                     1166441..1166548,1166611..1166732)
                     /locus_tag="CNA04340"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_024512057.1"
                     /db_xref="GeneID:3253656"
                     /translation="MKIVSQDDVRGYNDATIVGGIKGAFLAAAICIPGHMFLMKRSPY
                     IRALPLPLKALGHVTITVPCISIAAEKGGEAYNRAQYSGVGQREIDWELQIRNEKWEK
                     MSKLEKAGDWAARHKYGIIGGGWAASMALAFGIVARNPYQSTSQKVVQARMWAQGLTV
                     ALLVGSAMATGLGASNSSTPVESADHSWRRMLEHDEHLTPEERAQLRDTRDPTTAKEI
                     QKAVSQRKAAAAQA"
     CDS             join(1165795..1165800,1165868..1166232,1166287..1166384,
                     1166441..1166548,1166611..1166732)
                     /locus_tag="CNA04340"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_024514157.1"
                     /db_xref="GeneID:3253656"
                     /translation="MKIVSQDDVRGYNDATIVGGIKGAFLAAAICIPGHMFLMKRSPY
                     IRALPLPLKALGHVTITVPCISIAAEKGGEAYNRAQYSGVGQREIDWELQIRNEKWEK
                     MSKLEKAGDWAARHKYGIIGGGWAASMALAFGIVARNPYQSTSQKVVQARMWAQGLTV
                     ALLVGSAMATGLGASNSSTPVESADHSWRRMLEHDEHLTPEERAQLRDTRDPTTAKEI
                     QKAVSQRKAAAAQA"
     gene            complement(1167581..1170005)
                     /locus_tag="CNA04350"
                     /db_xref="GeneID:3253356"
     mRNA            complement(join(1167581..1168705,1168755..1168985,
                     1169034..1169136,1169186..1169302,1169358..1170005))
                     /locus_tag="CNA04350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656269.1"
                     /db_xref="GeneID:3253356"
     CDS             complement(join(1167772..1168705,1168755..1168985,
                     1169034..1169136,1169186..1169302,1169358..1169904))
                     /locus_tag="CNA04350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511917.1"
                     /db_xref="GeneID:3253356"
                     /translation="MTTASPFLFQSSLHDTGLIHEMLSNPLKFGAPVNKKSLGFEAGM
                     KEVVSEPESPNLVKRQLKNVNDEVKYDTEGELAAKDKSQKQFNGNAKNPQRVNPEFIN
                     QSVTPLSPAKSQIPDTNEGDNTQGLFPSTFDLSWPEAIATAKRAAGLHNPSMACYANA
                     TLQVLLHTPPVLRIALTHDEGSCSQIKKKNFCMLCSLKHMAEGSHWSGRKAYAPGIHR
                     SLSQIKKGFSKNRQEDTHEFFRFVTDALQNTALAKLPKDTPEKIKHTSWVYRIWGGRV
                     RSRVVCSRCNNPSDTFDSFLDLSLDVNKQGKKSVLGMLAGFTKEDRLEGDNKYHCERC
                     KRKANATKSFKIDQAPPILTLHLKRFSVNYNPYSGRARAEKFNQPIKFEQTLDIAPYM
                     VDPASPGTKYRLFGVTCHRGTELRFGHYTSYVRGPSGQWFHADDDEVSPVQLEQVLND
                     KTAYLLSYIRVDNGNEGLCESPAVRDRVKGLVNGSAKGMRDDESESQSEAESSSHKSS
                     SPIKRKSTYDPEDPPRMKIGAFVNNKAYAPSTNKSESPFSDGENKMPPELPKFGYKPK
                     PTIRAPAPVEASSFYTSPVARPSNSLAGMSKKEKKKFKHKEKGKPRHSATPMPFAQGR
                     VGNGRNRQPGVLSRMKGRA"
     gene            1171606..1174363
                     /locus_tag="CNA04360"
                     /db_xref="GeneID:3253354"
     mRNA            join(1171606..1172196,1172259..1172537,1172588..1172859,
                     1172911..1173826,1173875..1173919,1173986..1174070,
                     1174123..1174363)
                     /locus_tag="CNA04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656270.1"
                     /db_xref="GeneID:3253354"
     CDS             join(1171777..1172196,1172259..1172537,1172588..1172859,
                     1172911..1173760)
                     /locus_tag="CNA04360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511918.1"
                     /db_xref="GeneID:3253354"
                     /translation="MSTLPIYHPVPTDEKHPISATLVDGEFDPRYIHPAAIGSQYLYI
                     GGPRSAYQAAKDKYAGLSKVKKGLLALAVVWFGLVVGHQAARLAGGKCHQDAHHAPAE
                     FGVKQWRDHSSHRFGGPIFLEDGPLDCHGGRKDRAPEELSSVATVYESINVVGSNDAT
                     DILSANASFPLKLGRGKHFDLTFQGEGNVIISRAEEESEDSTVNVFVESTWSGEEAEG
                     VKMLSGKHSHALSVASSQSSSHIVHLVLPANKKRLPSISIFSTKDLTLDIHPSVQDIH
                     VGKLSLKSESGDIKLPTLAVNKLVAETVTGDVGGNFNVSNSFVVKTVTGNINAIVNVV
                     PHSPPKDKLNLHNVDAKHEHKKFDSRHGEHNHEKKHFGGRFHSEEERPSKWSLNIFKS
                     KKEDEPEHPPPPPVFIGAFSTSGNILLKVFGSPNVSTDTNVFSHTGDVDVTHDKSFHG
                     LYEVGSLKGTYDVVVRDGKVHRVLEEYVTEEGGKQKGLAFVPKNRKTEGSHEKRHFRN
                     AESVDGELPPPPPGKGHGPDGPDGPDGPGGPSGPGGPGGPDGPGGPGGPGGPGGPGGP
                     GGPGGPGPDHPRGPPPWVVFPPGHSEVFVHTEVGNAKIVL"
     gene            1175342..1177454
                     /locus_tag="CNA04370"
                     /db_xref="GeneID:3253352"
     mRNA            join(1175342..1175452,1175782..1175893,1176075..1176220,
                     1176297..1176599,1176650..1176814,1176864..1177205,
                     1177259..1177454)
                     /locus_tag="CNA04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_566793.1"
                     /db_xref="GeneID:3253352"
     mRNA            join(1175594..1175893,1176075..1176220,1176297..1176599,
                     1176650..1176814,1176864..1177205,1177259..1177454)
                     /locus_tag="CNA04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656086.1"
                     /db_xref="GeneID:3253352"
     CDS             join(1175809..1175893,1176075..1176220,1176297..1176599,
                     1176650..1176814,1176864..1177205,1177259..1177294)
                     /locus_tag="CNA04370"
                     /codon_start=1
                     /product="glutamate-ammonia ligase, putative"
                     /protein_id="XP_024514158.1"
                     /db_xref="GeneID:3253352"
                     /translation="MSQLIATKRVDLLAPYLALDQGSRVQAEYIWIDAEGGIRSKTMT
                     LDKAPSSVADLKEWNFDGSSTNQAPADNSDVFLRPVAIFKDPFRGGANILVLCECYDN
                     DGTPNKSNYRAHCKKVMDAAKDTEPWFGLEQEYTLFDADGQVFGWPKNGFPGPQGPYY
                     CGVGAGKVFARDFIEAHYRACLYAGIKISGINAEVMPSQWEFQVGPCTGIEMGDHLWM
                     ARFLLLRIGEEWGITPSLHPKPLKGDWNGAGCHSNYSTKDMRTPGKGMAAIEDAIKKL
                     EKKHLEHIAVYGEDNDLRLTGKHETASMTTFSAGVANRGASIRIPRHVGAQGYGYLED
                     RRPASNVDPYRVTAILVETTVLNN"
     CDS             join(1175809..1175893,1176075..1176220,1176297..1176599,
                     1176650..1176814,1176864..1177205,1177259..1177294)
                     /locus_tag="CNA04370"
                     /codon_start=1
                     /product="glutamate-ammonia ligase, putative"
                     /protein_id="XP_566793.1"
                     /db_xref="GeneID:3253352"
                     /translation="MSQLIATKRVDLLAPYLALDQGSRVQAEYIWIDAEGGIRSKTMT
                     LDKAPSSVADLKEWNFDGSSTNQAPADNSDVFLRPVAIFKDPFRGGANILVLCECYDN
                     DGTPNKSNYRAHCKKVMDAAKDTEPWFGLEQEYTLFDADGQVFGWPKNGFPGPQGPYY
                     CGVGAGKVFARDFIEAHYRACLYAGIKISGINAEVMPSQWEFQVGPCTGIEMGDHLWM
                     ARFLLLRIGEEWGITPSLHPKPLKGDWNGAGCHSNYSTKDMRTPGKGMAAIEDAIKKL
                     EKKHLEHIAVYGEDNDLRLTGKHETASMTTFSAGVANRGASIRIPRHVGAQGYGYLED
                     RRPASNVDPYRVTAILVETTVLNN"
     gene            1177880..1179868
                     /locus_tag="CNA04380"
                     /db_xref="GeneID:3253350"
     mRNA            join(1177880..1178087,1178140..1178252,1178454..1178566,
                     1178623..1179868)
                     /locus_tag="CNA04380"
                     /product="expressed protein"
                     /transcript_id="XM_024656271.1"
                     /db_xref="GeneID:3253350"
     mRNA            join(1177880..1177955,1178213..1178252,1178454..1178566,
                     1178623..1179868)
                     /locus_tag="CNA04380"
                     /product="expressed protein"
                     /transcript_id="XM_566796.2"
                     /db_xref="GeneID:3253350"
     CDS             join(1178463..1178566,1178623..1179805)
                     /locus_tag="CNA04380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511920.1"
                     /db_xref="GeneID:3253350"
                     /translation="MPPQPSHHGTARYGSLATHSGGLRGGKQPTKLEIESLASMDKPS
                     YYDPPSSPSSSRSASPPPPSMMSNSGNKLVSGAQFMRRGKIYPWGPSFEVAKTNQHAR
                     KRLKLCLEQFMPPAAAEVNADIPANISGAEERRREKKRKREEEKEYILPHLRSPSPPM
                     STAKLASLLALPQTYTDLLLNPAMRHSLGNDNMEQGLQRTAGELLEGEKPLLQALGRL
                     RDVVRVLERDVPVAKPRAQADRDAVPSSTANGNDNLSQSYPHLIPPLPHISDTDNLWR
                     VTQELLSQPGQAQSVPVPTLTYSATPPGAAAPSLDSIAEPEPIPTPLQRLFTCPSGIT
                     LHAVPSASHPGYAYPQGHSLHPQTVKYNLDLKNQCRAVDDAWERISELLADCNEYRER
                     LEEARDRVADVARVRKRVWRTIKERAGWELERESKP"
     CDS             join(1178463..1178566,1178623..1179805)
                     /locus_tag="CNA04380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566796.1"
                     /db_xref="GeneID:3253350"
                     /translation="MPPQPSHHGTARYGSLATHSGGLRGGKQPTKLEIESLASMDKPS
                     YYDPPSSPSSSRSASPPPPSMMSNSGNKLVSGAQFMRRGKIYPWGPSFEVAKTNQHAR
                     KRLKLCLEQFMPPAAAEVNADIPANISGAEERRREKKRKREEEKEYILPHLRSPSPPM
                     STAKLASLLALPQTYTDLLLNPAMRHSLGNDNMEQGLQRTAGELLEGEKPLLQALGRL
                     RDVVRVLERDVPVAKPRAQADRDAVPSSTANGNDNLSQSYPHLIPPLPHISDTDNLWR
                     VTQELLSQPGQAQSVPVPTLTYSATPPGAAAPSLDSIAEPEPIPTPLQRLFTCPSGIT
                     LHAVPSASHPGYAYPQGHSLHPQTVKYNLDLKNQCRAVDDAWERISELLADCNEYRER
                     LEEARDRVADVARVRKRVWRTIKERAGWELERESKP"
     gene            complement(1179859..1181236)
                     /locus_tag="CNA04390"
                     /db_xref="GeneID:3253348"
     mRNA            complement(join(1179859..1179918,1179973..1180114,
                     1180169..1180566,1180619..1181236))
                     /locus_tag="CNA04390"
                     /product="expressed protein"
                     /transcript_id="XM_566798.2"
                     /db_xref="GeneID:3253348"
     CDS             complement(join(1179911..1179918,1179973..1180114,
                     1180169..1180566,1180619..1181147))
                     /locus_tag="CNA04390"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566798.1"
                     /db_xref="GeneID:3253348"
                     /translation="MLLANYGSDSGSDSESEAPVAPPPKPAPISAASSSSKVPQPKKK
                     KPVKITLDLPKASDGSEDEKNVGNNVEMGEDERETKRAKLPKGGKGTSSLLGMLPPPK
                     RKLPQSSTLATKGTGLTVNKAMARPQLPAPPRVIDEDSDDEDSVPKVRDMLPASLARK
                     QQKMESKEEVIDVFGLKTASAPLAKPTIATPSLKPPSISSAPVAPDFVPPEPTANDPY
                     PGYYQLPSGEWRAYDPDYYHSFFHSSAPVSDKQDADDGRVGRHWDAFEKGQFQGQVLD
                     IDANKDLAEARAEEERRALMKKPKLPGEEFVYQPKGQVKGLASQRHQLTSLLNTAYSQ
                     REELEERIAANKKGMRAAGTKYGF"
     gene            complement(1181695..1183484)
                     /locus_tag="CNA04400"
                     /db_xref="GeneID:3253643"
     mRNA            complement(join(1181695..1182568,1182623..1183484))
                     /locus_tag="CNA04400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567168.2"
                     /db_xref="GeneID:3253643"
     CDS             complement(join(1182084..1182568,1182623..1183442))
                     /locus_tag="CNA04400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567168.1"
                     /db_xref="GeneID:3253643"
                     /translation="MSPLHTSTLTHPSSPSSNSGTEVVLTPTTMAEERHTNSDVHIEQ
                     AAEESAQVVAERAPKKAKTSDSGSFGQENDIDFAGITNQRLTVFPMFTGAWNEATESN
                     STSPIPTHPANAMQSPNHQQSQQQNGLDPLLALRSPSATHSTPQVNVDVGLTPELRFP
                     DETLASATADVSQETSQGDHAPIQVDESSQQQSASGMLTVPSSHTGPSSTSESGQASK
                     KENNAAFSRSPELRVSHKLAERKRRKEMKDLFDELRDELPADRGMKASKWEILTKAIE
                     HIKHTKSQQVEMHREIEHLRRELEIARAGNAHYHPHAYPTYSIPYPPGPFAAHPHHAQ
                     AQPPTSGTTSQAQTPQPQTQTVAQPQLQSQMTQQPQQVQQQPQSQPQQQIQPAAHVQT
                     VSQVQQQQSQPSQQQSQTSGLQTPTQEVQQQPLSAQGTPAPV"
     gene            complement(1183678..1186033)
                     /locus_tag="CNA04410"
                     /db_xref="GeneID:3253346"
     mRNA            complement(join(1183678..1183696,1183753..1184069,
                     1184118..1184192,1184243..1184411,1184460..1184597,
                     1184642..1185019,1185071..1185130,1185188..1185311,
                     1185363..1185481,1185536..1185754,1185818..1186033))
                     /locus_tag="CNA04410"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_024656272.1"
                     /db_xref="GeneID:3253346"
     CDS             complement(join(1183805..1184069,1184118..1184192,
                     1184243..1184411,1184460..1184597,1184642..1185019,
                     1185071..1185130,1185188..1185311,1185363..1185481,
                     1185536..1185754,1185818..1185944))
                     /locus_tag="CNA04410"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_024511922.1"
                     /db_xref="GeneID:3253346"
                     /translation="MKDSAILISLLFSLLLFTPVTFAAQEEQKVVVPSQIQGLNPSLY
                     DKYEPTKSGLFHCLDSSKSIPFSAINDDYCDCPDGSDEPGTAACSNGLFWCKNEGHIP
                     GSVRKSRVNDGLCEPECCDGSDEWATGACPNNCEAIGKEWRAAKEASEKIRKTGAKVR
                     GTYIKWAQGEKKRLEEDLARKRQELVTKEQEVAKAKAILDKTEARSQEDLERKKQSPV
                     YISLLSHRLALARLRSKTSSLEAEIESLHSLLREMAKGYNPNYQDMAVKAAVVGYEEL
                     TGIKYREGESEGEMEVKKEQNEEDDKEEEITEEELEELEKEDLEALLLSDTTDENEED
                     EEDDGTSLLWKLDEYIPDSLYGSWEHVRDVAIDWMIRFGLAGRSKAKTSSGDGPQAAA
                     AREKHRLLNNELVKLNGAIRNTEDTLKNMEFHYGPEGEWKKLDGTCVDKVVGDYTYEL
                     CFFGKATQKSNKDKSSNNLGSFNQWNTAAEQGSFGYYSQQLYKNGAKCWNGPNRSVTV
                     DLSCGTSNALISVSEPEKCEYRFKITSPALCWPDVPDSPADDVKVKEEL"
     gene            1186783..1189269
                     /locus_tag="CNA04420"
                     /db_xref="GeneID:3253344"
     mRNA            join(1186783..1187176,1187262..1187947,1188001..1188165,
                     1188215..1188537,1188597..1188763,1188818..1188939,
                     1188990..1189068,1189125..1189269)
                     /locus_tag="CNA04420"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_566802.2"
                     /db_xref="GeneID:3253344"
     CDS             join(1186882..1187176,1187262..1187947,1188001..1188165,
                     1188215..1188537,1188597..1188763,1188818..1188939,
                     1188990..1189068,1189125..1189135)
                     /locus_tag="CNA04420"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_566802.1"
                     /db_xref="GeneID:3253344"
                     /translation="MAIITPISRLATSRTLTAASRSSSGALLRRPTALRIRTFASEAK
                     FDPESVERAQDEVDVCIVGGGPAGLSAAIRLKQLEQERGGDELRVVVLEKGGEVGAHI
                     LSGAVIEPRALNELIPDWKELGAPLNQPALSDSMRFLTSNSSFPLPHPPQMNNKGNYI
                     VSLSRFTAWLGEQAEALGVEVYPGFAGAKVLYTEDGKGIKGVITGDVGLDKDGNPKDN
                     YEPGMEFHAKVTLIAEGAHGSLSKELQKKFNLREGKDPQTYGLGIKEVWKVKDEVYEP
                     GKIVHTLGWPLDYKTYGGSWMYHMEDNMVSIGLVVGLDYQNPYLSPYKEFQRMKHHPF
                     FANILKDGQCIAYGARALNEGGFQSIPKLHFPGGALIGCSAGFLNVPKIKGTHNAMKS
                     GMLAAESAFAAITSTESSEEVSLDTNPADLSNYATAIENSWIWSELKEVRNLRPSFHN
                     PLGLWGGMAYSGLDSLILKGRVPWTFRNSVEDYEATKKASEEKPIDYPQPDGKLSFDI
                     LTSVSLTGTNHAENQPVHLRLPKVEGARASHTKINVEDYAGLLGRVCPAAVYEYADAE
                     GSEVDADGKKFVINSQNCIHCKTCSIKTPTQDISWDVPEGGGGPKYSIT"
     gene            1190553..1191439
                     /locus_tag="CNA04425"
                     /db_xref="GeneID:36392685"
     mRNA            join(1190553..1190786,1190866..1190956,1191023..1191119,
                     1191190..1191439)
                     /locus_tag="CNA04425"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_024656087.1"
                     /db_xref="GeneID:36392685"
     CDS             join(1190638..1190786,1190866..1190956,1191023..1191119,
                     1191190..1191314)
                     /locus_tag="CNA04425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514159.1"
                     /db_xref="GeneID:36392685"
                     /translation="MMFSSPQPLGHFSVSQVKMATMSLATARMELSKLKRVPVSAEAY
                     LDVLNSTRVDGVENVVERSTIFHGVNEAAFILGQNIVIERTTGHPVVFYEMERASRRP
                     MRYGPTRGTDSIDCSRRALHVLKAFTPLISNALGSPPQRLPVSLINRPAVA"
     gene            1192448..1197322
                     /locus_tag="CNA04430"
                     /db_xref="GeneID:3253342"
     mRNA            join(1192448..1192659,1192706..1192728,1192789..1192843,
                     1192909..1193023,1193143..1193205,1193259..1193267,
                     1193328..1193442,1193494..1193586,1193638..1193731,
                     1193784..1193986,1194041..1194219,1194264..1194622,
                     1194671..1195161,1195213..1195589,1195641..1195929,
                     1195978..1196184,1196242..1196367,1196415..1196773,
                     1196823..1196952,1197007..1197322)
                     /locus_tag="CNA04430"
                     /product="U2 snRNA binding protein, putative"
                     /transcript_id="XM_566804.2"
                     /db_xref="GeneID:3253342"
     CDS             join(1192509..1192659,1192706..1192728,1192789..1192843,
                     1192909..1193023,1193143..1193205,1193259..1193267,
                     1193328..1193442,1193494..1193586,1193638..1193731,
                     1193784..1193986,1194041..1194219,1194264..1194622,
                     1194671..1195161,1195213..1195589,1195641..1195929,
                     1195978..1196184,1196242..1196367,1196415..1196773,
                     1196823..1196952,1197007..1197222)
                     /locus_tag="CNA04430"
                     /codon_start=1
                     /product="U2 snRNA binding protein, putative"
                     /protein_id="XP_566804.1"
                     /db_xref="GeneID:3253342"
                     /translation="MHLLNLTLSSPTNVSTAVVGSFSGSKSQEILCVRGGTKLEIFKL
                     NATTGQLDTIVSTEAFGTIRNIAGFRLAGMTKDYILATSDSGRLSILEFVISPTPHFE
                     SLYQEVFGKSGSRRIVPGQFLAVDPKGRSCLVGSLEKTKLVYVLNRNTEGKLYPSSPL
                     EAHKNHTLVTHIVGVDQGYDNPLYAALETDYSESDQDSTGEAYENTQKHLTFYELDLG
                     LNHVVRKWSEPTDRRANLLVQVPGGQNANSDRFEGPSGVLVCTEDHIIWKHMDVEAHR
                     IPIPRRRNPLVQRGDKSRGLIIVSAVMHKIKGAFFFLLQSEDGDLYKVWIEHNGEDVV
                     ALKIKYFDTVPVANSLCILKRGYIYVASEFSDQNLYQFQSLAEDDGEQEWSSTDYPEN
                     GNIDGPLPFAFFDPQPLRNLLLVDTVPSLDPITDAHVVNLLGASSDTPQIYAACGRGA
                     RSTFRTLKHGLDVAEMVSSPLPGVPTNVWTLKLTEDDEYDSYIVLSFPNGTLVLSIGE
                     TIEEVNDTGFLSSGPTLAVQQLGNAGLLQVHPYGLRHIRAADRVDEWPAPPGQTIVAA
                     TTNRRQVVIALSTAELVYFELDPEGSLSEYQEKKALPGNATCVTIAEVPEGRRRTSFL
                     AVGCDNQTVSIISLEPDSTLDTLSLQALTAPPTSICLAEIFDTSIDKNRATMFLNIGL
                     MNGVLLRTVVDPVDGSLSDTRLRFLGAKPPKLVRANVQGQPSVMAFSSRTWLLYTYQD
                     MLQTQPLIYDTLEYAWSLSAAMCPDGLIGISGNTLRIFNIPKLGEKLKQDSTALTYTP
                     RKFISHPFNSVFYMIEADHRTYSKSAIERIVKQKESEGRRVDTLLLDLPANEFGRPRA
                     PAGHWASCVRVLDPLANETIMTLDLDEDEAAFSIAIAYFERGGGEPFLVVGTGVKTTL
                     QPKGCKEGYLRVYAIKEQGRILEFLHKTKTDDIPLCLAGFQGFLLAGIGKSLRLYEMG
                     KKALLRKCENNGFPTAVVTINVQGARIIVGDMQESTFYCVYRSIPTRQLLIFADDSQP
                     RWITCVTSVDYETVACGDKFGNIFINRLDPSISEKVDDDPTGATILHEKSFLMGAAHK
                     TEMIGHYNIGSVVTSITKIPLVAGGRDVLVYTTISGAVGALVPFVSSDDIEFMSTLEM
                     HMRTQDISLVGRDHIAYRGYYVPIKGVVDGDLCESFSLLPYPKQQAIALDLDRSVGDV
                     LKKLEQMRTSSAF"
     gene            complement(1197601..1197701)
                     /locus_tag="CNA04440"
                     /db_xref="GeneID:3253974"
     tRNA            complement(1197601..1197701)
                     /locus_tag="CNA04440"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:3253974"
     gene            complement(1199420..1199520)
                     /locus_tag="CNA04450"
                     /db_xref="GeneID:3253956"
     tRNA            complement(1199420..1199520)
                     /locus_tag="CNA04450"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:3253956"
     gene            complement(1199990..1200640)
                     /locus_tag="CNA04460"
                     /db_xref="GeneID:3253340"
     mRNA            complement(join(1199990..1200129,1200192..1200367,
                     1200503..1200640))
                     /locus_tag="CNA04460"
                     /product="expressed protein"
                     /transcript_id="XM_566806.2"
                     /db_xref="GeneID:3253340"
     CDS             complement(join(1200097..1200129,1200192..1200367,
                     1200503..1200533))
                     /locus_tag="CNA04460"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566806.1"
                     /db_xref="GeneID:3253340"
                     /translation="MSGNNDNSEKTFNILPHPAKTNNPADLTGEPAEHGGLQSASANA
                     YNAKPPYIPSKEIAEGLEKPKTREELRAEAQQLNS"
     gene            1200828..1201785
                     /locus_tag="CNA04470"
                     /db_xref="GeneID:3253338"
     mRNA            join(1200828..1200949,1201005..1201132,1201190..1201363,
                     1201408..1201785)
                     /locus_tag="CNA04470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566810.2"
                     /db_xref="GeneID:3253338"
     CDS             join(1200892..1200949,1201005..1201132,1201190..1201363,
                     1201408..1201650)
                     /locus_tag="CNA04470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566810.1"
                     /db_xref="GeneID:3253338"
                     /translation="MDSLTDEIEAVLFVAREVMVYQIPPRTTTAGYKAAEWNVESFLW
                     KGRMRVLDVGSRSEIRLEDPNTGELFAQVNYVSPWNQVEPVLDSSRYFVLRVEGEGGK
                     RAYIGMGFAERGESFDFQVALQSVTKRSQNISSASNPSEPPQPTAPPKDYSLKDGQTF
                     TIKIPGREGKKPSPSQTPSSGGGGGGGLFSLPPPPPGRRG"
     gene            complement(1201403..1202798)
                     /locus_tag="CNA04480"
                     /db_xref="GeneID:3253336"
     mRNA            complement(join(1201403..1201922,1201969..1202062,
                     1202112..1202537,1202599..1202662,1202710..1202798))
                     /locus_tag="CNA04480"
                     /product="sterol metabolism-related protein, putative"
                     /transcript_id="XM_024656273.1"
                     /db_xref="GeneID:3253336"
     CDS             complement(join(1201716..1201922,1201969..1202062,
                     1202112..1202537,1202599..1202662,1202710..1202779))
                     /locus_tag="CNA04480"
                     /codon_start=1
                     /product="sterol metabolism-related protein, putative"
                     /protein_id="XP_024511925.1"
                     /db_xref="GeneID:3253336"
                     /translation="MSTTPTMPSTEDVYSNDQDWYPGIRQRSKPGKAPHEAIYDKTQD
                     INGTLVTDKPANRAMLANQRRQKEHDAKVQAKRERRAAQMGQQSKSSLWTFLPILLFL
                     PLLSSFLTQSYTFNLSPYVLPHLRNFWAETPLNIWRREMKEFTPLQLAMFDGSPDRPV
                     YLAIDGIVYDVSANRRIYGKGGSYNMMAGRDASRAFITGCFETHLTHDIRGLSKEELA
                     SLEHWKSFFAKSDKYFKVGTVLNPPIDTESPIPPSCREDESASGADIHAPGEAAAKKG
                     KIKPGPVHGQ"
     gene            1202912..1205241
                     /locus_tag="CNA04490"
                     /db_xref="GeneID:3253334"
     mRNA            join(1202912..1203251,1203301..1203417,1203462..1203921,
                     1203963..1204048,1204112..1204256,1204307..1204991,
                     1205047..1205241)
                     /locus_tag="CNA04490"
                     /product="expressed protein"
                     /transcript_id="XM_566814.2"
                     /db_xref="GeneID:3253334"
     CDS             join(1203051..1203251,1203301..1203417,1203462..1203921,
                     1203963..1204048,1204112..1204256,1204307..1204991,
                     1205047..1205119)
                     /locus_tag="CNA04490"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566814.1"
                     /db_xref="GeneID:3253334"
                     /translation="MPDLGIDNLTVVLLALLAALAIYHRFFAAPSPLVHPLLLSKQSE
                     VSAVRKSGETGIYRSWATGQGTPLTVRPANTVKTVQDVARPPKADPKEKATRPDQRCI
                     LDVQLTDEALAEIVRLVPLGIEILFPRSSPMIASSIVTLIPPSPNSALPLLLLSLSAT
                     PHRPLAILPNPRLLTAALTGHGAHPTAGIVVVFADLLAEVVEQVWEDEGDKVGVLIIG
                     DENKLQRSVVEEARRKGLTIHWWEEIWEMAESEMAEKIQLQNAHFSDVHSYYYSESED
                     PEKPVIVKVTHMNVTAGIASLLSIFPADKRPSSKLHDVVASAVRLDTPLGMTIALASI
                     WNGAGYRMIGNQEPVFDVEDIECVEHLTALADPTKDLPKPTILFITPKYHRALLDSLQ
                     FSYEAHPWASLAALHKARDLSHGHVDRDGIWDKILWSGMRENVVGGVAGRKLRAVILV
                     GDAPSPTALGASHLLLSLPLTRLHPSLYSSGPVFVSHFYDLQSPGVNHVLKQVDMWES
                     TEKSHSGPPASNVEVMLKGEDVDEAHDRGDKWIEGRVFIRGPSILERVDGGGRVQDGW
                     VDTGEHAKVQTNGTFIVNGLAK"
     gene            complement(1205199..1206640)
                     /locus_tag="CNA04500"
                     /db_xref="GeneID:3253332"
     mRNA            complement(join(1205199..1205802,1205864..1206251,
                     1206305..1206384,1206423..1206640))
                     /locus_tag="CNA04500"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_566816.2"
                     /db_xref="GeneID:3253332"
     CDS             complement(join(1205282..1205802,1205864..1206251,
                     1206305..1206384,1206423..1206492))
                     /locus_tag="CNA04500"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_566816.1"
                     /db_xref="GeneID:3253332"
                     /translation="MGLLHLLAVAGGIAAFLFVTLSLASGLLWLAELIEEHSKYAKTV
                     GMRAIYAIIGLHIVLYFTDNLPITPILFSITCHFVYLSNFSSSWPLISLTSPRFILSC
                     ILVVGDHFVWFFHFAAVAQEAKDYRVPKYRYGGQQAKAAGNNPSFGDVAAFFAVCVWF
                     VPLYLFLSLSANDNALPSFDSSAPPSPSSSHVNLGSPRLHAHADRKHATSLIKSALLP
                     LLSLLPSIRSRSRVRNPEGLIAPRSPSKSSPLPSPALQAPNYYPWGTEEKPMSSPGFI
                     TPHRSMTPLGGPKTPPPPRRTQSELQISTRGNSHSGPRAEEGMRKVSVGRPAGLASST
                     NLAPATGGETELSKRKAD"
     gene            1206699..1207701
                     /locus_tag="CNA04510"
                     /db_xref="GeneID:3253330"
     mRNA            join(1206699..1206784,1206834..1206853,1206902..1206979,
                     1207027..1207242,1207292..1207558,1207612..1207701)
                     /locus_tag="CNA04510"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /transcript_id="XM_566818.2"
                     /db_xref="GeneID:3253330"
     CDS             join(1206769..1206784,1206834..1206853,1206902..1206979,
                     1207027..1207242,1207292..1207558,1207612..1207623)
                     /locus_tag="CNA04510"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /protein_id="XP_566818.2"
                     /db_xref="GeneID:3253330"
                     /translation="MSNLEKSLFQLKFTAKSLQRQAKKATKDEAAEKNKLKQALAKGN
                     TDGARIYAQNAIRKKNEGLNLLRLSSRIDAVASRVETAVTMRSVTNSMGSVVKGMDKA
                     MESMNLERISLVMDKFESQFADMDVQTSYMESTMSDTTAMATPQDQVDSLMLQVADEA
                     GLEIQHGLGEAKVPAKEPTLGEASKEEDSNLAERLRALRPAT"
     gene            complement(1207624..1208418)
                     /locus_tag="CNA04520"
                     /db_xref="GeneID:3253328"
     mRNA            complement(join(1207624..1208068,1208122..1208253,
                     1208306..1208418))
                     /locus_tag="CNA04520"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_566820.2"
                     /db_xref="GeneID:3253328"
     CDS             complement(join(1207697..1208068,1208122..1208253,
                     1208306..1208362))
                     /locus_tag="CNA04520"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_566820.1"
                     /db_xref="GeneID:3253328"
                     /translation="MSHHPTAKEVDRTYHPKGYGMSPSLARARKPFILTNVLIGGTIV
                     AFALGVYAYSISAVQQDDFSDVEDLLPPIEERKKIRSIEDEAREQKAFQSVASVLPTN
                     RNLPLATSTPASPSKAIPEAPLAETAAAAPKTSSSWVPIKRLGDVEWIKKRGWVDGKG
                     NVLVWGAPDVDRIGRVGDAVSSKKLV"
     gene            1208523..1208623
                     /locus_tag="CNA04530"
                     /db_xref="GeneID:3253952"
     tRNA            1208523..1208623
                     /locus_tag="CNA04530"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:3253952"
     gene            1208847..1210456
                     /locus_tag="CNA04540"
                     /db_xref="GeneID:3253326"
     mRNA            join(1208847..1209116,1209198..1209943,1209993..1210199,
                     1210252..1210456)
                     /locus_tag="CNA04540"
                     /product="expressed protein"
                     /transcript_id="XM_566822.2"
                     /db_xref="GeneID:3253326"
     CDS             join(1208955..1209116,1209198..1209943,1209993..1210199,
                     1210252..1210375)
                     /locus_tag="CNA04540"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566822.1"
                     /db_xref="GeneID:3253326"
                     /translation="MPIHTIASAFGDISTSQLIAGAATFAVIFWIKLWSGGKKCSWER
                     EWAGKMILVVAPPTPTIITLIDQLLHLPSPPQILFLPPIQSPLPQDLLTILHTIRLSA
                     SRNPVAQLHCESLPRTPDAVRDFTKKWAAAPTGTTGADGRRIDAVVLGEGWEVRPMEP
                     KIEGKWSVHEHQYHLLTALLPYLLRAPKERSIRIVSLVSPAWTSAIPSMAGVKPRDDI
                     VYNTGRRSISTILLMKHFQLILDTLAAAALGAVKPVPVAGDEDEVVKKRDMSVKSNVM
                     SVSVIMPWARTEVLKAAMVETPLSKILWILLYPFVLILTPSSQKTIQSVLFALSAPVR
                     YEALDDTLKVKDQGKEIIDPRRSTVGGGDVVRDCAVIDVPPVLCDPALAKATYDDLEK
                     RVEAGVKRMESKDKTKSEGK"
     gene            complement(1210420..1211108)
                     /locus_tag="CNA04550"
                     /db_xref="GeneID:3253324"
     mRNA            complement(join(1210420..1210628,1210682..1210780,
                     1210834..1211108))
                     /locus_tag="CNA04550"
                     /product="defender against cell death 1 (dad-1), putative"
                     /transcript_id="XM_566824.2"
                     /db_xref="GeneID:3253324"
     CDS             complement(join(1210562..1210628,1210682..1210780,
                     1210834..1211039))
                     /locus_tag="CNA04550"
                     /codon_start=1
                     /product="defender against cell death 1 (dad-1), putative"
                     /protein_id="XP_566824.2"
                     /db_xref="GeneID:3253324"
                     /translation="MASKSPQPTVNSKNLQSSFDTLIDNYTSTTPARVKLIDAFLLFI
                     LLSGILQFAYRVLITVYPFHAFAGGFGSTVGQFVLLAGLRAQVAPGRDGEFKEVSQER
                     AFADFCAASVVLHLFAFNFLG"
     gene            1211372..1212651
                     /locus_tag="CNA04560"
                     /db_xref="GeneID:3253322"
     mRNA            join(1211372..1211826,1211879..1212346,1212407..1212469,
                     1212529..1212651)
                     /locus_tag="CNA04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_566826.2"
                     /db_xref="GeneID:3253322"
     CDS             join(1211503..1211826,1211879..1212346,1212407..1212469,
                     1212529..1212576)
                     /locus_tag="CNA04560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566826.1"
                     /db_xref="GeneID:3253322"
                     /translation="MNPTQPNSWHRRWFAHPDFHYSISHRFRWPAYPVEGPAVASSAA
                     AGATNAASAGAAGAAEGAAANAALGAGGGLPPRGPYGGYHHYYDGRYPYGRRFGRRPF
                     LRRFFWFGLGIGAATIWHRHHDQKRQDLERFITDPKCWSSMHHRRPLPATPVDSTAAA
                     ATTMAPLDSNDINPSYEASPRDDHRRRGWKACRERKMEERRLSEEALKYRAQPQSNTP
                     TSASRDAAPVEQKETADFQSAREAVEKLWAAKRAEANEAQQRANDKAREYASERIEKL
                     SAALERLRVSLQEDNKRGEDKKLV"
     gene            complement(1213058..1216097)
                     /locus_tag="CNA04570"
                     /db_xref="GeneID:3253320"
     mRNA            complement(join(1213058..1213387,1213442..1213533,
                     1213589..1213883,1213937..1213962,1214024..1215043,
                     1215091..1215204,1215250..1215379,1215472..1215775,
                     1215871..1216097))
                     /locus_tag="CNA04570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656274.1"
                     /db_xref="GeneID:3253320"
     CDS             complement(join(1213215..1213387,1213442..1213533,
                     1213589..1213883,1213937..1213962,1214024..1215043,
                     1215091..1215204,1215250..1215353))
                     /locus_tag="CNA04570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511928.1"
                     /db_xref="GeneID:3253320"
                     /translation="MQFQQIYWLLGALTVPANAYFILSHPILETTRLDPIVSPGEISS
                     HVHAIVGGNNFDKTMTYQSTQEGICTTASITVDKSNYWTPQLYYYNLADESYEMIPVS
                     YVNTYYLPRYSSGEDTVQAFPDGLRMISGDPFRREYVDGDPDSTAITYVCLDYDNDHS
                     GDADWAERNSFFDHNCPNGMRAQIFFRSCWDGVNLDSDDHKSHMAWPGGGVDGGDCPS
                     THPVRLVSLFYEFIYNVQDFPFNGAGNVTWVFATGDTTGYSMHGDFVNGWPSLANGTN
                     VLQEALDQCNEDNGVGGELNNCPPFVPYIDSASASACKPLNLLVDEDVGDGHSISKLP
                     GDNPLWIGDGTKPTYANYTDDGIGFTDFKSVIPDGYTEVGCIAESTTGRALTGSHFTA
                     SNMTRGVCVSFCEANGYPLAGIEYADECYCDFEMRNGASNTTLLASEKCNLACPANSN
                     ENCGGSSTLTLFNNPSLYSTFTYPTGWTSYGCMTEATNARALAKYSFTSSSMTPQLCM
                     STCQAEGYIYSGTEYSTQCYCGNTFSAGSVPADESSCSMACGGDKLQTCGGSDRLTTF
                     KFDNNAASNSSSITASATASVTANESTSSSYVTTAPSSSLG"
     gene            1216997..1219538
                     /locus_tag="CNA04580"
                     /db_xref="GeneID:3253318"
     mRNA            join(1216997..1217446,1217497..1217605,1217684..1218989,
                     1219050..1219167,1219215..1219538)
                     /locus_tag="CNA04580"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_024656275.1"
                     /db_xref="GeneID:3253318"
     CDS             join(1217823..1218989,1219050..1219167,1219215..1219507)
                     /locus_tag="CNA04580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511930.1"
                     /db_xref="GeneID:3253318"
                     /translation="MTMLRIKIALIVPFLLLVAAAFTKRVHATVQEDDTKALQRVRKL
                     VHRQGTEDTRSVTDSSIASATTDESIAASFGQTSQAATSVTSSDPSSANSPTSRVASS
                     SVTGSMPFASSFASLAEPSTNCTDPGGGCVIFLSSISSCSNDSCACDLSYPAQVCAQC
                     LASEEAIDSFNSFLKTCDDAGYVAPMSTVLVEIKYCEGQEESVFASETYSGLTAVSLT
                     DTAKITATEDVTLLTATMASSSAFATETSDREVVAVEINDSNDSSTILSPFTSSSNAM
                     ANTSDALNNLVALATDSISELSASGAASVVVITSYSTVLHTASISPTSLFSLSESAQV
                     SDMGALTTGASTLSGTISTQNESGIGALNSAREFFSGDELSNCSNDCENWQQMAQTCT
                     DDNCICTSDALSAASKCSSCIGSQSSNSTAQMRAYAAFTSNCTSASPLSDTSGSRTSA
                     AGLTFGGEATSSAGANPFATASSSGTSVNAEEAQGAATTIVVAGAGLRNVDWQPVMAI
                     VVVVTTMACLVAGLYVV"
     gene            complement(1219554..1220863)
                     /locus_tag="CNA04590"
                     /db_xref="GeneID:3253316"
     mRNA            complement(join(1219554..1219574,1219626..1219767,
                     1219817..1219926,1219979..1220053,1220110..1220215,
                     1220268..1220584,1220637..1220863))
                     /locus_tag="CNA04590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566833.2"
                     /db_xref="GeneID:3253316"
     CDS             complement(join(1219650..1219767,1219817..1219926,
                     1219979..1220053,1220110..1220215,1220268..1220584,
                     1220637..1220786))
                     /locus_tag="CNA04590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566833.1"
                     /db_xref="GeneID:3253316"
                     /translation="MALRCRFSCIRNYRAATSNRAFKRSIMSHIRAVHSKPTLAVTDD
                     DAARLQEIYAKFQDPSSHYYIAPGSFGPEHEEDHRTSHVPDPAYSLDAITNAEASSPF
                     QGSQEQREQMDDRPWLNEDSGRKEQALEYFKQQNHDTTGVLTWPVAWGDQDSFQHVNN
                     VQILRWVESARIRYCESWAGKLGKKTVYDMLRAKGTGIILKEVSIKYKAPITYPDTLM
                     ISNCIHSVNVERASYGHRHIIWSLKDQHVKAVSDSSIVIYDYDNLRKGVMSDQLRELL
                     LSVAGDSKWSEEDTK"
     gene            complement(1221085..1222967)
                     /locus_tag="CNA04600"
                     /db_xref="GeneID:3253314"
     mRNA            complement(join(1221085..1221316,1221370..1222141,
                     1222194..1222299,1222351..1222449,1222501..1222674,
                     1222730..1222967))
                     /locus_tag="CNA04600"
                     /product="single-stranded DNA binding protein, putative"
                     /transcript_id="XM_566835.2"
                     /db_xref="GeneID:3253314"
     CDS             complement(join(1221259..1221316,1221370..1222141,
                     1222194..1222299,1222351..1222449,1222501..1222674,
                     1222730..1222846))
                     /locus_tag="CNA04600"
                     /codon_start=1
                     /product="single-stranded DNA binding protein, putative"
                     /protein_id="XP_566835.1"
                     /db_xref="GeneID:3253314"
                     /translation="MAKSAKSAPAATVKVDKKDKKSKKDEKPVPAPAPAKAAKKDVKE
                     KKEKKSKKAKTPTPPPESSTSESEDSEEDSSDSESSSSEDEKPAAKTAAPAAKAKEEE
                     PSTEESSDSDSESEEEFKTETKKEVNEESESDSDSDSGSDSNSSEDEDEKVEETKEEA
                     KPQANGNKRKAEEESIAPAKKARADGGDEEATTNVFVGQLSWNVDNDWLKSEFESCGE
                     VVSARVVFDRDSQKSRGFGYVEFADLESSAKAIEKDGSEIDGRAIRVNYATQRKPNEA
                     AEKRARVFNDKQSPPAETLWIGSLSFSVTEDQVYEAFGQHGDVQSVRLPTDRDTGAPK
                     GFGYVQFSSVDDASAALKAMNGAEIAGRAIRVDFAPPKQDNGERGGFGGGRGGGGFGG
                     RGGGRGGGRGRGGFDRGGRGGGRGRGGPPRGGARTGGIVKPEGQKVTFD"
     gene            1223187..1225246
                     /locus_tag="CNA04610"
                     /db_xref="GeneID:3253312"
     mRNA            join(1223187..1223279,1223378..1223461,1223529..1223615,
                     1223670..1223799,1223862..1224031,1224084..1224138,
                     1224193..1224271,1224335..1224437,1224487..1224539,
                     1224588..1224666,1224724..1224827,1224933..1224984,
                     1225042..1225246)
                     /locus_tag="CNA04610"
                     /product="isocitrate dehydrogenase, putative"
                     /transcript_id="XM_566837.2"
                     /db_xref="GeneID:3253312"
     CDS             join(1223226..1223279,1223378..1223461,1223529..1223615,
                     1223670..1223799,1223862..1224031,1224084..1224138,
                     1224193..1224271,1224335..1224437,1224487..1224539,
                     1224588..1224666,1224724..1224827,1224933..1224984,
                     1225042..1225131)
                     /locus_tag="CNA04610"
                     /codon_start=1
                     /product="isocitrate dehydrogenase, putative"
                     /protein_id="XP_566837.1"
                     /db_xref="GeneID:3253312"
                     /translation="MFARSASKSVVSSLRTVQAPVGVRYYASAFNSSTPTSAFAGKKG
                     ADGNYTVTLIPGDGIGPEIANSVKQIFKAAQVPIVWEEVDVTPILKDGKTVIPDDAIK
                     SIKKNTVALKGPLATPIGKGHVSLNLTLRRTFSLFANVRPCVSIKGYKTPYDNVNTVL
                     IRENTEGEYSGIEHEIVDGVVQSIKLITREASERVARYAFHYASESGRNKVTAVHKAN
                     IMKMSDGMFLTACRDVAKEYPNISYDEDLLDRVCLRIASDPSPFADRVMVMPNLYGDI
                     LSDLSAGLIGGLGLTPSGNIGKDASIFEAVHGSAPDIEGKGLANPTALLLSSLMMLRH
                     MSLYELADKIEKAALSTIAEGKAITRDLGGKAGTKEYTDAILSKL"
     gene            1227512..1229968
                     /locus_tag="CNA04620"
                     /db_xref="GeneID:3253310"
     mRNA            join(1227512..1227523,1227589..1228082,1228163..1229968)
                     /locus_tag="CNA04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656276.1"
                     /db_xref="GeneID:3253310"
     CDS             1228427..1229617
                     /locus_tag="CNA04620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511933.1"
                     /db_xref="GeneID:3253310"
                     /translation="MTSFSDTSSASPLPVTPSSSRRAPSPVVAASSLATHDLSTPVSS
                     GPYITPPPSLRLYSSALKEKMAAGMTAAMRELKGDRDGRERKYDVEYGYDEDPIERHV
                     KLFLTPRTAIRPDRPRPSLSHLSTSASIRPVSAPPAVKSAKLRVTDDGYGVNMTVDDS
                     QRIELAVSDESDTEMLAASPSTVGQSPVLTRERDSFVPGLIKFHRAYPSSSSLMPPRP
                     DAWRTDSTGSTASSIASEASFEAIKAEDMVSLYGGGGGVKRAEGPFHEETYWGDESEW
                     GFNRASMLSTSTNETVRPAKTPKRTPTSTVHTSSPTATLACSLLPRATLSPAPHQQPP
                     PRRPGCSQQMSAASDDGRSIDGLGDLSMENDPVWLKERTLSEKMVLQAGLRSQRQRVE
                     VRRR"
     gene            1230510..1232637
                     /locus_tag="CNA04630"
                     /db_xref="GeneID:36392686"
     mRNA            join(1230510..1230618,1230697..1230721,1230785..1231256,
                     1231317..1232637)
                     /locus_tag="CNA04630"
                     /product="RPN10-like protein, putative"
                     /transcript_id="XM_024656277.1"
                     /db_xref="GeneID:36392686"
     gene            complement(1230514..1233992)
                     /locus_tag="CNA04640"
                     /db_xref="GeneID:3253306"
     mRNA            complement(join(1230514..1232589,1232642..1233131,
                     1233179..1233326,1233374..1233844,1233892..1233992))
                     /locus_tag="CNA04640"
                     /product="expressed protein"
                     /transcript_id="XM_024656278.1"
                     /db_xref="GeneID:3253306"
     CDS             join(1231068..1231256,1231317..1232483)
                     /locus_tag="CNA04630"
                     /codon_start=1
                     /product="RPN10-like protein, putative"
                     /protein_id="XP_024511934.1"
                     /db_xref="GeneID:36392686"
                     /translation="MTDDGQFASRTVLSRKKPSQWAISDYDRYQDEEDCRPPDLPWWD
                     SAVSDATRWYKERCKASGFDITQPANRQRAITEWSSVVASTIKPLLKHNSSGFVIHPK
                     LAIVTDEDIDFALRNEYSFQDGEYAPVIVSRSGTQHGSDIIRVKTEEECGSRSSATSS
                     RLAVPNAHLIIHSEYASDSGAPPAVHTRLALPSDPALLSKTSPAVYALFDPEDTEAQQ
                     SMQSVINQAVEAFDQFDRDPYRSRVIEKGLMGHSRRTWSEHTRDPIDKSKYLSKYTAA
                     FLASFFDEPGDNEENTQGTVSGAYLTPEVVSLHGHKNSTWESCLENGTIHPAFLCDSS
                     SIKQEITEDVQGRLQGLSGYGGPEFETPPPPYESQENLQEDHWEAGSLFLDFVEDGES
                     SQLPSRRTGGVRSVFSRSFWTRDRGTDGREDFQDSRTPRRSLRASLILRLLGNSDLSD
                     L"
     CDS             complement(join(1232661..1233131,1233179..1233326,
                     1233374..1233844,1233892..1233917))
                     /locus_tag="CNA04640"
                     /codon_start=1
                     /product="RPN10-like protein, putative"
                     /protein_id="XP_024511935.1"
                     /db_xref="GeneID:3253306"
                     /translation="MPLESCMLILDNSEYMRNGDYPPTRFQAQAEAVQTVFTAKTDAN
                     PESAVGMMTMAGNSPSLLVTPTNDLGRLMHALSKVLVSNTAQLSTAISIAQLALKHRE
                     NKNQRQRIVIFVGSPLGESAESLVKLGKRLRKNNVFVDVVTFGDEGRDNDEKLRGLVE
                     AVGEESNLVSVPSGERFLSDVIASSPILFDGENPMAAAGGFEGDIDPNMDPELAMAIR
                     MSLQEAQAQQSQPADAGPSSGSGVALPDSLTQPLSTTHPSSSSGDVLMAPGDKGDLPG
                     TPSAQAHAEAADKAGAIAESGTGSTFTSGNPLTGNRAPDAVQQEEEDEELKRALAMSR
                     GEGGDIEMEEDEDEEAAIARAIAMSLGGQEEGKDKNQ"
     gene            1234101..1236271
                     /locus_tag="CNA04650"
                     /db_xref="GeneID:3253304"
     mRNA            join(1234101..1234146,1234654..1234687,1234740..1234821,
                     1234867..1234935,1234982..1235745,1235800..1235940,
                     1235994..1236271)
                     /locus_tag="CNA04650"
                     /product="actin"
                     /transcript_id="XM_566845.2"
                     /db_xref="GeneID:3253304"
     CDS             join(1234669..1234687,1234740..1234821,1234867..1234935,
                     1234982..1235745,1235800..1235940,1235994..1236052)
                     /locus_tag="CNA04650"
                     /codon_start=1
                     /product="actin"
                     /protein_id="XP_566845.1"
                     /db_xref="GeneID:3253304"
                     /translation="MSMEEEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG
                     VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE
                     HPVLLTEAPLNPKQNREKMTQIMFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDG
                     VTHTVPIYEGFSLPHAILRIDLAGRDLTDYLVKILMERGYLFTTSAEREIVRDIKEKL
                     CYVALDFEQELQTAAQSSQLEKSYELPDGQVITIGNERFRCPEALFQPSLLGLEAAGI
                     HETTYNSIMKCDLDIRKDLYGNIVMSGGTTMYNGIADRMQKEITALAPSSMKVKIVSP
                     PERKYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKCF"
     gene            complement(1236290..1238693)
                     /locus_tag="CNA04660"
                     /db_xref="GeneID:3253302"
     mRNA            complement(join(1236290..1236407,1236470..1236828,
                     1236902..1237200,1237286..1238146,1238208..1238693))
                     /locus_tag="CNA04660"
                     /product="tricarboxylic acid cycle-related protein,
                     putative"
                     /transcript_id="XM_566847.2"
                     /db_xref="GeneID:3253302"
     CDS             complement(join(1236321..1236407,1236470..1236828,
                     1236902..1237200,1237286..1238146,1238208..1238503))
                     /locus_tag="CNA04660"
                     /codon_start=1
                     /product="tricarboxylic acid cycle-related protein,
                     putative"
                     /protein_id="XP_566847.1"
                     /db_xref="GeneID:3253302"
                     /translation="MFFRLRRFGLLHRPRSPTACISPISYSFASPSHLNFSGKFRICS
                     RPLHQSSAALKLSPFKLHDIGEGITEVEILKWHVTDGQAVEEFDALCEVQSDKSVVEL
                     TSHAKGIVRDIKTDPGHMVKVGTVLCVIETDEPSEDAAEDDLQAPPQLDNAQDSVEDN
                     TKSPTLGVQPQKLSGQDEIRAHESATVAQAEDLSEELERASERESPPPTPSASRRKHP
                     LADADKDEDDRFSETETLFRAHDASMDASGPTKLSGEAAILPSASRREPEQYTGPVPE
                     RRSQPVGDRERAVIKAAPAVRTLALRLGIDLSQVTPSGEGGRVVREDVFSAANTTAGV
                     ENQSAQVKKYNTQATSNKSEVIEQETTRVEFGRTRKVMFKALSEQAKIPHFGYSHTLD
                     LTALIPYLKSKPFSPSKPSYTASDIPSSLIHEDEAIPEVGKNAKPTLLTFLIKTILLA
                     LEEHPIMRSRVKHGTDGTEKWLEVSRHGIIGVAVSDPKYGLLTPSLPPLNPSTPIPIL
                     TNHLTHLRQTAHRPSSQEGAHLTVSSVGGLGECSGASPILPPGGGLAICAVGRAKWEV
                     EWVKKEGGKVFDLGVEDVKSAGLKAVLRVPVGWSADHRVLEGAELISFTETWKKYIEE
                     PWRWMKFSG"
     gene            complement(1238955..1240564)
                     /locus_tag="CNA04670"
                     /db_xref="GeneID:3253300"
     mRNA            complement(join(1238955..1239475,1239523..1239723,
                     1239785..1240018,1240076..1240203,1240255..1240291,
                     1240389..1240564))
                     /locus_tag="CNA04670"
                     /product="expressed protein"
                     /transcript_id="XM_566849.2"
                     /db_xref="GeneID:3253300"
     CDS             complement(join(1239094..1239475,1239523..1239723,
                     1239785..1240018,1240076..1240203,1240255..1240291,
                     1240389..1240453))
                     /locus_tag="CNA04670"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566849.1"
                     /db_xref="GeneID:3253300"
                     /translation="MDQKSVKDVAQDLATKFVSLDKVEFDSAINQYFDANCKQTSRLA
                     EVQGVSRIKKLAALEAAVASDSHLAGNVNYDPKDETIRFSWERTFRPPAIPSVIPLSH
                     WANHHLEKVALKSTWDSQLHMNAARDEEGETKLYVTKVGPTKRRDTTWFEDILPFFLI
                     RPIISFFFILASDVYSIISRHPVAEEGQLEASLSIVSELFGCDTSVDKGIAAKRIITW
                     PVYFLFGLFGLLISSVQSSIHFVHDTLHLDSNPIAQLVSVFEDYALRLFNIIYPNVRH
                     IVLSSVNVAENTAKAYGVPAEEYHELAERKVGEAVKWLGRATEAQSSRNEASGTRRNP
                     QAPGAPSYAEAVKE"
     gene            1240793..1241633
                     /locus_tag="CNA04680"
                     /db_xref="GeneID:3253297"
     mRNA            join(1240793..1241252,1241316..1241407,1241462..1241633)
                     /locus_tag="CNA04680"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_566854.2"
                     /db_xref="GeneID:3253297"
     CDS             join(1240896..1241252,1241316..1241407,1241462..1241540)
                     /locus_tag="CNA04680"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_566854.1"
                     /db_xref="GeneID:3253297"
                     /translation="MSVLRALPRVARVVRPAPPSLRSISTTNTIFKSPTADPFPLPFS
                     DPELAHANNSLPSNSEEWPLPEPLDRTGEDEKTLRARLIYQTRKRGTLETDLILSTFA
                     RDELPNMDFEEMKQFDKLLDEPDWDIFYWSVKKRDPPARWKGTPLLEKLQKHAKNEGK
                     VVRMMPELMQKEPDL"
     gene            1241680..1244940
                     /locus_tag="CNA04685"
                     /db_xref="GeneID:36392687"
     mRNA            join(1241680..1242019,1242068..1242172,1242232..1242336,
                     1242402..1244164,1244214..1244940)
                     /locus_tag="CNA04685"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656088.1"
                     /db_xref="GeneID:36392687"
     CDS             join(1241762..1242019,1242068..1242172,1242232..1242336,
                     1242402..1243706)
                     /locus_tag="CNA04685"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514160.1"
                     /db_xref="GeneID:36392687"
                     /translation="MQHPRVNRYPDNVLIRLPAYYADYGGPGWYPELQFPHQTRLAVR
                     YSSALRKDVYIQPNALYISGIKEELGKEGICEILYSFGVERGLEFTMYQPLRHLPGLV
                     MTTMQFPSQRQAEDVLIIVNKNSHLFVSSTSEFKARYSEINSRGVNAASTRDILLVRE
                     ELSLAPAYIPTVASSHPAHPLSLQPSRWNAVGYARDAFVNKRKLTEYDHDLHPLVYGH
                     LHDPSDKRTHRGRGYDRMNRCNPHDRRVVPSPRKKRLLAHDFLPSSLHRYEDIPKLHH
                     HDYQVSSHLIESVPESALQHGRKSPYTRFQNVLADYSQHKSASRSTLWNTTQRPPKKK
                     IKRRKNLFKAKYAYALDMGIRSHVGNETVRTGANAQKRTFLSKRLPTLTETSENQMEG
                     ENQTEAPSIPSADVLEWLRQTVLDNDGNAKTLATAAETLKVNVPVQAEQGRNLTSEEH
                     PGWNGEANAALDKESRPQLRALPQTCAINLGPPRPSCSTPSPFIYSDLQPFATYFCPF
                     IRQTGYCEPKFIALSNDRKTLSLMRRYDPHESRSFSAVCAIDALPEDQRNLLGLERRW
                     TMIGHAEKMWRESEKGAVQFRAPE"
     gene            complement(1243859..1245799)
                     /locus_tag="CNA04690"
                     /db_xref="GeneID:3253295"
     mRNA            complement(join(1243859..1244097,1244155..1244287,
                     1244338..1244581,1244633..1244653,1244707..1244796,
                     1244849..1244867,1244917..1245002,1245055..1245443,
                     1245505..1245799))
                     /locus_tag="CNA04690"
                     /product="expressed protein"
                     /transcript_id="XM_566857.2"
                     /db_xref="GeneID:3253295"
     CDS             complement(join(1243984..1244097,1244155..1244287,
                     1244338..1244581,1244633..1244653,1244707..1244796,
                     1244849..1244867,1244917..1245002,1245055..1245443,
                     1245505..1245692))
                     /locus_tag="CNA04690"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566857.1"
                     /db_xref="GeneID:3253295"
                     /translation="MWIHRYSPIVQFLLVLALVPLNCWSLPPHLPKPQLPGKLVPFSR
                     LHECPSLPSRAYPTVAKDVRPDDFRVVMALGDSITAGLLARGSRSSSASSAPSQVDPQ
                     RPLLPFLDIQEYRGLSYPIGSDPGAITIPEILRHFSPSAKEIPGSSKGKHPPVTCLNG
                     WGIKGCAERPEEDGLNAAVSGSVSSGLLRQVEDFILPRLKDMEIRKEDWKFVNLGIGA
                     NDICSFCLYSNMTDIDFNGSPKRFAKDIKRAVNALRKNVPNIIINIIGLFRVSAIYKL
                     TLKDPYCQPPLFPYPIPHFPLGCSCALLPGPTGDWTRQKMDELGEAYDEAVLEIVREW
                     EKEDDEHFGAIWQPGTAIDLPNYPITALSPIDCFHPSEASHQRMAAGIWNRLTLSLEE
                     KYLPISWDDEIMVRCLEEDDRVSVGMVSESFRGAS"
     gene            1245947..1247099
                     /locus_tag="CNA04695"
                     /db_xref="GeneID:36392688"
     mRNA            join(1245947..1246089,1246160..1246305,1246367..1247099)
                     /locus_tag="CNA04695"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656089.1"
                     /db_xref="GeneID:36392688"
     CDS             join(1246031..1246089,1246160..1246305,1246367..1246404)
                     /locus_tag="CNA04695"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514161.1"
                     /db_xref="GeneID:36392688"
                     /translation="MSSTALDTADKRAFPGKDCLTCRLTGAAAFTGIGTYALVQANQQ
                     GAFKRIRPQGAPVVAGKITALVGTVFIGLGIGRLFI"
     gene            complement(1246583..1248510)
                     /locus_tag="CNA04700"
                     /db_xref="GeneID:3253293"
     mRNA            complement(join(1246583..1246694,1246748..1246945,
                     1247002..1247086,1247137..1247411,1247475..1247722,
                     1247775..1247817,1247876..1247933,1247980..1248066,
                     1248143..1248243,1248298..1248510))
                     /locus_tag="CNA04700"
                     /product="acetyl-CoA C-acyltransferase, putative"
                     /transcript_id="XM_566859.2"
                     /db_xref="GeneID:3253293"
     CDS             complement(join(1246662..1246694,1246748..1246945,
                     1247002..1247086,1247137..1247411,1247475..1247722,
                     1247775..1247817,1247876..1247933,1247980..1248066,
                     1248143..1248243,1248298..1248417))
                     /locus_tag="CNA04700"
                     /codon_start=1
                     /product="acetyl-CoA C-acyltransferase, putative"
                     /protein_id="XP_566859.1"
                     /db_xref="GeneID:3253293"
                     /translation="MASTIQNITNSIPSLGRARLLINSSDDVVIVSAVRTPIAKAKKG
                     GFKDCCPEDLLAAVFTEAVKRGKVNPSQIQDVAVGNVLPPGGGANVARMAQLYAGIPY
                     TTPINTVNRQCSSGLTAVVQIANEIKAGEIDIGIGAGVEHMTAHYGAGVLPEKMSEEI
                     LSNPESADCLTPMGITSENVAKQYNISRDVQDTFAANSFGKAAAAQKAGKFKEEIVPV
                     KVRWTDPKTNDEKEIIIDSDEGIREGVTAESLAKLKPAFAKDGSTHAGNASQVSDGAA
                     AVILARRSVAQKLGLPILGKFVISAVVGVPPKLMGIGPAFAIPKVLEKAGISKDDVDF
                     FEINEAFASQAVMSIQHLHIPFEIVNPVGGAIAIGHPLGCTGARQIATAFSEAKREKK
                     KIFVTSMCIGSGMGMAAVFVNEQ"
     gene            1248657..1249970
                     /locus_tag="CNA04710"
                     /db_xref="GeneID:3253291"
     mRNA            join(1248657..1249100,1249160..1249302,1249364..1249434,
                     1249486..1249697,1249776..1249970)
                     /locus_tag="CNA04710"
                     /product="expressed protein"
                     /transcript_id="XM_024656279.1"
                     /db_xref="GeneID:3253291"
     CDS             join(1248738..1249100,1249160..1249302,1249364..1249434,
                     1249486..1249601)
                     /locus_tag="CNA04710"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511938.1"
                     /db_xref="GeneID:3253291"
                     /translation="MASICTACSRLLPRPAIPSSSRLPASLARLPPPRHFSTLLTPYF
                     QRRVPRSDPKPCRLATTSAYNSSRSGLPDLPPIPSRPNIKVSAPSLAAIKEEGFYDDD
                     VKLLPPEEAFLNITPEAVQQLTRITSREPLEVLSQGKLALRVGVESGGCHGYQYIMDL
                     TEERGVDDYVLQPEGVACIPVVIDLTSFGLLKGATLHHATELIGSSFRLQDNPQAKEG
                     GACGCGVSWEAK"
     gene            complement(1249592..1252492)
                     /locus_tag="CNA04715"
                     /db_xref="GeneID:36392689"
     mRNA            complement(join(1249592..1249871,1249933..1250007,
                     1250061..1250093,1250144..1250779,1250847..1251661,
                     1251715..1251946,1252013..1252492))
                     /locus_tag="CNA04715"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656090.1"
                     /db_xref="GeneID:36392689"
     CDS             complement(join(1249669..1249871,1249933..1250007,
                     1250061..1250093,1250144..1250779,1250847..1251456))
                     /locus_tag="CNA04715"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514162.1"
                     /db_xref="GeneID:36392689"
                     /translation="MSTHLEELKNHKKMIWNDAACTQLDILRRSYSAVQSHLTTNQML
                     PDIATKIYDDLCSLRSGASKPLTGKNKNRSRPWTKALSELRFAVSNLQSSAWDIDPEL
                     LIDIQQKADRFFTETTERQEGPIRKCHMDALTKGDLDDPTYGPSVLRFSLTRLKELES
                     YTKAKRDEVAKMVNTINKDWEECSDGRNFKWNEVTTPRVSRQNVANSWFGMSSSTPFT
                     QENATADEPSLHDYLLERMIPYIPSKVDYTPDLSALKPMPQVAFNCLSELQQDINSYA
                     DTLPSGQPRNKMVSSQQAKYSAAISSAMEEIVERSKAKWEEMATPLNDSTVASEGLEA
                     HNALTSRAASNYFTLRALQTEHSKPPATTKNEHKAWATSVQRDREEAKKWERDVEEWH
                     VSRMANESIGVGSDGEASRQLDAVTTQIDAATVSETHTIAPRQLTELEKLFIANGLEL
                     NEQFDWFEEVQTNLPLPESAAITSQSGTRTREKSASAMSVPSSGSTLSNSDRWRKIRD
                     LPSWRKTGVE"
     gene            complement(1252581..1257493)
                     /locus_tag="CNA04720"
                     /db_xref="GeneID:3253532"
     mRNA            complement(join(1252581..1253361,1253417..1253812,
                     1253880..1254341,1254398..1254492,1254546..1255173,
                     1255228..1256823,1256903..1257022,1257188..1257310,
                     1257417..1257493))
                     /locus_tag="CNA04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656280.1"
                     /db_xref="GeneID:3253532"
     CDS             complement(join(1253296..1253361,1253417..1253812,
                     1253880..1254341,1254398..1254492,1254546..1255173,
                     1255228..1256823,1256903..1256929))
                     /locus_tag="CNA04720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512060.1"
                     /db_xref="GeneID:3253532"
                     /translation="MQSGPRMVMPSAPHIQHPGMNPPIDPALQQQMMVVNGAQRVPFE
                     QQTMSDENRAYLEQQVRLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPQQGRE
                     VKTAAQRSLGVAAQQAPRHMMQHPQMVQSLQAQGIRQVLTPQGGVVWLDAQNRQVQIN
                     QAWQNDPRQQQQQQQQQQVGQGQQMQALYQQQQQQHLQQQQLLQQMQQQQVQQQQQQQ
                     VQQQQQMMTPQQQAQLQHLQRQQALAQQAAQAQQRASLPPSARPPPASLPTPSLLQVP
                     PPPSMKRPMHDISRSASPMPPHMRMQQSQPPQPQATHMQASSSALSVTGNAPAILPPR
                     ASTIPVSMSDSHIAQNRPQQVGQSQANGLQIPPQIPPEPPMRWSKTLILSSQNRLERW
                     KQKTDKLESMLADAKLGLAEMEKEAKEGKKRAEERSHDPQGMFDKEILAYLKRAGYSN
                     AVQAFEEDMKRAGRNIEGKPGSPSGSSPKMQSPRDVKTSSTPAGQSVSATGKDDPQGS
                     DSIFGRETDDEKMGVDKDGEEKDETKDLGELFTWWMLYQDTRTLLAQKPHLFQPPTSL
                     ISSHSANAANNVAFPPTTTRTAPQAKHDDTQLRLQQAEEMKQAQQAQISAQQESVRRQ
                     LAMQQGQNQHPHQQQQQQQGQEQRHIVMINNQPHTLTQDEVHRLIQQQQYMTQQNQIQ
                     QQQRQQQQQQHQQSQMFAISNGHIASQTPGMHHQTQQQRMQFESPLQKRKREGEDGQM
                     GGKFPKVGAPTPEDQRRQAVELARSVSAQMTPQQGHMNEISQSPASQTSQDPTRQHNL
                     AEAQRVYAATQAAYARQQVERTSVANSPANFTIGVSPVQLGTSPMGNGQSPAVGHDVD
                     GNSNVNGNTVDRAPTPASAKGKKKPARITIDTEVGGASDLDAPQSGAASATSKRKTPS
                     AGKRPLKSATTTAEKPVKGKAKTKAAKNAYANQPTGDALRTEGEEPAQTPSGQVAQTP
                     GSTQSTVYPLPAQTPSQEQPTPAPLTEIEHIHPESQPAPPPPPAQVPAQMQTQAPQSQ
                     NTSFEAPFEFDDSNELFKMLDFNDGDGGGFDNEVFNFDGFAFPSVGENQEDWQAIDSS
                     S"
     gene            complement(1257731..1259800)
                     /locus_tag="CNA04730"
                     /db_xref="GeneID:3253289"
     mRNA            complement(join(1257731..1258256,1258317..1258397,
                     1258487..1258764,1258828..1258976,1259034..1259074,
                     1259129..1259230,1259288..1259375,1259454..1259800))
                     /locus_tag="CNA04730"
                     /product="expressed protein"
                     /transcript_id="XM_566863.2"
                     /db_xref="GeneID:3253289"
     CDS             complement(join(1258017..1258256,1258317..1258397,
                     1258487..1258764,1258828..1258976,1259034..1259074,
                     1259129..1259230,1259288..1259375,1259454..1259746))
                     /locus_tag="CNA04730"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566863.1"
                     /db_xref="GeneID:3253289"
                     /translation="MSGPLGNLPGMTYDPLKNRYFPTPKGPLQNDQPTPSLYASASLS
                     RKGRPEMILGILDCQPQRKRQKPDIHESLVSGPGRKLVKGRGRMGVGMGKRSERGEEA
                     ILSKLQLDAEHHSCGCHGETITSYKSFGEEAYLATTDHGKLVMHGPEGETVVLYICPQ
                     VLMGVHFDIMRMTLIAVSGGADPHVHLFKRDPQMLEHIFMSHSELNLNGGDMYEVSSF
                     DDRCTIGGHKSLTTINYTSSFTTSNRRLPSDALAVHQYSRDLVFTGQRSGLVTCEDLR
                     VKPKSPVVVGGTRGRKAVVNVKRVQDGAVPWGLVVSGMGDELLLYDVRFSDKPLHTFQ
                     GHINNYQTQVSTALSPSGTHLFASGSDNRIRAYSLLTGSPLTPWPEDEYHQQEENPLV
                     KEFEDKITGLSVRDDLGLDVVVKGQLLRFAK"
     gene            1259986..1260727
                     /locus_tag="CNA04740"
                     /db_xref="GeneID:3253287"
     mRNA            join(1259986..1260269,1260337..1260727)
                     /locus_tag="CNA04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_566865.2"
                     /db_xref="GeneID:3253287"
     CDS             join(1260051..1260269,1260337..1260624)
                     /locus_tag="CNA04740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566865.1"
                     /db_xref="GeneID:3253287"
                     /translation="MSQPSQQALLAALAAQSSRPRPATVPYAALGPSQLKSEATSGNS
                     RKLHCPRDGCGSVLLQPGVGVWADLQASVLPDDPSSPFPAPAAPHAVWHVASGPFAFD
                     NIGFSRPDASTTLPPHTPSGSAQGADKGKVKWLICADCDLGPLGWTYEGERDAWLAVE
                     RVSYGESK"
     gene            1260951..1262953
                     /locus_tag="CNA04750"
                     /db_xref="GeneID:3253285"
     mRNA            join(1260951..1261623,1261712..1261866,1261944..1262362,
                     1262453..1262588,1262700..1262953)
                     /locus_tag="CNA04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656281.1"
                     /db_xref="GeneID:3253285"
     CDS             join(1261012..1261623,1261712..1261866,1261944..1262362,
                     1262453..1262588,1262700..1262859)
                     /locus_tag="CNA04750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511940.1"
                     /db_xref="GeneID:3253285"
                     /translation="MDDPWADAPASPLPKSEHRFGNVNINDNENANAFSNYSLPKSPS
                     ANGPEKVQEEQTEEKTKVETETEPSREEINGASESDDEAQVAQVQSSPAQESHQWLSP
                     QVEASDQEEKAEREESEEREEDGEEEQDDFDDFNSFDGPRSSSFPTPNPDKGAMPGEG
                     GDIDDGFGDFADFEKGEFDEPVGAEAGIGGNGLVEEPEPIKERWHALELRPPPPKSEI
                     ANQLSSILSPLFLHQDSLSNEPIRMVGGLKQVLVSQSSRDAYAQLTTPPITKPLDWTR
                     SRVRREHLISMGVPVNLDEVDSHRLSALPPLRIVTSSGSGSSRPQPRRAETFDAYTGV
                     KYTSDQKGKGRDTDGSMSAGPGVGVGYMERDMNGEETGKYGLGEKPEMDTLRAEELCG
                     LEEDALSILPIASLRKLQSDLVENTSQVSATLAWMLQLKDAQLHDSATYNGMISSLIA
                     NAARVKASENTGGGGVFRRGSSKRPQSVSGGMTPKRTGSPGVW"
     gene            complement(1262944..1265816)
                     /locus_tag="CNA04760"
                     /db_xref="GeneID:3253283"
     mRNA            complement(join(1262944..1263840,1263898..1264325,
                     1264375..1265325,1265373..1265816))
                     /locus_tag="CNA04760"
                     /product="response to osmotic stress-related protein,
                     putative"
                     /transcript_id="XM_566869.2"
                     /db_xref="GeneID:3253283"
     CDS             complement(join(1263116..1263840,1263898..1264325,
                     1264375..1265325,1265373..1265716))
                     /locus_tag="CNA04760"
                     /codon_start=1
                     /product="response to osmotic stress-related protein,
                     putative"
                     /protein_id="XP_566869.1"
                     /db_xref="GeneID:3253283"
                     /translation="MPSQVPASPTAPGPPVLSAPTMSSSPRSLGPINDNPYNVDLVVP
                     YSIALSKKDLKNRPKAEAEIKEGYVYLLRELEGSGFRLASKAGRGNKGQEEVWIFVGA
                     SEERVEQLVEEERRLDASHNLLTAPSAFPPAPATRLRLIYNTLTAPKLQGGLGITPGR
                     GKWSRVKSISALHDEAADKAWVEKWTTGGDWQVGLTKGLDEDTRKRGGLGDQQPPPVH
                     LYFDFLTTYTLSLFPITVVSVLFYFFTPADSYPPLYALCLSLYSTIFIAIWRVKQRKF
                     AVKWGTYGCENVAFGRLRPEYVASLGLDKTTAQQDVETVDAVQAGSELKRDSKVAASI
                     PVIAACGVGLGVVLMGLFVLEAFVSELYDGPGKQIVPLIPTGLFVLIVPSIVGAYQLL
                     AKFMVKWEDHPTPVGEEKSLTAKTFAMNAIVAYLGLFLSAYIYIPFGSFIMTHVQTHL
                     MGRLPVPGSRRVNSTTSSVTSPTSSAPASISAEKHAINGGRLKSQLFTYTVTNQVSGA
                     FLELGMPFIMRFIHDWRAGKTTIKEALKKTNGHGESEKVPTTEEEIEKRFLNKVEREL
                     ALPEYDTFTDYAEMVTQFGYVVIWSLVWPLAPVFALINNYIELRSDALKICKHVRRPV
                     GDRVETIGSWLETLSIISWIGAITNATLIYLFRPSPASPDLHSQSPNPNFPTPGSPSL
                     SHIVSAYHSSSSLQEWYPQLATLGLWALGASHGYIVLKWVVEGIVERVWWRGSEEERE
                     VQRMRAGSSSPSTSGVVNSPSKSISARTPEPEFRYGDETDQNGGLGKILGKEPVSTFW
                     NGGEEGAKEIARIIKAE"
     gene            1267190..1270455
                     /locus_tag="CNA04770"
                     /db_xref="GeneID:3253217"
     mRNA            join(1267190..1267668,1267746..1267846,1267908..1268000,
                     1268048..1268256,1268322..1268853,1268903..1270103,
                     1270158..1270455)
                     /locus_tag="CNA04770"
                     /product="phosphoprotein phosphatase, putative"
                     /transcript_id="XM_566871.2"
                     /db_xref="GeneID:3253217"
     CDS             join(1267515..1267668,1267746..1267846,1267908..1268000,
                     1268048..1268256,1268322..1268853,1268903..1270099)
                     /locus_tag="CNA04770"
                     /codon_start=1
                     /product="phosphoprotein phosphatase, putative"
                     /protein_id="XP_566871.1"
                     /db_xref="GeneID:3253217"
                     /translation="MPSTPTRAFPNEVAVFSNYLVFTTLTLKEVQAHAKTPYGHPGNK
                     RACSLFTLDDDMRYTSFAMDHGPLNLAFTFHACIRIHEKLEKARERGKPVCLYTTTEP
                     KMKSNMILIAALYSLIVDKQPPWNAFRPIAQFEIMPFRDAGSGPMDYGLTVQDILYGV
                     EKAIGNGLLDLSSFDADEYQYYEMVENGDLNILGPFIPFASPTENSWIEGVLQSPSNG
                     HIIHTPVKSKTISHQLRCVLDIFQRENVGLVARLNDELYDRRHFLDMGIEHIEMFFDD
                     GTNPPDDIVREFIRLAEYTIEHKRQKVAVHCKAGLGRTGVLIGAYLVYKYQFTAQEAI
                     GFMRIVRPGMVVGPQQQYMVLNQLKWVGWAARDQALREIAHASCVESNPSMSPPVEIV
                     INPHAGQDIETPTRIRPITRSSKLRPRRSHSSSSLVTTSPRRGGDAVGQPRKPRQLVE
                     STTETEQEELRSSQSRLPPSSPPVVAEVPADQKENEFNPSTVSSLGSIRGTKRSAARP
                     SSGYEHPNSLPRVSLNVPPSNLTRANSNVSIGSEGSVDERAPKRRTGSSPEVEGSGAI
                     VSPVSEPMVTEQVETPVRLTVTKKLRLHIHSSPPTSPPASTPCVPRATPPSVNLAAST
                     EAPSTPTRVPTRAIHEDMSVTASVRRTMPAKKSFLPVRKSVESKSSPVRATTNPATAQ
                     SPSLSTRNSGRIANTLNKYEGIAVNSNGNAKNVRTATPASKKLGRGVMKKGVLTPPRI
                     TEMWGQLSRIGSSPPADKEKQ"
     gene            complement(1270242..1272201)
                     /locus_tag="CNA04780"
                     /db_xref="GeneID:3253215"
     mRNA            complement(join(1270242..1270710,1270788..1270931,
                     1271014..1271313,1271371..1271526,1271586..1271649,
                     1271703..1271828,1271879..1272201))
                     /locus_tag="CNA04780"
                     /product="carnitine/acyl carnitine carrier, putative"
                     /transcript_id="XM_566873.2"
                     /db_xref="GeneID:3253215"
     CDS             complement(join(1270654..1270710,1270788..1270931,
                     1271014..1271313,1271371..1271526,1271586..1271649,
                     1271703..1271828,1271879..1271979))
                     /locus_tag="CNA04780"
                     /codon_start=1
                     /product="carnitine/acyl carnitine carrier, putative"
                     /protein_id="XP_566873.1"
                     /db_xref="GeneID:3253215"
                     /translation="MSDDASEIEAVSRNAGKQTVDPVKSFLSGGFGGISCVLVGHPFD
                     LTKTRLQTAPPGVYTGAIDVVKKTVKADGFRGMYRGVTPPILGVTPIFAISFWGYDLG
                     KRLVYSFSPDRTEQALSISELAFAGAFSALPATLVAAPAERVKVLLQVQGQSGAQAYN
                     GVFDVVTKLYAEGGIRSLFRGTFATLARDGPGSAAYFATYESLKKILSAAPDTLPDGT
                     KAPAPPLSVPAIMTAGAGAGIAMWSLGIPPDTIKSRLQSAPQGTYTGFMDCARKLIAQ
                     DGVTALWKGFGPAMARAVPANAATFLGVELSLKMMDKLW"
     gene            complement(1272524..1273690)
                     /locus_tag="CNA04790"
                     /db_xref="GeneID:3253200"
     mRNA            complement(join(1272524..1272766,1272820..1273575,
                     1273629..1273690))
                     /locus_tag="CNA04790"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656282.1"
                     /db_xref="GeneID:3253200"
     CDS             complement(join(1272537..1272766,1272820..1272973))
                     /locus_tag="CNA04790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511941.1"
                     /db_xref="GeneID:3253200"
                     /translation="MPGANVVSESENKKWALLNWRPKKVEEEDGGMSGNEEMGMTVFL
                     LKFGEGMEEVPVSRLYISALTIGLSYFIGSVGGGGLIPLIPYMEINIKIIIRPAAGLT
                     AGKRTTTYVLAMLHSKRPYTTSPYA"
     gene            complement(1273867..1279984)
                     /locus_tag="CNA04810"
                     /db_xref="GeneID:3253220"
     mRNA            complement(join(1273867..1275522,1275598..1275723,
                     1275779..1275950,1276009..1277848,1277902..1279399,
                     1279463..1279532,1279610..1279694,1279759..1279984))
                     /locus_tag="CNA04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656283.1"
                     /db_xref="GeneID:3253220"
     gene            1273920..1275517
                     /locus_tag="CNA04800"
                     /db_xref="GeneID:3253280"
     mRNA            join(1273920..1274104,1274160..1274352,1274408..1274716,
                     1274766..1275517)
                     /locus_tag="CNA04800"
                     /product="hypothetical protein"
                     /transcript_id="XM_566921.2"
                     /db_xref="GeneID:3253280"
     CDS             join(1273959..1274104,1274160..1274352,1274408..1274716,
                     1274766..1275431)
                     /locus_tag="CNA04800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566921.1"
                     /db_xref="GeneID:3253280"
                     /translation="MPPSGDKSLYSKDKWPNYDPEEAPNGYVEDPESRKIVWRPNWEN
                     LRNAFFGNLVDAAVKACEGDRKSLKLECPSTEETRDRVVAYLENIAKHKCGKQSKKEA
                     DEKRILGRTRTFRQWIKKNWESLPLSKCREASYLRNALFAGDGILRAVHFIDRSEEQN
                     FLRYTENVAADGDGIDDLEDDDLEYDEFLLLCDLYNGTKVDNPGWMVYEPWWWSEEVR
                     LAVWTAYECWQSSLRKTSHTTTHIFHLPFNFHRINSSGFRLADRYIDTDDSTDLFQPK
                     LQCTKSMVNWDVIAKVHSPSVPDYTDVPFDPFSSTSRLPPLLDLLQTQHPGLLERVKK
                     HLALPPCLSEDKLKTLWKSRRGYDCSPYHYRLNRAISLNRFRSMXEYIDDAMASERDG
                     GPHPQLTMDGDGEMDSFGGYSMXFGERGVDTDSADLEAHDSYLDF"
     CDS             complement(join(1275715..1275723,1275779..1275950,
                     1276009..1277848,1277902..1279399,1279463..1279532,
                     1279610..1279641))
                     /locus_tag="CNA04810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511955.1"
                     /db_xref="GeneID:3253220"
                     /translation="MAPSGFLSSFRRPYKPYSRDGPIEAQSISEGMNIPFKALVRCRC
                     PLCPIAGKVMQYRTWLDHRDLLPLQGPLDHLLPQSHQSPRPFTTTPLATNEPFGSHRL
                     PAPTISSTHASPSIDNQLLTSTEGHLQQGSFENTQQENGDGAEGCSSPQDGANGWFDI
                     GWDLPPIVVDDVDSDHDNRLMGLLSRWPTKIPECLIPSYSGRHESPYRLDFELFSDSP
                     LATMPLLYNVLAAFIVMLTAFAGIAQRFGDMTRAIVEVIIKLAITEDRKAMRASVLEA
                     ADLPEPQRRKVLELLDRPIETSASELQKNVKSVYKHLDINPTLIVNPKCPTKDCQATL
                     FQITNSEGLVDLPDKCHECNTPLKEAGKVMAQFFPRQSLQSALEHLFSINGVERLVEQ
                     QQILREQQDERDRQLGCPGYMRXARPGKIYRHQLDGECYRQDGLQRERGCLVLTINIS
                     LDYADPSRSRNRSPRSMGPILCQLADLPNQYRSRLSFMMIMGITPAPNEPPGCLLHRL
                     LLALGVDLLSGECDGLWIRTPGHPTGRKVYVRIGAICCDRPAAVAITGVSHFSKEDTP
                     CLKCTVPRNRMHLPGQFPLRSGLEHSHAMLNQQREFLAKFDEAPQTSYQTHVARRAGR
                     ITKASQAHVERLENAVFQVPGHLSIFDLFPNLDKLTHSVVDPMHAILEGVLPYYIRRV
                     LILGRFCGMPPSNWRQEEDDDVVSVHYSDGEGEGGNLDELRDMHERIMERNASSENPR
                     QVATYERVARAVLGREEADGKPVIPKKLLPRIEWMMEQVVLPPYIDSIGKGFFTKQKK
                     PTAAQWRTFGEILGPLVMPWLWAEEAVKGSPLPAEELTAILKLFAIVRYTFQSAISEA
                     QITRLREHIDNFSRLVAKLHPYLPARVTNFHIIRHIPDDIVNHGPIYGWWLMALERLN
                     GRIKRISLSGRNMFQEQVIALRALLRGRSAFLHLNKVFLSEAAVNNEAYLEEVLDGFK
                     QGGIDLRVDBELETLRLFDNSGLDQQFSIDLLSRGRRTQATEDKDVFRHFLTFIRYPF
                     SESIINRYEFHHELAVRGYSFRPIDPEFKWSWAIDAAAELPGLLCKKNARSFLECRPA
                     IRRFAEVHEQTMTGILWCVFSHTRRTRDGAILSEKLYGVFRWLKWRPLGQNXGYEYIQ
                     EKTLDIQTFAEDILSPPFFFEINAVSIGRLHPVALVKVPVVPNLPSGRGFIVTIPIAR
                     HT"
     gene            1280166..1282382
                     /locus_tag="CNA04830"
                     /db_xref="GeneID:3253202"
     mRNA            join(1280166..1280376,1280431..1280458,1280536..1280692,
                     1280750..1280934,1280982..1281608,1281661..1281770,
                     1281822..1281946,1282009..1282382)
                     /locus_tag="CNA04830"
                     /product="NADH kinase, putative"
                     /transcript_id="XM_566923.2"
                     /db_xref="GeneID:3253202"
     CDS             join(1280295..1280376,1280431..1280458,1280536..1280692,
                     1280750..1280934,1280982..1281608,1281661..1281770,
                     1281822..1281946,1282009..1282158)
                     /locus_tag="CNA04830"
                     /codon_start=1
                     /product="Ptc1p, putative"
                     /protein_id="XP_566923.1"
                     /db_xref="GeneID:3253202"
                     /translation="MNQPSTLAQAHPDHPTLAELVADRPDPATATPLGHDIASPQHTT
                     TPTSMSDADSSPASPEAPRRPGGLSEGPNARSKSVTVASGEDTFGALNCHPGPGSAAI
                     SNSNLPADSFRVGVSEDRNRRCRRTMEDAHSFVYDFAGVKGQGYFAVFDGHAGKHAAE
                     WCGQNFHEYLLDGLLIEPDTPVPDLMNKTFHLVDKRLSHLAHAAGTSSGCTAVTAFLR
                     VEEMDDNDSFRKGFTNPGLQPRGLWEGKGEDELESQTSLQPSSRRSSMGGGTGGQMGG
                     ASAPGVNGRTGSLARRLSSKKIRDFVKGLTGGMEKNFDEAITEDEGVISAADGTRVEA
                     IEPKSEKGVRRVLYTANVGDARAVLCRGGKAVRLTYDHKGSDAQEAKRITDAGGFVMN
                     NRVNGVLAVTRSLGDASMKEFVVGAPYTTETTLDEQDEFLIVACDGLWDVCSDQEAVE
                     IVHLVTDPQEASKRLLDHAMSNFSTDNLSVMVVRFNH"
     gene            complement(1282411..1284543)
                     /locus_tag="CNA04840"
                     /db_xref="GeneID:3253258"
     mRNA            complement(join(1282411..1283744,1283837..1284368,
                     1284440..1284543))
                     /locus_tag="CNA04840"
                     /product="expressed protein"
                     /transcript_id="XM_024656284.1"
                     /db_xref="GeneID:3253258"
     CDS             complement(join(1282493..1283744,1283837..1283868))
                     /locus_tag="CNA04840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511956.1"
                     /db_xref="GeneID:3253258"
                     /translation="MPSSPHRIPDLDDNSRLDPMTPPPSLVTTYSRSTLLSLATPDLP
                     PPNPLRLQSFSSILRSSISDDEWGVSEDVATLLDGKPVSEVMPVRRDDKGKPKVGKLP
                     SAAGRPVSTRQNSGSSTSSSTSQVLFHFTSATATPSRINNPPQVLMEFSNPFSSPNSL
                     GLGVPIKLGPRKSSASSIFQDFPASVNSSSSSLHIAPNGRGLNVIGGARDSLTLGKEL
                     GRMRLGRRDSLDSVGSSVSAQSSVSFPGGGLNPFAPPFPHLSANDDDLKPGVKPFRNA
                     YSSSHIPQVAQAPQVPQHVHASLPLPRPSSLPQRPGPLPPVFIKRESAALPQPMALPD
                     VAPLGREWEGENALSGNEKRRMSAVGSIGSIGSLSGLGALGNTSGVGTRSRSGSDASS
                     DAGWNTGPVGKRPERLARLGERLRESMSQGRAAKA"
     gene            1284704..1285589
                     /locus_tag="CNA04850"
                     /db_xref="GeneID:3253257"
     mRNA            join(1284704..1284981,1285049..1285147,1285233..1285589)
                     /locus_tag="CNA04850"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656285.1"
                     /db_xref="GeneID:3253257"
     CDS             join(1284793..1284981,1285049..1285147,1285233..1285268)
                     /locus_tag="CNA04850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511957.1"
                     /db_xref="GeneID:3253257"
                     /translation="MSFFRSFLRPSSSILPNSQPLLNLSLRQPQINAFSTTSSTLVKQ
                     KLKSHSASKKRFFPNASGMFKRAQAGKSHLNTPFSPSKVNRLAKGVYVTNTQAKKLKK
                     LLPFA"
     gene            complement(1286087..1287522)
                     /locus_tag="CNA04860"
                     /db_xref="GeneID:3253273"
     mRNA            complement(join(1286087..1286626,1286689..1287346,
                     1287402..1287522))
                     /locus_tag="CNA04860"
                     /product="expressed protein"
                     /transcript_id="XM_566926.2"
                     /db_xref="GeneID:3253273"
     CDS             complement(join(1286227..1286626,1286689..1287346,
                     1287402..1287435))
                     /locus_tag="CNA04860"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566926.1"
                     /db_xref="GeneID:3253273"
                     /translation="MKISVALVAALAASANASPLRFIVATEPDTESLDIDIINHGTEF
                     PRLSAEKLPLDQLHSGVVAEKKPCHGALSNFLGYMGWNSASQSSAPFPPAPRTHRDKG
                     KGRLAKDESRLKFKHKHHAKLINEQQRYGLFDTLRSYFPGYTPYLLGGAAASSSTPSE
                     NFVPHMISEELNTVYRIDLTPEIKWWRPAKNGHRKWEVKEGMGEWRAAKKGEKPPRSG
                     KHKGRKSKHFFQKLRRSLDSLTFLESIAIALVIGFGMGSIAYMIMTLFVLCCRRLGLS
                     NISDPRSGFASKFGGRKMSKTEREEEKNEMDKQMVDEKEGQAEGQSEIKLFEGDEFIP
                     KGTRFEDEDLPEYEEGEDAPFIKEKDLGV"
     gene            1287682..1289488
                     /locus_tag="CNA04870"
                     /db_xref="GeneID:3253235"
     mRNA            join(1287682..1287829,1287882..1288654,1288715..1289433,
                     1289481..1289488)
                     /locus_tag="CNA04870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656286.1"
                     /db_xref="GeneID:3253235"
     CDS             join(1287697..1287829,1287882..1288654,1288715..1289323)
                     /locus_tag="CNA04870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511958.1"
                     /db_xref="GeneID:3253235"
                     /translation="MSVMLETSLGDLIIDLEVDKCPRTCENFIKLCKLKYYALNAFFN
                     VSKNFIAQSGDPTATGTGGESLASYVYSQSPSGPRPPRYFTPEILNSLKHTHKGTLSM
                     AVAPINPPGCGSQFFITLADNIDYLDGKHAVFGHVIEGLDTLDKINDAFTDKEGRPLQ
                     NIRIRHVEILEDPFPDPDNFMPIPQSPIRPPDDLSKVRIADTEDPNAVIPEEEAEELR
                     RRTEAASSALTLEMIGDLPFAAVRPPENILFVCKLNPVTQDEDLELIFSRFGKILSCE
                     VVRDKKSGDSLQYAFIEFDEREAAEQAYFKMQNVLVDDRRIWVDFSQSVAKMNRSMLS
                     SSNPTGRGGRGGRGGRGGNYSGRRDGDRDRDRDSGWSSRRDAPDSRRPPPPPVPMSSS
                     RDVGGTEGYGLVFDDRSAPSSRGSKRDRERSPKRERDRERERDRSPRRDRDRERDRSP
                     RRDRDRERDDHDRRDRDRNGRDRERNGDRERYRERSRERENERYRERDDRDRRR"
     gene            1289490..1292316
                     /locus_tag="CNA04880"
                     /db_xref="GeneID:3253229"
     mRNA            join(1289490..1289537,1289587..1289883,1289967..1290045,
                     1290104..1290811,1290869..1290891,1290929..1290955,
                     1291000..1291107,1291178..1291421,1291482..1291745,
                     1291809..1292316)
                     /locus_tag="CNA04880"
                     /product="expressed protein"
                     /transcript_id="XM_024656287.1"
                     /db_xref="GeneID:3253229"
     CDS             join(1289760..1289883,1289967..1290045,1290104..1290811,
                     1290869..1290891,1290929..1290955,1291000..1291107,
                     1291178..1291421,1291482..1291745,1291809..1292178)
                     /locus_tag="CNA04880"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511959.1"
                     /db_xref="GeneID:3253229"
                     /translation="MPDSPESSQQSETGPTGRRNRNSERITRACGFCKARKIRCTGEL
                     PKCQNCQRLGKACVYRTEMDKRATDRTAQLKIDELQSRVQELESILAAQRNDIHTSSL
                     ASSRNHLSPNYLPSRGPLEGIDGMDPFETGRLVLSSTGNLHLHPSATFYCPAHVIPEW
                     RQALDTLSNTRSVALPAYLAPYLPLHTTQAHHRKLIDLAFDCMLCFGPNPLKDKFIDS
                     MDFDPDRRGLYFSPILHLTILGIGWRYCTDPEMLAMYYAKSPIENRGSEYVDKARDMV
                     MQEADTGQLSNMLALMVMALFYVGQSKDTMAGSCFMMCQYQCLNFRVHKRCDAQLYEL
                     GLAPGSELDTARRDVWNFCLNISAWWATFYAEPVLPMAQNADQRPTDLRNSDNADLRL
                     LSLMALHHSRLSHYGLESLITNHLRRMPIEVRVKHVRELGDLLFQWRDDLPSEITWPP
                     PSDSPIMHPSNLITHGMYATYLIILYRPYIIEIGGGPSLISEALRKCLQYTKDIIDMA
                     RYLVKHHGVMRAPLSWQHILYVGGTMLILQIAGLPNVTVEERTWALESLSFIQDALQE
                     FSYIWPAARLTAQSLKTLQEECSPTADNTLNVIGGEQLQYAAAGIDLGSEEQVQQIPP
                     VAQFSQSDSTGGEMIDLMAGLDYP"
     gene            complement(1292099..1294466)
                     /locus_tag="CNA04890"
                     /db_xref="GeneID:3253275"
     mRNA            complement(join(1292099..1292374,1292426..1294466))
                     /locus_tag="CNA04890"
                     /product="hypothetical protein"
                     /transcript_id="XM_566929.2"
                     /db_xref="GeneID:3253275"
     CDS             complement(1292428..1294404)
                     /locus_tag="CNA04890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566929.1"
                     /db_xref="GeneID:3253275"
                     /translation="MPQLTEIDVLTYYSSVVCGLLQPGSSSLTSVPKVASRQDVGDDV
                     NMKSPQNVIDNNVRKKEKKPKGKRGNQNMTQAVEPGVKPVEEAVIAVVEPKDKERQSK
                     RGKKRSLNASISITEDLEQNLPAPDDKKKQKQSKSLPKNATSGQIEAVQTPAHQAQPQ
                     PRSTDAMFSAIASKGDKKSARRKKQDQAAAVLEVLHKGTSKGADKEGTKEQTPAKAKP
                     RKSKGKEKDVAAIAKETEPAEEVTENDKEPAKAKTRKSKGKDNPVTPRIPVAITDPGT
                     SNAFASSSTPSKTVITASVPGSHASPKSTTPPPSFSRAPSTPVSEEDVLRHLYTRLSN
                     GSGPFAASLSAPSASEIRKRRRESMVETPLRHKVLLRPSESLGKKRRMSVANENVDLH
                     EEGEDTMEEIDMLASPAFPTAPAAGKKDKKDKKGKVPAPPHKAPSDLALTPVPDDPTE
                     LPIFSELRRKDKKKTKEKKEEKQKKDRKEKEKQEREKSETREKNEAKEKGKEKEHGKG
                     RKRKGEALQAETSGPAVAPATIPASAPAPAPAPIPVSPAASISTPAPNQKTPTSSTSK
                     KKRRLTEIPIPRLSPSIKSPAGTTSAASPASSKKTKLSQGLIPLGSSLDTAKMHMYAS
                     MGIVTPSPSSKGSSKKEKKIGKRGPKWITETPRM"
     gene            complement(1294535..1297044)
                     /locus_tag="CNA04900"
                     /db_xref="GeneID:36392690"
     mRNA            complement(1294535..1297044)
                     /locus_tag="CNA04900"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656288.1"
                     /db_xref="GeneID:36392690"
     CDS             complement(1295348..1295986)
                     /locus_tag="CNA04900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511960.1"
                     /db_xref="GeneID:36392690"
                     /translation="MVRSLSRLPRLSSPSSIVLLQPVGPSLSSTHCSLNVPLEWILDN
                     GAFESMTGDRSWLQDLHRMANGGSLTANEAGTAVFLNHRGAQIQLSHVLLAPGLRFNL
                     LSTTGIMTAGVRVSMADGHSDFLYHGESVLRARLGNNSWVLGVCRPPCPPSSQLISLP
                     AVIDPTSPPAFVRVSVVSAPLDIWHRRLSHLSVELVFIQHLRTNNLREQCTI"
     gene            complement(1299222..1302224)
                     /locus_tag="CNA04910"
                     /db_xref="GeneID:3253277"
     mRNA            complement(join(1299222..1300657,1300718..1300936,
                     1300996..1301325,1301381..1301544,1301605..1301707,
                     1301772..1302224))
                     /locus_tag="CNA04910"
                     /product="retrograde transport, endosome to Golgi-related
                     protein, putative"
                     /transcript_id="XM_566931.2"
                     /db_xref="GeneID:3253277"
     CDS             complement(join(1299437..1300657,1300718..1300936,
                     1300996..1301325,1301381..1301544,1301605..1301707,
                     1301772..1302188))
                     /locus_tag="CNA04910"
                     /codon_start=1
                     /product="retrograde transport, endosome to Golgi-related
                     protein, putative"
                     /protein_id="XP_566931.1"
                     /db_xref="GeneID:3253277"
                     /translation="MDPLARTDDINAGWSSPTSNLRFNAQSAAEDTVPTSATSNPYSD
                     RSVSANENANGYRTHTSPGLGSGVVGAGYREPVVFGAPGMGLVSPPPESAFQQSQQET
                     PAGEVQQERKAPRVYLRVRIGALERNKKDLLIRFDASTNLSTYKNGMYRNMQRSYVEF
                     QKFAEQLSLVCPQTIIPALPLPSTSASTDEEDDRLVRIALQRWFSRVCEDPVLIRQDE
                     VRSFIESNFGYSPIPPPTAKRSQANVLSALTKVVRRGPLDEDDELSSAKIALDKLEER
                     YGHAATCVSHVGKARRQLANSNAELGAKMVGLSTVESEPSLAGAERKIGRAWEQVSGM
                     INAQASNENVILSDTLGYQALNARAAKDTLVQRTAVLEDSQSASKAAITKRRNLERLK
                     ASSNINPAKVDDAISEMQEADSLEQSLSHRVTAISQNLHLSLRAHSRHAHEDIAISLM
                     EAARMSAMYHKQTLRELESLRADIGKVAPGAAPLDGLAVSGKSPAASRVQPTQASLMS
                     RAPPSQPQFASPYAAQPPLTAQVGRQPPMARAPQSQVQTQPQAQPQIQPPIQPQAQTT
                     FHPQPQAYPRNPYATQPPPSQSAAPPFPTQPLSSSYPIQPPGSSSQSPYGPAPNSGGP
                     STTSQFPPRIPTSPPTTGFPVADGTQSMFLPSGGNGGMQRPHSAAPDAPGSAGTSRVV
                     DPLAGFPRGPAAPGMQGTQGMAQSMFVPSQPQSQASSRIHPGYSSQSQPLTPNAGPGP
                     LSQAYQSQFQPPQPSYQPGQFTQGYPVQNVPDYPGQQQPQQVSPFPGPAGVQRAATIA
                     TGRRKLDERKAAKMLAGGF"
     gene            complement(1302331..1304052)
                     /locus_tag="CNA04920"
                     /db_xref="GeneID:3253281"
     mRNA            complement(join(1302331..1302670,1302724..1302882,
                     1302939..1303411,1303458..1303617,1303678..1303888,
                     1303958..1304052))
                     /locus_tag="CNA04920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566932.2"
                     /db_xref="GeneID:3253281"
     CDS             complement(join(1302390..1302670,1302724..1302882,
                     1302939..1303411,1303458..1303617,1303678..1303888,
                     1303958..1304005))
                     /locus_tag="CNA04920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566932.1"
                     /db_xref="GeneID:3253281"
                     /translation="MADCITIAPELSFKDQITELAAHLSRSLPNADNQVAVKEFVQGY
                     EAQVDTEEGRGDVEDAKKKQVVKSIVDKFVELKGGLEAAKESEVESSHFLLQHVLSTT
                     FDQASEEYAQAVKDVNEAVKKGAQETTKITRAEAASRVLKNTYNFLPSNSPIRPSTLL
                     SLMSLLASTLDLSALPLPTSTLLPALSSWSIPSSEKVSFLTTASGLYQSTGNLAKALE
                     LLTLALKESVEPTVVERAVLLALAVPNKFELDDVLAVQGVKEQLGKVQGVVELFEGDE
                     VEAIEKGKKWTAENVSLIEGAGIPGFTSETVLRKLRLIALVALCTKSETRQLEYAPIA
                     KALAIEESEVETWVIDAVRSKLIVARISQPQSLIRIHSISSITASSRRFGPSEWQLLE
                     KRLEQWKKSVNEARQVVEEAETVAQQGLGQQRRGGKRREEKKEKEDKEEQE"
     gene            1304233..1304830
                     /locus_tag="CNA04930"
                     /db_xref="GeneID:3253251"
     mRNA            join(1304233..1304376,1304436..1304655,1304734..1304830)
                     /locus_tag="CNA04930"
                     /product="prefoldin subunit 2, putative"
                     /transcript_id="XM_566933.2"
                     /db_xref="GeneID:3253251"
     CDS             join(1304255..1304376,1304436..1304655,1304734..1304745)
                     /locus_tag="CNA04930"
                     /codon_start=1
                     /product="prefoldin subunit 2, putative"
                     /protein_id="XP_566933.1"
                     /db_xref="GeneID:3253251"
                     /translation="MPPKAPTDAQEASVIFQRYRTELQNLAQKIGELESEMDEYSLVL
                     STLHPLKSSEPSRTCYRLIGGTLVKRSVQDVVPTLETTHSGIKEVLDSLVKSYQEKEK
                     EFDAWRKEAGVQMPR"
     gene            1305283..1307302
                     /locus_tag="CNA04935"
                     /db_xref="GeneID:36392691"
     mRNA            join(1305283..1306553,1306622..1306739,1306805..1307302)
                     /locus_tag="CNA04935"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656091.1"
                     /db_xref="GeneID:36392691"
     CDS             join(1306175..1306553,1306622..1306739,1306805..1306937)
                     /locus_tag="CNA04935"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514163.1"
                     /db_xref="GeneID:36392691"
                     /translation="MWPLSLVSDMQGDLYDTTGATFTVWSAPLQPNASVITFDQANTA
                     LADNSAEGGWLGGAIDVAIEKMGGDGVYYTTDGEGGYEGKILMPSKTETNRTRVEEAG
                     MWALVYLTGQYAVRESIPDDDATWLNFMQKVDGSPVLIYTTDTPDSSLTKDQYYTVNT
                     ITNKSNVTLWDPYGEGMNAYKYIDITALKTSSKWIYHLDWPHFLRQNDD"
     gene            complement(1307628..1309366)
                     /locus_tag="CNA04940"
                     /db_xref="GeneID:3253250"
     mRNA            complement(join(1307628..1308000,1308052..1308196,
                     1308244..1308523,1308576..1308668,1308719..1308932,
                     1308980..1309051,1309104..1309183,1309248..1309366))
                     /locus_tag="CNA04940"
                     /product="mitochondrial carrier protein, putative"
                     /transcript_id="XM_566934.2"
                     /db_xref="GeneID:3253250"
     CDS             complement(join(1307659..1308000,1308052..1308196,
                     1308244..1308523,1308576..1308668,1308719..1308932,
                     1308980..1309051,1309104..1309183,1309248..1309335))
                     /locus_tag="CNA04940"
                     /codon_start=1
                     /product="mitochondrial carrier protein, putative"
                     /protein_id="XP_566934.1"
                     /db_xref="GeneID:3253250"
                     /translation="MSSRPIIRFAQTPLSRGIATSVPAFAPKKAAATTAKAKQGFAQK
                     KKDTSSGSGGGNNNITLRYSMSANPPDLSDLPRLNPEKFRKDNVGKPTIFSQDVQDKL
                     KSFGLPSKIDKEFASAGGPASVVREATLDLVKRVEAAKTGSSKLARYILTGEQGSGKS
                     VLLVQSVAYAIESGWIVLYSPRASKWVNSTSQYIYDPETKTYAQWESAQNILSVLLET
                     NRDKLSAIELSEKVELTKGKSVEAGETVAALAQLGAKDDRSAVKALEAVVGALEKQTQ
                     FPVLWAIDEAQSLFNTSKYRAADYTPIEPYHLSTPRLALDFIAARRSFSRGAVVTSLS
                     LSDPSNLPSPAIRSALSISSSSPLTPYTAINPYHLAHAENLTPINVPYGMNSEEAAGL
                     FELFTKKGWAPNGSDELFMESFIASQGNPREMGKGLRKTFMPLTA"
     gene            1309504..1311129
                     /locus_tag="CNA04950"
                     /db_xref="GeneID:3253231"
     mRNA            join(1309504..1309767,1309822..1310907,1310960..1311129)
                     /locus_tag="CNA04950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566935.2"
                     /db_xref="GeneID:3253231"
     CDS             join(1309544..1309767,1309822..1310907,1310960..1311023)
                     /locus_tag="CNA04950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566935.1"
                     /db_xref="GeneID:3253231"
                     /translation="MVPRASTRAQGKPYDRPAASTKSKGKGKAPVHDLGAPSTHSQPS
                     RKGKKAWRKNIDITHEEEALEKAREDERVTGGPMATKSNNELFTVDVVGDAQVGAKAK
                     RQHKPLRSLAILSERSAVPSLTSRVSKAAPQKKKPLLSSAEKERLKRIARKTQAFSDG
                     TGLASADIQARGPVEKDVWEEEQEFEVEGGFGEETIVKKKVKVPVTIARQRAAYLGSV
                     DKAVETPEGGVSYNPSAESHAKLIDEAYKEELAAVEREKEEAALIEKFGSVVEARRHI
                     KRSEFAEDMLVGDGESDDEESSGDQDLPEKKASKRKTTAQRNRQARQRAIEEAARQEK
                     EKRKLANSVSSLAAFKKEVERKQKEQAEKERIAKLAKKEKERRGKQEGEKVGKYRVQK
                     KRVEVQLGEDLAESLRQVKPEGNLFKDRFLALQKRALVEPRVPQLPKKKALKIKEFEK
                     HAWKRFL"
     gene            complement(1311068..1314073)
                     /locus_tag="CNA04960"
                     /db_xref="GeneID:3253219"
     mRNA            complement(join(1311068..1312257,1312338..1313689,
                     1313745..1313919,1313965..1314073))
                     /locus_tag="CNA04960"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656289.1"
                     /db_xref="GeneID:3253219"
     CDS             complement(join(1311218..1312257,1312338..1313689,
                     1313745..1313919,1313965..1314001))
                     /locus_tag="CNA04960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511961.1"
                     /db_xref="GeneID:3253219"
                     /translation="MAPSPGKIHQLPVKVLYSLDTSPHSYVTVLNNLQEVYVHYDVGA
                     GSDPNRREELMGSCFLKGVARAICFASPECIPNQASLDFSVYNLDPSRRSPAPRAFAP
                     SEESTSWTGRGFLSWALSETSPGSTIVKGRLTQDYEFSCSQFTPEGGLEGLVAAANAG
                     PQSREDDGRGWGLEVSISLRQVNPEGKAEFKGRKEFEESLAKGTGTAGSPASTPGILS
                     SPAVRKFASQQNVGRQVPVGQSKEKVHSQAQSQAQPQNSGPSQGQNQSQRQSQTIERL
                     QSQTGSSSRPTSSMGNRTSSSGIPPSSFPGDPTSSNSNQLSSRASSTIPPPPPPPQRQ
                     STTNPQNAPTFAESSATAAARSRQVTPPPSLRSKSPPPSTPSRKHLHALLRADGMMSP
                     ELARHLASNPTLRNLLKAVPNNSNMFTQLRSFSGLMGDKGKKDEIGQGAGSGAAGTRN
                     REAEVEREDSPTEPTTPTPSLPQPNTPLTVTQNRSAAAGAQGGGCCNCGTMQSDCWRI
                     RKMKDGPPRKVCDDCGVYFNEHKKMRPPELWNPKLAAINGLGRSQTAGPSSTAGKSTN
                     APDHKRRGHSHDLFSDGPASGLRSSPRLKRRSSSDHPPSSSHSHYNTRSHPPQPPPHT
                     LPSQAHSAHGRGAGGSDAGGHTPSSSSMTGHPMESPRKRYKPKTGVVPSPRMATRAST
                     RASVGTPSDFSSEVFGFSPRTIMGENNVHGHGHSHGSGYGSTSSTPHPAPTPSSQANP
                     TPNPSHPTPNPAHPVSNGSHPTPNPSHVTPDPNPTQPPAHSQPQTHRPQSQGPSDLDP
                     EFDINAFLSSMDTSTIGVDNFDLNSLFTGNDGQELNGELNQEIMDLLAGWEENADGQG
                     QEQGQSEARAT"
     gene            1314727..1316348
                     /locus_tag="CNA04970"
                     /db_xref="GeneID:3253264"
     mRNA            join(1314727..1315047,1315105..1315286,1315344..1315426,
                     1315483..1315655,1315708..1315933,1315987..1316348)
                     /locus_tag="CNA04970"
                     /product="mannitol dehydrogenase, putative"
                     /transcript_id="XM_024656290.1"
                     /db_xref="GeneID:3253264"
     CDS             join(1315117..1315286,1315344..1315426,1315483..1315655,
                     1315708..1315758)
                     /locus_tag="CNA04970"
                     /codon_start=1
                     /product="mannitol dehydrogenase, putative"
                     /protein_id="XP_024511962.1"
                     /db_xref="GeneID:3253264"
                     /translation="MVRMKTPGPTITGHEIVGTVVKAGPKSEHKVGERVGFGGQAGSC
                     RSCARCKDEFENYCPKSQNAFLSPLESESQPYTQGGFSDYYQAKGHFAIKIPEEVSSV
                     DAAPLLCAGVTVFTHLKHYKAGPGVKVGVVGTGGLGHVGLAIRQGHRCPCYCHLFQ"
     gene            1316599..1318095
                     /locus_tag="CNA04980"
                     /db_xref="GeneID:3253268"
     mRNA            join(1316599..1316858,1317007..1317067,1317133..1317246,
                     1317318..1317757,1317818..1318095)
                     /locus_tag="CNA04980"
                     /product="peroxisome targeting signal receptor, putative"
                     /transcript_id="XM_566938.2"
                     /db_xref="GeneID:3253268"
     CDS             join(1316629..1316858,1317007..1317067,1317133..1317246,
                     1317318..1317757,1317818..1317974)
                     /locus_tag="CNA04980"
                     /codon_start=1
                     /product="peroxisome targeting signal receptor, putative"
                     /protein_id="XP_566938.1"
                     /db_xref="GeneID:3253268"
                     /translation="MQYLRLSLPPFAHNNLAFSPFYDHHLALASGSNFGLVGNGRVHV
                     VKMDQQVAGGLGLVRSWDTADCVYDVAWSEIHENQIAAACGNGAIKLFDLALEGLPIQ
                     AWQEHTAEVTSIEWNNIEKELFVTGSWDQSVKIWNPNRQSSILTIPAHAGQIYSSTWS
                     PHSPTIIATCASDGFIRIWDTRILPSPIQEIFPPSAAPNPMSSRSAGEILSCDWNKYT
                     PQLLAFSSQDGGVSTVDLRHVPRNAEKMAVRLVGKHGLPARKVKWDPHNGTRLLSAGY
                     DMTCRVWQTDLPPAAPLRELFSHQNHTEFVMAADWALFDPGLIASAGWDGDLHMYRI"
     gene            complement(1318388..1320279)
                     /locus_tag="CNA04990"
                     /db_xref="GeneID:3253674"
     mRNA            complement(join(1318388..1318817,1318869..1318931,
                     1319015..1319213,1319368..1319643,1319697..1319730,
                     1319808..1319925,1320016..1320019,1320081..1320183,
                     1320233..1320279))
                     /locus_tag="CNA04990"
                     /product="expressed protein"
                     /transcript_id="XM_024656291.1"
                     /db_xref="GeneID:3253674"
     CDS             complement(join(1318582..1318817,1318869..1318931,
                     1319015..1319213,1319368..1319541))
                     /locus_tag="CNA04990"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512062.1"
                     /db_xref="GeneID:3253674"
                     /translation="MPVNHRRSSPACSHIFSFTSQLSTHLTYTLITFKMGFQQSVVLG
                     SCAFLLGMVFVSQVVDIPLLYQPVTPEAIDNAYKFYEMWWEAPGAVKALFHVALGLPL
                     VVLLVKLHKWSESAVFFDGSCIVMHLATIVLYLTVHINSFRTFLYESTVTSSYTILPP
                     QAPRDTPPTADERIEAVRVLAAGNALVGLLTLGVMGMQIGQEYARRVEEREEREVETK
                     VKKDI"
     gene            1320457..1322746
                     /locus_tag="CNA05000"
                     /db_xref="GeneID:3253359"
     mRNA            join(1320457..1320659,1320729..1320932,1321022..1321708,
                     1321766..1321908,1321979..1322428,1322496..1322575,
                     1322636..1322746)
                     /locus_tag="CNA05000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566785.1"
                     /db_xref="GeneID:3253359"
     CDS             join(1320797..1320932,1321022..1321708,1321766..1321908,
                     1321979..1322428,1322496..1322575,1322636..1322675)
                     /locus_tag="CNA05000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566785.1"
                     /db_xref="GeneID:3253359"
                     /translation="MAKSAMCTVVVLGASYGGCPAVKILAEKLPRNCKLIAIDRNTHM
                     NHVYTFSRFTVKTKHAPKSFIPYKHLLDPQPKLAPEIDLSTPPETPPIHPSVLDQEDD
                     VLAGRARHQFIQGVVTKLSSKEVTFVRPSEEDRPAFKDVAFKSVPAANVDSKEVNMTY
                     GEFDGPEEKIEYNYLLYALGSTLPDPVNVWQPLSGQPRVTGDERKLGNKKRGLKFMAI
                     QSEKFKAAGRILIIGGGALGIQYATDLKDVYPEKKITLLHSRTRLLPIYPIKLHVTVM
                     EALTKMGVDVVLGERVMTWPDEPEVLDGKTKYVTTDKGRTFEADIVLPCTGQRPHVSL
                     MAELDPALISPMTGRIRVLPTQQVCPSRLASVENTEKQFSKSFMPTVTPPLTSSSATS
                     IGSDEDQLQTQKDYNHIFAIGDCAQTKAIQAGHTAFGQGEVAARNILRLIEKEGEAGK
                     INDEELEEYEAPKPAIKLTLGIKNGVLVDGESVTPNNTGEEDLHALLMWGLPNAVGMD
                     INE"
     gene            1323383..1325472
                     /locus_tag="CNA05010"
                     /db_xref="GeneID:3253358"
     mRNA            join(1323383..1324524,1324586..1324652,1324706..1324889,
                     1324961..1325472)
                     /locus_tag="CNA05010"
                     /product="C-5 sterol desaturase, putative"
                     /transcript_id="XM_566786.2"
                     /db_xref="GeneID:3253358"
     mRNA            join(1323383..1323774,1323848..1324524,1324586..1324652,
                     1324706..1324889,1324961..1325472)
                     /locus_tag="CNA05010"
                     /product="C-5 sterol desaturase, putative"
                     /transcript_id="XM_024656092.1"
                     /db_xref="GeneID:3253358"
     CDS             join(1323948..1324524,1324586..1324652,1324706..1324889,
                     1324961..1325119)
                     /locus_tag="CNA05010"
                     /codon_start=1
                     /product="C-5 sterol desaturase, putative"
                     /protein_id="XP_024514164.1"
                     /db_xref="GeneID:3253358"
                     /translation="MDIILEYSDEYVLDKVYNFLLPHPPVPSSLTSINATALSESYSG
                     STTYHPSIEPASLLPRDSIIRQSISLFTVALLGAYALYFIFCSLSYYYVYDRRLEHHP
                     KFLKDQKRKEIISSVVSAPWIALMTVPWFVAEVRGHSMLYESVADYGWGYTALSVFMF
                     LLFTDFGIYWVHRIEHHPAIYKHIHKPHHKWIVPTPYAALAFHPLDGYAQSLPYHIFP
                     FCFPLHKYVYLGLFVFVQFWTILIHDGDMITGHILERYINGPAHHTLHHLYFTCNYGQ
                     YFTWADQYFDSYRDPAPHLDPIHDSLKMMRKKGLIDEAGNAIPQAREGKKEQ"
     CDS             join(1323948..1324524,1324586..1324652,1324706..1324889,
                     1324961..1325119)
                     /locus_tag="CNA05010"
                     /codon_start=1
                     /product="C-5 sterol desaturase, putative"
                     /protein_id="XP_566786.1"
                     /db_xref="GeneID:3253358"
                     /translation="MDIILEYSDEYVLDKVYNFLLPHPPVPSSLTSINATALSESYSG
                     STTYHPSIEPASLLPRDSIIRQSISLFTVALLGAYALYFIFCSLSYYYVYDRRLEHHP
                     KFLKDQKRKEIISSVVSAPWIALMTVPWFVAEVRGHSMLYESVADYGWGYTALSVFMF
                     LLFTDFGIYWVHRIEHHPAIYKHIHKPHHKWIVPTPYAALAFHPLDGYAQSLPYHIFP
                     FCFPLHKYVYLGLFVFVQFWTILIHDGDMITGHILERYINGPAHHTLHHLYFTCNYGQ
                     YFTWADQYFDSYRDPAPHLDPIHDSLKMMRKKGLIDEAGNAIPQAREGKKEQ"
     gene            1325639..1326547
                     /locus_tag="CNA05015"
                     /db_xref="GeneID:36392692"
     mRNA            join(1325639..1325777,1325852..1326547)
                     /locus_tag="CNA05015"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656093.1"
                     /db_xref="GeneID:36392692"
     CDS             1325957..1326388
                     /locus_tag="CNA05015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514165.1"
                     /db_xref="GeneID:36392692"
                     /translation="MLNEKIHLINQARLVLTSPQLKDEWLASFSAWARSSQGIQGLHE
                     TGGSLKAGGGGRGPHVFRHISLDEFTPHYVDGTAENEHEENADEKEEEEEEEPQYFTY
                     PCRCSGQFMISLEQLEEGVEVVGCEGCGEWVRVGYEVVEDV"
     gene            1326829..1332780
                     /locus_tag="CNA05020"
                     /db_xref="GeneID:3253357"
     mRNA            join(1326829..1326919,1327026..1327117,1327176..1327242,
                     1327293..1329287,1329364..1329438,1329508..1329576,
                     1329645..1330676,1330729..1330915,1330982..1332780)
                     /locus_tag="CNA05020"
                     /product="hypothetical protein"
                     /transcript_id="XM_566788.2"
                     /db_xref="GeneID:3253357"
     CDS             join(1327293..1329287,1329364..1329438,1329508..1329576,
                     1329645..1330676,1330729..1330915,1330982..1332549)
                     /locus_tag="CNA05020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566788.1"
                     /db_xref="GeneID:3253357"
                     /translation="MSYNASGGWGAGPQQAENVDDGGWGGPPEAVEWAPPGAWPSDPP
                     PKPAPTATAEISQPAPAPEPTPAPVQAESVKTGASETQEAEDGGGWGGSAEVVNPASV
                     PIPPSTAATSTVSAASVSVPSSDVGADAGETQDDNAGGWGGEPAKPSADNEDDRTAPV
                     TGNVTLNGWDGSQHAQKGVSDGEWKQPEPEPQQDNAGGWGAEPASLKTSNSDNDAGGW
                     GSPEPQQANGGWDAPVPSSNDNAGGWEEPQPPVRAPRSQTSNSGGWDSQSQSTGNGNA
                     GGWDNTDTQSIHSQRSQSAVHSAHLSRQSGPQSQSRSINYGYGGGRDASDVGVYIPDA
                     VVSRGPWDRPFVMPQSDNGWAGFAARRRGGAAGGAGRGGYGDNGGRQPQRQQQQQGGW
                     DAEPAQASGGWGSESVQQSSGGWNAEPTQQSSGGWGAEPAQTFSNDADDGGWGADPAP
                     IKSTSTSVSASAPVPAPAPAPVPAQAQVDNNAGGWSADPVPAADSSSDDAGGWGSPEP
                     VQRTPKAKTKVVDDAGGWGAEPAPVPVQTNQAQSNDDTGGWGAEPASNGSGDTGGWGD
                     TTQSQPQSQSQSNSGSGGWGDDTQSQSQSQSQNSGGWGDEPAPLGENNWGSRSGGGAS
                     QQPTESGFGGGLQGGYSSGGGDGRGRGFGGECHHCGKTGHIARMCPDTGYSGSPNDCF
                     RCQQPGHMARECPNTFGGGDACFKCGQPGHFARECPGAYGGGGGGFGGSNGGFRGGFA
                     PPASGANAVTNVTGATGWGFRKAYLSQNPNAGERSQSSWDSSNFNSGGGNGGGDNSNG
                     SGTDRPARTSWKDDASSGHSALSRDRDLTGWSVHEKWENEKVSLPKHKREILAGQSWL
                     EEDDGTSLAAEAVVEDDNTSSGWGAMKAARANQPEPKTEDDGGWGGAPVPAQNQDEDD
                     GGWGGAPVALPSGGKEDAGGWGDNGGSNDGEMGGGPETTPKAQPARLKPEPSAQSQPQ
                     TGGWDVEPVQPQAQTSSDDNAGGWGAEPVSNGANDDAGGWGAPEPKQISRPSNGGGWG
                     ASEPEPVSSGGGSGWGQQGGRGNFGGNDSSGTSISSQAGRRPGVRTPWAERSVMKTNQ
                     TGKWGNDGFEQLERDWQTYGRGGFGGRGRGAPRGRGGFGGGFGSRGDDGDNFQSRDNG
                     WGARASSNANDNGAFAPTASNVNAGGWDATPAPVPDASSNNDDGGWGSAPAPVPAASS
                     NNDDGGWAGEPAPVSAPAAPSNEDHGGWAGEPDSVTAPVQSTQAQADDGGWRGEPEKQ
                     SSVPASTAPVQESASADDDGGWGGEPEKVEVARGPDSIPVSASKEETKPEEDDGGWGN
                     ESKKVEAPVAPAPAPVEEPRTEPEDGGWGGEPEKVEQPQEKRPVEAEQPESKADEESK
                     PAIKAEINPASDSKPSSVAGSVKAESVSSKQDAEHHTPKSVASSLRESSAPPSQGASS
                     PRPFAQPFTPRTVQNSLLFASPVQRHISPVPSIVGAGYLDGRASPFTPGYISPLAAPG
                     PYPIPAAPVGVPPVPAYTAPIPVIPAVSPPIQPSGPRYFEPARSDSRVSIKTPNGAPV
                     MSPAGSNASLPTSSPVGQAGYYEVPHVPVGQEGYYQQAMNPYDSMSSHVSVPVAVGGQ
                     GMSGFVEGPDGAYYPVSQQPGYGYRPFGYGM"
     gene            complement(1332741..1335277)
                     /locus_tag="CNA05030"
                     /db_xref="GeneID:3253355"
     mRNA            complement(join(1332741..1333081,1333158..1333253,
                     1333317..1334440,1334496..1334662,1334724..1334792,
                     1334850..1335277))
                     /locus_tag="CNA05030"
                     /product="transporter, putative"
                     /transcript_id="XM_566790.2"
                     /db_xref="GeneID:3253355"
     CDS             complement(join(1332932..1333081,1333158..1333253,
                     1333317..1334440,1334496..1334662,1334724..1334792,
                     1334850..1335217))
                     /locus_tag="CNA05030"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_566790.2"
                     /db_xref="GeneID:3253355"
                     /translation="MRGRALSAIAALSRFYLARRFRTECLCLTAMSSERAPVVLYDIE
                     RSAATSSPDIPHILHAKRLGTRRLPRLPWPRPLANALTCLAIAASALQANGVYCWATY
                     GPVVASMRRLDGTQAQTIVVGGIVGVYLMAAPLGSLTDRYGPRIGSLVSACLSAAGYL
                     SFAAILATSTAETPLLYVWLTAAYFLVGAATVGSYFACLTCASLSFPTHPTLSLSLPL
                     SLIGLSSLALSSFSSLRIFISPSTGDLDPVKFLFFLGLLSPGVNLFGALFMRIIQPTT
                     PPLLEQDVHFPGQDEDTEPGSPISQFLHLSEHTPLLIGGPEAARPALEQSYASIRDGD
                     EAEDSSKPSHLSNVNNTGPEAGQWGVWDLIADWQGFWIFGILVALVIGPGEMTIASIG
                     SILTSLLPTPSSLPTPFSLFTPDNISYASITNDTDIDTDTNPLAQRNTQVFLISLSST
                     LARLFTGFLADYLSPPPTAVPNPAYRPDQDDPLASTPSPHDDDDHHAIAAGDGDDRER
                     AHPEPPHLWKQIHKVRMSRAAMTGTCALLLGGVYVFAAAGLQGGKGEKRLWVLSVGVG
                     GMYGALFTLTPAIVSLHFGPTNFGLAWGMISYFAALGSVVYSYLYALLSIPSDSQTEC
                     HGTHCFRVTFIVCAVSCFVGSLGLWLLGRRWKV"
     gene            1335259..1339320
                     /locus_tag="CNA05040"
                     /db_xref="GeneID:3253353"
     mRNA            join(1335259..1335728,1335778..1335879,1335942..1336326,
                     1336383..1337309,1337397..1338140,1338202..1338736,
                     1338814..1339081,1339143..1339320)
                     /locus_tag="CNA05040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656292.1"
                     /db_xref="GeneID:3253353"
     CDS             join(1335296..1335728,1335778..1335879,1335942..1336326,
                     1336383..1337309,1337397..1338140,1338202..1338736,
                     1338814..1339081,1339143..1339165)
                     /locus_tag="CNA05040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511919.1"
                     /db_xref="GeneID:3253353"
                     /translation="MPPASTDSQSTDFPDLPPAPPSHVVGQGYSAHNPVPTVQSYKAT
                     QQKHEEQAHAYAEMVERRAREAEERERRSRESRSGVGGDGHAAPQSGSPDAQAGSAPV
                     NAGPDEETNAAKVQEGKKTDEPNAASGANEKARMMEQMNANQLKPTERFAKAEKGQRR
                     VRDPITGAEIIVKDADPKDFDSKQPATKGTNVLYHAFPPPQPISVKTAMEKLKLIQYG
                     IAGFTFFIWLTVAFGSGLFAFFYRSTLCSVSAFILMTAVSLVERSLERDVEKVRQDMG
                     RQRGEAFSPPVPESVEWMNGLIKLVWGLVDPAMFVSIADMVEDILQQSLPGFVDAVRI
                     TDIGQGTNPIRITSVRALPDQPGDEGYPHTGWINQGNDDIKTKDTSGQEVEEDEAGDY
                     YNFEVAFSYAALPGQGAHQRARNIHLLIEFFLGLYDWLHIPIPIWIQVEQIFGIIRLR
                     VQFIPQPPFVRNLTFALCGVPAVEVSAIPMSKHLPNVLDLPFVSSFVKMGIAAGTAEM
                     SVPKSMTINLQEMLSGAAVGDTRAIGVFLITIHHCTGLSSQDNNGSSDPYVVLAYAKF
                     GKPLYSTRIILEDLNPVFEETCVLLLTMDEVKSKEDLAAMLWDSDKLSADDLVGRVQI
                     PVDELMAKPNQMIRREDGLMGFEDANDMPGKLVWSIGYFEKVPLRKELEQGPTVEEAA
                     SATDPGPKTAPEMEMHPADIAPNPAAKDLPPPPPDVLKTRPDPRWPSGVLSIILHQVN
                     NLERQNLKGASGSNREGEAGQDTDEPSEQSDNLPSGYGEFIVNDDLVYKTRVKQYSTN
                     PYFEAGTEVFVRDVENTVVRVVVRDSRLREADPILGIVSVRLSEVFREGSSVNQTYAL
                     TEGVGFGKANISFAFRGMQMTLPPNMRGWETGTLEVSDVRFTSTNPALFDAQATRLRV
                     VTSEQVEVLPKKEAEVQGHTISWEMDMLRLPVYARYQSSVVFEIGKTGGPLSILGVGV
                     KPDAIAVLWMQDLTDDIEQEVKLPVLVSNKIENLRQNAINDQTQKHHDFKVVGELVAR
                     IKLDSGLDEDHENLKQSQSRRHALEAYDHIEGEAEVARKQTHFADDGVIDKHEQKELD
                     KAHKRQLQSRGRGPAQVKAYRSAKWMAKGITDRLPGNKPKTREPTVQTEV"
     gene            complement(1339325..1340952)
                     /locus_tag="CNA05050"
                     /db_xref="GeneID:3253351"
     mRNA            complement(join(1339325..1339697,1339751..1340535,
                     1340590..1340633,1340695..1340952))
                     /locus_tag="CNA05050"
                     /product="hypothetical protein"
                     /transcript_id="XM_566795.2"
                     /db_xref="GeneID:3253351"
     CDS             complement(join(1339463..1339697,1339751..1340535,
                     1340590..1340633,1340695..1340791))
                     /locus_tag="CNA05050"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566795.1"
                     /db_xref="GeneID:3253351"
                     /translation="MADQESLPALPPAPLAPPRYVPAYSDDQVMYQERYVALQQLIHE
                     LEDENDLIAYRALKEERRLDESGTTFRGFAPEEGDVNGWFNNSSGRASRSGPLGDEPA
                     IESVVNDSISGRSKLSDDNRAEIQRKERERIEAERRELERLQAIERKRRLAEEEEERE
                     YLGTSGRRSPISVTASIPMSVPVHPTGDAPDMQEAEAFDEDLEMDRRRWLEFERELEN
                     RGEDSRHKPSEPLDVRNEQIGALPLDAARRHPSPGAPEAPEGEARRSWAKEREGYPER
                     HEKRRREEDSGAVGTGMKRRRGSVMDNHAEQPFSRRAQQSPLTRAPLPTLDSSRQDQE
                     LASPFSTRPAVHLSPITLRHPASPTASLREGRRSLGVIHGDRLSPGREDEEE"
     gene            1342403..1344310
                     /locus_tag="CNA05060"
                     /db_xref="GeneID:3253349"
     mRNA            join(1342403..1342641,1342700..1342798,1342862..1342960,
                     1343012..1343143,1343194..1343291,1343355..1343408,
                     1343466..1343893,1343946..1344061,1344122..1344310)
                     /locus_tag="CNA05060"
                     /product="acetyl-Coenzyme A acyltransferase 2, putative"
                     /transcript_id="XM_566797.2"
                     /db_xref="GeneID:3253349"
     CDS             join(1342544..1342641,1342700..1342798,1342862..1342960,
                     1343012..1343143,1343194..1343291,1343355..1343408,
                     1343466..1343893,1343946..1344061,1344122..1344233)
                     /locus_tag="CNA05060"
                     /codon_start=1
                     /product="acetyl-Coenzyme A acyltransferase 2, putative"
                     /protein_id="XP_566797.1"
                     /db_xref="GeneID:3253349"
                     /translation="MRITAKRLASHIPRQESYIVASKRTPFGAYGGKLREFKASELGG
                     IAGKAALAELPQGIKIDQVFFGNVTQTDNSTPYLARHVGHLSGLDSTVPALTVNRLCG
                     SGFQTAIIGAQHIALGEAEVCLTGGVEAMSMSPYTLSGLTRYGSKYGVDLKMEDSLAA
                     ALVDQNPGGPKTPMGITAENLAKKYNITRDECDAFALMSQQRYADGLAAGAFASELIP
                     VTLKPIKGVPQTLEADEHPRPQSTLASLQKLPSVFIKGTGVVTAGNASGICDGAAANI
                     LMSEEAVNKYGVKPLARVASYAWSACEPEIMGIGPVVAVKEALKKVGKSVGEMDIIEL
                     NEAFAAQWLAVQKELQLPSEKTNMFGGAIAVGHPLAASGARILANLTHNLHRLDKQWA
                     LGTACIGGGQGIAVVLERC"
     gene            1344500..1347041
                     /locus_tag="CNA05070"
                     /db_xref="GeneID:3253347"
     mRNA            join(1344500..1344807,1344897..1345177,1345227..1345274,
                     1345327..1345417,1345466..1345580,1345634..1345773,
                     1345827..1346719,1346777..1347041)
                     /locus_tag="CNA05070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656293.1"
                     /db_xref="GeneID:3253347"
     CDS             join(1344618..1344807,1344897..1345177,1345227..1345274,
                     1345327..1345417,1345466..1345580,1345634..1345773,
                     1345827..1346719,1346777..1346851)
                     /locus_tag="CNA05070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511921.1"
                     /db_xref="GeneID:3253347"
                     /translation="MSVPRPSRSPPPGPSTPNLSSTHNSTSNSARGIEATKGTSLWNE
                     ILASTDRQKALGRKNVILLSERNHGRTHLLSQLTSSRKKKSAKPNSVFYWNGQPKSTS
                     QPGDRRAGLALGYEVIDAGEEYSDSAPPISVFYPPSSHPSLLKLVPSALPPKSLADTA
                     VMIVLDWTKPSSMLQELLNWLSWVEAWALGSAEKGEIEELHERLQSYLQHYTEPSATN
                     TGVTAYSGLGPLLPLGAGTLTLNSSGIPIIVVCTKADLMDNVAEEIGIKGGRWEERTD
                     WVQQVLRTICLSYGAALFYTAPTRPTTYSLLKSYLLHRLYTVPPSLSPAPTSLTDPSH
                     IAPSPAQGVSTRYPFAHRANVLDRDAVMVPSGWDSWGKINVLREGFEPERIHKAWTVS
                     LRYHEQKEMGSCGADHGGDNGEEGLDGIWMGMIPDTSRGPRLPGPSALSIQSEPEQTF
                     LARHLEVLLKDPNRDPRQSFRLPSTRNGLSTPGPGSNSSAASTTAGLATPGVVGPMIG
                     DSLSLPGVEKVMKEMEGGKEKEGEELKEKFARLGRREGKSSGSGSGAAAGADGAIGGE
                     RVRNTSGGTPAMPNEALHNFFQGLLANRGKAATPVKTQSSGENK"
     gene            complement(1347575..1349241)
                     /locus_tag="CNA05080"
                     /db_xref="GeneID:3253345"
     mRNA            complement(join(1347575..1347857,1347918..1348035,
                     1348102..1348286,1348341..1348695,1348755..1348855,
                     1348941..1349076,1349160..1349241))
                     /locus_tag="CNA05080"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656294.1"
                     /db_xref="GeneID:3253345"
     CDS             complement(join(1347725..1347857,1347918..1348035,
                     1348102..1348286,1348341..1348695,1348755..1348803))
                     /locus_tag="CNA05080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024511923.1"
                     /db_xref="GeneID:3253345"
                     /translation="MVKKIQLAVIIGIPLLAMAVPAPDSATITASSVSSSAASSSATS
                     GPLLGEDGVAKCTDLQLHSGADWLVTALCAISKCNHMWPVSNILMLDEGDVLYDGASA
                     NFTTYDLTLASTTTTVNYTDAIGNIADNNGTAWFGGGFNRAIIAMGGPGVDSGELITN
                     DYSNVTAVETAGMWGLTYLTGQYAVVESIPSDDTTWATWMSKIDGTPVLIRTSDAPDA
                     SLKANQYYTLSTMDGADNVVVWNPSGTGDDSYISIPIGNLKTSSKYLYHLDWAHFFYE
                     ISP"
     gene            complement(1349244..1351723)
                     /locus_tag="CNA05090"
                     /db_xref="GeneID:3253343"
     mRNA            complement(join(1349244..1351241,1351298..1351615,
                     1351665..1351723))
                     /locus_tag="CNA05090"
                     /product="translation initiation factor eIF-2B epsilon
                     subunit, putative"
                     /transcript_id="XM_566803.2"
                     /db_xref="GeneID:3253343"
     CDS             complement(join(1349328..1351241,1351298..1351615,
                     1351665..1351706))
                     /locus_tag="CNA05090"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B epsilon
                     subunit, putative"
                     /protein_id="XP_566803.1"
                     /db_xref="GeneID:3253343"
                     /translation="MPPKKHQQKNEPKQKADNVDEAPLQAVVLADSYNRRFEVLCTDQ
                     PRVLLPLCSTPLLAWTLESLSLSKVKQVFIFCGVHADKIRTFVESSPYRAMLDIHCLS
                     SQTARSAGDALRELDDMHVLNPDNPFILVHSPLISNYDLSKIIDAHRKRRDVDKNFIM
                     TMGVSRGGRPHPESPIMLVHPPSSRLLHYAPHPLSPTQPRISFPSSLFLDPFPATIDT
                     YEIWSGTSPSSSNQGGYRDLGVDICEADVPALCTENFDYHDLRRHFVNGVLTSELLGK
                     KIAVHVVGQEEESLDARAGGGRYVESVRDTRTFGEVTRDVLRRWAFPLAPDLNEPGGS
                     QYELRAGNVYIAKESVVLSRTTTLSGPLLIGPRSALAHNTLVRQSTLGADCKIGAGSI
                     IRKSYVFDDVKIGEGCVVEECMIGEGVVIGHGCKIGKGVLLGNGVRLGKGVVVPDFSR
                     IGRQPYRGDDWDSDEERDEFEKEEILSFLGEDSIGYLWPNEEEEPPSDSEDEGEDPYE
                     HPRNKKLLQLGRRLSNLSSPSTSISTLSAASSSAPSSPLSDASSTSLPDIPSLSLDAG
                     PDKAFYSEAAASLQRAYEEDHKIENALLELRTLVMGYNAGLERAREEVVKFFVSKIDV
                     RGPATSILSSAVKIFSRWGPLMANLTSDPTLLILDAQQYCVSTVPFAYIPWFGIILRA
                     MYETDLVGEDELVEWREMSSSQGEGVGKKGKEGEEEKARWRESWAKGKGYVDVLESMD
                     SESGEEESSSEEESDDA"
     gene            1351903..1354590
                     /locus_tag="CNA05100"
                     /db_xref="GeneID:3253341"
     mRNA            join(1351903..1352553,1352615..1352717,1352770..1353094,
                     1353138..1353258,1353318..1353444,1353504..1353800,
                     1353854..1354048,1354104..1354112,1354171..1354590)
                     /locus_tag="CNA05100"
                     /product="WD-repeat protein, putative"
                     /transcript_id="XM_024656295.1"
                     /db_xref="GeneID:3253341"
     CDS             join(1351969..1352553,1352615..1352717,1352770..1353094,
                     1353138..1353258,1353318..1353444,1353504..1353800,
                     1353854..1354048,1354104..1354112,1354171..1354487)
                     /locus_tag="CNA05100"
                     /codon_start=1
                     /product="WD-repeat protein, putative"
                     /protein_id="XP_024511924.1"
                     /db_xref="GeneID:3253341"
                     /translation="MPPRQHYIVSSDDDDDEDYQPSDPEVALLDLLHDGYELYEEDYN
                     EDDTDDEDEEDDDGLMVDENGNIIRDDGNDFDDDQEMSDDTESRAFADLLEFAQAVDD
                     GESPLAFLSGRVSGSFPSILHRLAMRSDSRFRNNDWASKVKKKQTVADPKGTELLRSG
                     EFGRVGNWQAPGKAGRQRLRRWQRAVKGWKPPRSTTSQHLVPNEPGTVVAYYPSVPYV
                     GQFAGEDYSIFYTATQYFTLHLYSTTQYLKSKDNIHQRRTARPSDSTRLTLTPSTPPA
                     QGNQVIEDEDQGGQEDDWEDEDDYVSRPSVIEDSSMKRIKRVQGVEGRWTITDCDADK
                     KGEKMIYSSITPYVHMLYTDEFDQEHVELDFSDPRERGNYYRSGIWSIRFSADGKEIV
                     AGASDGKIMVYDINAQRRSLSVSGHAEDVNAVCFADHSSTNILISGSDDGYIKVWDRR
                     SLSSHVPSGVLVGATEGITYTSPKGDGRYIVANSKDQAARLYDLRKMRSYGDFVDEPN
                     ASQKYGAAGFDYRDMRYPRSEPRSHPQDCSVMTYSGHSVLRTLIRCHFSPIESTGQSY
                     IYSGSADGMIHVWSLDGRVVQVLDRSASEGLYSSQGIYSDPSAPAHSTQSSRTNLFGS
                     YSHAVRDVAWHGYEPTLMSTCWDMMGSMRRGGTVAKHEWKGLGKNGLAKLEDWEIRRK
                     EENEGSRATN"
     gene            1354958..1357307
                     /locus_tag="CNA05110"
                     /db_xref="GeneID:3253339"
     mRNA            join(1354958..1355471,1355538..1355776,1355831..1355952,
                     1356004..1356607,1356662..1357307)
                     /locus_tag="CNA05110"
                     /product="sulfite transporter, putative"
                     /transcript_id="XM_566807.2"
                     /db_xref="GeneID:3253339"
     mRNA            join(1354958..1355471,1355538..1355776,1355831..1355952,
                     1356004..1356607,1356662..1356985,1357053..1357307)
                     /locus_tag="CNA05110"
                     /product="sulfite transporter, putative"
                     /transcript_id="XM_024656094.1"
                     /db_xref="GeneID:3253339"
     mRNA            join(1354958..1355471,1355538..1355776,1355831..1355952,
                     1356004..1356607,1356662..1356985,1357062..1357307)
                     /locus_tag="CNA05110"
                     /product="sulfite transporter, putative"
                     /transcript_id="XM_024656095.1"
                     /db_xref="GeneID:3253339"
     CDS             join(1355192..1355471,1355538..1355776,1355831..1355952,
                     1356004..1356607,1356662..1356970)
                     /locus_tag="CNA05110"
                     /codon_start=1
                     /product="sulfite transporter, putative"
                     /protein_id="XP_024514166.1"
                     /db_xref="GeneID:3253339"
                     /translation="MVVKSTAAKNMSHDTRRDQRISRDDQLASVSGVSEITIAESSTR
                     GRLSSCDTNPASIGSRSRNYEVKHEPVNLSRRVMRRVEHAILNISPAFFSFNMGTGIT
                     SILLYNLPFNGGWLRRLGVVVFIFNVVLFILFAVASVVRILRWKGIFSATLKNHLSGL
                     YWGTLPMGFITIVNMIAFTCVQNGKMGWARTAIGLWWVDVILSVIINLGMVYVMITRQ
                     NHTTEAMSAAWLLPIVTCVVASSSGGVVSSAIMSYSPQLARSIIIVSYIVWGIGVPFA
                     LFVICNYLHRSFLYGAPPVAALTSTYLPLGPCGQGSFGIMALGKAVRELAYNHGIGFA
                     VIPDGVADAVLRRNIILQMADAVYTGSLVTGLILWGLSFCWYVLATTVLLDHWWNTNR
                     AYFGRESFSVGFTALIFPIGVWATATTTLATEFDSLVFKILGTIISLQVIFNWIYVML
                     LTIYKVCDGTLFIAPELDIFPERNPPLRWVRHASATAKTCRKEDIELSFTSTEERRVG
                     LGDSYGEND"
     CDS             join(1355192..1355471,1355538..1355776,1355831..1355952,
                     1356004..1356607,1356662..1356970)
                     /locus_tag="CNA05110"
                     /codon_start=1
                     /product="sulfite transporter, putative"
                     /protein_id="XP_024514167.1"
                     /db_xref="GeneID:3253339"
                     /translation="MVVKSTAAKNMSHDTRRDQRISRDDQLASVSGVSEITIAESSTR
                     GRLSSCDTNPASIGSRSRNYEVKHEPVNLSRRVMRRVEHAILNISPAFFSFNMGTGIT
                     SILLYNLPFNGGWLRRLGVVVFIFNVVLFILFAVASVVRILRWKGIFSATLKNHLSGL
                     YWGTLPMGFITIVNMIAFTCVQNGKMGWARTAIGLWWVDVILSVIINLGMVYVMITRQ
                     NHTTEAMSAAWLLPIVTCVVASSSGGVVSSAIMSYSPQLARSIIIVSYIVWGIGVPFA
                     LFVICNYLHRSFLYGAPPVAALTSTYLPLGPCGQGSFGIMALGKAVRELAYNHGIGFA
                     VIPDGVADAVLRRNIILQMADAVYTGSLVTGLILWGLSFCWYVLATTVLLDHWWNTNR
                     AYFGRESFSVGFTALIFPIGVWATATTTLATEFDSLVFKILGTIISLQVIFNWIYVML
                     LTIYKVCDGTLFIAPELDIFPERNPPLRWVRHASATAKTCRKEDIELSFTSTEERRVG
                     LGDSYGEND"
     CDS             join(1355192..1355471,1355538..1355776,1355831..1355952,
                     1356004..1356607,1356662..1356970)
                     /locus_tag="CNA05110"
                     /codon_start=1
                     /product="sulfite transporter, putative"
                     /protein_id="XP_566807.1"
                     /db_xref="GeneID:3253339"
                     /translation="MVVKSTAAKNMSHDTRRDQRISRDDQLASVSGVSEITIAESSTR
                     GRLSSCDTNPASIGSRSRNYEVKHEPVNLSRRVMRRVEHAILNISPAFFSFNMGTGIT
                     SILLYNLPFNGGWLRRLGVVVFIFNVVLFILFAVASVVRILRWKGIFSATLKNHLSGL
                     YWGTLPMGFITIVNMIAFTCVQNGKMGWARTAIGLWWVDVILSVIINLGMVYVMITRQ
                     NHTTEAMSAAWLLPIVTCVVASSSGGVVSSAIMSYSPQLARSIIIVSYIVWGIGVPFA
                     LFVICNYLHRSFLYGAPPVAALTSTYLPLGPCGQGSFGIMALGKAVRELAYNHGIGFA
                     VIPDGVADAVLRRNIILQMADAVYTGSLVTGLILWGLSFCWYVLATTVLLDHWWNTNR
                     AYFGRESFSVGFTALIFPIGVWATATTTLATEFDSLVFKILGTIISLQVIFNWIYVML
                     LTIYKVCDGTLFIAPELDIFPERNPPLRWVRHASATAKTCRKEDIELSFTSTEERRVG
                     LGDSYGEND"
     gene            1358106..1359695
                     /locus_tag="CNA05120"
                     /db_xref="GeneID:3253337"
     mRNA            join(1358106..1358343,1358423..1358573,1358629..1358746,
                     1358811..1358956,1359002..1359292,1359357..1359695)
                     /locus_tag="CNA05120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566811.2"
                     /db_xref="GeneID:3253337"
     CDS             join(1358139..1358343,1358423..1358573,1358629..1358746,
                     1358811..1358956,1359002..1359292,1359357..1359522)
                     /locus_tag="CNA05120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_566811.2"
                     /db_xref="GeneID:3253337"
                     /translation="MGDVVPTQPSRWWIQYINTQVPSSLQSSFEYTFLEFMPMSSIPT
                     TGNRTKLASSLAAFLKEDGKDLHLGGDEDFHAERRKHTEILGIHRIQGALEVPIGEVQ
                     FTAIRGPHGCIPLRILKPSNPGDRALVYMHGGGYTVGCADDFERGLRVVAEESGFTVV
                     IVEYRLAPEYKFPTQLDEYEAVVAWLQGEEGKKRGIKKVVGGGDSAGGNMTAALALRL
                     HDQKKANLAAQLLLYPEARVPFDTKACAENNSGYYLEANGIFSFADHYLPRGVPPSDR
                     YISPGMQDVGNLKDLPPTYVFTAGFDPLRDVGVEYAHKLQEAGNEVVWRHRPDLTHGF
                     LQFGHWSEECEEATKEVGKTLKDL"
     gene            complement(1359652..1363617)
                     /locus_tag="CNA05130"
                     /db_xref="GeneID:3253335"
     mRNA            complement(join(1359652..1360013,1360067..1360273,
                     1360325..1360520,1360572..1360684,1360741..1360974,
                     1361023..1362165,1362213..1362480,1362537..1362746,
                     1362805..1363079,1363141..1363256,1363305..1363617))
                     /locus_tag="CNA05130"
                     /product="enolase 1, putative"
                     /transcript_id="XM_566813.2"
                     /db_xref="GeneID:3253335"
     CDS             complement(join(1359792..1360013,1360067..1360273,
                     1360325..1360520,1360572..1360684,1360741..1360974,
                     1361023..1362165,1362213..1362480,1362537..1362746,
                     1362805..1363079,1363141..1363256,1363305..1363593))
                     /locus_tag="CNA05130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566813.1"
                     /db_xref="GeneID:3253335"
                     /translation="MSSEKGQSNTNEKQLINRADTGKTAVSDSPLPFKPHTALSGKIL
                     EALGSDAASGLSDEEVSRRLQQYGPNRLKPPKRPSILKIIARQVGNAMTLILIAAMAT
                     SLGTMDWISGGVIAALVILNVSVGAYTEWQAEKTVASLESVGAPQATVVRTRKGSRDP
                     TISIIPVEEVVPGDIIQLKNGDIVPADGRILDGHLSNLEADEAFLTGESLPVAKQTEP
                     IDEEDCPVGDRICMVFSGSQITKGRARVVITSTGMGTEIGKIAQALESKAQNKNRGFA
                     AFWWKLKVILGVEETTPLQMKLNKLAYFLLACALVIAVIVVASTGFNDVPLSIATYAV
                     AAAVSILPASLIAVVSLTLARASTDLASRHALVRRMDAIEALAGVENVCSDKTGTLTV
                     GRMVVRKVWVPALDWRPNDFAPLDTSGGQAYSFETGSDPFYPRGEVRADPQKISGTAE
                     TLDLKQPRDQSDSSSSDTDPEERDVEYQERVIHVEEMENNLRDLALCISLCNQATLSR
                     PVDQDGQWEANGDPTETALQVAAHKLGHGKPFLTHVAKPSHRADSIRSGQSSRPLVAG
                     IRGHFVQIIEHPFDSTVKRMSIAYKFVGEDPQDSHVLCLLKGAIERVFERCTKIQGQP
                     ITEEHKKDIMIKVDALAAQGLRVLALCGKRLPVSMVDEVKSTPRDAFEADFHFLGLAG
                     IFDPPRKESAGAVADCFRAGITPRMLTGDHPATATAIALNIGILDKTYSKTSVMTGQQ
                     FDSLSEDEIDQLPELPLVVARCAPETKVRMVDAIHRRGQSTVMTGDGVNDSPALKRAD
                     VGVGMGTGSDVAKQSARIVLSDDNFSTIIRAIRKGRSVFKNLSKFLLYLLSGNLAEII
                     VLMIGLAFKDENGQAVFPLSPVAALWINTLAAGPPALALGLEPTAIDAMEQGPEVYHQ
                     IFTLEFYIDLIFYGFLMGSISLVNFVIVLWGYYPGDLGRFCNEDDPSICDPVYQARAA
                     CFATLVIVLMIHALECKHLNKGLAQINLRDNKVLLWCVVVLSLSAFPVVYIPVINNKV
                     FLLDGPRWEWGIIFGMIIVYVGATELYKWLKRIWIRRHAPPSKGPTDKTLRMESTIAP
                     PV"
     gene            1364009..1365651
                     /locus_tag="CNA05135"
                     /db_xref="GeneID:36392693"
     mRNA            join(1364009..1364496,1364554..1365175,1365240..1365651)
                     /locus_tag="CNA05135"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656096.1"
                     /db_xref="GeneID:36392693"
     CDS             join(1365132..1365175,1365240..1365591)
                     /locus_tag="CNA05135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514168.1"
                     /db_xref="GeneID:36392693"
                     /translation="MDTAEEDRRSAASSRMVSIDRNRHHPARRVEFEDHLCYGELLNL
                     ITIDPPYHPKSSNTPPVTLAFAHIKPAVSHKHRIGSHEWSYYKKHQAEEIVDLASVNQ
                     LVGRVKSISKPGTTYIIDSGTRYSRVSLA"
     gene            complement(1367346..1368921)
                     /locus_tag="CNA05140"
                     /db_xref="GeneID:3253333"
     mRNA            complement(join(1367346..1367922,1367972..1368065,
                     1368118..1368921))
                     /locus_tag="CNA05140"
                     /product="expressed protein"
                     /transcript_id="XM_566815.2"
                     /db_xref="GeneID:3253333"
     CDS             complement(join(1367644..1367922,1367972..1368065,
                     1368118..1368587))
                     /locus_tag="CNA05140"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566815.1"
                     /db_xref="GeneID:3253333"
                     /translation="MGGEESLPSSVDNIVPNRREPFHRRVKSYFTTEIDAPRSTDLIS
                     IYACFLTGFTSAPSFTACYVWCGFQTGNVAQLGVAIARCFAPGSRRTFGFQKPDQQAL
                     TSLLSFWIGTSLGRFGDWSGAKKRTWLAIATLLQALLAMAAALTAHYSGESGIASSRE
                     GPSWASPTGMAALGFLSATMGIQGIVGKRIASPMNTTVVLTTTWVEIFNDPLLFAFKY
                     TPSRDIRIAGGLSVLLGAFVSRAILDASSSAGACGVLAGLRMIQFIWWFFIPDKQVKK
                     VESK"
     gene            1369549..1371743
                     /locus_tag="CNA05150"
                     /db_xref="GeneID:3253331"
     mRNA            join(1369549..1370177,1370225..1370284,1370335..1370451,
                     1370504..1370608,1370665..1370923,1370973..1371169,
                     1371231..1371349,1371400..1371743)
                     /locus_tag="CNA05150"
                     /product="mitochondrial matrix protein import-related
                     protein, putative"
                     /transcript_id="XM_566817.2"
                     /db_xref="GeneID:3253331"
     CDS             join(1369599..1370177,1370225..1370284,1370335..1370451,
                     1370504..1370608,1370665..1370923,1370973..1371169,
                     1371231..1371349,1371400..1371514)
                     /locus_tag="CNA05150"
                     /codon_start=1
                     /product="mitochondrial matrix protein import-related
                     protein, putative"
                     /protein_id="XP_566817.1"
                     /db_xref="GeneID:3253331"
                     /translation="MLRQATSRFLSSTHRSIRPLSTTAPSFIRIRSQASEPSPAERPP
                     PVPENVNPSQPFEPEVSKSEGTAKAAETQQAEEPASAGTPLTPPQPEVVFGNTHSAAS
                     TTPETEPNVENPDYSKLPSLDIDQEAAAISEPATGKDQEVEGGERKKTGAGKKEYVSS
                     QEKSRRMWIRAGYGALAVGAVGAVLAMGNDETTGKKQGGFVETFQNNMLELFDFFNKP
                     AFQTLLPDPLPPPHQRPYTLCIDLEGLLVHSSWDRTHGWRTAKRPGVDYFLGYLSQFY
                     EIVLFSSQPLYTAAPIAEKIDPYQAFMPYRLFRESTRSVKGKVVKDISFLNRDPSKVI
                     VLDVNPEHVALQPENGIVLQPWNGSPGDKGLVDMIPFLESIGIFNPADVRPILQAYAG
                     KDIPIEYAKKEAEAKAKAIEEWERAHPTAITGAGSGFLSSIFGSVAAPGSSRPNQPMT
                     YLEQKRAQAQRIYQEEQKYWAEHADEFKKLIEEDKQRQLAEMKGSILGYLGAPKMQDG
                     PKEEVLKA"
     gene            complement(1371719..1372573)
                     /locus_tag="CNA05160"
                     /db_xref="GeneID:3253329"
     mRNA            complement(join(1371719..1371857,1372063..1372203,
                     1372438..1372448,1372501..1372573))
                     /locus_tag="CNA05160"
                     /product="expressed protein"
                     /transcript_id="XM_566819.2"
                     /db_xref="GeneID:3253329"
     CDS             complement(join(1371812..1371857,1372063..1372203,
                     1372438..1372448,1372501..1372533))
                     /locus_tag="CNA05160"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566819.1"
                     /db_xref="GeneID:3253329"
                     /translation="MSYTIAGRAIKNEYLALGTIISTIGIAVAATGGSDKAAASSAPV
                     SVSDDKTITGETPEEEDFIRQFVAEAEKSEKH"
     gene            1372745..1374029
                     /locus_tag="CNA05170"
                     /db_xref="GeneID:3253327"
     mRNA            join(1372745..1372968,1373030..1373044,1373139..1373445,
                     1373500..1374029)
                     /locus_tag="CNA05170"
                     /product="structural constituent of ribosome, putative"
                     /transcript_id="XM_024656296.1"
                     /db_xref="GeneID:3253327"
     CDS             join(1372795..1372968,1373030..1373044,1373139..1373445,
                     1373500..1373768)
                     /locus_tag="CNA05170"
                     /codon_start=1
                     /product="structural constituent of ribosome, putative"
                     /protein_id="XP_024511926.1"
                     /db_xref="GeneID:3253327"
                     /translation="MISLSFFRPATSSPRIALSLPKFLAPKTPTQGVQQVRFRGQLAP
                     KRTKYRKAAKGAPGTQIPIGGSLKGTVLHHGTFGLRACSSVRISAAQLTSCQAAVRRK
                     IKPIKGAQFYLRVFPDIPVCVKGNEQRMGKGKGSFEYWSCRVKPGKVIMEVGGGDIRE
                     EIAKAALKLAQARLPLQTEFITLSSPPRLGRIATPALADPPSAQPIPNNLAYLDAKEE
                     GGARRVIMRREERAVEEIVDGLQGLEMKDAAKGIDG"
     gene            complement(1374077..1375148)
                     /locus_tag="CNA05180"
                     /db_xref="GeneID:3253325"
     mRNA            complement(join(1374077..1374133,1374206..1374269,
                     1374326..1374412,1374504..1374587,1374676..1374749,
                     1374884..1374899,1374959..1375148))
                     /locus_tag="CNA05180"
                     /product="expressed protein"
                     /transcript_id="XM_024656297.1"
                     /db_xref="GeneID:3253325"
     CDS             complement(join(1374347..1374412,1374504..1374587,
                     1374676..1374749,1374884..1374899,1374959..1374976))
                     /locus_tag="CNA05180"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024511927.1"
                     /db_xref="GeneID:3253325"
                     /translation="MPVPWEALIPCGLLVAMFGITGNLFSAAKFMTNDMKPPRYALDT
                     WENMMMERDRRLTGSLRGQSTDPIAPKEFATNSVWETERVH"
     gene            complement(1375521..1375591)
                     /locus_tag="CNA05190"
                     /db_xref="GeneID:3253970"
     tRNA            complement(1375521..1375591)
                     /locus_tag="CNA05190"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3253970"
     gene            1375854..1378008
                     /locus_tag="CNA05200"
                     /db_xref="GeneID:3253323"
     mRNA            join(1375854..1376949,1377001..1377221,1377270..1378008)
                     /locus_tag="CNA05200"
                     /product="carnitine acetyltransferase, putative"
                     /transcript_id="XM_566825.2"
                     /db_xref="GeneID:3253323"
     CDS             join(1375944..1376949,1377001..1377221,1377270..1377935)
                     /locus_tag="CNA05200"
                     /codon_start=1
                     /product="carnitine acetyltransferase, putative"
                     /protein_id="XP_566825.1"
                     /db_xref="GeneID:3253323"
                     /translation="MPIRSSVFAQRALSQLKMPIATSKRTITNKPLYASQSTIPHLPV
                     PPLSSTLHKYLETLSPLLSQSDFSQSASVVKAFAGSDQAKVLQQRLKNRAQEKDSWLS
                     EWWNEAAYMGYRGRIIPNVSYFYLHKRGLGKGKSQEDRAAELVRATVEFKKLVDSELL
                     EPEKIKGQPLCMASYRYLFNSARQPNSPSDFAKAYGPGNHHIVVLRNNRYFKVDTHGR
                     GAKDLAETFKKIKIIADRQPGPNIGVLTADDRDVWTSARNHLFSLSPTNKSTVEAIDS
                     AILLICLDAYPAPTTDDSRAWSYWAGGHANGKDGRGFNRWFDKHEIIVDSEGESGFNG
                     EHSMLDGTPTLRLNEFMLASIDSQRIPLELDSSEMSRCSTMEPEELKFELDDKLKQII
                     EQSKRGFEEEMEKQDLKMVTFREYGKNLIKTYRVSPDAWAQLIFQLAFYRLFQRLPAT
                     YESCQTRKFLLGRTEVIRSASNEGKAWVEAMVNENFPEGDEGREKLFRKAVERHVQYA
                     VWAADAQGVDRHLFGLKKLIAPGEPIPEIFSDPAFARSSHWELSTSNLGSRYLDGWGY
                     GEVVEDGFGLSYSIEDDALRWGITKKKGPSGAGASAAELGQALESAAREVASMMERAK
                     TVKTNA"
     gene            complement(1378169..1378888)
                     /locus_tag="CNA05210"
                     /db_xref="GeneID:3253948"
     mRNA            complement(join(1378169..1378313,1378440..1378600,
                     1378676..1378888))
                     /locus_tag="CNA05210"
                     /product="expressed protein"
                     /transcript_id="XM_024656298.1"
                     /db_xref="GeneID:3253948"
     CDS             complement(join(1378281..1378313,1378440..1378600,
                     1378676..1378718))
                     /locus_tag="CNA05210"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512063.1"
                     /db_xref="GeneID:3253948"
                     /translation="MPPSNFRFKVRATKEALNVPCAPELTSLLSCFATTGDLRHTTSC
                     ADSAKALHTCMAQGKGKGGKSGSSINYLLGKIRR"
     gene            complement(1378972..1381725)
                     /locus_tag="CNA05220"
                     /db_xref="GeneID:3253321"
     mRNA            complement(join(1378972..1379431,1379481..1379604,
                     1379663..1380048,1380098..1380264,1380318..1380450,
                     1380502..1380722,1380805..1380952,1381043..1381725))
                     /locus_tag="CNA05220"
                     /product="membrane transport protein, putative"
                     /transcript_id="XM_566827.2"
                     /db_xref="GeneID:3253321"
     CDS             complement(join(1379292..1379431,1379481..1379604,
                     1379663..1380048,1380098..1380264,1380318..1380450,
                     1380502..1380722,1380805..1380952,1381043..1381511))
                     /locus_tag="CNA05220"
                     /codon_start=1
                     /product="membrane transport protein, putative"
                     /protein_id="XP_566827.1"
                     /db_xref="GeneID:3253321"
                     /translation="MSSPNTITTSTTLPPSPVSSRIGTISITDSNDDHDHITRIPTST
                     SHRTADYGHPLQRTMTTASRRAPPDLAFPYLTTDMSRGGITQEYRIETREGFIPANDA
                     EYGLQPMRSRATTIHGDRFVLHDKEKGGMGEKKLVTFQEGDPQNPRNWSKSRRWIITG
                     IVSCAVIQVALSSAIVTGDFPDQEEYFGVSSEVIALTVSLTVCGFGTGPLLWSPLSEL
                     LGRRWLWAIPTAIYIIFNIPCALAPNIGCLLASRFLCGFFGSAPLTLAGGTIADVWGP
                     EERGFAIAIFAAAPYTGPVIGPLIGGFIGKYAGWRWIYWVNMISAGVVWLASLIIPET
                     FAPAILKKRAKQMRYDSQDDSYVTEQEIFRKPLNEIVIETLIRPFEMLATEPVLLCMS
                     LYISLVYGLLYAFFFSFPVVFNEDYGWDDAKTGLTFIPVFIGVGLALCVTPWLEKKYV
                     AKGDKAEPEDRLPGMLIGGPFVPISLFIFGWTSPPYVAPGGGSWVGPVSAGIPFGLGM
                     VLVYFSANAYLIEAFPDYVASALAAKTVVRSAAGAAMPLFIPQMFHGLGNGGAASLLA
                     GIAIIMACIPFAFAKWGKKIRARSKRAAL"
     gene            complement(1381987..1382178)
                     /locus_tag="CNA05230"
                     /pseudo
                     /db_xref="GeneID:3253933"
     gene            1385221..1388025
                     /locus_tag="CNA05240"
                     /db_xref="GeneID:3253319"
     mRNA            join(1385221..1385398,1385463..1385504,1385569..1385763,
                     1385822..1385916,1385970..1386146,1386201..1386424,
                     1386478..1386496,1386556..1386662,1386722..1386837,
                     1386897..1387100,1387159..1387243,1387305..1387556,
                     1387607..1387771,1387853..1388025)
                     /locus_tag="CNA05240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656299.1"
                     /db_xref="GeneID:3253319"
     CDS             join(1385246..1385398,1385463..1385504,1385569..1385763,
                     1385822..1385916,1385970..1386146,1386201..1386424,
                     1386478..1386496,1386556..1386662,1386722..1386837,
                     1386897..1387100,1387159..1387243,1387305..1387453)
                     /locus_tag="CNA05240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511929.1"
                     /db_xref="GeneID:3253319"
                     /translation="MVTVGYPFPEESMLGNTHVDPVSDMEQSLPQKTTWKGRIWDTFD
                     RPPLERKLLFKVDAAILTFASLGYFLKNLDQTNINSAFLSGMKEDLGMTANQLVTATS
                     IWTVGYVIGQIPSNLLLTRIEPRWVIPALELGWGVATLGSYGVKSYKALYALRFLVGL
                     FESGFYPGMHYMLGGWYTPSEIGKRASIFWVAGSLGQMFSGILQAAAYNNLSGIHGLA
                     GWRWLFIIDAVITLPLAIFGFLFFPPLPLQGKKCWWLSSEEFSIAQSRLLRFGRVGKK
                     AWTRTKLKSLLFSWHTYFLPLLYVLWNNQFPQAPIGYFLKSFNDTPYPGGDRRFSVGQ
                     INQLPLPQTAIFVVVALAFAWLSDGLFRGRRWPFVYVGAVISLIIASILVHFPLYKNV
                     DSTIVLYWFSTVGQGAGPLILTYINEICSDDSEKRAILVAAGNDLAYVVQAVAPNFVW
                     KTTDFPQARKGWTWSIALNVALIFWMSVILILRQRDIKRIIHKSPAETIQVIETPEED
                     DKSSGTLGSLEKA"
     gene            complement(1387860..1390199)
                     /locus_tag="CNA05250"
                     /db_xref="GeneID:3253317"
     mRNA            complement(join(1387860..1389094,1389147..1389293,
                     1389344..1389565,1389613..1390199))
                     /locus_tag="CNA05250"
                     /product="T3P18.10, putative"
                     /transcript_id="XM_566832.2"
                     /db_xref="GeneID:3253317"
     CDS             complement(join(1388141..1389094,1389147..1389293,
                     1389344..1389565,1389613..1389963))
                     /locus_tag="CNA05250"
                     /codon_start=1
                     /product="T3P18.10, putative"
                     /protein_id="XP_566832.1"
                     /db_xref="GeneID:3253317"
                     /translation="MTGTNEQFHHFNRPVRNVAIIGSGPSGTPAARQLRDAGLNVRVF
                     ERQNKPGGIWNWRPSVSLPLAVPTPPPSVGAFTPVIRGTGVYEDPGRVEREKFNPPNP
                     CYWSLNNNVPTSTMAFKDFPYPPGTQSNVSHALISSYVQSYVKNYGIDQITSYNTRVE
                     RAEKIGDTWKLTLRKVVDEGEDRVREEYWTEEFDAVVAASGHYNAPYIPPFEGSDAWS
                     AAWPQQLIHSQGYRKPEPYTGKTVLIVGIGTSGNDIAKDISPYASKIYMVGRNTLRGP
                     QQYRELRKMQRHFAPPNSEILPEIRRFRLPSPGQAINEGSIELTNGRIITGVNEIIFA
                     TGYQYSYPFLPQYHQDSTMVNPAFPTVTPVVTNGDGVLNLYRDVFYIPDPTLTFLGLS
                     VNTSAFSFFEYQALSIARVFAGTARLPDESSRWKAYRNLVREKGEGKFSHLLGKDGER
                     SYVHETVQWLNRDAEWSGASKVEGHTIEWLTESDKIPLLIASKFGLDAAGLKALREKP
                     SDIPEEDTAQPVETERSIGLFGDKFKTATEETNARTSEAFARKAALTSA"
     gene            1390652..1392798
                     /locus_tag="CNA05260"
                     /db_xref="GeneID:3254024"
     mRNA            join(1390652..1390868,1390927..1391039,1391110..1391153,
                     1391219..1391424,1391478..1391750,1391810..1391942,
                     1392001..1392155,1392210..1392347,1392408..1392798)
                     /locus_tag="CNA05260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656300.1"
                     /db_xref="GeneID:3254024"
     CDS             join(1390719..1390868,1390927..1391039,1391110..1391153,
                     1391219..1391424,1391478..1391750,1391810..1391942,
                     1392001..1392155,1392210..1392347,1392408..1392536)
                     /locus_tag="CNA05260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512061.1"
                     /db_xref="GeneID:3254024"
                     /translation="MTIIPQQKRVKIGVIGAGPGGLSVAINLLKLPFIDLNIYDQATE
                     LREVGAGISINQNTWRHLRLLGAADTIEQSTVRGDGSKIDIEQRNGRTGELLLRKYQS
                     VNPDAPARSRIERYKLQHALLGQIPEDFIKLSKKLKTVVESDDGVTITFKDGTAAGPF
                     DLLIGADGIRSVVRQYAYPEHRLSYTGKVAYRTLIPQSKVAHIANIPHAATFWHTANS
                     HVYTDPLDNGLFEIATRAIESEEHGNKVSWGQKVSRDRVIHHYKDYCETIRQIVEAPD
                     EWLEFAMFGGPRLDSVIHNGRIALIGDASHPLSGAFGSGAAFAFEDAYVLAQALVYTH
                     ARNENISEALRLYDEVRSPHYKNLYAILTGFAATAREVQTTYGMEDEDQFVRETVRRN
                     WSAHHDWIYSYDVTKVWHQRVVDEDAKKGVAQLKIGDELGTNIVVDAHSITMAV"
     gene            1392997..1394768
                     /locus_tag="CNA05270"
                     /db_xref="GeneID:3253315"
     mRNA            join(1392997..1393098,1393148..1393277,1393317..1393402,
                     1393456..1393560,1393613..1393899,1393959..1394768)
                     /locus_tag="CNA05270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656301.1"
                     /db_xref="GeneID:3253315"
     CDS             join(1393055..1393098,1393148..1393277,1393317..1393402,
                     1393456..1393560,1393613..1393898)
                     /locus_tag="CNA05270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024511931.1"
                     /db_xref="GeneID:3253315"
                     /translation="MAQASGDDNAWEERWAQGRTAFDQSAAHPVFVKFLKSDIARELG
                     VPKSGKALVPGCGRGYDVHLLASTGLDAIGLDLAPTGVEAARRWIGSQPSTSGKADIL
                     VQDFFTYDPLEKFDLIYDYTFLCALPPSLRQEWARQTTHLANIAADTNPILITLMYPL
                     PPSAKSGGPPFALSEEIYQELLKEQGWKMVWSEDIEEPTRMVGAPGGEKLAVWKRI"
     gene            complement(1393970..1395854)
                     /locus_tag="CNA05280"
                     /db_xref="GeneID:3253313"
     mRNA            complement(join(1393970..1394651,1394702..1394788,
                     1394834..1394906,1394949..1395854))
                     /locus_tag="CNA05280"
                     /product="expressed protein"
                     /transcript_id="XM_566836.2"
                     /db_xref="GeneID:3253313"
     CDS             complement(join(1394019..1394651,1394702..1394788,
                     1394834..1394906,1394949..1395787))
                     /locus_tag="CNA05280"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_566836.1"
                     /db_xref="GeneID:3253313"
                     /translation="MALPGEYPYTRLAQHGQNHPEDDWESSDSDSPPHLASRGLNMPS
                     TPVRAGYSANSNVSVYSSRQPRRQGPRRRVDARPVTPRRSRLAPRAPERNAAAFGTSL
                     SYILTPVRLMLYPIQMICFPFFAHLINVLILVALATLAGYVIIPRFPGWITSLLSRIM
                     SYVFKSSFFDIRGLGDLSKDVMDFSARALATPSCTLTGLFCAHSLFTTSHSSTTTQEA
                     PDNIGAMASPFWKWLTPQPKEEIDIGLVAQGLTKRVKWARNIFDSVKLLGEEHVIDPL
                     DPVRIWQIGAMMTYGTQQDMGVGEQVIKLGDYSRDLMDQLSFIDSTSVDKFSWIQWEF
                     SRLLLSLSSAHPPSPSQLSKTLHHLLHRITSTLDTLHSLTSQSTIHATRASALGREVW
                     LKLQSLQRDHQMELDEAPAWSRGALGEAVSRGKRALVGGPLSRGEIMKRDLMVTQETI
                     RTISSLVRALENTRRTIMGFRDQIGMFDASMMGFHLAAGAEEEEGGLGLGPEEELRIL
                     GEVINGFGTAVGQEKLRWEIGDVYRGGTEFLEIAK"
     gene            1396931..1404592
                     /locus_tag="CNA05290"
                     /db_xref="GeneID:3253311"
     mRNA            join(1396931..1397189,1397246..1397444,1397502..1398625,
                     1398683..1399254,1399304..1399400,1399449..1399774,
                     1399822..1399922,1399981..1400518,1400572..1400676,
                     1400714..1400916,1400964..1401156,1401211..1401357,
                     1401409..1401546,1401601..1401729,1401783..1401995,
                     1402046..1402430,1402481..1402817,1402872..1403007,
                     1403064..1403363,1403416..1403723,1403773..1403920,
                     1403992..1404592)
                     /locus_tag="CNA05290"
                     /product="IDN3-B, putative"
                     /transcript_id="XM_024656302.1"
                     /db_xref="GeneID:3253311"
     CDS             join(1397027..1397189,1397246..1397444,1397502..1398625,
                     1398683..1399254,1399304..1399400,1399449..1399774,