GenomeNet

Database: RefSeq
Entry: NC_006670
LinkDB: NC_006670
Original site: NC_006670 
LOCUS       NC_006670            2300533 bp    DNA     linear   PLN 14-AUG-2010
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 1,
            complete sequence.
ACCESSION   NC_006670
VERSION     NC_006670.1  GI:58271746
DBLINK      Project: 10698
            BioProject: PRJNA10698
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella;
            Filobasidiella/Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 2300533)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 2300533)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2300533)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AE017341.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2300533
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /variety="neoformans"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="1"
                     /note="MAT-alpha"
     repeat_region   977..1101
                     /rpt_type=tandem
                     /rpt_unit_seq="cgagt"
                     /satellite="microsatellite"
     gene            <4713..>6181
                     /locus_tag="CNA00010"
                     /db_xref="GeneID:3253454"
     mRNA            join(<4713..5053,5090..5174,5258..5377,5453..5560,
                     5646..5768,5914..6055,6087..>6181)
                     /locus_tag="CNA00010"
                     /product="expressed protein"
                     /transcript_id="XM_567229.1"
                     /db_xref="GI:58259632"
                     /db_xref="GeneID:3253454"
     CDS             join(4713..5053,5090..5174,5258..5377,5453..5560,
                     5646..5768,5914..6055,6087..6181)
                     /locus_tag="CNA00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567229.1"
                     /db_xref="GI:58259633"
                     /db_xref="GeneID:3253454"
                     /translation="MRGSCERLVRSLSITATLRFSENAATMKPAEHSHRVVSQQCNNV
                     GQRAPPISSQKVNRLPCYEDPLVMKTYPLALDLWDSGSSVIIRSATGTRIASFPLDFI
                     SRGGDNSWSYVLRTGIIKDEHGRVLEPNESPSAGVFFFSQLAQTDVSFSSGPEYFSSI
                     KAPNPEGSISTRSDSKRSSVNQSRFYISLIARDGTCVVSGAHWESCTASHIVPASRPD
                     IYDCFYGDGGGLPMFRPSAGLLLRDDLHHAFDRLMFSFYQKARPNTTEKQFRPIGFVQ
                     HPVTCRIQCLSSGITANASKPGFEASPLTCCWPSQLKKLARLNKFRHLDLRLHGLNMH
                     STT"
     gene            complement(<6520..>8278)
                     /locus_tag="CNA00020"
                     /db_xref="GeneID:3253645"
     mRNA            complement(join(<6520..6730,6792..7128,7437..7501,
                     7562..7678,7748..7804,8103..>8278))
                     /locus_tag="CNA00020"
                     /product="expressed protein"
                     /transcript_id="XM_566435.1"
                     /db_xref="GI:58258044"
                     /db_xref="GeneID:3253645"
     CDS             complement(join(6520..6730,6792..7128,7437..7501,
                     7562..7678,7748..7804,8103..8278))
                     /locus_tag="CNA00020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566435.1"
                     /db_xref="GI:58258045"
                     /db_xref="GeneID:3253645"
                     /translation="MSPAIPPFDSLPIDKSGPPYNAWGLYGSEDELGRLHLITQEAVK
                     RGRDTITEGISINLNLPMNFFPAHPSRKRLERQIVCSGHSNDDELSFNTQSSTQWDGL
                     KHYPYQHFPEEGQYRFYNGMTLEEASDSSITKLGIHNFAQKPITSCAHLLDIPLYLSR
                     HSLPPLSPFSASSTISLDILIACAEESKVNIQPGDILIVRTGFTDELLKLSEETRDQL
                     RKREVNGSCGVAHGKEILKWHWEKGIAAVVADCPSYEAWPSQQLTAHQVFISGWGLPI
                     GELFDLAELAKKCEEIRRWTFFFTSMPLNVIGGIASPPNAQAIL"
     gene            9106..12963
                     /locus_tag="CNA00030"
                     /db_xref="GeneID:3253928"
     mRNA            join(9106..10557,10662..11183,11270..11936,11995..12174,
                     12324..12963)
                     /locus_tag="CNA00030"
                     /product="cation transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41559262|gb|CF705103.1,gi|41559267|gb|CF705108.1"
                     /transcript_id="XM_566436.1"
                     /db_xref="GI:58258046"
                     /db_xref="GeneID:3253928"
     CDS             join(9208..10557,10662..11183,11270..11936,11995..12174,
                     12324..12574)
                     /locus_tag="CNA00030"
                     /codon_start=1
                     /product="cation transporter"
                     /protein_id="XP_566436.1"
                     /db_xref="GI:58258047"
                     /db_xref="GeneID:3253928"
                     /translation="MPNSSTQTVVAIDYAQTPSRHLHSDTHQIPNSRPSPILTHHTPA
                     RIAQPEFAELLTPLKFRRRKLQPRPDQQPTSLPLVAGPSRLGYYTLEGDLYRGSAYDP
                     TQPPPANATAQVDDDAISLETGSTTSSTSNWSWGSGNFDRAMAVIGRVGEALGVRRGS
                     AGSSSSDSSAGSSDMESLKSQATAPRKGRKRRGSFMSGLSRQASRGGAEGVKAKHKRE
                     QLPKRRQFTLLVPPPALPSGDVDIGIPSTIDPHVFAETEKLPGDRKGDKNYPPDRVIT
                     TPSLPTVLDKIQSVRLSSGYSGIPSSVGNTPPQTPGAFPSSPTPNFASRVPVRRGGSA
                     PGRSRKSAGFVNPPVPLLPQTQSRLQCRSQSAASSRTATQSRLHTLRGAAESLSPIRP
                     KSVSDLLGLKFDAESMKEGTALMESKVGLELKGKSKSKGCWWLDVSCPTWEDLREIGE
                     LLSLHPLTLEDVLQQDPREKLERFDKLGYYFLVIRALDENYFKYTPGSSISSPSVQSG
                     NSNGKGGDTQTPKSTPSEKELIDEKEGLSQGMDDRSGNNRNEDGNEQRQDIEGLEYKK
                     SERRRRGWGMGRAQGKMTGKMGEKVEIIEDRPGKEGLEGVGVGAVNVYLVVFADGIIS
                     FHFDDISKHTNRVLDRVLTLANPDHGADWIAHGLLDSIVDAFFPIIRYVDGAIDDIDS
                     LTIDPTTDPKKTTAYLGLGLGNVMAGTDEDGSERFKQGGLGNGNEGKRDGLWRTPDHS
                     ATQHISVRKRLRASFPHFYPPPRVLRTFTYLRLFLLPTSSAVKRKHDQAPKTVFGRST
                     MLKNMTDMRKLVTGLTRLLSAKGTVIGRLRKRAKEEGGTVEAYIGDVEDHILLLQNSL
                     YHYEYILSHCQPAYLSHLNVSYAFTKGRTDQAILALSVVAISILPMQFITGLFSINVH
                     VPHNGWIHCPTDTLCEPDGSMSPFNYFAAIVIGIALVACCMVSVIRWWRWDARKKFGR
                     LRGIELPNAWDGFWGWE"
     misc_feature    12236..12291
                     /locus_tag="CNA00030"
                     /note="CT-rich"
     misc_feature    13027..13153
                     /note="GA-rich"
     gene            complement(14301..>15931)
                     /locus_tag="CNA00040"
                     /db_xref="GeneID:3253494"
     mRNA            complement(join(14301..14537,14599..14647,14705..14949,
                     15008..15078,15178..15220,15383..>15931))
                     /locus_tag="CNA00040"
                     /product="calcium-binding protein, putative"
                     /transcript_id="XM_566437.1"
                     /db_xref="GI:58258048"
                     /db_xref="GeneID:3253494"
     CDS             complement(join(14508..14537,14599..14647,14705..14949,
                     15008..15078,15178..15220,15383..15931))
                     /locus_tag="CNA00040"
                     /codon_start=1
                     /product="calcium-binding protein"
                     /protein_id="XP_566437.1"
                     /db_xref="GI:58258049"
                     /db_xref="GeneID:3253494"
                     /translation="MPQYISAPNPYGSVSAEARRRYEERYAKKRAEEAAKARAEAEAA
                     NQPEQPLQPVQQQQSPAPPPTLQPGYNQQYTNGSSQQHPGHPHQPQQAYSGPQHLHQN
                     YARTPQQVTQNDPSVQPQAYHLAQSSTPPQQQQQQQWNNPTPQAQGLALGHPSQSQLP
                     FQQQQPEQHPQQQQQWQQAHQHSDARMEAREDAVKMVNIFDTDRSGSINFQEFEGLYR
                     YIQDWHGIFRRFDRDNSGLIDRLELSNALQGFGFSLPPELVAKLVKRFTPPSTLGQTV
                     AARPGISFDRFLLACVTVKHYTEAFRRLDPENTGFITVAYNDYMDIVLDAPS"
     gene            <16393..>20462
                     /locus_tag="CNA00050"
                     /db_xref="GeneID:3253550"
     mRNA            join(<16393..16489,16700..16970,17009..17166,17205..17405,
                     17444..18135,18186..18336,18409..18534,18594..18723,
                     18775..19000,19079..19184,19242..19351,19407..20126,
                     20196..>20462)
                     /locus_tag="CNA00050"
                     /product="cell cycle arrest in response to
                     pheromone-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542629|gb|CF688470.1,gi|41542638|gb|CF688479.1"
                     /transcript_id="XM_566438.1"
                     /db_xref="GI:58258050"
                     /db_xref="GeneID:3253550"
     CDS             join(16393..16489,16700..16970,17009..17166,17205..17405,
                     17444..18135,18186..18336,18409..18534,18594..18723,
                     18775..19000,19079..19184,19242..19351,19407..20126,
                     20196..20462)
                     /locus_tag="CNA00050"
                     /codon_start=1
                     /product="cell cycle arrest in response to
                     pheromone-related protein"
                     /protein_id="XP_566438.1"
                     /db_xref="GI:58258051"
                     /db_xref="GeneID:3253550"
                     /translation="MIMKRDGQEDGLLSGLPGGTFRSPMQEKKQKVAVIDWTEAPLSS
                     RKAYIEVQLEQFESPNQHTRRLAQGRLLYLLQGCFEETTSPEMQLHWVIENAKAVRAV
                     DGVATIVYGLRDAARRYSISADDKPAPGSLPAGTVPAQVDPYDDHSAELMDLLAMLYF
                     IVEVLRTDDTFGDELMAMSPPLPLALFQMVSTLRDKIPKGYPVKKVLLLLWKTLLACL
                     GGMKEVQQAMALSREQAGLDPNTKYFTKASPIDIASWHRDTATKYPTFAPPRCSAHPI
                     PSEKLAESTRPIPPRPNYHSTEMPPAPPRPQPQPSAPATNNPSLPMPGTPAPSPPPSP
                     APPKKKQQFQTDPSRPFVFPYSRSSAAVPSSLVPFAISEADKLYHQHEYVSLGLLQMW
                     QVREDYIREERGLGKSGLIGFTNGYDGEEEEDAEEVEAMMREWKYEQEEMDCEERGDR
                     EGVKKAREKRMAAKRLRRVDIIHKNTLPILHSCVIALLKLLLATVTSPSTGGGVNLQN
                     ANMPPGLHSPTQEMPPSDKPNAPPPTQEEIDIARHREITSKAVSAILILLLKWFKASH
                     VLKFHLLTQLLFDSNCLLLLLKMFGLTDISQVVTAHNEVESLNFFNYCYLECGRQRPN
                     DAADLRPSRHPSGPLPENAELSNDYSWRNFFSTINFLKVLQKVTKHRSHRTYVMSSYK
                     SWQILKRMLKVNQPMLQLQVLKLIKSQMPWCGRKWRQAAGNMKVITSIYLNCRPELRD
                     DWLAGTDQDTELEDAVPQDTALRTLVQFYNLRHYIPPAPLSPDVSHRRTSSFNPLYED
                     PVLQTQHPQFGHRARSDSTSGTSSESDVFPPRKSSSNNPASLPYNPDEMIEFWLHEYE
                     DVLVEVFGVEGGNEVLDEFGLSSEIAGLSFTSKSPSGVSDGEDIQTPGPGNTDSRAWN
                     RLSEIMRRGDEEEISDSESVVSVGELGSAARLGGQGADAVNDEEGISEDGEGLEESVP
                     EGEKSRVGMGKGRRRSGAGENTWEHISPTLALLPRTPAERRRSSSSSTGSPLRPVVPT
                     VNSTINLGSLEGPDEVFEDEEIDTRGPMPIKMDTKDHEEREGGAVDEVEYTYGE"
     gene            complement(20600..22794)
                     /locus_tag="CNA00060"
                     /db_xref="GeneID:3254020"
     mRNA            complement(join(20600..20944,21003..21483,21547..21799,
                     21849..22077,22129..22215,22266..22459,22517..22794))
                     /locus_tag="CNA00060"
                     /product="methionine-tRNA ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537453|gb|CF683294.1,gi|41537459|gb|CF683300.1,
                     gi|41538152|gb|CF683993.1,gi|41538160|gb|CF684001.1,
                     gi|41545541|gb|CF691382.1,gi|41545547|gb|CF691388.1,
                     gi|41548459|gb|CF694300.1,gi|41548475|gb|CF694316.1,
                     gi|41554382|gb|CF700223.1,gi|41554393|gb|CF700234.1,
                     gi|41560906|gb|CF706747.1,gi|41560913|gb|CF706754.1,
                     gi|41566883|gb|CF712724.1,gi|41566887|gb|CF712728.1"
                     /transcript_id="XM_566439.1"
                     /db_xref="GI:58258052"
                     /db_xref="GeneID:3254020"
     CDS             complement(join(20633..20944,21003..21483,21547..21799,
                     21849..22077,22129..22215,22266..22459,22517..22709))
                     /locus_tag="CNA00060"
                     /codon_start=1
                     /product="methionine-tRNA ligase"
                     /protein_id="XP_566439.1"
                     /db_xref="GI:58258053"
                     /db_xref="GeneID:3254020"
                     /translation="MVLRHLTRLSPCLRVSKSFAPISMRYSSSVPSNTPTTPSLFTPE
                     GDPANAKPFYVTTPIFYVNASPHVGHLHSLLLTDVLARFSRLRHPQRKVVFATGTDEH
                     GLKIQQAAKANGVGEQEFCDDVSQRFRKLAKLANASNTDFIRTTELRHVKAVEQFWNT
                     LVASGDIYKGTHSGWYSISDESFYAVSQVTKSPEDGKMIAIETGNEVIWEEETNWKFR
                     LGRHKKVLEKWLSQPESVHPNTVRLDLLRQLSSLEDLSVSRPSSRVKWAIPVPGDPEQ
                     SIYVWVDALINYITVLGYPDWEGKGESVGWPADVHVVGKDIIKFHALHWPSLLHSASL
                     PAPKRIIAHAHWTMSHTKMSKSRGNVVDPISAMTQWGEDGVRWYLMRVGGGLVDDADY
                     NPAEVEVHYRLLADQVGNLLSRISGAKVLKKAEREFDWGNEKTRDRGEDRDEELDGMM
                     ARMREEFEGKMEVFGVSQACAGVMDVVMATNKLFTSLAPWSPSTPSSVPALTYAYHAL
                     RLSAILLQPIIPAKAGEALDRLGVPAEERSWVDAEWPPSEEKVLRTEKMVERLKEASK
                     KWKGKGHLFPLPGKDA"
     gene            <22985..>24309
                     /locus_tag="CNA00070"
                     /db_xref="GeneID:3253998"
     mRNA            join(<22985..23186,23239..23321,23375..23464,23606..23661,
                     23727..24211,24269..>24309)
                     /locus_tag="CNA00070"
                     /product="proteolysis and peptidolysis-related protein,
                     putative"
                     /transcript_id="XM_566440.1"
                     /db_xref="GI:58258054"
                     /db_xref="GeneID:3253998"
     CDS             join(22985..23186,23239..23321,23375..23464,23606..23661,
                     23727..24211,24269..24309)
                     /locus_tag="CNA00070"
                     /codon_start=1
                     /product="proteolysis and peptidolysis-related protein"
                     /protein_id="XP_566440.1"
                     /db_xref="GI:58258055"
                     /db_xref="GeneID:3253998"
                     /translation="MNRQGAEAFAKLAQQLNRARMQASGGGGGGGRGGGQMPGGFKGF
                     MAGSGAIGTLVVGAIALNYSLFNVDGGHRAIKYSRLQGVKADIYPEGTHLVLPWFEHP
                     VIYDVRAKPRNIASLTGTKDLQMVNITCRVLSRPSVNDLPTIYRELGTDYDERVLPSI
                     VNEVLKSVVAQFNASQLITQREMVSRLVRENLTRRARRFNLILDDVSITHVAFSPEFT
                     HAVEAKQVAQQIAQRAAFLVDQAIQEKQSIIVKAQGEARSAELIGEAVKTNKGFLQLR
                     KLEAAREIAGTLAQSGNRVMLDAKSLLLDVTEDEVLNATLRK"
     misc_feature    27987..28010
                     /note="AT_rich"
     gene            28166..29480
                     /locus_tag="CNA00080"
                     /db_xref="GeneID:3253721"
     mRNA            join(28166..28891,28972..29480)
                     /locus_tag="CNA00080"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41564720|gb|CF710561.1,gi|41564732|gb|CF710573.1"
                     /transcript_id="XM_567247.1"
                     /db_xref="GI:58259668"
                     /db_xref="GeneID:3253721"
     CDS             join(28562..28891,28972..29277)
                     /locus_tag="CNA00080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567247.1"
                     /db_xref="GI:58259669"
                     /db_xref="GeneID:3253721"
                     /translation="MLNPRSLRFDTRQIDYTHHHHDYDYTLPKSTLISLIIGVGTFAV
                     TSILVVFSLRIYLRRRSLRRAQAMSGSGEDLREIMREYLDEGVKGNEGTKPEMWEVEM
                     KYEDEITQPLTLREPTSTRPHLAQPDISKAISIFIAFPAPYSSGPDDLPEIVLGTAIF
                     HQSTLSSTISRFSENEKTLSRNTSEEGSYVVKDKNTEKDGTNVVVQALEYV"
     gene            <30054..>30884
                     /locus_tag="CNA00090"
                     /db_xref="GeneID:3254004"
     mRNA            join(<30054..30174,30262..30289,30383..>30884)
                     /locus_tag="CNA00090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566441.1"
                     /db_xref="GI:58258056"
                     /db_xref="GeneID:3254004"
     CDS             join(30054..30174,30262..30289,30383..30884)
                     /locus_tag="CNA00090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566441.1"
                     /db_xref="GI:58258057"
                     /db_xref="GeneID:3254004"
                     /translation="MASTILPLELVDRCIGSPIWVLMKNEREFTGTLMGFDDYVNMVL
                     KDVKEYEVTASGITETDLGDTLLNGNNIAMVRTTTHLPSPLEIELCSWYGYYCTISRN
                     GMSAPFFLGRDCFPRRDFMLCVLWGREYWGRNADIFPSYPHSLYQVARDPRLRSYPSI
                     HLPTNTNTTNHKTPTTIMNIEMKMKVLRQRDNTGRKRSDVDVAGYRRQLWIEIGLG"
     gene            complement(31136..32790)
                     /locus_tag="CNA00100"
                     /db_xref="GeneID:3254003"
     mRNA            complement(31136..32790)
                     /locus_tag="CNA00100"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541325|gb|CF687166.1,gi|41541330|gb|CF687171.1"
                     /transcript_id="XM_567230.1"
                     /db_xref="GI:58259634"
                     /db_xref="GeneID:3254003"
     CDS             complement(31375..32730)
                     /locus_tag="CNA00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567230.1"
                     /db_xref="GI:58259635"
                     /db_xref="GeneID:3254003"
                     /translation="MENDAIEVDGRAGGLSHRHPYPQPNAHATYFPSSFSPTHPHPHY
                     PHSQTHNINDMYTTETLWDPPARPVRSVKRYRLSQPPLPPSGSGAVSASYQPYFQLYP
                     HSRPHQHPHEHELPHERRHEHTLERARPILANEYTRSPSPSLYTHFPEYKRDPHLRLG
                     ISLSVPTFAHMQSHSRGALPHAPELMDQERDGDEQRDREQRVRDSVTPFGVRVFAQER
                     ERGKEREEQRPISLVDLRQLDPSSSCPASVPSAPSSALSNFTSAPTSVSAPFPESATV
                     LISTSTANKNKSSSEWTSHHTRTARVGTGRFWKWDLFGRSSGSAGGERERERKKEDER
                     EREWEGEQRGYYHPYPTPKTSGEIEREADYNDHEHYDHTQNHVHTQNHVHTQNHVHTQ
                     NQNQKAKYVSRDIPFSLWTPPGQGAGQMGGREKGEDRDELQRAADGVELLALAAAKIQ
                     G"
     repeat_region   33516..33589
                     /rpt_type=tandem
                     /rpt_unit_seq="cat"
                     /satellite="microsatellite"
     gene            35851..38610
                     /locus_tag="CNA00110"
                     /db_xref="GeneID:3253976"
     mRNA            join(35851..36922,36974..37507,37572..37627,37684..38020,
                     38069..38217,38266..38610)
                     /locus_tag="CNA00110"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530289|gb|CF676130.1,gi|41537787|gb|CF683628.1,
                     gi|41537795|gb|CF683636.1,gi|41541034|gb|CF686875.1,
                     gi|41543525|gb|CF689366.1,gi|41556552|gb|CF702393.1,
                     gi|41556564|gb|CF702405.1,gi|41558523|gb|CF704364.1,
                     gi|41558526|gb|CF704367.1,gi|41569682|gb|CF715523.1,
                     gi|41569694|gb|CF715535.1,gi|41571148|gb|CF716989.1,
                     gi|41571158|gb|CF716999.1"
                     /transcript_id="XM_567248.1"
                     /db_xref="GI:58259670"
                     /db_xref="GeneID:3253976"
     CDS             join(35862..36922,36974..37507,37572..37627,37684..38020,
                     38069..38217,38266..38540)
                     /locus_tag="CNA00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567248.1"
                     /db_xref="GI:58259671"
                     /db_xref="GeneID:3253976"
                     /translation="MAGYDARYGNPLDPMSGGRPSPPETSQQDAYEYSKHGSSSGYLG
                     QLPLGADSAQAETASALRTLFGEGADVQALQEPPNQINTLAEGAAVAETGGVLGGDTT
                     RSDNEALAIDPSLSEQAAPAPKDSTETPDDRSRSPSSGNHHHHHPAVKRKATSRAGML
                     ARGGACEFCKRRKLKCSAELPACANCVKSGKECVYAQKKQRSRVKVLEDRLQELEKRL
                     EQGQAGAASASGGDSGAHAASSVYTAPSLGSGGGSELTVEQTLVHNVDPSLLPPSEYD
                     EAFILHDFDSFADMRKQETQLEPDLMTLADAAAADTPAAAAAETNDPWAKMSPEEIVK
                     EIIKVATGGKGEGERIISHLVQTYMNSTVNTWHPLVIPPMDLVSRVSRTTPDPIHPTL
                     LLSLIPALLPLSPIQSLRHPAIPLLLLPHARAHSVQAITQSDPRVLDTIIAGVSRAYS
                     FFNEAKNIDGWVDCVAATSLVRAAGLTKQGGVGERFVPEDRVPAERLAKRRREAGLRA
                     LMHKGAIVPPPESWYQFGQRVNLFWTSYICDRAAAIGWGWPSSYNDEDITTPWPKDDY
                     KSVQALLDDTTIHTFLSPLAPAPAPATPDSDLCAQAKSITLLYHAQRLLDSPPELSTP
                     EKTHRLLGLTEGYMESLEKMRGPRMRAGKLSSVWMILYTTIAVLHSKDGFDKCDPDGA
                     DQVSITRVVAAADKVLELVSAVQNTGDTHLSSCDVISSVLFLHLARLMIQYTNRLRLR
                     VQDSALVSTLRAKTESFKRALIDQGERLVFAQVAAQMLENYHVGAEWKAGEWERADGG
                     DWRGV"
     repeat_region   36780..36821
                     /rpt_type=tandem
                     /rpt_unit_seq="cgg"
                     /satellite="microsatellite"
     misc_feature    37787..37808
                     /locus_tag="CNA00110"
                     /note="GC_rich"
     gene            complement(<38569..>39025)
                     /locus_tag="CNA00120"
                     /db_xref="GeneID:3253809"
     mRNA            complement(join(<38569..38817,38864..>39025))
                     /locus_tag="CNA00120"
                     /product="chaperone, putative"
                     /transcript_id="XM_567077.1"
                     /db_xref="GI:58259328"
                     /db_xref="GeneID:3253809"
     CDS             complement(join(38569..38817,38864..39025))
                     /locus_tag="CNA00120"
                     /codon_start=1
                     /product="chaperone"
                     /protein_id="XP_567077.1"
                     /db_xref="GI:58259329"
                     /db_xref="GeneID:3253809"
                     /translation="MDFSQFNGAEQAHMSKVIEKKQMQDFMRLYSGLVEKCFNACAQD
                     FTSKALTTNETTCVQNCTDKFLKHSERVGARFAEHNAGMLSPYGAASLMASQSKCRAP
                     DSNGLGVFCKWRRIKSTVVLYNHLACIKQMDNRF"
     gene            39158..42819
                     /locus_tag="CNA00130"
                     /db_xref="GeneID:3253994"
     mRNA            join(39158..39987,40112..40517,40602..40935,40989..41137,
                     41197..41427,41557..41629,41698..42298,42369..42537,
                     42588..42819)
                     /locus_tag="CNA00130"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41570449|gb|CF716290.1,gi|41570453|gb|CF716294.1,
                     gi|41572007|gb|CF717848.1,gi|41572014|gb|CF717855.1"
                     /transcript_id="XM_566442.1"
                     /db_xref="GI:58258058"
                     /db_xref="GeneID:3253994"
     CDS             join(39176..39987,40112..40517,40602..40935,40989..41137,
                     41197..41427,41557..41629,41698..42298,42369..42537,
                     42588..42770)
                     /locus_tag="CNA00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566442.1"
                     /db_xref="GI:58258059"
                     /db_xref="GeneID:3253994"
                     /translation="MFKSLPQAIGLPFLSPAEDAQLKFKSSPAGIQRLAGPERIPPAD
                     TAYWAQWYSLFPSPHDVPPIVRPPDLRHALQHNPANLATLTTHLAHRLFTLVPDPRFP
                     PAPDLCAHALSCLRVLGTVLAVVYEAEGDTPGDSFAATHLWARQKAPASSHSDTQFTL
                     ADSDDDDAELDAGARAFKATLGHPPAPASPISDPLTQPPDDTPRPQQPDEYLPSLAER
                     LFSCAIDLLFCAGFTLPQSVNGEDEDDKINACLVCQHSEQADSFRSTSSGKRGLPPHP
                     PLLPALHTPLGPAHHPQPPAVHPHPHPRTPARPFPPLLVPQHLPHPGPIVLGRRRDRH
                     SRRARQARRVRRLGAQGRRGAKGAGEGLYGRPARRARLQDGGKSRPCRSARRRVCRNG
                     DERDRDGRRKGGKRHRKEDFTFILDGILATLAEYHTSLTNGYLPGGVGVGKKDIGCLL
                     QTCTSLRRPPVPLLSPQKTKIVRTDILLWRLVDLNKRFKAHLLEQPGKTVDLVVYILV
                     TCLELKDDPAQNGLLRLLSYLLQTLSANEPFGKSLNQTIRIPVPARWGVTGSAVDFMI
                     VSIYSIATTPGLNPLFPALTISIANISPYITNIGVQASARLLGLFKAFSAPNFLLGDE
                     GHPRLVYYLQVVFLFPPVVDTLATFTLMSGLRDIKRRKFLRAAAAEKNGRPGSAATTN
                     PSSTNSLFTRLGGGGGGGGRDNGITSDAEMIAEKAALLGLEPEEEDDVHLSGSQSQGQ
                     GEGQGQGQGHASTPSEGDVPSLSTTPTPTPNTTTATATPDYASNPPPPSRSMSEKARG
                     KMRATESTTSLATTNTHPGGGGGGGGGGGGGQEERVEDDEEEEELMKIAAAGVGPNGY
                     VPTQEWVSSWQKGLPLDPVLVAISELLPKIRETQPLVGAPSEKVFNILKDVELADVLP
                     PAPPITPRRFQWSPASCIWLTSLLWGDIYVAGLTSIGSWKDTQVRLFGIKQAPVRGRG
                     AQVGRVLKMMGVV"
     misc_feature    39367..39544
                     /locus_tag="CNA00130"
                     /note="C-rich"
     repeat_region   40949..40982
                     /rpt_type=tandem
                     /rpt_unit_seq="ctca"
                     /satellite="microsatellite"
     repeat_region   42140..42178
                     /rpt_type=tandem
                     /rpt_unit_seq="cgg"
                     /satellite="microsatellite"
     misc_feature    42181..42228
                     /locus_tag="CNA00130"
                     /note="GA-rich"
     gene            complement(<43545..45210)
                     /locus_tag="CNA00140"
                     /db_xref="GeneID:3253834"
     mRNA            complement(join(<43545..44401,44490..44716,44784..45210))
                     /locus_tag="CNA00140"
                     /product="adenosylmethionine decarboxylase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539209|gb|CF685050.1,gi|41541378|gb|CF687219.1,
                     gi|41555773|gb|CF701614.1,gi|41561925|gb|CF707766.1,
                     gi|41567540|gb|CF713381.1,gi|41568653|gb|CF714494.1"
                     /transcript_id="XM_566443.1"
                     /db_xref="GI:58258060"
                     /db_xref="GeneID:3253834"
     CDS             complement(join(43545..44401,44490..44716,44784..45082))
                     /locus_tag="CNA00140"
                     /codon_start=1
                     /product="adenosylmethionine decarboxylase"
                     /protein_id="XP_566443.1"
                     /db_xref="GI:58258061"
                     /db_xref="GeneID:3253834"
                     /translation="MTAELTPSIEEQALTSPGPFEGPEKLLEVWFAPSIEELPSAEEV
                     EGKVAGGLNARPAKENGEWQGLRKVPREVWEEMLDIVKCKVLSMVEGDDLDAYLLSES
                     SLFVAPHVLILKTCGTTLNLLGLYRIIEIAREYCGFNNVWRCFYSRKSFFFPERQQGP
                     HRDWRDEVQFLDSVFGTAGAAYTVGPMNRDHWLLYLTTPNSQPILPSDPKPCTLSLPA
                     PSPSSSIPTFSSSSTVTYQDTTLEILMTHLSPSARAPFFHDSDSFSSPSTTPGHVLGE
                     AISHKLGIDALFSKDETTLDSFGFDPCGYSANAVIGSGLPVSGKGGKEGGGYFTIHVT
                     PEEGWSYASFECNVPLPFSSSSSPGALAKRPDLQTLIRNVVNIFQPSRLSITLFVSTP
                     PSSSGPGSSEAEVKAWNSFGTDLLGNEFVRKDRIGYEFDGYDLVFACFEKKGWVESQL
                     ALGSETKKSL"
     gene            complement(<45806..>46776)
                     /locus_tag="CNA00150"
                     /db_xref="GeneID:3253729"
     mRNA            complement(join(<45806..45995,46151..>46776))
                     /locus_tag="CNA00150"
                     /product="holocytochrome-c synthase, putative"
                     /transcript_id="XM_566444.1"
                     /db_xref="GI:58258062"
                     /db_xref="GeneID:3253729"
     CDS             complement(join(45806..45995,46151..46776))
                     /locus_tag="CNA00150"
                     /codon_start=1
                     /product="holocytochrome-c synthase"
                     /protein_id="XP_566444.1"
                     /db_xref="GI:58258063"
                     /db_xref="GeneID:3253729"
                     /translation="MWPFSSSAAPSTAPAQAQQHPSAAASADQCPVDHTTRQAWLANN
                     PSTPHPFHPPTSEGSSSSASAGLSQSRVISSIPRGSTPSSPSPAPPASASASASAAAG
                     PSSGPSSFTADAGSGHAQPQQDANGNWVYPSEQQFFNAMLRKKHNPHPQDMRTIVPIH
                     NAVNEKAWEEILKWECHWPSERCGGPRLVSFVGRPKERTPKAWVKTALGYTPPFDRHD
                     WIVDRCGTHVRYVIDFYTGRQTEGPGKMAFYLDVRPAVDDWEGIKTRVKGWWS"
     misc_feature    46474..46533
                     /note="GA-rich"
     gene            complement(<47087..>48272)
                     /locus_tag="CNA00160"
                     /db_xref="GeneID:3253756"
     mRNA            complement(join(<47087..47255,47320..47519,47589..>48272))
                     /locus_tag="CNA00160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566445.1"
                     /db_xref="GI:58258064"
                     /db_xref="GeneID:3253756"
     CDS             complement(join(47087..47255,47320..47519,47589..48272))
                     /locus_tag="CNA00160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566445.1"
                     /db_xref="GI:58258065"
                     /db_xref="GeneID:3253756"
                     /translation="MLTRTPQPPPSTNTHARATQPRSSKIFNTPDSDIVPSILYVDSS
                     STSSSHPTRGRTYSRTYEWYEAYQAEREKRRGSKGSTKSTSSGGSARGRRSDELEVVD
                     PQTISLHHTLPSVEDEIKISSAPILYLPPLLSPLPEHGHEHDHNHDNHHDYEHSQVEV
                     REVIGLDDSRQTLSESNEQVDPLRDFTTRLPHIDPASLALHQTLHHFKPLSNAYASLP
                     YDKAFNWSSLNLPKSTEREWYCVVFRSRRKPESANLSLYKADREAHEEAVKNGGLIMY
                     WYGVPDETGLNLATCIWQSRRHAIKAISGPKHISAMKQTKGAYETYSLERWVLSTEVG
                     NREVKLRKWEGGEVGW"
     gene            50135..54254
                     /locus_tag="CNA00170"
                     /db_xref="GeneID:3253713"
     mRNA            join(50135..50304,50482..51090,51238..52229,52283..54254)
                     /locus_tag="CNA00170"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531742|gb|CF677583.1,gi|41534243|gb|CF680084.1,
                     gi|41537688|gb|CF683529.1,gi|41549483|gb|CF695324.1,
                     gi|41549735|gb|CF695576.1,gi|41555408|gb|CF701249.1,
                     gi|41558676|gb|CF704517.1,gi|41564775|gb|CF710616.1,
                     gi|41570385|gb|CF716226.1,gi|41570987|gb|CF716828.1,
                     gi|41570993|gb|CF716834.1,gi|41571364|gb|CF717205.1"
                     /transcript_id="XM_566446.1"
                     /db_xref="GI:58258066"
                     /db_xref="GeneID:3253713"
     mRNA            join(50135..50304,50482..51090,51238..52229,52283..53335,
                     53392..54254)
                     /locus_tag="CNA00170"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531742|gb|CF677583.1,gi|41531749|gb|CF677590.1,
                     gi|41534243|gb|CF680084.1,gi|41537688|gb|CF683529.1,
                     gi|41537696|gb|CF683537.1,gi|41541961|gb|CF687802.1,
                     gi|41541963|gb|CF687804.1,gi|41544531|gb|CF690372.1,
                     gi|41544588|gb|CF690429.1,gi|41549483|gb|CF695324.1,
                     gi|41549489|gb|CF695330.1,gi|41549703|gb|CF695544.1,
                     gi|41549735|gb|CF695576.1,gi|41549743|gb|CF695584.1,
                     gi|41552396|gb|CF698237.1,gi|41555408|gb|CF701249.1,
                     gi|41555416|gb|CF701257.1,gi|41558420|gb|CF704261.1,
                     gi|41558676|gb|CF704517.1,gi|41558684|gb|CF704525.1,
                     gi|41564775|gb|CF710616.1,gi|41564834|gb|CF710675.1,
                     gi|41570385|gb|CF716226.1,gi|41571364|gb|CF717205.1,
                     gi|41571367|gb|CF717208.1"
                     /transcript_id="XM_566448.1"
                     /db_xref="GI:58258070"
                     /db_xref="GeneID:3253713"
     mRNA            join(50135..50304,50482..51090,51238..52229,52283..53314,
                     53392..54254)
                     /locus_tag="CNA00170"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531742|gb|CF677583.1,gi|41534243|gb|CF680084.1,
                     gi|41537688|gb|CF683529.1,gi|41544517|gb|CF690358.1,
                     gi|41549483|gb|CF695324.1,gi|41549735|gb|CF695576.1,
                     gi|41555408|gb|CF701249.1,gi|41558676|gb|CF704517.1,
                     gi|41564775|gb|CF710616.1,gi|41570385|gb|CF716226.1,
                     gi|41571364|gb|CF717205.1"
                     /transcript_id="XM_566447.1"
                     /db_xref="GI:58258068"
                     /db_xref="GeneID:3253713"
     CDS             join(50923..51090,51238..52229,52283..53314,53392..53449)
                     /locus_tag="CNA00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566447.1"
                     /db_xref="GI:58258069"
                     /db_xref="GeneID:3253713"
                     /translation="MPYMYERPVGQQIKQRREEEARGRTEMELFKLLNGEQAGEVATF
                     GNEAPADGMEVDNALYGGHQPSSINDRLLPAGFDTTNYSSNADWMYDAEARAAAEYSK
                     QVAAQQAAIGTQQSKAYLFEREFPDPVNYHAQRSVWSPPRAEVPTWSNYEPAYRAPAV
                     PARYVQLPERPITPHDTYRYPASHAEHIYVAPPAPVEPSADAINGAFAFWYAQQVIHL
                     LIVPGQFRAGTGGASDEEWGPAGREKDSYMRVGVLPPDYSRNWGRMGMTTPPSAPLAH
                     QLSARRPEYEVRDPWNVAWAHSVKPTATFVSFILDMIQRMTISPSALVAGIWFLAGLG
                     LHEGDGVKGTKLRQFLREQVSCEPEAVEKRVAMLGLILAGKWLDDNSFLTKSWTEVTS
                     VPISQIDAMERLALADFNFSLYVPVPSWVDHVNKLFTALDLKRHRDEVDSIIHPILDR
                     MAKEAHEVELTDPAAHAVQTYSKPVIDCRSSSDEIPAAADQATSRDWVSFASSYAHDQ
                     KLANSRWSARGSEDDVELERAERNVEMLLNDEDMDEVEQEVLEQDEDEEEFLEYDGAK
                     KWLPTASEMRRSTSGTDAREQKAFALQAPRQDSRVQVSAPTQVPVTSFVRARSTTPTA
                     SQTFAGRPRAHGDWNAPTAANKRWHHAHNPFGFPVYLDPSCCQKIERKRTPINRHSSS
                     YRPGYPSYAHTAVGAQIEPGMSIMREPASAVSEFGFMGGGGASMCGPKRSRRFDAAHP
                     YSSFAAAGH"
     CDS             join(50923..51090,51238..52229,52283..53335,53392)
                     /locus_tag="CNA00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566448.1"
                     /db_xref="GI:58258071"
                     /db_xref="GeneID:3253713"
                     /translation="MPYMYERPVGQQIKQRREEEARGRTEMELFKLLNGEQAGEVATF
                     GNEAPADGMEVDNALYGGHQPSSINDRLLPAGFDTTNYSSNADWMYDAEARAAAEYSK
                     QVAAQQAAIGTQQSKAYLFEREFPDPVNYHAQRSVWSPPRAEVPTWSNYEPAYRAPAV
                     PARYVQLPERPITPHDTYRYPASHAEHIYVAPPAPVEPSADAINGAFAFWYAQQVIHL
                     LIVPGQFRAGTGGASDEEWGPAGREKDSYMRVGVLPPDYSRNWGRMGMTTPPSAPLAH
                     QLSARRPEYEVRDPWNVAWAHSVKPTATFVSFILDMIQRMTISPSALVAGIWFLAGLG
                     LHEGDGVKGTKLRQFLREQVSCEPEAVEKRVAMLGLILAGKWLDDNSFLTKSWTEVTS
                     VPISQIDAMERLALADFNFSLYVPVPSWVDHVNKLFTALDLKRHRDEVDSIIHPILDR
                     MAKEAHEVELTDPAAHAVQTYSKPVIDCRSSSDEIPAAADQATSRDWVSFASSYAHDQ
                     KLANSRWSARGSEDDVELERAERNVEMLLNDEDMDEVEQEVLEQDEDEEEFLEYDGAK
                     KWLPTASEMRRSTSGTDAREQKAFALQAPRQDSRVQVSAPTQVPVTSFVRARSTTPTA
                     SQTFAGRPRAHGDWNAPTAANKRWHHAHNPFGFPVYLDPSCCQKIERKRTPINRHSSS
                     YRPGYPSYAHTAVGAQIEPGMSIMREPASAVSEFGFMGGGGASMCGPKRWATAAR"
     CDS             join(50923..51090,51238..52229,52283..53339)
                     /locus_tag="CNA00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566446.1"
                     /db_xref="GI:58258067"
                     /db_xref="GeneID:3253713"
                     /translation="MPYMYERPVGQQIKQRREEEARGRTEMELFKLLNGEQAGEVATF
                     GNEAPADGMEVDNALYGGHQPSSINDRLLPAGFDTTNYSSNADWMYDAEARAAAEYSK
                     QVAAQQAAIGTQQSKAYLFEREFPDPVNYHAQRSVWSPPRAEVPTWSNYEPAYRAPAV
                     PARYVQLPERPITPHDTYRYPASHAEHIYVAPPAPVEPSADAINGAFAFWYAQQVIHL
                     LIVPGQFRAGTGGASDEEWGPAGREKDSYMRVGVLPPDYSRNWGRMGMTTPPSAPLAH
                     QLSARRPEYEVRDPWNVAWAHSVKPTATFVSFILDMIQRMTISPSALVAGIWFLAGLG
                     LHEGDGVKGTKLRQFLREQVSCEPEAVEKRVAMLGLILAGKWLDDNSFLTKSWTEVTS
                     VPISQIDAMERLALADFNFSLYVPVPSWVDHVNKLFTALDLKRHRDEVDSIIHPILDR
                     MAKEAHEVELTDPAAHAVQTYSKPVIDCRSSSDEIPAAADQATSRDWVSFASSYAHDQ
                     KLANSRWSARGSEDDVELERAERNVEMLLNDEDMDEVEQEVLEQDEDEEEFLEYDGAK
                     KWLPTASEMRRSTSGTDAREQKAFALQAPRQDSRVQVSAPTQVPVTSFVRARSTTPTA
                     SQTFAGRPRAHGDWNAPTAANKRWHHAHNPFGFPVYLDPSCCQKIERKRTPINRHSSS
                     YRPGYPSYAHTAVGAQIEPGMSIMREPASAVSEFGFMGGGGASMCGPKRWATAARW"
     gene            complement(54488..57199)
                     /locus_tag="CNA00180"
                     /db_xref="GeneID:3253522"
     mRNA            complement(join(54488..54792,54857..54923,54995..55064,
                     55163..55256,55316..55393,55463..55591,55646..55951,
                     56007..56348,56395..56644,56697..57199))
                     /locus_tag="CNA00180"
                     /product="calcium ion transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538162|gb|CF684003.1,gi|41538310|gb|CF684151.1,
                     gi|41544968|gb|CF690809.1,gi|41550923|gb|CF696764.1"
                     /transcript_id="XM_566449.1"
                     /db_xref="GI:58258072"
                     /db_xref="GeneID:3253522"
     mRNA            complement(join(54488..54792,54857..54923,54995..55064,
                     55163..55256,55316..55393,55463..55591,55646..55951,
                     56007..56348,56395..56644,56697..57090,57166..57192))
                     /locus_tag="CNA00180"
                     /product="calcium ion transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538155|gb|CF683996.1,gi|41538297|gb|CF684138.1,
                     gi|41541084|gb|CF686925.1,gi|41544962|gb|CF690803.1,
                     gi|41566874|gb|CF712715.1"
                     /transcript_id="XM_566450.1"
                     /db_xref="GI:58258074"
                     /db_xref="GeneID:3253522"
     CDS             complement(join(54736..54792,54857..54923,54995..55064,
                     55163..55256,55316..55393,55463..55591,55646..55951,
                     56007..56348,56395..56644,56697..57090,57166..57178))
                     /locus_tag="CNA00180"
                     /codon_start=1
                     /product="calcium ion transporter"
                     /protein_id="XP_566450.1"
                     /db_xref="GI:58258075"
                     /db_xref="GeneID:3253522"
                     /translation="MFHQNTQEDPPVSDSPLSSPKLPEYDPQSSSTTPIVSSNLPTDT
                     ANTASAGPRRRQQPSRQVTLDARPPSAARRGTTESARTQHSRAGSRRTSNSLDPNPGL
                     IRRVTTVLFTPPKKIGKAPTYWGSIKAAITSTWLNILLVFIPIGWALYLAKHSGGKDS
                     ISDTAVFCCTFIAIIPLAGLLGFATEEAALRLGQTLGGLLNATLGNAVELIVAILALI
                     KCELQVVQSSLVGSILSNILLVLGMCFFAGGVRFAEQAIKSTAAQLNASLLLIAVIAV
                     LIPSAFHFSISSSTSNTDASELANGEGADLLSMSHAVSILLLILYLGYLLFQMWTHAT
                     YYVDDAVTGSTQYPEAITNVSEKLKFRNFHRRKHDEEEGYSTATTVSEATVPPSARPG
                     GGEVPATHGPGTVASETGNRVEHESEEEEEEEETPQMNVVCTIALMVIDTVLVGVTAE
                     FLVDSINGMVESNPSLSAEWVGLILLPIVGNAAEHFTAVSVSVKDKLDLSISVAVGSS
                     IQIALFVIPVIELLAWTIGKPMTLLFDPYESIVLFLSVLIVNQTLADGRSNWMEGMVL
                     MMLYIIIAVSFWYYPGSTTATLLGCQDSSSVTG"
     CDS             complement(join(54736..54792,54857..54923,54995..55064,
                     55163..55256,55316..55393,55463..55591,55646..55951,
                     56007..56348,56395..56644,56697..57124))
                     /locus_tag="CNA00180"
                     /codon_start=1
                     /product="calcium ion transporter"
                     /protein_id="XP_566449.1"
                     /db_xref="GI:58258073"
                     /db_xref="GeneID:3253522"
                     /translation="MSLPRRVSFPPDTQEDPPVSDSPLSSPKLPEYDPQSSSTTPIVS
                     SNLPTDTANTASAGPRRRQQPSRQVTLDARPPSAARRGTTESARTQHSRAGSRRTSNS
                     LDPNPGLIRRVTTVLFTPPKKIGKAPTYWGSIKAAITSTWLNILLVFIPIGWALYLAK
                     HSGGKDSISDTAVFCCTFIAIIPLAGLLGFATEEAALRLGQTLGGLLNATLGNAVELI
                     VAILALIKCELQVVQSSLVGSILSNILLVLGMCFFAGGVRFAEQAIKSTAAQLNASLL
                     LIAVIAVLIPSAFHFSISSSTSNTDASELANGEGADLLSMSHAVSILLLILYLGYLLF
                     QMWTHATYYVDDAVTGSTQYPEAITNVSEKLKFRNFHRRKHDEEEGYSTATTVSEATV
                     PPSARPGGGEVPATHGPGTVASETGNRVEHESEEEEEEEETPQMNVVCTIALMVIDTV
                     LVGVTAEFLVDSINGMVESNPSLSAEWVGLILLPIVGNAAEHFTAVSVSVKDKLDLSI
                     SVAVGSSIQIALFVIPVIELLAWTIGKPMTLLFDPYESIVLFLSVLIVNQTLADGRSN
                     WMEGMVLMMLYIIIAVSFWYYPGSTTATLLGCQDSSSVTG"
     misc_feature    55114..55141
                     /note="T-rich"
     gene            complement(57717..59788)
                     /locus_tag="CNA00190"
                     /db_xref="GeneID:3253540"
     mRNA            complement(join(57717..57851,57906..57959,58013..58383,
                     58448..58903,58964..59220,59286..59479,59673..59788))
                     /locus_tag="CNA00190"
                     /product="aminotransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535457|gb|CF681298.1,gi|41535470|gb|CF681311.1,
                     gi|41545281|gb|CF691122.1,gi|41547436|gb|CF693277.1,
                     gi|41547443|gb|CF693284.1,gi|41553145|gb|CF698986.1,
                     gi|41553151|gb|CF698992.1,gi|41555868|gb|CF701709.1,
                     gi|41555875|gb|CF701716.1,gi|41556761|gb|CF702602.1,
                     gi|41564430|gb|CF710271.1,gi|41564445|gb|CF710286.1,
                     gi|41568797|gb|CF714638.1,gi|41571487|gb|CF717328.1"
                     /transcript_id="XM_566451.1"
                     /db_xref="GI:58258076"
                     /db_xref="GeneID:3253540"
     CDS             complement(join(57786..57851,57906..57959,58013..58383,
                     58448..58903,58964..59220,59286..59464))
                     /locus_tag="CNA00190"
                     /codon_start=1
                     /product="aminotransferase"
                     /protein_id="XP_566451.1"
                     /db_xref="GI:58258077"
                     /db_xref="GeneID:3253540"
                     /translation="MPRISVPAFAKTVSSRLNFTSTRTLLYTRRMSTTPNAVIPQAKR
                     MFDGATHKLDVWSIFTPANVPADCINLGQGFMNWAPPDWIRAESHESMDHDIMSNHYS
                     HPRGRPRLLKAISKHYSPQFENIVARGKDLTNEEILVTSGANCGMFAALTAHCEPGDE
                     VICIEPYFDQYFASIHFQGAKPVFVPLHPPTGKGIKHGGDWTLNIDEFAAAFTPKTKA
                     VIINTPHNPVGKVFTKEELEQIAKVCIEKNVLVLADEVYDCMVYDGNKHFRIATLPGM
                     WERTLTVGSGGKSFACTGWRVGWLIGPPQLTAATLAAHSRIVFCTNSPMQEAVAIGLE
                     KAAEHKFFEEQVAAYEERRDILCSYFDQIGLSYTKPEGSYFLLVDISPVKVPEGYPIV
                     ETCKGRGKDFEFCWWLCQELKVVGIPPSEFYSEEHVNIGERFARFAFCKDPELLHAAG
                     KRLLKLKEYL"
     gene            60467..63152
                     /locus_tag="CNA00200"
                     /db_xref="GeneID:3253542"
     mRNA            join(60467..60849,60908..61342,61393..62031,62082..62197,
                     62245..62275,62331..62601,62662..62745,63014..63130)
                     /locus_tag="CNA00200"
                     /product="transcriptional activator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537870|gb|CF683711.1,gi|41538749|gb|CF684590.1,
                     gi|41547533|gb|CF693374.1,gi|41574201|gb|CF720042.1"
                     /transcript_id="XM_566453.1"
                     /db_xref="GI:58258080"
                     /db_xref="GeneID:3253542"
     mRNA            join(60467..60849,60908..60982,61036..61342,61393..62031,
                     62082..62197,62245..62275,62331..62601,62662..62954,
                     63014..63096)
                     /locus_tag="CNA00200"
                     /product="transcriptional activator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41547526|gb|CF693367.1"
                     /transcript_id="XM_566452.1"
                     /db_xref="GI:58258078"
                     /db_xref="GeneID:3253542"
     mRNA            join(60489..60849,60908..60982,61036..61342,61393..62031,
                     62082..62197,62245..62275,62331..62601,62662..62950,
                     63014..>63152)
                     /locus_tag="CNA00200"
                     /product="transcriptional activator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538737|gb|CF684578.1,gi|41554923|gb|CF700764.1"
                     /transcript_id="XM_566455.1"
                     /db_xref="GI:58258084"
                     /db_xref="GeneID:3253542"
     mRNA            join(60489..60849,60908..60982,61036..61342,61393..62031,
                     62082..62197,62245..62275,62331..62601,62662..62745,
                     63014..63130)
                     /locus_tag="CNA00200"
                     /product="transcriptional activator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537870|gb|CF683711.1,gi|41537877|gb|CF683718.1,
                     gi|41547533|gb|CF693374.1,gi|41574201|gb|CF720042.1"
                     /transcript_id="XM_566454.1"
                     /db_xref="GI:58258082"
                     /db_xref="GeneID:3253542"
     CDS             join(60562..60849,60908..61342,61393..62031,62082..62197,
                     62245..62275,62331..62601,62662..62745,63014..63111)
                     /locus_tag="CNA00200"
                     /codon_start=1
                     /product="transcriptional activator"
                     /protein_id="XP_566453.1"
                     /db_xref="GI:58258081"
                     /db_xref="GeneID:3253542"
                     /translation="MSPQQRASSPDVLASPVTPGNVSTSTTNANSAATSSNNGAPQAV
                     SGSPANGNQTLSPGRKRRKVTRSRLGCLTCRKRRKLCDMAKPVCQACTRLKIQCSWPS
                     ESASKPPRSSSQRQSQTPAVSESPFVPPTDLDNMTHSISPYMSYGPTSTILPHSYTPS
                     QASAPSTAAAGPLSASNTLEDFTRIFGHIEEDRAGLQMNERNVRPYAIYSASAVPEVG
                     LPPELNTEAEVMDWLNGSCSLDESMLQLWAADCLAVPTTQTFNAFDSLNNLLQPTPPS
                     QDHVDASHPAPSHGPSDPQPPQPISRPESGRQSPSHFHSPSRRSDRGTPTSQPQTALL
                     HYFHDSLARLVSCTGDASSNAFEAFTKLSNMAAGQGSAGQGLHLSILAWAARHAVNRG
                     LVKYEAASEKFSSQSATLVNNRMRDLFDGDGNERRSGAMPNHEKNREYMTLLASNLML
                     MQFKICRGDVWGFDTVVRHLTVLVPFVFRTEKDFQAESMHHQFFENVLYHDVLGSFIL
                     NRAPMVPSSLVSHYCSFNLEALNTLTGASLPLFSTMHRLAALVRQRRGRRGKGWSDED
                     LFDALQRAMELEKDLTDEKKRLDALLIAKPHVKPHRYLHEAFRLTCLIQLHHDVLYMS
                     TGFSTLSDHGKLFMKFGREIRMDNCIWIG"
     CDS             join(61049..61342,61393..62031,62082..62197,62245..62275,
                     62331..62601,62662..62950,63014..63152)
                     /locus_tag="CNA00200"
                     /codon_start=1
                     /product="transcriptional activator"
                     /protein_id="XP_566455.1"
                     /db_xref="GI:58258085"
                     /db_xref="GeneID:3253542"
                     /translation="MSYGPTSTILPHSYTPSQASAPSTAAAGPLSASNTLEDFTRIFG
                     HIEEDRAGLQMNERNVRPYAIYSASAVPEVGLPPELNTEAEVMDWLNGSCSLDESMLQ
                     LWAADCLAVPTTQTFNAFDSLNNLLQPTPPSQDHVDASHPAPSHGPSDPQPPQPISRP
                     ESGRQSPSHFHSPSRRSDRGTPTSQPQTALLHYFHDSLARLVSCTGDASSNAFEAFTK
                     LSNMAAGQGSAGQGLHLSILAWAARHAVNRGLVKYEAASEKFSSQSATLVNNRMRDLF
                     DGDGNERRSGAMPNHEKNREYMTLLASNLMLMQFKICRGDVWGFDTVVRHLTVLVPFV
                     FRTEKDFQAESMHHQFFENVLYHDVLGSFILNRAPMVPSSLVSHYCSFNLEALNTLTG
                     ASLPLFSTMHRLAALVRQRRGRRGKGWSDEDLFDALQRAMELEKDLTDEKKRLDALLI
                     AKPHVKPHRYLHEAFRLTCLIQLHHDVLCEPPSSLHIRLLVRQSLSLLETMIDQSLPG
                     LCSAHWVIFQTALCCVAGGQDKAELDDRETVERIYDDILHEYGFLNVERSRKIVHEVW
                     ARNQDGQLHMDWLDLLEEYDWEIFVV"
     CDS             join(61049..61342,61393..62031,62082..62197,62245..62275,
                     62331..62601,62662..62745,63014..63111)
                     /locus_tag="CNA00200"
                     /codon_start=1
                     /product="transcriptional activator"
                     /protein_id="XP_566454.1"
                     /db_xref="GI:58258083"
                     /db_xref="GeneID:3253542"
                     /translation="MSYGPTSTILPHSYTPSQASAPSTAAAGPLSASNTLEDFTRIFG
                     HIEEDRAGLQMNERNVRPYAIYSASAVPEVGLPPELNTEAEVMDWLNGSCSLDESMLQ
                     LWAADCLAVPTTQTFNAFDSLNNLLQPTPPSQDHVDASHPAPSHGPSDPQPPQPISRP
                     ESGRQSPSHFHSPSRRSDRGTPTSQPQTALLHYFHDSLARLVSCTGDASSNAFEAFTK
                     LSNMAAGQGSAGQGLHLSILAWAARHAVNRGLVKYEAASEKFSSQSATLVNNRMRDLF
                     DGDGNERRSGAMPNHEKNREYMTLLASNLMLMQFKICRGDVWGFDTVVRHLTVLVPFV
                     FRTEKDFQAESMHHQFFENVLYHDVLGSFILNRAPMVPSSLVSHYCSFNLEALNTLTG
                     ASLPLFSTMHRLAALVRQRRGRRGKGWSDEDLFDALQRAMELEKDLTDEKKRLDALLI
                     AKPHVKPHRYLHEAFRLTCLIQLHHDVLYMSTGFSTLSDHGKLFMKFGREIRMDNCIW
                     IG"
     CDS             join(61049..61342,61393..62031,62082..62197,62245..62275,
                     62331..62601,62662..62954,63014..63019)
                     /locus_tag="CNA00200"
                     /codon_start=1
                     /product="transcriptional activator"
                     /protein_id="XP_566452.1"
                     /db_xref="GI:58258079"
                     /db_xref="GeneID:3253542"
                     /translation="MSYGPTSTILPHSYTPSQASAPSTAAAGPLSASNTLEDFTRIFG
                     HIEEDRAGLQMNERNVRPYAIYSASAVPEVGLPPELNTEAEVMDWLNGSCSLDESMLQ
                     LWAADCLAVPTTQTFNAFDSLNNLLQPTPPSQDHVDASHPAPSHGPSDPQPPQPISRP
                     ESGRQSPSHFHSPSRRSDRGTPTSQPQTALLHYFHDSLARLVSCTGDASSNAFEAFTK
                     LSNMAAGQGSAGQGLHLSILAWAARHAVNRGLVKYEAASEKFSSQSATLVNNRMRDLF
                     DGDGNERRSGAMPNHEKNREYMTLLASNLMLMQFKICRGDVWGFDTVVRHLTVLVPFV
                     FRTEKDFQAESMHHQFFENVLYHDVLGSFILNRAPMVPSSLVSHYCSFNLEALNTLTG
                     ASLPLFSTMHRLAALVRQRRGRRGKGWSDEDLFDALQRAMELEKDLTDEKKRLDALLI
                     AKPHVKPHRYLHEAFRLTCLIQLHHDVLCEPPSSLHIRLLVRQSLSLLETMIDQSLPG
                     LCSAHWVIFQTALCCVAGGQDKAELDDRETVERIYDDILQT"
     gene            complement(64202..66515)
                     /locus_tag="CNA00210"
                     /db_xref="GeneID:3253506"
     mRNA            complement(join(64202..64539,64596..64698,64753..64921,
                     64982..65118,65191..65286,65340..65524,65598..65700,
                     65760..65909,65959..66133,66198..66515))
                     /locus_tag="CNA00210"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41566044|gb|CF711885.1,gi|41566837|gb|CF712678.1"
                     /transcript_id="XM_566456.1"
                     /db_xref="GI:58258086"
                     /db_xref="GeneID:3253506"
     CDS             complement(join(64305..64539,64596..64698,64753..64921,
                     64982..65118,65191..65286,65340..65524,65598..65700,
                     65760..65909,65959..66133,66198..66329))
                     /locus_tag="CNA00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566456.1"
                     /db_xref="GI:58258087"
                     /db_xref="GeneID:3253506"
                     /translation="MTDISQYQDNKDYSGHFENDDVGTIEVPIRDQYEPAFIRKTTRK
                     LDFTLLPILTLMYLCSSLDKSNLGNAKTLGMINDIGGDTTGDKYALLNALYYVSYAPF
                     MVPLALLGKRTRMAKLLSICAICWGISATCFAAVRNFSGAYACRFLIGLGEAGFVPLI
                     QVYLSRFYTRRQLGTRVGIWLAMAPMGGFFNGIIAYGVAFIKSPHLESWQILFLIEGG
                     ATFLIAIIAFIMLPEDIVRCRWLSQRQKDYLVYERSLSMAPESNEVNWKHVKGTFIRW
                     QQIVPVFMNMCQQITGALFSAFLPTFLSENGFEGANAQIATLAPYGSAAVCMIIASMI
                     SDRYRNRGWPTQFGWWLSIIAFGIYLGAPYTNRSARIAALILGETGHYIATPLIVTWT
                     ANNAGSESRRAVAVPLAVSCAQAVAVGSGYLFPAKDKPAYQMGSAVVLGLSIAGSLFT
                     FLYQGLIWRENKKRDKAEGGPPASDFVAETNVYADDAPGFRYMP"
     gene            <66911..>69614
                     /locus_tag="CNA00220"
                     /db_xref="GeneID:3253507"
     mRNA            join(<66911..67303,67361..67401,67457..67569,67629..68027,
                     68096..68221,68362..68463,68553..68657,68716..68927,
                     68995..69103,69197..69300,69534..>69614)
                     /locus_tag="CNA00220"
                     /product="D-3-phosphoglycerate dehydrogenase, putative"
                     /transcript_id="XM_566457.1"
                     /db_xref="GI:58258088"
                     /db_xref="GeneID:3253507"
     CDS             join(66911..67303,67361..67401,67457..67569,67629..68027,
                     68096..68221,68362..68463,68553..68657,68716..68927,
                     68995..69103,69197..69300,69534..69614)
                     /locus_tag="CNA00220"
                     /codon_start=1
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="XP_566457.1"
                     /db_xref="GI:58258089"
                     /db_xref="GeneID:3253507"
                     /translation="MAISPSTKGQNGILNGVANGHHINGTNGTCGAHVKPRVFALDPL
                     HSEALTLAEKHFDLVLPGHEGENQWQEEAQGLLVRGSYVTAEDLERATSMKGGKLKYI
                     SKQGTGVDKIDIVNAKKLGIPVMNTPGVNAQAVAELAFGMMLSLARQTPSIDRKIRKG
                     ASVTKLDGWKGQMLYGKTLGVIGGGNIGLLVAKMFAGAFSGKIVLYDPYLKSLDTWHS
                     AIPNASIHKVSEIDELLTTSDIVTIHVPLTPSTENMISAPQFKTMKPTAILINTARGG
                     IINEEDLSQALLNEEIFAAGLDAFTVEPPSLERYPDLCASRISELHANLFSRLRVSPW
                     FKISSMPLKARSRIGYIKKCLGFLRAVLLPLSAERNPLRASHRLFVYVRPEVHVPVRN
                     SMSNFYPPPRLVTARAFSSVPTTLWSTKTTDWLPGSGVPPEIFLEGPTTDAQGNLFVV
                     DVPYGRILRCELKSREWEVLADSDGEPNGLALNDEGQLIVADYKNGLMKCDPKTGKID
                     PVLLRRNMERFKGLNDVIVARNGDIYQTGLVYRLSPNGKLDTLLWNGISPNGLVLNPE
                     ETLTKKVTCSSAILHFCQYSSLRSTVSL"
     gene            complement(69840..72366)
                     /locus_tag="CNA00230"
                     /db_xref="GeneID:3253942"
     mRNA            complement(join(69840..70346,70411..70440,71092..71170,
                     71404..71512,71568..71590,71641..71712,71787..72366))
                     /locus_tag="CNA00230"
                     /product="expressed protein"
                     /transcript_id="XM_566458.1"
                     /db_xref="GI:58258090"
                     /db_xref="GeneID:3253942"
     CDS             complement(join(70217..70346,70411..70440,71092..71170,
                     71404..71512,71568..71590,71641..71712,71787..72363))
                     /locus_tag="CNA00230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566458.1"
                     /db_xref="GI:58258091"
                     /db_xref="GeneID:3253942"
                     /translation="MSNRSAELTRQTTTSSPTVSWDHHEPLRTQTHVPTSYSTTHSQN
                     QHIDSTLNRGSQPTSPPLTTAQPTTTLDSDGPSPRYEAISTTYPKPHDRPLPSNDQIL
                     LDLPTDLGVVSILEQSSSTQIPLSSRITSLIRINRDILPPAENVWFLIAHFEDFISAA
                     FPIFHIPTLRVWVDNVCFKGEPVEAEIACSVLLVLAVSATSLARGSPCEYLKNRAASL
                     WEYGQKFLPPVFLPPIDEQRGLLRVQVMLIRLQYVLYNPNAGTRTAAIVIWAWRWVVH
                     QRFKMNGLRPNLYERDGGFSCPDSRHGIHTQYMGSGIRTNDSATLVPCAVGSLISPLI
                     AKWTK"
     gene            <73395..>74293
                     /locus_tag="CNA00240"
                     /db_xref="GeneID:3253508"
     mRNA            join(<73395..73541,73590..73741,73789..>74293)
                     /locus_tag="CNA00240"
                     /product="aldolase, putative"
                     /transcript_id="XM_566459.1"
                     /db_xref="GI:58258092"
                     /db_xref="GeneID:3253508"
     CDS             join(73395..73541,73590..73741,73789..74293)
                     /locus_tag="CNA00240"
                     /codon_start=1
                     /product="aldolase"
                     /protein_id="XP_566459.1"
                     /db_xref="GI:58258093"
                     /db_xref="GeneID:3253508"
                     /translation="MSTITNGITVHVPRHRLRNGLEAGKPMIGCFSSLPSAWTARIVA
                     SCGWDYVIIDCEHGNHDDSDMHDTVNVIASENVSPIVRLRAGEYGLIKRALDCGAHGI
                     MVPMVNTPEDARNIVKWSKFPPMGVRGQGSSFSAMASGLTTHQYVSLANKTILTIVQI
                     ETPEAVSNAEKIASIEGVDALFIGPNDLALSLLGYVPARWDEPEFLDALEKVRLAAKK
                     YGKYVGILARNGAHAKELSEKWKLVGLGSDVRALQTAMKATVAASRSEA"
     gene            75798..76906
                     /locus_tag="CNA00250"
                     /db_xref="GeneID:3253943"
     mRNA            join(75798..75944,76237..76356,76410..76503,76556..76732,
                     76784..76906)
                     /locus_tag="CNA00250"
                     /product="60s ribosomal protein l9, putative"
                     /transcript_id="XM_566460.1"
                     /db_xref="GI:58258094"
                     /db_xref="GeneID:3253943"
     CDS             join(75804..75944,76237..76356,76410..76503,76556..76732,
                     76784..76827)
                     /locus_tag="CNA00250"
                     /codon_start=1
                     /product="60s ribosomal protein l9"
                     /protein_id="XP_566460.1"
                     /db_xref="GI:58258095"
                     /db_xref="GeneID:3253943"
                     /translation="MKDISSIESLVVPEGVTVAIKARTVTVEGPRGKLTKNVGHIQMD
                     IQLVKTPKDSKVVFTVWHGARKHVACLRTVKSLVENMIIGVTKGFLYKMRLVYAHFPI
                     NALPSDDGSALQIRNFLGEKFVRDCPMLEGVKVSLSDVKDEIIIQGNDIEKVSQSAAS
                     ITDKCRVKDKDIRKFLDGVYISERTVVVKDE"
     gene            80030..83130
                     /locus_tag="CNA00260"
                     /db_xref="GeneID:3253794"
     mRNA            join(80030..80083,80790..80956,81008..81104,81156..81834,
                     82026..82203,82268..83130)
                     /locus_tag="CNA00260"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533468|gb|CF679309.1,gi|41533474|gb|CF679315.1"
                     /transcript_id="XM_567076.1"
                     /db_xref="GI:58259326"
                     /db_xref="GeneID:3253794"
     CDS             join(81028..81104,81156..81834,82026..82203,82268..82734)
                     /locus_tag="CNA00260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567076.1"
                     /db_xref="GI:58259327"
                     /db_xref="GeneID:3253794"
                     /translation="MSNQKEHQYWEVTAPAIEAQSSSQTELSPVGPQGVDYSPSQSLP
                     QVPDSTPPPSGSHTSSGISSTYSSMMLPPLRMTHDPRNLVPSPLSSGHPQMYSLRPPP
                     PNSSPNQIQAEFYYSYSMPYPPRPPAYSGHMPAHSGSSSNGPPEIFTPVSAHTNSYRF
                     SYPGQGTIQPYLFSPWQGQDRQLPGAPGSNFGTSERKGSPDSSTTTGERWDRPSPNQV
                     GAASPLTERSTSVDEKDCKGISYTADAEVKQTPQLCNKCGIFERTHHRPRPPQNDDQK
                     LRKASTLSNSIHRREAPPPLQNARTEHSSASPRSPFSGPQSTPMSTSLTYPPMYGSPD
                     PLQASGGYFRRSATHQPTLGSPERSPFSHSMISPNLSSSAEDPNAMSGTASRHYGYQH
                     SVSSPYAHAYASRRRYAPTARGMVSSPSMTPGAFSGAMGPVMTPISGQSQLGSQTPAA
                     GEERQPQQGQEDNDSA"
     gene            complement(83413..>84847)
                     /locus_tag="CNA00270"
                     /db_xref="GeneID:3253509"
     mRNA            complement(join(83413..83753,83829..83861,84015..84059,
                     84113..84405,84484..84714,84762..84796,84842..>84847))
                     /locus_tag="CNA00270"
                     /product="sec14 cytosolic factor, putative"
                     /transcript_id="XM_566461.1"
                     /db_xref="GI:58258096"
                     /db_xref="GeneID:3253509"
     CDS             complement(join(83716..83753,83829..83861,84015..84059,
                     84113..84405,84484..84714,84762..84796,84842..84847))
                     /locus_tag="CNA00270"
                     /codon_start=1
                     /product="sec14 cytosolic factor"
                     /protein_id="XP_566461.1"
                     /db_xref="GI:58258097"
                     /db_xref="GeneID:3253509"
                     /translation="MSAYDPLSGHPGHLSEAQETALKEFRQELTTEELIPADWEALVQ
                     RIGYNRFDDQTLLRFLRARKFDLPKAKLMWANNEKWRKQFGADEIAANGFDYPEQSQV
                     VKYYPQFYHKTDNDGRPVYIEQLGKLDINKLYAITTQDRQLKRLVSEYEKFLRDRLPA
                     SSKMTGHLVETSCTILDLYNAGISTFYKVKDYVRAASAVGQNNSRSDGTHVYHQCTIS
                     LLNRLVSH"
     misc_feature    86313..86333
                     /note="AT_rich"
     gene            complement(89520..91165)
                     /locus_tag="CNA00280"
                     /db_xref="GeneID:3253945"
     mRNA            complement(join(89520..89703,89767..89939,89988..90369,
                     90420..90476,90533..90619,90675..90769,90820..90928,
                     90983..91165))
                     /locus_tag="CNA00280"
                     /product="alcohol dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534713|gb|CF680554.1,gi|41534722|gb|CF680563.1,
                     gi|41544456|gb|CF690297.1,gi|41544465|gb|CF690306.1,
                     gi|41552971|gb|CF698812.1,gi|41552987|gb|CF698828.1,
                     gi|41557896|gb|CF703737.1"
                     /transcript_id="XM_566462.1"
                     /db_xref="GI:58258098"
                     /db_xref="GeneID:3253945"
     CDS             complement(join(89620..89703,89767..89939,89988..90369,
                     90420..90476,90533..90619,90675..90769,90820..90928,
                     90983..91093))
                     /locus_tag="CNA00280"
                     /codon_start=1
                     /product="alcohol dehydrogenase"
                     /protein_id="XP_566462.1"
                     /db_xref="GI:58258099"
                     /db_xref="GeneID:3253945"
                     /translation="MSSPKTMKRYVLVHRNDLSGITFEQGAPLPQIKKSTEILINIKA
                     LSLNARDLQIATNQYPAPHPIPDGIVPVSDASGEIAAVGDDVTDFKVGDRVTPIIFQG
                     HHQDEDVTLDSMNRGIGGARNGVAAEYFVCDQSEAVKIPKSFSHQDASTLAIAYATAW
                     SSLYSHHPRLQSGDTVLCLGTGGVSLCAAQIALISGAKVIVTSSSQSKLDRVVDLLKP
                     LVKGNFADTIHTIDYSRIDKWDEEVRRITEGKGANFVIEIGGRGTIGKSIRSTRRGGL
                     VAVSGYLSTYKDIPKEILEEDLAQTILYSGSYVRGVFVCNREDEKRMISALEVGNVKP
                     VIDKVFDFENLKEAYQYMADGKHFGKICVTV"
     gene            94248..98982
                     /locus_tag="CNA00290"
                     /db_xref="GeneID:3253946"
     mRNA            join(94248..94501,94576..94908,96208..96651,96706..98190,
                     98249..98982)
                     /locus_tag="CNA00290"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541357|gb|CF687198.1,gi|41541369|gb|CF687210.1,
                     gi|41552062|gb|CF697903.1"
                     /transcript_id="XM_566463.1"
                     /db_xref="GI:58258100"
                     /db_xref="GeneID:3253946"
     CDS             join(96258..96651,96706..98190,98249..98817)
                     /locus_tag="CNA00290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566463.1"
                     /db_xref="GI:58258101"
                     /db_xref="GeneID:3253946"
                     /translation="MVSVEQYRSQRTSYYPPPHSPTYVSPTSTASPVSGAPIFTFPFQ
                     QPDISSPVGKMARRPSRADPMVRTEDDMYEEDDGYGELGQRHPLRRGKEDMREEIEAR
                     PGHEVNLTRIRERGEGMSLPGIKTLLGVKEHPSGSSSLYHSPSLPSLETNSPTTSPSS
                     ARTSRFSSFTSSTVPELSAPGWWAPEFERSPFHAVPSRSDSFSSAQLHIVDEHDQKRR
                     RSDVPPLRDVEESARLRWQAQSRNASFPSSSPHSSGRTTPTSWSSMRNRLHPPISSSP
                     SVATVMGRGSISSTSGAMSPPITRRASPSSRNPSLVGGQLSRHFADLSATDSQRGSIS
                     GAAGPPERRISVQAPSSTTPIDLDRAPILPPLISPENERPSMPSASFSLPSIRRSSST
                     SSDCLRRHSNTQPTTPDTTGQPEVRRSSLTEIIMARSGDHIAMKEGRYAFSTEERHGS
                     LGMEKRAETALGLAPIPLQSKTSVQSLAGTSSDTPAWNPQGRRESTESISSATAHLAI
                     NSEAERERTASLRGRKRSADMRDDSEPRADPSLVGVGVSVNVGAGDPGLRGMEVLAES
                     ARRIAAAEEEQKAKNVEEEEVEEAQEKDEVPEKTGGPKYTCTYCVKTFSRPSSLKIHT
                     YSHTGERPYICNEAGCGRRFSVQSNLKRHAKVHQVGPLGVSAPEPSVPPTKASKQPTH
                     PSKPNEHSSPHPPPLHHHQSHHRMAQPLPPPVMSGPMPPPGGYPFFPPSYPPLSMNAM
                     PGPPPPGSTPGMAPPPGYYIDGRYAVAPPPPTNGMPHGGYVQYDMPVPTHDGKDESGR
                     DNGKGKEKSRKSNSKEE"
     gene            99512..101925
                     /locus_tag="CNA00300"
                     /db_xref="GeneID:3253947"
     mRNA            join(99512..99776,99873..100112,100167..100244,
                     100294..100665,100713..100885,100940..101066,
                     101121..101134,101181..101598,101657..101925)
                     /locus_tag="CNA00300"
                     /product="sterol 14-demethylase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531920|gb|CF677761.1,gi|41531932|gb|CF677773.1,
                     gi|41532732|gb|CF678573.1,gi|41532740|gb|CF678581.1,
                     gi|41534606|gb|CF680447.1,gi|41534609|gb|CF680450.1,
                     gi|41540910|gb|CF686751.1,gi|41540912|gb|CF686753.1,
                     gi|41542775|gb|CF688616.1,gi|41542784|gb|CF688625.1,
                     gi|41552174|gb|CF698015.1,gi|41552192|gb|CF698033.1,
                     gi|41557703|gb|CF703544.1,gi|41564907|gb|CF710748.1,
                     gi|41564920|gb|CF710761.1,gi|41573097|gb|CF718938.1,
                     gi|41573104|gb|CF718945.1,gi|41574477|gb|CF720318.1,
                     gi|41574482|gb|CF720323.1"
                     /transcript_id="XM_566464.1"
                     /db_xref="GI:58258102"
                     /db_xref="GeneID:3253947"
     CDS             join(99621..99776,99873..100112,100167..100244,
                     100294..100665,100713..100885,100940..101066,
                     101121..101134,101181..101598,101657..101731)
                     /locus_tag="CNA00300"
                     /codon_start=1
                     /product="sterol 14-demethylase"
                     /protein_id="XP_566464.1"
                     /db_xref="GI:58258103"
                     /db_xref="GeneID:3253947"
                     /translation="MSAIIPQVQQLLGQVAQFFPPWFAALPTSLKVAIAVVGIPALII
                     GLNVFQQLCLPRRKDLPPVVFHYIPWFGSAAYYGEDPYKFLFECRDKYGDLFTFILMG
                     RRITVALGPKGNNLSLGGKISQVSAEEAYTHLTTPVFGKGVVYDCPNEMLMQQKKFIK
                     SGLTTESLQSYPPMITSECEDFFTKEVGISPQKPSATLDLLKAMSELIILTASRTLQG
                     KEVRESLNGQFAKYYEDLDGGFTPLNFMFPNLPLPSYKRRDEAQKAMSDFYLKIMENR
                     RKGESDHEHDMIENLQSCKYRNGVPLSDRDIAHIMIALLMAGQHTSSATSSWTLLHLA
                     DRPDVVEALYQEQKQKLGNPDGTFRDYRYEDLKELPIMDSIIRETLRMHAPIHSIYRK
                     VLSDIPVPPSLSAPSENGQYIIPKGHYIMAAPGVSQMDPRIWQDAKVWNPARWHDEKG
                     FAAAAMVQYTKAEQVDYGFGSVSKGTESPYQPFGAGRHRCVGEQFAYTQLSTIFTYVV
                     RNFTLKLAVPKFPETNYRTMIVQPNNPLVTFTLRNAEVKQEV"
     gene            complement(101924..>104181)
                     /locus_tag="CNA00310"
                     /db_xref="GeneID:3253823"
     mRNA            complement(join(101924..102771,102889..103279,
                     103355..103591,103656..103860,103935..>104181))
                     /locus_tag="CNA00310"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41561529|gb|CF707370.1,gi|41561538|gb|CF707379.1"
                     /transcript_id="XM_567078.1"
                     /db_xref="GI:58259330"
                     /db_xref="GeneID:3253823"
     CDS             complement(join(102379..102771,102889..103279,
                     103355..103591,103656..103860,103935..104181))
                     /locus_tag="CNA00310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567078.1"
                     /db_xref="GI:58259331"
                     /db_xref="GeneID:3253823"
                     /translation="MGPFPPKVRNICISQTIHQSFQRRTVTAMSARPPSFASNFPTST
                     AEPSAYFKWPGITWDSTKAVREVLEENNRGYDIYESRRFAHNHFPHSVFSRYAFGAPP
                     KLIHDCWNHDKTHLVSLDPAGPDRKDVDETKVPKRITREDWGNHLGNKGCYAPYLVFF
                     HDEIARLGPQGVLEEYIFSPQANWEIFTDPSSKDQGPPNMFNRLLAGAIHPFIHIGFG
                     LEFNDRVVLAEGLAEAAVHPDVIVNLVIPPSHIQPLFTTSSPRPSSSPSLLSIYTSLI
                     SSPILTPQPYDPKSMVNDQLKSSVNGPKAQELRAIVDRWSLSDEEVADGPNGWQKKFE
                     EIAVFATLLACATGRKGKEIRVDFFLMHALTSSIFLPAYLSRLPPSFRRALLRRYILE
                     AFHTALARGRPSIDPELIMSYDLYPTINTEGSEDALKKLVKEDKALGKGEKEERNAWL
                     SLVESAMVYPGMSLLFAFITFFLPSLPPSRMIHICHPSVR"
     misc_feature    103126..103212
                     /note="GA-rich"
     gene            complement(104600..>106913)
                     /locus_tag="CNA00320"
                     /db_xref="GeneID:3253790"
     mRNA            complement(join(104600..105664,105737..>106913))
                     /locus_tag="CNA00320"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41561567|gb|CF707408.1,gi|41561577|gb|CF707418.1"
                     /transcript_id="XM_567084.1"
                     /db_xref="GI:58259342"
                     /db_xref="GeneID:3253790"
     CDS             complement(join(104898..105664,105737..106913))
                     /locus_tag="CNA00320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567084.1"
                     /db_xref="GI:58259343"
                     /db_xref="GeneID:3253790"
                     /translation="MAVTSTFSSSDTLHTISLLPLATFLKSLTSAENIARLQDVLVKY
                     RSPESWERVDERMISSGDLPPPGYTSKPKDDLSDEYIDDIKARNQSQDRKPDRGEDED
                     ENEVLEEGMEWDHDHDILYPSPPKRYIQEIRIDLRTLHPRAIFALESWRRETLGMEQL
                     VMESMESKAFAAGLDAGAGEKNEGGYFSLGVSSSPKPVQLRSLDIWFRGDREGSESTS
                     TDERSSIEVESIPIRAKAEPFMDGLSISGSAKRARVLKTYGSSKRLSSSSLSHPDFAT
                     RFASLSPILATSSSPLLSPTPSEAEKGKTEDRESVSGERLEAVSASKAVSEQRSLSKK
                     RKRGRPRKKAERPGRPVQTSAQLGEEISATKSDGVEEEEEDKSFIEHDAGEEKEGTSR
                     GPSSRSLRSRMLIASTSKTPDIFEGEEELESFPSEDEPEMKKQRRIYRRKEKGVNGEE
                     RPKKRGRPRKRPFVLASPPPANMFLPVNRPAKGTFANPIKISTPALPINNGPTAATFA
                     SLKPKSTFDSRNASPIPYLYAATLPRISGNPTLPFGSTSSTSSSSSPRPQRPKRKNAS
                     GVLQAAEFESDSELTELSEMSELEPRPQSQFQSHSRSGSGSWPHSQSQSKFRASASAS
                     ASSKHKYKFQFDGVLLPSFSRHV"
     gene            107107..110956
                     /locus_tag="CNA00330"
                     /db_xref="GeneID:3253510"
     mRNA            join(107107..107211,107268..108181,108236..109185,
                     109244..109365,109419..110361,110420..110557,
                     110616..110956)
                     /locus_tag="CNA00330"
                     /product="translation elongation factor 2, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540518|gb|CF686359.1,gi|41540521|gb|CF686362.1"
                     /transcript_id="XM_566465.1"
                     /db_xref="GI:58258104"
                     /db_xref="GeneID:3253510"
     CDS             join(107173..107211,107268..108181,108236..109185,
                     109244..109365,109419..110361,110420..110557,
                     110616..110857)
                     /locus_tag="CNA00330"
                     /codon_start=1
                     /product="translation elongation factor 2"
                     /protein_id="XP_566465.1"
                     /db_xref="GI:58258105"
                     /db_xref="GeneID:3253510"
                     /translation="MSNIFAVPLQNTRNVTIVAHVDHGKTSFADSLLSSNNIISSRMA
                     GKLRFLDSREDEQERGITMESSAVSLRFDMTRLSPDGTSSIQQCICNVIDTPGHVDFA
                     SEVSTASRLCDGALVLVDVWEGVATQTIAVLRQAWMDKLKPLLVINKMDRLITELKLS
                     PSEAYHHISQLIEQVNAVMGSFYASERMEDDLRWREEREKRLAARKEQQGEDLDDDEE
                     YEEKEDEDIYFAPDRGNVLFASAIDGWAFRLGKFARLYAEKLKIKEGNLRRVLWGDWY
                     LDPKTKRVVGRKKLAGRNLKPMFVQFVLENIWRVYDTVLNEYNPDAVQKIVTALNIRI
                     TPRDLRSKDTRNLLNLIMQQWLPLSTATFQSIIEVIPPPPSAQAIRLPYMLHPEKAKA
                     AAASGGLKAENELERGLYECDQGEGAEVVAYVSKMFAVRKGDLPEYKPKEMTAEEMRA
                     RGREERERRAALVAERQAKGEGLDGQPLPEDLAKPLESLSLENIQPATSEKPAVDDSD
                     SEVLLGFSRIFSSTLHRGTSLLAILPKFDSSLPPSHPHNIKHTVPIIASDLYMMMGRE
                     LVSVDSVPAGHVCAIGGLNRAVPRSATLWAPDAKGVEEGFGKEALVNLAGVGVGANAI
                     VRVALEPENPSDMPKLIRGLRILNQADPCAEYFVQESGEHVIITAGELHLERCLKDLR
                     ERFAKCPIQQSAPIVPFRETAVKAPDMAPPKTTGAPRGTINGTVINGLVKFRLRAMPL
                     PEGVETFLLSQQGAISKMLVRERDGKEGEEETDVQEGAEGQSGEGEVPEGQQEARQLS
                     PEEFWTELERLLNKAGGDWAGAADRVWSFGPKRVGANLLLDPVGTKHLRLRRREQLFT
                     QARAQGQSADDALLSTDHAVAADQLASLSSITSSDNEAARAELRLLRDYESSIETGFQ
                     LSTFQGPLCAEPVVGMAWVVESVELDRQGMESEQGKGQVVGGALISAVRDACRQGLLD
                     WSPRIKLAMYTCDIQASTDVLGKVYGVIARRRGRIVSEEMKEGTSFFTIRAMLPVVES
                     FGFADEIRTRTSGAASPQLIFSGYETLDLDPFWVPTTQEELEDLGEKADKANVAKAYV
                     DGVRKRKGMFVERKIVEFAEKQRTLKK"
     gene            complement(110962..112420)
                     /locus_tag="CNA00340"
                     /db_xref="GeneID:3253495"
     mRNA            complement(join(110962..111688,111748..111899,
                     111978..112420))
                     /locus_tag="CNA00340"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41547782|gb|CF693623.1,gi|41547790|gb|CF693631.1"
                     /transcript_id="XM_566466.1"
                     /db_xref="GI:58258106"
                     /db_xref="GeneID:3253495"
     CDS             complement(join(110998..111688,111748..111899,
                     111978..112388))
                     /locus_tag="CNA00340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566466.1"
                     /db_xref="GI:58258107"
                     /db_xref="GeneID:3253495"
                     /translation="MSDPLNAASLLGLLPTLLPQGTTSPLPLSTDAIAALVHAIHTAL
                     QFRLISPAPQPVDDNSKLEQPRSGGDNDDAMSEVTAVEQEDNSQPPIGRLAEGWNSRG
                     EDSYSFQYRHDQSAMNFRVRVGKMGNRVQIDAMAEDGEPHNLSVVRSELVDSGLFPIP
                     SSATASSASNQESPDASATAVGFKSMNDVKTFVEKYSRDVISRLLPGLSIPGYSQVSG
                     SDPRGPPPAGAPQGSEPSPARPSVPRTGDPLLDNINNINPSGRNPASLGHRDLDPLAS
                     LRPPGSFNPNRDGGGMLMDFNHPMFDSRRGRGLGDPDLDGPGGSVQPPGSRWDPVGPS
                     PDGVGGGGIFPGVGGNPLGGVGRGDRDRWGDEMPPPGEFGPDLGRFGGGNGIGGPLGG
                     GRGGGRFGGGGGFGGGGGFGGNMYM"
     misc_feature    111023..111082
                     /note="C-rich"
     gene            112605..114131
                     /locus_tag="CNA00350"
                     /db_xref="GeneID:3253496"
     mRNA            join(112605..112679,112740..112765,112827..112955,
                     113038..113138,113193..113801,113862..114131)
                     /locus_tag="CNA00350"
                     /product="proteasome regulatory subunit 12, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544635|gb|CF690476.1,gi|41544637|gb|CF690478.1,
                     gi|41568109|gb|CF713950.1,gi|41568122|gb|CF713963.1"
                     /transcript_id="XM_566467.1"
                     /db_xref="GI:58258108"
                     /db_xref="GeneID:3253496"
     CDS             join(112656..112679,112740..112765,112827..112955,
                     113038..113138,113193..113801,113862..114025)
                     /locus_tag="CNA00350"
                     /codon_start=1
                     /product="proteasome regulatory subunit 12"
                     /protein_id="XP_566467.1"
                     /db_xref="GI:58258109"
                     /db_xref="GeneID:3253496"
                     /translation="MPGLTTAQVTELSGVNVVIHPLVLLSVVDHAARVPLSKNKRVLG
                     VLLGQDNGTSINVANSFAIPFEEDERDPKTFFLDLDYVEEMWRMFRKVNAKERPIGFY
                     HTGPRLRSSDLEITELFKRFCPRPVMVIVDVRTSGGRGDTGIPTDAYFAVEEIKDDGT
                     ATQRTFTHVSTSIEAEEAEEIGVEHLLRDISSSSSAPSSSLLTTQSLSTRVASQLQSL
                     RGLHARLHEIGEYLEAVRSGKMPINHQVVYQLQEIIGLLPQLGGDVELGKAFRMGVND
                     QSLVVFLSSMIRTVLALHDLIENRIQNAQQDIEDAKSPAEKANEARAEAAGIKAEDVA
                     KAKKDAEEEEKEKKKK"
     misc_feature    113975..114026
                     /locus_tag="CNA00350"
                     /note="GA-rich"
     gene            complement(114123..116506)
                     /locus_tag="CNA00360"
                     /db_xref="GeneID:3253792"
     mRNA            complement(join(114123..114273,114330..114421,
                     114476..114500,114563..114646,114711..115002,
                     115059..115151,115232..115677,115735..115805,
                     116021..116214,116273..116506))
                     /locus_tag="CNA00360"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535073|gb|CF680914.1,gi|41535911|gb|CF681752.1,
                     gi|41536721|gb|CF682562.1,gi|41536995|gb|CF682836.1,
                     gi|41537003|gb|CF682844.1,gi|41541341|gb|CF687182.1,
                     gi|41541345|gb|CF687186.1,gi|41565646|gb|CF711487.1,
                     gi|41565661|gb|CF711502.1"
                     /transcript_id="XM_567085.1"
                     /db_xref="GI:58259344"
                     /db_xref="GeneID:3253792"
     mRNA            complement(join(114123..114273,114330..114421,
                     114476..114500,114563..114646,114711..115002,
                     115059..115151,115232..115677,115735..115805,
                     115862..>115906))
                     /locus_tag="CNA00360"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535073|gb|CF680914.1,gi|41535084|gb|CF680925.1,
                     gi|41535911|gb|CF681752.1,gi|41536995|gb|CF682836.1,
                     gi|41541341|gb|CF687182.1,gi|41565646|gb|CF711487.1"
                     /transcript_id="XM_567086.1"
                     /db_xref="GI:58259346"
                     /db_xref="GeneID:3253792"
     CDS             complement(join(114255..114273,114330..114421,
                     114476..114500,114563..114646,114711..115002,
                     115059..115151,115232..115677,115735..115805,
                     116021..116214,116273..116345))
                     /locus_tag="CNA00360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567085.1"
                     /db_xref="GI:58259345"
                     /db_xref="GeneID:3253792"
                     /translation="MSRFKISGALWDSIHHYSSFPQTGVSLQQMIHFGHNPTPGTLLK
                     ASQFLSEELPIRLSHRVVELNALPDGLAKMPSINKVKEWYAQSFEELVTFPKPRFKPE
                     LEGILNVPNSDRTKLAFPSSTPNPSLDPLMDEGPVGSGLLVERHNQGNGNGNGNGNIS
                     GNGNGNGNGNGQRLRIPMERRYYSPPPATLVYPPEVHEYNERFTHLLENIKKRHDPTV
                     TTVAQGVLEWKRKRKTGRIGVPIQEWLDRFYMSRIGIRFLIGQHVALNTLQPHPDYVG
                     IICTRANVHDICHEAIENARYVCEEHYGLFKGPPIQLLCPKDLTFPYVPGHLSHICFE
                     LLKNSLRAVVERFGVENEEAFPPIKVVVVEGREDITIKISDEGGGIPRSAIPMIWTYL
                     YTTMSDEGLEATIEQSDFKAPMAGFGYGLPLARLYARFFGGDLRLISMDGYGTDVYIS
                     LNKLSSSCEPLQ"
     CDS             complement(join(114255..114273,114330..114421,
                     114476..114500,114563..114646,114711..115002,
                     115059..115151,115232..115677,115735..115805,
                     115862..115906))
                     /locus_tag="CNA00360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567086.1"
                     /db_xref="GI:58259347"
                     /db_xref="GeneID:3253792"
                     /translation="MVLTKSGRHEDTGTVELVTFPKPRFKPELEGILNVPNSDRTKLA
                     FPSSTPNPSLDPLMDEGPVGSGLLVERHNQGNGNGNGNGNISGNGNGNGNGNGQRLRI
                     PMERRYYSPPPATLVYPPEVHEYNERFTHLLENIKKRHDPTVTTVAQGVLEWKRKRKT
                     GRIGVPIQEWLDRFYMSRIGIRFLIGQHVALNTLQPHPDYVGIICTRANVHDICHEAI
                     ENARYVCEEHYGLFKGPPIQLLCPKDLTFPYVPGHLSHICFELLKNSLRAVVERFGVE
                     NEEAFPPIKVVVVEGREDITIKISDEGGGIPRSAIPMIWTYLYTTMSDEGLEATIEQS
                     DFKAPMAGFGYGLPLARLYARFFGGDLRLISMDGYGTDVYISLNKLSSSCEPLQ"
     gene            complement(<116872..>118899)
                     /locus_tag="CNA00370"
                     /db_xref="GeneID:3254017"
     mRNA            complement(join(<116872..117017,117078..117192,
                     117251..117761,117812..118124,118183..118460,
                     118523..118569,118666..>118899))
                     /locus_tag="CNA00370"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_566468.1"
                     /db_xref="GI:58258110"
                     /db_xref="GeneID:3254017"
     CDS             complement(join(116872..117017,117078..117192,
                     117251..117761,117812..118124,118183..118460,
                     118523..118569,118666..118899))
                     /locus_tag="CNA00370"
                     /codon_start=1
                     /product="hexose transport-related protein"
                     /protein_id="XP_566468.1"
                     /db_xref="GI:58258111"
                     /db_xref="GeneID:3254017"
                     /translation="MEDKTAPAVHSLEPVGSHSSFDKKEVHVELETTQKQGEATFYET
                     ISASPLNPWSKTSFQLYGILLVAALNATASGFDGYSEYFHHEELGSSTGIIFMIYTIG
                     NMIGSLFTGPICDHFGRRAGMGSGAIIIMAAAIILTAAKNDSYLLGGRFLLGFGISIG
                     TSSAPTYALELAPPQWRARIVGFYNTFFYAGSILSTGVAYASNKSSGELAFRLPLGLQ
                     LIPPTCILAGLAFVPESPRWLTARGKTDQAAEILAKYHGGGDINHPVVQMELREFEEG
                     IQVKKAQSWWNYYDLVDTHNQRWRFLMMACMSFFAQLSGVSLGLIYTSQQLLTTTIQN
                     SVLTYYLPSMYTKLGITSTDRRLLLTFANSIVSCTGAVFGSATNDMIGRRTKLWVGSI
                     VLACLFAAVTGFSSQFEGGADNVDAPMSNAGVAFIFLFGCAYSFVYTPLTATYCAEVL
                     ANHTRAKGMGVHVIMSNCANLYNTYVTAIALEAIGWKYYLVFVALNLVYAAVWFILGV
                     ETRGRTLEELNSVFDAKWPPKEALKKATLVKAEGRLEQL"
     gene            <119952..>121269
                     /locus_tag="CNA00380"
                     /db_xref="GeneID:3253497"
     mRNA            join(<119952..120139,120215..120274,120335..120474,
                     120536..120811,120872..121032,121117..>121269)
                     /locus_tag="CNA00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_566469.1"
                     /db_xref="GI:58258112"
                     /db_xref="GeneID:3253497"
     CDS             join(119952..120139,120215..120274,120335..120474,
                     120536..120811,120872..121032,121117..121269)
                     /locus_tag="CNA00380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566469.1"
                     /db_xref="GI:58258113"
                     /db_xref="GeneID:3253497"
                     /translation="MTRPAFLNDLERDGYVVVPGIVPESSCDEFISEAWEWLESFPYG
                     FKRDDRSTWTTEHLPYSTTGGLYNRYSVNHEAFVWKIRTDPGIRKIFEQIWDTDDLIV
                     SFDGMNASLPINDQTGRTDIKPTAPWPHIDQNPRNVNRFELYQGIANLAANGPSDGGL
                     CVLKGSHKIHQEYFDSMGGFKPDQDVGVLENGYNYKLEDTEWYKNKGCEEVKICAGKG
                     DLILWDSRTIHWNASPIGDQTRFVTYVCYCPRNSMSPAELAKKVEVFKGRKGTTHFPY
                     LNRIPVERPGYYNALPRRPDGTLDPANRTRPRKEPEETPAVLNAVGIRA"
     gene            complement(121378..>122557)
                     /locus_tag="CNA00390"
                     /db_xref="GeneID:3253498"
     mRNA            complement(join(121378..121745,121799..121917,
                     121967..122043,122100..122191,122259..122359,
                     122413..>122557))
                     /locus_tag="CNA00390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566470.1"
                     /db_xref="GI:58258114"
                     /db_xref="GeneID:3253498"
     CDS             complement(join(121386..121745,121799..121917,
                     121967..122043,122100..122191,122259..122359,
                     122413..122557))
                     /locus_tag="CNA00390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566470.1"
                     /db_xref="GI:58258115"
                     /db_xref="GeneID:3253498"
                     /translation="MSTTADQETQVITADGMATPVGKSSIGKGRIAVDMDDVLCQTNA
                     TIVRMHNELFGLDPPLTLDDFENYLYWMNRGWGNPEETSKLYQNGLYMRAPPVPGAKE
                     ALQKLKDMGYCLIIITARSESQREGTEEWIMEYLPDIFDEIHFTGAFQDLEPTKEEHE
                     GHAARKAIVSHKKRSKAEIIHNTSSLFLIDDSAENAYDIATSCYTHPHATKVLLFGAY
                     PWNAVVRSPESTLPIEKMTYVAKKEKGLLGESEKLRNEKIQKGWLPEGVVRVSGWKEV
                     VKWVEAFDKNGGAGGNRIKTA"
     gene            complement(123052..126382)
                     /locus_tag="CNA00400"
                     /db_xref="GeneID:3253499"
     mRNA            complement(join(123052..123831,124180..126166,
                     126216..126382))
                     /locus_tag="CNA00400"
                     /product="histone deacetylation-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41553165|gb|CF699006.1,gi|41553176|gb|CF699017.1"
                     /transcript_id="XM_566471.1"
                     /db_xref="GI:58258116"
                     /db_xref="GeneID:3253499"
     CDS             complement(join(123083..123831,124180..126166,
                     126216..126227))
                     /locus_tag="CNA00400"
                     /codon_start=1
                     /product="histone deacetylation-related protein"
                     /protein_id="XP_566471.1"
                     /db_xref="GI:58258117"
                     /db_xref="GeneID:3253499"
                     /translation="MANNGAVPEPTEPFSGKQTDTVPQLSPHSTIAERRSVKLPPNIP
                     LNRKESFPRKDSMLSGQSTDVENDVELRTAVSEIDTLVLEDGEEQDELGAEKARELNL
                     IASVKAAQARHVHLQEFPILAWNMAAAPEESSRVTVMDDEGRERMLKEFTRPLKREEA
                     IRAKFVRFVVAHEKVKTKNTITRLKDSYLSINKKWKDHCSFLDELMKERGPPPPELYA
                     MPGAIHPVVTPGAVAPTTPAVEEIFNSRSNRRRGLGGDIVATDAEFEEILAGLADNAL
                     KDPNLRASKTAAVIPDMIVGQERNLQYDNDNDLVTDPLSFYDNIGVAEPIWTSEERAI
                     FVKRYLAYPKQFGRIADGIPNKTAGECVLYYYRTKKEMDYKGMLAHKRGGGKRKLALK
                     KGAKSSALMQDLTRAKPTVSKDDAAVATPAKGREQSVVLPAGGKRGRGEGGGPGRKKR
                     VSQSVAVPQTPTPQNEEEEEGHMDSASTSRAGSEVPSVSSTKAKMRMTVKTAKRPRVS
                     SIPELSTPTQNPPAQPDTTALTPATEVPEHPSLTNTTELAAAALASLADVATSAAQAE
                     LLPPVRRAGKRRKIAGEPGPIVDPNAPPAITVAGAPEKEKPARRSATNSYWSVEERRK
                     VKELVVLHGMDAKLIAAQLKGKSERQVGNFLEGHRTELEALEGSNSPVRPIFRAGGMR
                     ISALLNDEPPTEAGEQGEIGVVPDSIDTASDVTIDERELDVVTGPSPRSLPAASDIPA
                     GYPSYEQRHDERHSAHASQSPSLPHMSHSPNAWNGTRPEASPIYGHAPAVPAPTLAHR
                     GSWESHPPPGHICTSSTTRFETLPPIRSQPATYDRSPLAHGHIGPLTPHGHDREQFHQ
                     QQPQAHDGSQREWDERKYEKTEGFQSATLPPLRNMEHEGGAQGGTGDGVADDRNGDQE
                     R"
     misc_feature    126965..127021
                     /note="CT-rich"
     gene            128832..129459
                     /locus_tag="CNA00410"
                     /db_xref="GeneID:3253466"
     mRNA            join(128832..128967,129029..129170,129269..129459)
                     /locus_tag="CNA00410"
                     /product="expressed protein"
                     /transcript_id="XM_567226.1"
                     /db_xref="GI:58259626"
                     /db_xref="GeneID:3253466"
     CDS             join(128929..128967,129029..129170,129269..129372)
                     /locus_tag="CNA00410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567226.1"
                     /db_xref="GI:58259627"
                     /db_xref="GeneID:3253466"
                     /translation="MTNLFEGLYHTVQGIFQSIFAVFQSFFNVVYAFVHGVVSLVWNV
                     LESIAEFVGASVHFVISNILIIGLIALGVVLYNDRNKRGTLGNDLKKKAQ"
     gene            129753..131304
                     /locus_tag="CNA00420"
                     /db_xref="GeneID:3253732"
     mRNA            join(129753..129935,130008..130248,130306..130393,
                     130459..130515,130566..131100,131192..131304)
                     /locus_tag="CNA00420"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530060|gb|CF675901.1,gi|41530075|gb|CF675916.1"
                     /transcript_id="XM_567079.1"
                     /db_xref="GI:58259332"
                     /db_xref="GeneID:3253732"
     CDS             join(129882..129935,130008..130248,130306..130393,
                     130459..130515,130566..130656)
                     /locus_tag="CNA00420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567079.1"
                     /db_xref="GI:58259333"
                     /db_xref="GeneID:3253732"
                     /translation="MPPVVSSVVWFAQNAQYIIAFVLGATTLVFSCLAYLILRWVILP
                     NPFLGLFSPKSHPKRKPTKAKGKTTNLKKTTSRSKVTRNSSPGLVDSAFTMMGTGLLI
                     CSIASAVICAYSLTSQGCEALRHFGLIEWLPWKTGLRCYRSRWDWVGEFLGELLLTLL
                     HKSEYGTAAIKTIENM"
     gene            complement(<130842..>131710)
                     /locus_tag="CNA00430"
                     /db_xref="GeneID:3253934"
     mRNA            complement(join(<130842..131173,131255..131324,
                     131396..>131710))
                     /locus_tag="CNA00430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566472.1"
                     /db_xref="GI:58258118"
                     /db_xref="GeneID:3253934"
     CDS             complement(join(130842..131173,131255..131324,
                     131396..131710))
                     /locus_tag="CNA00430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566472.1"
                     /db_xref="GI:58258119"
                     /db_xref="GeneID:3253934"
                     /translation="MPRSADDPIVQAEQNFYNSSMYNAMGAAQMSFQPINRIHQHLCG
                     LHIYAHDTKRGVKAHHFCTHLRHDLHQCVIYDSDQPDARLIGIEYLIPEDAFIALPTD
                     EKKYWHSHRYEVDSGMLMLGTKSLVPNAVSDIAERPAMLELHRMYGKTTHTWQFDLHP
                     DLPLGPPQLMMAYTDDSQVDRQLLKERDEALGVSTEAKRKVRKGYLKKEDLERPPAEG
                     ADPCWNGKLGQWEYVEKEKE"
     gene            132051..133392
                     /locus_tag="CNA00450"
                     /db_xref="GeneID:3253500"
     mRNA            join(132051..132816,132871..133036,133093..133392)
                     /locus_tag="CNA00450"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533687|gb|CF679528.1,gi|41556092|gb|CF701933.1,
                     gi|41573717|gb|CF719558.1,gi|41573727|gb|CF719568.1,
                     gi|41574857|gb|CF720698.1"
                     /transcript_id="XM_566473.1"
                     /db_xref="GI:58258120"
                     /db_xref="GeneID:3253500"
     gene            complement(132063..132917)
                     /locus_tag="CNA00440"
                     /pseudo
                     /db_xref="GeneID:3253672"
     CDS             join(132080..132816,132871..133036,133093..133350)
                     /locus_tag="CNA00450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566473.1"
                     /db_xref="GI:58258121"
                     /db_xref="GeneID:3253500"
                     /translation="MESAQTSSASATNPAAANSIASLLYHDGPAHEADNHGLIDYLQS
                     HGDYANDINHYHAQPSHGHSQRSPSPPNPSIPIPSSLNRLANTALAHYVPPALPPLPG
                     AIDQAAVAAAVDYGDRGEMGGKRRKLPHQRAGWADMENSQSKKRRTRKSEDAPHLVGS
                     NAGRSASPAGSQRASAGVQGEVQIPAGQDLSSLTELSRMALEGVTGETLQAQEVQEPK
                     PQQGTHEIDPTLASVHEPRPAPPPEPPISNEKLSRAEQNKRAQQAFRRRREEHMKRLE
                     AESAHLQVVLKQCQEKDIIIKDLVLGQQTDRIRIAALESLIKHLAPHVNIPLLTPEGE
                     LNIPEDPIATSGHSGDDSVVEVGEMRSDPELERAFDVLERQSREVAKVNFKL"
     gene            133655..135951
                     /locus_tag="CNA00460"
                     /db_xref="GeneID:3253501"
     mRNA            join(133655..133799,133858..134341,134396..135951)
                     /locus_tag="CNA00460"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542788|gb|CF688629.1,gi|41542799|gb|CF688640.1,
                     gi|41574331|gb|CF720172.1,gi|41574337|gb|CF720178.1"
                     /transcript_id="XM_566474.1"
                     /db_xref="GI:58258122"
                     /db_xref="GeneID:3253501"
     CDS             join(133771..133799,133858..134341,134396..135907)
                     /locus_tag="CNA00460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566474.1"
                     /db_xref="GI:58258123"
                     /db_xref="GeneID:3253501"
                     /translation="METAPLTLKVLHISPLTLIPTSNPDASASIPPIPLPPPPPPAGF
                     NFSPTPNYPPPFGSIPLGSKLDLRVGLENVHRQRYGVHGVRMMVEVQSASGRVRLGEA
                     IHGQISDTSSEQPLQEGQESQLPELKFGEMVELGVESEMKDLGLGVVIVSVAWETLDG
                     RKTFQRFFKFNIITPLGIKTRVQIPSHPNSTLSLSLREQTYLEVFMQNTSLESMLISG
                     ISLEPVEGLKVNKIGGSEMDGEELIVGGTRQYLFVVDSSPSNDDEGAKQGKSIFPPTY
                     PAGAVLPLGRLLVEWISGPYHTPGKLLTSMLNRRAPAPRLPSITQPHPTPTRTLSAAP
                     PTPSKGPTALDTGSGTLATPRRGLSPNPDSIPSPRHRPLPSPSPKWAFDLTLNGSRKV
                     PLQSEWYLTLNLAVRSAAPIQDSSEEQAVPTLPRLGIQYLTPVEPPLVDGAQSETDHS
                     RQSQQGNPQMMLSPPSRTSTPASPALSSAGRPLSPFTTTSTASTSIAGISGISRSTTP
                     LRAELKSAVGSMIGPNPFTSAFFKKIQTAPDDDQEEKESRASFPPIASVVPNPDYKPS
                     ASLDKSAGPVQIYHIGSSLIFPDFPPLTPKFENLGLQPLSAGGSEKKERESEKVAKKY
                     WETSVQWQWKFVGFEEGLGVLGGARVLISEGEDEGVIGREWECLGDVTVS"
     gene            complement(136220..137816)
                     /locus_tag="CNA00470"
                     /db_xref="GeneID:3253502"
     mRNA            complement(join(136220..136830,136887..137027,
                     137080..137164,137218..137438,137576..137816))
                     /locus_tag="CNA00470"
                     /product="fructose-bisphosphatase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542220|gb|CF688061.1,gi|41542228|gb|CF688069.1,
                     gi|41554097|gb|CF699938.1,gi|41570625|gb|CF716466.1,
                     gi|41570632|gb|CF716473.1"
                     /transcript_id="XM_566475.1"
                     /db_xref="GI:58258124"
                     /db_xref="GeneID:3253502"
     CDS             complement(join(136372..136830,136887..137027,
                     137080..137164,137218..137438,137576..137722))
                     /locus_tag="CNA00470"
                     /codon_start=1
                     /product="fructose-bisphosphatase"
                     /protein_id="XP_566475.1"
                     /db_xref="GI:58258125"
                     /db_xref="GeneID:3253502"
                     /translation="MAAPQATLGADLEPPATDLITLTRHILSQQYALGESATGDLTML
                     LIAIQVTSKYIASNVRKARLINLVGLAGASNVQGEDQKKLDVLSNDIMVNALSASGKC
                     SVMVSEEVDEAIIVSGIKGTYCVVFDPLDGSSNIDAGVNVGTIFGVYKVQEGSRGTVE
                     DVLRPGREMVAAGYTMYGSSCNLVLSTGNGVDGFTLDESLGEFILTHPAIKIPSRGKI
                     YSFNEGNSLHFYPPTNDYLNSIKYPENGKPYSARYIGSMVADVHRTLLYGGIFGYPDD
                     KKSKDGKLRMLYEAFPMSFLTEQAGGVATTGSQRILDIVPTSIHGRCPVFLGSKEDVE
                     DLKKFYVNYKDDSRKW"
     gene            complement(138027..140770)
                     /locus_tag="CNA00480"
                     /db_xref="GeneID:3253935"
     mRNA            complement(join(138027..138178,138462..138642,
                     138701..138838,138898..139083,139171..139291,
                     139353..139694,139767..139834,139897..140027,
                     140093..140293,140358..140382,140453..140498,
                     140586..140611,140674..140770))
                     /locus_tag="CNA00480"
                     /product="T-complex protein 1 epsilon subunit, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531066|gb|CF676907.1,gi|41531081|gb|CF676922.1,
                     gi|41534768|gb|CF680609.1,gi|41534778|gb|CF680619.1,
                     gi|41538993|gb|CF684834.1,gi|41538997|gb|CF684838.1,
                     gi|41547101|gb|CF692942.1,gi|41547113|gb|CF692954.1,
                     gi|41551460|gb|CF697301.1,gi|41551468|gb|CF697309.1,
                     gi|41552822|gb|CF698663.1,gi|41552832|gb|CF698673.1,
                     gi|41559334|gb|CF705175.1,gi|41563691|gb|CF709532.1,
                     gi|41563700|gb|CF709541.1,gi|41564229|gb|CF710070.1,
                     gi|41564232|gb|CF710073.1,gi|41573906|gb|CF719747.1,
                     gi|41575150|gb|CF720991.1,gi|41575158|gb|CF720999.1,
                     gi|41575581|gb|CF721422.1,gi|41575587|gb|CF721428.1,
                     gi|41576149|gb|CF721990.1,gi|41576160|gb|CF722001.1"
                     /transcript_id="XM_566476.1"
                     /db_xref="GI:58258126"
                     /db_xref="GeneID:3253935"
     CDS             complement(join(138048..138178,138462..138642,
                     138701..138838,138898..139083,139171..139291,
                     139353..139694,139767..139834,139897..140027,
                     140093..140293,140358..140382,140453..140498,
                     140586..140611,140674..140724))
                     /locus_tag="CNA00480"
                     /codon_start=1
                     /product="T-complex protein 1 epsilon subunit"
                     /protein_id="XP_566476.1"
                     /db_xref="GI:58258127"
                     /db_xref="GeneID:3253935"
                     /translation="MSVDQINPGQAVYAQDENGRPFIIVREQGRKVRTHGLEAIRSHI
                     LAARSVTNIIKTSLGPRGLDKILISPDGEITVTNDGATILGQMEVEHQIAKLLVEVSK
                     SQDDEIGDGTTGVVVLAGALLSSALSLLDRGIHPIRIADGYEKACEIAVAELDRVADT
                     IEFSKDDVSNLMKTAKTSLGSKIVSIAHDKFASIAVEAVLSVADLERRDVDFELIKVD
                     GKVGGSLEDTSLVKGVVIDKDMSHPQMPSVVRDAKIAILTCPFEPPRPKTKHKLDIES
                     VEEYKKLREYEKEKFLDMIKKVKDTGANLVICQWGFDDEANHLLMQNELPAVRWVGGP
                     EIELIAIATNGRIVPRFEDLTADKLGHAGVVRELTFGTTRDKMLVIEECANSRAVTVF
                     VRGSNKMIIDEAKRALHDAICVARNLVRDNRVVYGGGAAEICASVAVSKRADEIPTIE
                     QYAMRAFANALDAIPLALAENSGLSPIDTLADVKSRQVTEGNPRLGIDCLGRAENDMK
                     KQHVYDPLISKRQQFLLATQVVRMILRVDDVIDASAFGDE"
     repeat_region   141244..141287
                     /rpt_type=tandem
                     /rpt_unit_seq="cat"
                     /satellite="microsatellite"
     gene            complement(141989..>143566)
                     /locus_tag="CNA00490"
                     /db_xref="GeneID:3253503"
     mRNA            complement(join(141989..142495,142549..142749,
                     142818..143189,143263..143346,143462..>143566))
                     /locus_tag="CNA00490"
                     /product="chaperone regulator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41565906|gb|CF711747.1"
                     /transcript_id="XM_566477.1"
                     /db_xref="GI:58258128"
                     /db_xref="GeneID:3253503"
     CDS             complement(join(142052..142495,142549..142749,
                     142818..143189,143263..143346,143462..143566))
                     /locus_tag="CNA00490"
                     /codon_start=1
                     /product="chaperone regulator"
                     /protein_id="XP_566477.1"
                     /db_xref="GI:58258129"
                     /db_xref="GeneID:3253503"
                     /translation="MVADTTYYDLLEVAVDATETEIKKAYKKKAMQHHPPQNPDDPNS
                     HETFQRIGQAYETLSNPNDRATYDQYGADGPPRGGMPSDMDMDDLFSAMFGGGFDDFG
                     GGMGGGFFDPSGGRGGGRRKPAKGRDTTVPYDITLEEAFKGKKVVMSIERDRVCGGCK
                     GSGARPGVAPKECSKCSGKGVVFTDRMLGPGLVGKVKSPCPECNGEGVKLRDKEKCKK
                     CKGQKVVKEKKRIEFMIDPGTEDGERIALRGEGDEAPDIPPGDVIFLIRHLPHPSFRA
                     QPHSPGSLTILLSIRLSEALLGFSRVLFIHLDGKGVHVTSKKGERIIQPGSVWVIKGE
                     GLPIRGKGKRGDMYVRFDVEFPTTDWAKGVEVDGGESTKVELPGRKPDLGLSPEQIVV
                     RELSDKPVN"
     gene            143821..145711
                     /locus_tag="CNA00510"
                     /db_xref="GeneID:3253504"
     mRNA            join(143821..143900,143954..144436,144493..145029,
                     145083..145209,145260..145402,145471..145711)
                     /locus_tag="CNA00510"
                     /product="citrate synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531108|gb|CF676949.1,gi|41532064|gb|CF677905.1,
                     gi|41532072|gb|CF677913.1,gi|41533315|gb|CF679156.1,
                     gi|41533324|gb|CF679165.1,gi|41533439|gb|CF679280.1,
                     gi|41533445|gb|CF679286.1,gi|41533495|gb|CF679336.1,
                     gi|41533500|gb|CF679341.1,gi|41533607|gb|CF679448.1,
                     gi|41533621|gb|CF679462.1,gi|41533946|gb|CF679787.1,
                     gi|41533952|gb|CF679793.1,gi|41534674|gb|CF680515.1,
                     gi|41534683|gb|CF680524.1,gi|41534852|gb|CF680693.1,
                     gi|41534856|gb|CF680697.1,gi|41535007|gb|CF680848.1,
                     gi|41535014|gb|CF680855.1,gi|41535219|gb|CF681060.1,
                     gi|41535225|gb|CF681066.1,gi|41535228|gb|CF681069.1,
                     gi|41535239|gb|CF681080.1,gi|41535996|gb|CF681837.1,
                     gi|41535999|gb|CF681840.1,gi|41536049|gb|CF681890.1,
                     gi|41536058|gb|CF681899.1,gi|41536345|gb|CF682186.1,
                     gi|41536490|gb|CF682331.1,gi|41536497|gb|CF682338.1,
                     gi|41537169|gb|CF683010.1,gi|41537174|gb|CF683015.1,
                     gi|41537463|gb|CF683304.1,gi|41537469|gb|CF683310.1,
                     gi|41538252|gb|CF684093.1,gi|41538259|gb|CF684100.1,
                     gi|41538503|gb|CF684344.1,gi|41538515|gb|CF684356.1,
                     gi|415"
                     /transcript_id="XM_566478.1"
                     /db_xref="GI:58258130"
                     /db_xref="GeneID:3253504"
     CDS             join(143862..143900,143954..144436,144493..145029,
                     145083..145209,145260..145402,145471..145536)
                     /locus_tag="CNA00510"
                     /codon_start=1
                     /product="citrate synthase"
                     /protein_id="XP_566478.1"
                     /db_xref="GI:58258131"
                     /db_xref="GeneID:3253504"
                     /translation="MSFIASRNALRSQLRPSLARSFATTPAAYAQSLKDRMAELIPQE
                     IENVKATRAAHGAKSLGDVTVDMAYGGMRGIKGLIWEGSVLDPNEGIRFRGLTIPECQ
                     QKLPTAPGGSEPLPEALFWLLLTGEVPTDEQVKGLSQEWAARAAIPKFVEELIDRCPN
                     TLHPMTQFAIAVNALNHDSAFAKAYSNGVHKKEYWKTTFDDSMDLIAKLPNIAGRIFR
                     NVFGDGKLPPIDPSKDYSANLATLLGFGDNADFVELMRLYITIHSDHEGGNVSAHTGH
                     LVGSALSDPFLAFGASLNGLAGPLHGLANQEVLRWVQKMRSQIGEDASDEKVAEYVWS
                     TLKSGQVVPGYGHAVLRKTDPRYTAQREFALKHLPEDPLFKLVGQIYKIVPNILLEAG
                     KAKNPWPNVDAHSGVLLTYYGLHQQDFYTVLFGVSRAFGVVSQLIWDRALGMPLERPK
                     SYSTEAIKKMFEGK"
     gene            complement(144315..>145173)
                     /locus_tag="CNA00500"
                     /pseudo
                     /db_xref="GeneID:3253686"
     gene            complement(146891..149713)
                     /locus_tag="CNA00520"
                     /db_xref="GeneID:3253520"
     mRNA            complement(join(146891..146985,147040..147663,
                     147716..148221,148274..149410,149482..149713))
                     /locus_tag="CNA00520"
                     /product="peptide-binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531867|gb|CF677708.1,gi|41534893|gb|CF680734.1,
                     gi|41535858|gb|CF681699.1,gi|41548440|gb|CF694281.1"
                     /transcript_id="XM_566479.1"
                     /db_xref="GI:58258132"
                     /db_xref="GeneID:3253520"
     CDS             complement(join(146917..146985,147040..147663,
                     147716..148221,148274..149410,149482..149689))
                     /locus_tag="CNA00520"
                     /codon_start=1
                     /product="peptide-binding protein"
                     /protein_id="XP_566479.1"
                     /db_xref="GI:58258133"
                     /db_xref="GeneID:3253520"
                     /translation="MSGVPPGPPPGRPPVANVPYIPQPGAPAAPPFRPPAAPGFGFPP
                     GPPPGMPFSVGGFPHPLPPGWSEHRAPDGITPYYYNAQTRESTYIRPTFPPFPPGTTP
                     PTGSPAPGAVTPGGTGAAEEKTKKKKKEKPKDKVPIPGTGWMRITTTEGNVFYFEKEN
                     KRSEWTVPDEIKDAVAQLEEEERKKKEEKDKEEQEKIEQERIEKLKELERIRAEIDAE
                     RKKKEEAEKERKRKQREDGEDDAPEEKKAKVGGQEQEEEDVVGPEGEEDEEAWMKAVA
                     AEFAEKDAQTKKDLEEQDEKTKKEEAEAAKKVFAVPEKVNVSVEEGRALFKALLIEKD
                     ISPFAPWDQSLPLFINDPRYVLLSSMKDRREVYEEYCREVGRAKRLKKGSAAEEKKAE
                     PEKEYKALLDKEVTSTRTRWDDFRKKWKKDRRFYAFGRDDHQREKAFKQHLRDLGERK
                     RAAAQKAEEDFNTLLKESTNITSSSQWSSVKRSISSDPRYDAVGSSSLREDLFNNYIR
                     ALSSTSNPAKSNPEEQSIKEKEEAAARRLAERKAGQSAQPSESKEDAAARKLAERKAK
                     SEASLREREAKVREEKERVEREMHKSKMGAGREEAEALFRSLLVDSVKEPNVTLDEAQ
                     SYLSSDPRWNHPSLSARDKQRLFAAHSERLFSKRSNALHSLFESKTPALNTSYDDVYP
                     QIIDDPLVKRLGLQGEALEDRWRSWRRKKEHDARIEFDQMLRENSFVEFWSKMRKKTM
                     DEKALEVQEQDEYDEGEGMGEGGAADLTQLAKQIDLGEIKAVLRVRSFVLVHLCVVKN
                     ANGCGSQRDKRYTVFDHMPDEREKWLRDYLENVEAASGSKTIHNVGLDR"
     misc_feature    148811..149085
                     /note="CT-rich"
     misc_feature    149213..149257
                     /note="CT-rich"
     gene            complement(150778..152835)
                     /locus_tag="CNA00530"
                     /db_xref="GeneID:3253487"
     mRNA            complement(join(150778..151034,151100..151892,
                     151946..152082,152155..152414,152486..152638,
                     152709..152835))
                     /locus_tag="CNA00530"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534121|gb|CF679962.1,gi|41534127|gb|CF679968.1,
                     gi|41537375|gb|CF683216.1,gi|41537380|gb|CF683221.1,
                     gi|41539819|gb|CF685660.1,gi|41539833|gb|CF685674.1,
                     gi|41541736|gb|CF687577.1,gi|41541744|gb|CF687585.1,
                     gi|41546212|gb|CF692053.1,gi|41546222|gb|CF692063.1,
                     gi|41546262|gb|CF692103.1,gi|41546268|gb|CF692109.1,
                     gi|41546400|gb|CF692241.1,gi|41546406|gb|CF692247.1,
                     gi|41548320|gb|CF694161.1,gi|41548334|gb|CF694175.1,
                     gi|41550353|gb|CF696194.1,gi|41551017|gb|CF696858.1,
                     gi|41551025|gb|CF696866.1,gi|41552563|gb|CF698404.1,
                     gi|41555622|gb|CF701463.1,gi|41555630|gb|CF701471.1,
                     gi|41556513|gb|CF702354.1,gi|41556523|gb|CF702364.1,
                     gi|41556877|gb|CF702718.1,gi|41556878|gb|CF702719.1,
                     gi|41559088|gb|CF704929.1,gi|41559095|gb|CF704936.1,
                     gi|41564521|gb|CF710362.1,gi|41564531|gb|CF710372.1,
                     gi|41573481|gb|CF719322.1,gi|41573487|gb|CF719328.1"
                     /transcript_id="XM_566480.1"
                     /db_xref="GI:58258134"
                     /db_xref="GeneID:3253487"
     CDS             complement(join(150897..151034,151100..151892,
                     151946..152082,152155..152414,152486..152638,
                     152709..152820))
                     /locus_tag="CNA00530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566480.1"
                     /db_xref="GI:58258135"
                     /db_xref="GeneID:3253487"
                     /translation="MANQPEKLADAQNKDAGEKVQETEEKTVVEAVPTVEEEILNNIA
                     LIGRAVTTIEPRFTIRVLRTLTSLRKKLTKNALKTVLDDAFPKGSKTGQTLIASPIFS
                     SLPESAPAATEQQSDAMEIDSSIPAAEGTTAPTPKKKFVPPIYSATGDLLPEGIVYLR
                     LLLILANLDAGRVVEAGDFAMETADLISSWNRRTMDQLAGKIWFYVARAYELQGRLAE
                     LQPQFMAIRQTAALRKDETLEVTVLNLLLRSYLANSQYEQAEKLVSKTQFHGAANQAQ
                     TVRWLFYTGRLRAIQLNYAEARNYLQTAIRRAPKDEVAPGFVQLIHKYFIIVVLLTGV
                     IPDRALFRKPVLKQALAPYFQIVQAVRIGDVAGFQKAFQTHEATFFADSTHFLISRLR
                     HFVIKTALRTITLAYSRISLADVCIKLHLDSEEDTEYIVAKAIKDGVIDATIDPQGGW
                     MQSKVAKDLYETDEPAKQFQKRVQYCTQVYNESVRAMRYPPDAHRKELDSAAESRERD
                     REIAQLIQESDEPDDMDDMGDL"
     gene            <153345..154485
                     /locus_tag="CNA00540"
                     /db_xref="GeneID:3253486"
     mRNA            join(<153345..153468,153631..153758,153929..154050,
                     154206..154485)
                     /locus_tag="CNA00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_566481.1"
                     /db_xref="GI:58258136"
                     /db_xref="GeneID:3253486"
     CDS             join(153345..153468,153631..153758,153929..154050,
                     154206..154290)
                     /locus_tag="CNA00540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566481.1"
                     /db_xref="GI:58258137"
                     /db_xref="GeneID:3253486"
                     /translation="MARTVTSPSRGGGRSSIGEGSRKTKNTARKSTGGKAPRHSGDPK
                     SPAGPKKKHRFRPGTVALREIRHYQKSTDLLIAKLPFSRVVREVAMNVGSDEVGEYRW
                     QSSAIMALQEAAEAFLVHLFEDANLCAIHAKRVTIMQKDLQLARRIRGRY"
     misc_feature    154581..154602
                     /note="AT_rich"
     gene            complement(154609..155802)
                     /locus_tag="CNA00550"
                     /db_xref="GeneID:3253902"
     mRNA            complement(join(154609..154829,154954..155099,
                     155201..155340,155435..155488,155575..155802))
                     /locus_tag="CNA00550"
                     /product="COPII-coated vesicle protein, putative"
                     /transcript_id="XM_566482.1"
                     /db_xref="GI:58258138"
                     /db_xref="GeneID:3253902"
     CDS             complement(join(154705..154829,154954..155099,
                     155201..155340,155435..155488,155575..155694))
                     /locus_tag="CNA00550"
                     /codon_start=1
                     /product="COPII-coated vesicle protein"
                     /protein_id="XP_566482.1"
                     /db_xref="GI:58258139"
                     /db_xref="GeneID:3253902"
                     /translation="MLFRTLIPFLLALPLAFAHRIDIEAGEKECFYEVLAPQDRVTVT
                     YEVGGGGHLDIDFYVTDPQGKVIHTKNKQPQGSWSITTSQEGRFTFCFSNEMSSYTTK
                     TLSFNVHGQLYMGDDEQIAPVEQEVRDLSAGLQLVKDEQAYLVVRERVHRNTCESTNS
                     RVKWWSIAQIVILLGVCGWNIHYLKSWFEVKRVL"
     gene            156179..157681
                     /locus_tag="CNA00560"
                     /db_xref="GeneID:3253485"
     mRNA            join(156179..156230,156430..156524,156663..156814,
                     156893..157021,157115..157233,157351..157681)
                     /locus_tag="CNA00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_566483.1"
                     /db_xref="GI:58258140"
                     /db_xref="GeneID:3253485"
     CDS             join(156198..156230,156430..156524,156663..156814,
                     156893..157021,157115..157233,157351..157539)
                     /locus_tag="CNA00560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566483.1"
                     /db_xref="GI:58258141"
                     /db_xref="GeneID:3253485"
                     /translation="MAEPTETVNTGEEHDPQFEPVIRLTEQVEAKTFEEDEEPLFKMR
                     AKLFRFHKDTTEWKERGTGDVRLLKHKQSGKVRLVMRRDKTLKVCANHILSPDMKLSP
                     NVGSDRSWVYNVAADYAEGEASAETLAIRFGNSENANLFKQAFEDAQAHNASLSGAAP
                     KEEDESAAVAKPEAAAESAAPEAEAKKEEASTLEESKPEEPATGAEAETKVADAPAAT
                     EIKEEGIREADEAAAEKKDE"
     gene            complement(157905..>161984)
                     /locus_tag="CNA00570"
                     /db_xref="GeneID:3253899"
     mRNA            complement(join(157905..159969,160021..161201,
                     161242..161904,161936..>161984))
                     /locus_tag="CNA00570"
                     /product="membrane protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41568082|gb|CF713923.1,gi|41568093|gb|CF713934.1"
                     /transcript_id="XM_566484.1"
                     /db_xref="GI:58258142"
                     /db_xref="GeneID:3253899"
     CDS             complement(join(158119..159969,160021..161201,
                     161242..161904,161936..161984))
                     /locus_tag="CNA00570"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="XP_566484.1"
                     /db_xref="GI:58258143"
                     /db_xref="GeneID:3253899"
                     /translation="MSFRTLSCCSEREPFERNEATELGLTGDGHDVLRLDLVGVTGAE
                     LAGYDNSTNKLATLFTDTHAATARVYSSTTWLCNSLFPAALPEPYYPYNTTYCPLPAG
                     DFAINISIPLYRSYALTTLHTQVRIVDTSLEAASLTCLNIHVSPYDDSGWYYLLFRYW
                     LVALVAGFWLVSWGARFVTGWIVGSGVAEYGQKELAGARLMAGGSNNREATMRKWGTM
                     IISGLSGERLSVSGGLLRFVTPGVKDILFHIQYASMLGMIAVNWPEFSYPIFAQGAWG
                     NLVWNTTLVQGSNPTSKRVSIYPDNYTVPSQFSTQMTDPLYPLYLDADAFDPVLDLHN
                     SPDGMESFATAVGLRPQDLFGTCLAIFLCITAAVIFLSLLLWFLHGLSEYILTKEHKQ
                     NSPAAKRTTLGSSPRGSLGGKEALDPQTSSSEGLGVLPTQSGFFSHKSSSPSLLRRIW
                     LRFRPRGEAGAFHAAALYGNLIRLILVFHLPVTIFSMYQLCLGGRASIVSRVFAAFSF
                     AFISVLIPAYILYRVYNTPTGKLYDATRTLLSIGPMYTVYVEKKQMFRVFSLTASLIA
                     GIVVGAGQKSGIAQTIILIVVELAMLIIPGVWYPWGEGASMGAPNAFLTALRLVSVVL
                     AMLLSRTISMPGTAADWITYAILIIQAIIFVFFLLMLLTKIIEGSIRLFGGVHFDEST
                     HPLDGGIFAAIMDLDCLNPVRGGKAAERRRRKRDSRQLHKNVYAAGTLSTQMMLDRHS
                     QGVPRQTVSEGSTPMLYPVGYQPPLGPPPVDRRSSDDRSDERPSGSGNIMDAWRPVSG
                     PGYVPPGAYAPTVTSPTSPPPGSLFDNVQSGPSRGFSVVRGGRSNYQNPYDIQNLNAG
                     SDTSTPIMTMPVPTIRVSQVGQRPMSPPHSRQKSSSAIIELSTPPIQTVGLPRTTYPP
                     SPSTSQGIRPNNEGMRPPVLAIPKRRSLNDLKNENDPSPTSQYSESERQKKKGRRNAG
                     WFHRNEARAQDSESEESDDEPGPSRRKARKAALLTSGMREPEPFEDISKFEQPSGWKK
                     VLGIGKKGLDDLAAQERDENKARKAALATESGSLFAGVEAPKPSPKKKGFVVTRRSGD
                     RPGVTPISPASPESQAGTSFKVKRMGQPTPTPTRVESPAQPESAHASPISPMSPAPLA
                     GLATGSVVGPGKKKSFQVIRPATKSSVASPTGNGGSTGFVVNRRSPQSTPLENTSTPS
                     PPPPEQGGYAPSLFVPINQPDESEGLAKDPRRSSESQQRYHAL"
     gene            <162563..163778
                     /locus_tag="CNA00580"
                     /db_xref="GeneID:3253449"
     mRNA            join(<162563..162913,163016..163049,163292..163379,
                     163452..163466,163624..163778)
                     /locus_tag="CNA00580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567231.1"
                     /db_xref="GI:58259636"
                     /db_xref="GeneID:3253449"
     CDS             join(162563..162913,163016..163049,163292..163379,
                     163452..163466,163624..163636)
                     /locus_tag="CNA00580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567231.1"
                     /db_xref="GI:58259637"
                     /db_xref="GeneID:3253449"
                     /translation="MHIKERVRGRDQNCLKKGTPSSNFHHGAVKFTPMYFERPAELHP
                     SYSRLHLSSPPAIRRFQHASNEHEPTNCYPIIDLPCFTSTSLTSRNHLSISTMSERLT
                     EFAEIPRQFVKEGTLFVNRCTKPSAEEYKQLCRAVAIGFGVMGVIGYLVKLIHIPINN
                     ILVGGA"
     gene            167224..>169791
                     /locus_tag="CNA00590"
                     /db_xref="GeneID:3253743"
     mRNA            join(167224..167709,167790..167935,168803..169564,
                     169624..>169791)
                     /locus_tag="CNA00590"
                     /product="specific RNA polymerase II transcription factor,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535752|gb|CF681593.1,gi|41565884|gb|CF711725.1"
                     /transcript_id="XM_567081.1"
                     /db_xref="GI:58259336"
                     /db_xref="GeneID:3253743"
     CDS             join(167864..167935,168803..169564,169624..169791)
                     /locus_tag="CNA00590"
                     /codon_start=1
                     /product="specific RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_567081.1"
                     /db_xref="GI:58259337"
                     /db_xref="GeneID:3253743"
                     /translation="MSSIHHQVSATYEGRTGEGRTDVSPYPQQQHYPTSAQPSFQPPP
                     PISPPSSSPFAFAPPPLGTTLPPGGTSRPPLVSHHSDPPPVAQPISYSFMKQQQQLPP
                     PAPHHGSYPYVTSIPMSYRSYSGDSDRNSPQSLNGRAPAPSNPSTHSASISAQSSPLP
                     SNFQYQRQMLPGPYEAPVGQTLPDLNRSATYPQGYYNPGYASALSTEMPRSLSYPSGY
                     SQPYSYIPPLPSPTSFHPAIPGYSSLTRHHTLGTGPSYAFSSRQPVQDRPFKCDECLQ
                     SFNRNHDLKRHKRIHLSVKPFGCEKCGKTFSRKDALRRHWLVKGCRGSEGATAPIGE"
     gene            <171131..172762
                     /locus_tag="CNA00600"
                     /db_xref="GeneID:3253703"
     mRNA            <171131..172762
                     /locus_tag="CNA00600"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538646|gb|CF684487.1,gi|41538652|gb|CF684493.1"
                     /transcript_id="XM_567080.1"
                     /db_xref="GI:58259334"
                     /db_xref="GeneID:3253703"
     CDS             171131..172408
                     /locus_tag="CNA00600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567080.1"
                     /db_xref="GI:58259335"
                     /db_xref="GeneID:3253703"
                     /translation="MYLQLAASVFLVPSEQQKWSAVYLFKVYYLNLFSVYPLCMYLPK
                     KRRTTWDASSPSKRMTKRCFFFFFLWPNTYIINITRLPQHVSALDHSSSHPPITSFSE
                     NQPLTMSSSSSSSDSPSSHSSSDSPSFERSSIDISNLDTFLSSSITSPYIQETYPPTD
                     PSVVSAVSSVLKGSSFDISVPREVSAALSERSSAVEREVREIGSGKERDNGERVGKWM
                     RERAKRLGEMVESWVSSGATFAPFSSDRSSGYFSGSHNDRLSTATSIPSPGTCASTSS
                     YISSTPRSTTATAATTATTTASVELSSASRRRLATTTAANLKSSPPTIDPSTVRKIIS
                     YIRSANSNSNPPLNEEHWWTAYHALRSPSAFGTHGVPIPLSEKLARMRALRWEDVESD
                     VGYERARAKMFLGDERLAGSHLEGWGGSTFGVA"
     gene            174213..176206
                     /locus_tag="CNA00610"
                     /db_xref="GeneID:3254016"
     mRNA            join(174213..174329,174575..175046,175098..175335,
                     175366..176206)
                     /locus_tag="CNA00610"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533307|gb|CF679148.1,gi|41533316|gb|CF679157.1,
                     gi|41553210|gb|CF699051.1,gi|41574888|gb|CF720729.1"
                     /transcript_id="XM_566485.1"
                     /db_xref="GI:58258144"
                     /db_xref="GeneID:3254016"
     CDS             join(174306..174329,174575..175046,175098..175335,
                     175366..175933)
                     /locus_tag="CNA00610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566485.1"
                     /db_xref="GI:58258145"
                     /db_xref="GeneID:3254016"
                     /translation="MQSEVWTTSYSTEIFDMSAPPPVPARSRLRDAAPPKIDTSRDAR
                     DASSRLNAGNHNDNASTPATPSTPDLRVPTMPTSSSSPLSPYYRKASLQVDSVNPPTT
                     PRLNSPSTPSFTIGPSSLASPSSGPLSSFGRKRQSKVMEKDPRDPYKVKDGALKKKAS
                     SGIYTPPTFPGPSGHHLPLPQQSTSTLYTPSHSHILDAPGQSAGLGLGPMSPSQSSST
                     RSSASDHSDSTAPPRTPISPTNRFGKTMAALSGMTSPSREREEEREREEQRMKGRGSE
                     GASIAGSGSWNWSDGRSRKGSAHSHSYSHTFSYYPSGTPSLESGSSCDPHSSLEHYAN
                     PQPLVASPASVSALTPVPPPTPTPAHFYTPSSPSSPPSTASLGIHYSVEEEPGDGVEG
                     AENKVPRPSPRTKGRRKPVPRLLEDEDRNLVDRMDGLHVGL"
     misc_feature    175653..175709
                     /locus_tag="CNA00610"
                     /note="C-rich"
     gene            177801..179730
                     /locus_tag="CNA00620"
                     /db_xref="GeneID:3253483"
     mRNA            join(177801..177926,177988..178022,178079..178087,
                     178156..178178,178231..178271,178329..178410,
                     178464..178542,178604..178742,178801..179025,
                     179103..179362,179435..179730)
                     /locus_tag="CNA00620"
                     /product="disulfide-isomerase precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532758|gb|CF678599.1,gi|41532764|gb|CF678605.1,
                     gi|41534486|gb|CF680327.1,gi|41534492|gb|CF680333.1,
                     gi|41556139|gb|CF701980.1,gi|41556148|gb|CF701989.1,
                     gi|41556430|gb|CF702271.1,gi|41556441|gb|CF702282.1,
                     gi|41568260|gb|CF714101.1,gi|41568265|gb|CF714106.1"
                     /transcript_id="XM_566486.1"
                     /db_xref="GI:58258146"
                     /db_xref="GeneID:3253483"
     CDS             join(177828..177926,177988..178022,178079..178087,
                     178156..178178,178231..178271,178329..178410,
                     178464..178542,178604..178742,178801..179025,
                     179103..179362,179435..179678)
                     /locus_tag="CNA00620"
                     /codon_start=1
                     /product="disulfide-isomerase precursor"
                     /protein_id="XP_566486.1"
                     /db_xref="GI:58258147"
                     /db_xref="GeneID:3253483"
                     /translation="MRLSISISAALLAFTSLVSASNVVDLDSTNFDQIVGQDKGALVE
                     FFAPWCGHCKNLAPTYERLADAFPTDKVVIAKTDADGVGRELGSRFGVSGFPTLKWFP
                     AGSLEPIPYSGARDLETLAAFVTKQSGVKSNIKPPPPPAYTELDASNFDEIALNESKN
                     VLVAFTAPWCGHCKNMKPAYEKVAKVFSSEPDVVIALMDADEAENKPVAQRYGVSSFP
                     TIKFFPKGSKEPVAYDSGRTAEQFVNWINEKSGTHRSVSGLLSETAGRVLTLDTLASE
                     FFSANVPERSEIVKKAQEAVTTVDEKSKATANYYIKAMERITAKGEEWLTKEQARLAN
                     LLASPSLAPTKLDELKVKINILSAFAAQKAGEAYDSAEEVLEDAWDSAKQIPIQAKDG
                     LDQFADAVEEKAKRVRSDL"
     gene            complement(179766..183164)
                     /locus_tag="CNA00630"
                     /db_xref="GeneID:3253482"
     mRNA            complement(join(179766..180418,180474..181109,
                     181129..181420,181480..182113,182166..182331,
                     182381..182615,182665..183164))
                     /locus_tag="CNA00630"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532556|gb|CF678397.1,gi|41532574|gb|CF678415.1,
                     gi|41536117|gb|CF681958.1,gi|41536127|gb|CF681968.1,
                     gi|41565172|gb|CF711013.1,gi|41565183|gb|CF711024.1,
                     gi|41570895|gb|CF716736.1,gi|41570905|gb|CF716746.1,
                     gi|41575716|gb|CF721557.1,gi|41575719|gb|CF721560.1"
                     /transcript_id="XM_566487.1"
                     /db_xref="GI:58258148"
                     /db_xref="GeneID:3253482"
     CDS             complement(join(180147..180418,180474..181109,
                     181129..181420,181480..182113,182166..182331,
                     182381..182615,182665..183042))
                     /locus_tag="CNA00630"
                     /codon_start=1
                     /product="nuclear mRNA splicing protein"
                     /protein_id="XP_566487.1"
                     /db_xref="GI:58258149"
                     /db_xref="GeneID:3253482"
                     /translation="MNRAVQRSQLFNPAGQQTRSQYDPQNPGVQHRGPAGPAPQQQYQ
                     QYQQYQQPQQQGQPQQQQQQQQQQLSQQGPQSTNGTADGASGSGSTPGQEMNLASVLH
                     YLQSEWRRWERDRNEWEIERAEMRARIALLEGQRRSAENLKVDLLRRVKMLEFALRQE
                     RTKRVGAGGKLNSVPPTRLAALQDEDRLSTGDKEGSGSEGSQEDILEKPTKVNGVHSA
                     AVGKSSTIMSRSQPAEANQWKSIGVAPRDPKARARSREYLKQCLQEISYLTSPGALNP
                     LPPYPPVDPSALPQPDVSHDPNHPEVDLYERPRKELSEEPVPPLHTRKRNDEAAETKE
                     TAGSTSASEDDQVNGEKDKPIPSIPTPALPPGSSSSFPTSQPMEKSVSPSPLAFHRPG
                     LDPALLPPSDNSGPPSSPSPRTVSLPDISATKSEDEPRSPGAGKDSDEPGKQLLTAIY
                     RPDSKTAWREELKAANEEAEKAKEERARKVPDQAEDDRLTTLSLNTEEEEIKADDSVD
                     KIWVSKRSLKSHLDIVRAIAFAHGPGIMLATGGDDCTVKVWSVDSASIISHRYVLSAP
                     EISGRHTAQEIEPIMTLRGHTAAITSVAISNALSIIFSASLDSTIRLWQLPAHNHDPY
                     ATYNPSVAVQTLEGHTESVWDICLLPPQEVSPAGKEGIEGRLVSASSDGSVKLWERSG
                     SSPSASNWKLEKSFSSFGEGVIPTCLAVFNLDFGKVLVGTSDGKARLWDVDAGEEVRL
                     FGEEGQGVDSQVNAILSHPTLPAIVTAHEDGYLRFYDAKSSSTTPTHTVLAHPAPITS
                     LALSPSSPTCILTSSVDCTVRLWDLTKKTSIQELAGHRGRADEGVCAVASHPELPVIG
                     SAGADGVVRLWGLA"
     repeat_region   182828..182925
                     /rpt_type=tandem
                     /rpt_unit_seq="ctg"
                     /satellite="microsatellite"
     gene            183976..186688
                     /locus_tag="CNA00640"
                     /db_xref="GeneID:3253742"
     mRNA            join(183976..184487,184543..184609,184666..184744,
                     184804..184821,184876..184948,185009..185175,
                     185226..185357,185413..185601,185663..185740,
                     185804..185810,185879..185889,185950..186051,
                     186113..186178,186235..186274,186333..186396,
                     186452..186688)
                     /locus_tag="CNA00640"
                     /product="integral to plasma membrane protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532095|gb|CF677936.1,gi|41532105|gb|CF677946.1,
                     gi|41542777|gb|CF688618.1,gi|41542790|gb|CF688631.1,
                     gi|41553531|gb|CF699372.1,gi|41553542|gb|CF699383.1,
                     gi|41565829|gb|CF711670.1,gi|41565836|gb|CF711677.1,
                     gi|41566496|gb|CF712337.1"
                     /transcript_id="XM_567082.1"
                     /db_xref="GI:58259338"
                     /db_xref="GeneID:3253742"
     CDS             join(184054..184487,184543..184609,184666..184744,
                     184804..184821,184876..184948,185009..185175,
                     185226..185357,185413..185601,185663..185740,
                     185804..185810,185879..185889,185950..186051,
                     186113..186178,186235..186274,186333..186396,
                     186452..186580)
                     /locus_tag="CNA00640"
                     /codon_start=1
                     /product="integral to plasma membrane protein"
                     /protein_id="XP_567082.1"
                     /db_xref="GI:58259339"
                     /db_xref="GeneID:3253742"
                     /translation="MSAQEFYQGGNQRGYQQQQFPPPPGGPPQDQNGGKQEYVPPQGQ
                     PPNYNMKPSQPYASTNPETGGQPVYQDTAPFSQANEKTGERMNPRKRVNDIIPLILFI
                     AAVVGFAVVSGIAIHGFVQVNGLGGGMGDSSIGRTGSSITLDYHTVYLLLVVVALGLV
                     IASLYLAALRAFTKIILEVTLALTVILNIGICIYYFIIQYWSGAIIFLIIALVSVFFY
                     WGMRKRIPLAKLLLQTTIDVTKHHPSVYVVVFIGLIIQAAVSVWYTFTCIAIYVKWTP
                     GSAACSDGGCSSSKVAGLVFYATFSYLWLSQVIGNVILCTLAGGVFGGWYYYGPRTPG
                     GGVPKRASLLAFVRASTLSLGSIAFGSLLVTILELLRLILQLFRQYEAGQGDMIGSIL
                     ICIAQCCIGCIQWMVEYFNKYAYIEIALYGKSYIPAAKDTWRLLKDRGIDALVNDSLV
                     GTALMWGAYINGFLCAVLGYFYLRFTHPAYNSDGQYSAPVILFSFLIGLNESFTVGSA
                     IDAGVSTIFVGLGEDPMVLAERSPGLFEMIRQVYPRVVQGVPH"
     gene            complement(<186981..>187605)
                     /locus_tag="CNA00650"
                     /db_xref="GeneID:3253481"
     mRNA            complement(join(<186981..187221,187288..187442,
                     187528..>187605))
                     /locus_tag="CNA00650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566488.1"
                     /db_xref="GI:58258150"
                     /db_xref="GeneID:3253481"
     CDS             complement(join(186981..187221,187288..187442,
                     187528..187605))
                     /locus_tag="CNA00650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566488.1"
                     /db_xref="GI:58258151"
                     /db_xref="GeneID:3253481"
                     /translation="MSPQEQNNEPSQMTGQLNSASGLVQQAIGNVVPESMGASSWIQS
                     GHKLQKEGQNEVDAAKAQKAGAATVDSGIGKVKSVFGYVTGDQEKQTEGNTQAEKAQW
                     DYKQATSDSIAAIPIPSVEGAKGKLESVVGMAAEDPEKQKEGNVRAEKAAWKDGV"
     gene            187936..>190270
                     /locus_tag="CNA00660"
                     /db_xref="GeneID:3253763"
     mRNA            join(187936..188270,188324..188402,188460..188466,
                     188527..188564,188618..188693,188814..188957,
                     189005..189045,189093..189254,189314..189406,
                     189462..189684,189738..>190270)
                     /locus_tag="CNA00660"
                     /product="A/G-specific adenine DNA glycosylase, putative"
                     /transcript_id="XM_567083.1"
                     /db_xref="GI:58259340"
                     /db_xref="GeneID:3253763"
     CDS             join(187960..188270,188324..188402,188460..188466,
                     188527..188564,188618..188693,188814..188957,
                     189005..189045,189093..189254,189314..189406,
                     189462..189684,189738..190270)
                     /locus_tag="CNA00660"
                     /codon_start=1
                     /product="A/G-specific adenine DNA glycosylase"
                     /protein_id="XP_567083.1"
                     /db_xref="GI:58259341"
                     /db_xref="GeneID:3253763"
                     /translation="MRPDSSSPSIYSVSDSDSSDYAPSVSETKRSSIKRKRAAPASTK
                     SRTKTTIVKQARGKGKAVDNIEDIENLGATVSRRHGMDYHSVDKIVDEKESLLEWFEC
                     VREKRGMPWRKKYDPSLSFEEKGQRAYEIWVSEVMLQQTQVTTVIAYWQRWMERWPTI
                     SDLAKADVEVRGLGYYRRARSLLAGAKTVMGNSKYNGRLPDDPAVLEKEIDGVGRYTA
                     GAICSMAYGVRTPIVDGNIHRLLTRLLAVHAPQTGPATIKFLWRVADELIKHLPSGDK
                     HNNVVGDWNQALMELGSQVCKPANPECGVCPLKKACKGYAELSNSPSQPSTTKSDCKL
                     CAPIPCDIETDRIPTVMVFPMKKEKKASRVEEETVCIVQWRGDGDQRRWLFTKRPEKG
                     LLAGLFEPPTTPVSAGLSSSERLGASLEALSDYIEITEGEAEGLQKSSRDVGNIPHIF
                     SHINMTYHIHLLTLTSPGNEPPSVKPKAPRPAVWLNEEEVEKANVGTGVKKVWAEIYG
                     SWGSFEESEAGAILAKKQKRTNNKLTKPKPVVANRNEKIVKKVMMPPMPTTRKNVVDA
                     VE"
     gene            191885..194717
                     /locus_tag="CNA00670"
                     /db_xref="GeneID:3253894"
     mRNA            join(191885..192315,192364..192449,192499..192812,
                     192872..194717)
                     /locus_tag="CNA00670"
                     /product="sulfate transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538564|gb|CF684405.1,gi|41538572|gb|CF684413.1"
                     /transcript_id="XM_566490.1"
                     /db_xref="GI:58258154"
                     /db_xref="GeneID:3253894"
     CDS             join(192013..192315,192364..192449,192499..192812,
                     192872..194676)
                     /locus_tag="CNA00670"
                     /codon_start=1
                     /product="sulfate transporter"
                     /protein_id="XP_566490.1"
                     /db_xref="GI:58258155"
                     /db_xref="GeneID:3253894"
                     /translation="MGLIKSSLGNSNKGKFVDCSTPPLHNSSFIRIQEDSSSTAAART
                     STQEDLHASMSPDIKPSFRPEVVKSKIKHYFGYTETTPETVSVFDWARSQTPALGPGI
                     KAYILSLFPFIQWVPRYNLTWLFGDLVAGITVGMVLVPQSLSYAKIAELEPQYGLYSS
                     FIGVLTYAFFATSKDVSIGPVAVMSLETGNIILSVQDKYGDLYSKPVIATALAFICGF
                     IVLGIGLLRIGWLVEFIPQPAVSGFMTGSALNIAAGQFPAVFGLSKKFDTRAATYKVI
                     INTLKYLPQASLDTAFGMTALAALYGIKWGFTWLGKRYPRYGRITFFCQSLRHAFVII
                     IWTIISWRVNVHAASPRISLVGNVPSGLQHVGRPFIDSQLLSAIGPHIPVATIILLLE
                     HISIAKSFGRLNGYKINPNQELIAIGVNNTIGTLFSAYPSTGSFSRSALKSKAGVRTP
                     AAGLATGVVVIVALYAVAPAFYWIPNAALSALIIHAVADLVASPKHSYSFWRVAPIEY
                     VIFVGAVLWSVFYTIESGIYWSLATSVVLLLLRIARPKGHFLGRVRIKPEAGNTLEHI
                     RDVYVPLDEESSGEDVKVENPPAGVIIYRFEESFLYPNASYINDRLIEQAKKVTRRGG
                     DYSKVAAGDRPWNDPGPSKKNAAAVIEADMVKPVLKAVILDFAAVANLDTTGVQNLID
                     TKTEMEKWADGPVEFHFCGILSPWIRRALVAGGFGQGRAKEGAALEVAPAVIENLENA
                     ASPGMERERYNEHEVSFIHEVGQASNSTSAGTSFSEEEKRIGSGATTPSPQLDGVNER
                     RPSGVSTKTVPLLDRSTPFFHFDLADALNSLNLPENE"
     gene            195348..199819
                     /locus_tag="CNA00680"
                     /db_xref="GeneID:3253476"
     mRNA            join(195348..195827,195886..197009,197055..197130,
                     197178..197526,197577..197669,197731..197869,
                     197920..198018,198069..198201,198252..198451,
                     198501..198825,198880..199043,199094..199564,
                     199621..199819)
                     /locus_tag="CNA00680"
                     /product="vacuole protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537888|gb|CF683729.1,gi|41537898|gb|CF683739.1,
                     gi|41541288|gb|CF687129.1,gi|41541297|gb|CF687138.1,
                     gi|41567566|gb|CF713407.1"
                     /transcript_id="XM_566492.1"
                     /db_xref="GI:58258158"
                     /db_xref="GeneID:3253476"
     CDS             join(195523..195827,195886..197009,197055..197130,
                     197178..197526,197577..197669,197731..197869,
                     197920..198018,198069..198201,198252..198451,
                     198501..198825,198880..199043,199094..199564,
                     199621..199676)
                     /locus_tag="CNA00680"
                     /codon_start=1
                     /product="vacuole protein"
                     /protein_id="XP_566492.1"
                     /db_xref="GI:58258159"
                     /db_xref="GeneID:3253476"
                     /translation="MPARDPNASPHVPSTFPNRPVSPINSQHPNTLSPNASGFSVRTV
                     QSNNGVLSLPSPDHQQPHGYFTQALRRVSGTGGHNLPRMEAPASAGQDVPAERNGWDD
                     TSFHIQAGSTTSQAIRDSTARLASVSFSTRPRAFSSASQGDSSYSHSALSSRHASVNH
                     GPTHSVATSATEHRPIYPSHLNPAISKPGPTPVLEDDERDEVSPSKGLQALPASPFTG
                     AKSGLSMMLERDKEERRVRGLTEAASLRSKRSGSSIGKLASDEEESGERTPMPRRSSL
                     VDDILEVPTTEGNARMSHAGSSSSLRRFLANEVNEEELGQAPDERSLLLGDGRERKKR
                     SWAGEALSNIEGWKNNLLKVTPKDVVEGIILEPIRTLPSVILGLLLNVLDGVSYGMIL
                     FPATPIFVDFGSLGVSMFFVSCIVSQLVFSLGGSIFPGGNGSMMIEAVPFFHILINTF
                     EQVCGDDDKAIIATTMVAFAFSSILTGLVFFALGAFKLGSLIGYFPRHILVGCIGGVG
                     VFLIETGLEVSRGLKEEGFEYNLATLKLFFESGHAIALWTIPLALAILLRVITHFWHH
                     QLIFPAYFFIIPVIFYIVIAIGRWDLQHLRKMGWVFDVGTNTQAWWKFYTLFDFRKTN
                     WEAFWAAMPTQLALVFFGILHVPLNVPALGVSLSEDNVKLDRELVAHGASNMLAGLTG
                     TVPNYLTYVNTVLFYRVGGGSRLSGLMLAMGTAAIMMIGPAVIASLPVMVVGALIFVL
                     GIDLLMEAVWDTRHRVNKMEYITIWAIAIGMTVFDFVIGLLFGIILACIFFVVQSSRR
                     RAIRAVFNGATARSTVRRPKWQRSFIQQVGSQTYVMKLQGFLFFGTITTVEDEIRKLL
                     DLAKWQHNPIRFLIIDFALVHGLDFSSAEAFVRVQRLLAAKDVLLIMCGAKSDGLVGT
                     ALQGVGLWADREGTRVEVFESLNDALEWTENVYLTAFLENQQLMDCETTTKVMDFPKI
                     AKPPFSLSESFQNSPRRSHLVKAGGDTIFQTSYASKDDDEPSTPPPEEPLAQPIPVLL
                     QTFGAYSASSVSSISTSFCKSLAPYFTKSSIMPGDTLWMQGDPADGMYIIEVGCLRAT
                     YAYNDTTNLVQETMVAGTMAGDMSALSETTRNCSVVAERESVLWKLSQERLDQMVKEQ
                     PEVAQAFIKMVLKAVAEEQDVLSSHLIAVLS"
     gene            202164..203550
                     /locus_tag="CNA00690"
                     /db_xref="GeneID:3253473"
     mRNA            join(202164..202733,202784..203550)
                     /locus_tag="CNA00690"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543629|gb|CF689470.1,gi|41543640|gb|CF689481.1,
                     gi|41566786|gb|CF712627.1,gi|41566792|gb|CF712633.1"
                     /transcript_id="XM_566494.1"
                     /db_xref="GI:58258162"
                     /db_xref="GeneID:3253473"
     CDS             join(202638..202733,202784..203446)
                     /locus_tag="CNA00690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566494.1"
                     /db_xref="GI:58258163"
                     /db_xref="GeneID:3253473"
                     /translation="MATVTATMDDLIASLSGNMHVSQEGYDLKALHEFLAQNLPLSFP
                     SPTAYAYPVAPRPPPLSRKPSSLPSYTHPSPTPTSLPLPYTQAPHPPVSYERPQSSQT
                     PAQRPALPRRASSFGTVPHSYAPAASNYQAPEPSYAAFESDAFAPFWQGAVEETGRED
                     PWARIRGAPTGDFGFAAAQEQPQITDGGGKHEYQWGLQLGGCGQSQRKVMAAQSNEDV
                     GMDMDEDEDMEDNELVESMMECGDEDDTWRRDKW"
     gene            complement(204280..205893)
                     /locus_tag="CNA00700"
                     /db_xref="GeneID:3253472"
     mRNA            complement(join(204280..205180,205239..205893))
                     /locus_tag="CNA00700"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41552989|gb|CF698830.1,gi|41552996|gb|CF698837.1,
                     gi|41575095|gb|CF720936.1,gi|41575103|gb|CF720944.1"
                     /transcript_id="XM_566495.1"
                     /db_xref="GI:58258164"
                     /db_xref="GeneID:3253472"
     misc_feature    204365..204554
                     /note="CT-rich"
     CDS             complement(join(204530..205180,205239..205868))
                     /locus_tag="CNA00700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566495.1"
                     /db_xref="GI:58258165"
                     /db_xref="GeneID:3253472"
                     /translation="MRSCPDHLVYTNGHIEPVTDPMKRAWVFKNREAFLANRVIHSLD
                     DQSVLMSDEDYEAVRKLVSAAMVDTGEQASRVIQDYSKALESLEEARRRQLATSQDSK
                     FALDLSKQPYSMRRQTKPSWPRDDASRAFCSWAWRQVHEEHSRVPGTTVSLSLENSDL
                     DLAPFTTDNGRRLRSRLQESAKLYWNAREIEDECFNSSAMPLKYVHLQSHGYKEDDDS
                     VRFQRTDHHLMHLWRSDVLLTSLATGRSLTADETWSLIPLSLYQDFIQHQSKSRTNFN
                     ERKITRKKPTSFLALNDPEWRSWFQEMVTISHGKKRFLTMSELPTSGHESLFNAVRDI
                     RAGKGKRFIRSRYGEESEPLTIQKYLEDIDPLQRFMDVNKSLVSSSLTDDEVVSRLPP
                     KAYHRWKEISGANEGLSIKEMIRDSYKVERELRE"
     gene            complement(206616..209983)
                     /locus_tag="CNA00710"
                     /db_xref="GeneID:3253470"
     mRNA            complement(join(206616..206812,206874..207139,
                     207198..207835,207887..208965,209021..209107,
                     209144..209426,209482..209724,209779..209819,
                     209874..209983))
                     /locus_tag="CNA00710"
                     /product="pre-mRNA splicing factor prp1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531257|gb|CF677098.1,gi|41531264|gb|CF677105.1,
                     gi|41537858|gb|CF683699.1,gi|41541129|gb|CF686970.1,
                     gi|41541132|gb|CF686973.1,gi|41566787|gb|CF712628.1"
                     /transcript_id="XM_566496.1"
                     /db_xref="GI:58258166"
                     /db_xref="GeneID:3253470"
     CDS             complement(join(206669..206812,206874..207139,
                     207198..207835,207887..208965,209021..209107,
                     209144..209426,209482..209724,209779..209819,
                     209874..209933))
                     /locus_tag="CNA00710"
                     /codon_start=1
                     /product="pre-mRNA splicing factor prp1"
                     /protein_id="XP_566496.1"
                     /db_xref="GI:58258167"
                     /db_xref="GeneID:3253470"
                     /translation="MSNVGTVKHIPKEVRYNFLNMAAPASYVAGLGRGASGFTTRSDI
                     GPARAGPSAEVVAEAQARRGEEEIPDPDAFQDPDDERNLFAGTVYEADDEEADRVWDS
                     VDARMDARRKARRDAAEAKAAAEERARNPKLQTQFADLKRSLSSLNDADWDAIPEAGN
                     LTGKRRKANLRLEENQNGRSYNVSDTVIADAVKRNAMVGELDPAEVGNLAGIGIDGTE
                     TDLVSIGNARDRVLSLQLDQATRDASNGSSTSIDPKGYMTALNSQIVQTDAQIGDIKQ
                     ARQLLQNLIQSNPKHAPGWIAAASLEVHAKKMVAARKIIAEGCEKCPKNEDVWFHAAE
                     LNTPENAKVILGRAIQHVPQSVKIWLKAASLETDINAKKRVLRKALEFVPNSVGLWKE
                     TVNLEDDPEDARVLLTRAVEVIPNSVELWLTLARLETPENAKQVLNSARKRIPTSHEI
                     WIAAGRLAEQSPSAVAVKPEVKMEDEAEYEAEQRKKLAQQVNKLMAGAVNSLRKNQVI
                     LSREQWLQEAEKCEQDGSPLTAQAIVKATIAQDVEEEDRRSVWIEDAERATKGGFYEV
                     ARACYAVTLEAFPNTPSVWRKAAEFEKAHGTPDAVQEILAQGSQHCPHAEVLWLMAAK
                     EKWVGGDIPGAQAILAEAFKQNEDSESIFLAAAKLAAETGEMEAAIQILEKAKAQADT
                     ERVWMKSAVLLRQLGKLDEALSTLEVAIKKFASFDKLHMIRGQIYESRNEVALARNAY
                     AQGCRSCPKSIPLWILSARLEEKAGVTIKARALLEKARLHNPKNDELWAESIKIEERT
                     GSPQQAKSVLARAMQECPASPLLWSMAIFMETPQQRKGRSVDAIKKAGEHPAVILAVA
                     RNFWSERKIEKTRQWMANAITADEDWGDAWGYWLKFERQHGEKERQEAVVEKCIAASP
                     RHGPVWQSVSKDLANVGKSTKEILELVADKLE"
     gene            210168..211342
                     /locus_tag="CNA00720"
                     /db_xref="GeneID:3253480"
     mRNA            join(210168..210250,210305..210652,210703..211342)
                     /locus_tag="CNA00720"
                     /product="nucleotide binding protein, putative"
                     /transcript_id="XM_566489.1"
                     /db_xref="GI:58258152"
                     /db_xref="GeneID:3253480"
     CDS             join(210172..210250,210305..210652,210703..211271)
                     /locus_tag="CNA00720"
                     /codon_start=1
                     /product="nucleotide binding protein"
                     /protein_id="XP_566489.1"
                     /db_xref="GI:58258153"
                     /db_xref="GeneID:3253480"
                     /translation="MADIIETPVSRRLSTVKNIIIVLSGKGGVGKSSSSVQLALSLLA
                     QSPTNRVGLIDLDITGPSLPRMVGLDTPTATVHQSSAGWVPVYVDQGRRLGVMSIGFL
                     LKDRGDSVVWRGPKKDGMIRQFLSEVRWGDLDYLVIDTPPGTSDEHISLLTHLHPLFT
                     PTMSNATTPTSILISTPQTTALNDTLKSLSFTRKLSLPVMGLVENMAGYVCPCCGEIS
                     DTFGKGGGEAMAHKEGVGFLGRVPIDTVLVSLLDAVSKGEVLGEGAVEHTSDEAAEGQ
                     TNGSTEHFPLLDKYLETTSSKVWKDITQKLVDKIEQHKSDIRARLESSSETLAIA"
     gene            complement(211382..214583)
                     /locus_tag="CNA00730"
                     /db_xref="GeneID:3253897"
     mRNA            complement(join(211382..211561,211613..214065,
                     214119..214583))
                     /locus_tag="CNA00730"
                     /product="protein complex assembly-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539342|gb|CF685183.1,gi|41539350|gb|CF685191.1,
                     gi|41556742|gb|CF702583.1,gi|41556758|gb|CF702599.1,
                     gi|41567237|gb|CF713078.1,gi|41567251|gb|CF713092.1,
                     gi|41569588|gb|CF715429.1,gi|41569596|gb|CF715437.1"
                     /transcript_id="XM_566491.1"
                     /db_xref="GI:58258156"
                     /db_xref="GeneID:3253897"
     CDS             complement(join(211496..211561,211613..214065,
                     214119..214530))
                     /locus_tag="CNA00730"
                     /codon_start=1
                     /product="protein complex assembly-related protein"
                     /protein_id="XP_566491.1"
                     /db_xref="GI:58258157"
                     /db_xref="GeneID:3253897"
                     /translation="MAASYRGSEEPSPEIPSTQFIPEANDADNLYEAVEIMDERGAPV
                     DGEYLIKWSGTDEYGRPWKPSWEKKSGCTDALIMEWKEKKRRHPTIVGKEGEKLKKLE
                     KQERAPKTKKRKRKSEITVKREPGVTPVKKSRTSVGKVAARSTASVDSPASTSKAGRK
                     SRVSLASISAGTLSESPAPVAGPSRSRSSVNDHEDVSEDSEGSTHATRRGGMTRFRSR
                     ESQIEPNSPEVQRSRAPLLKSLSAKATSPPKSDQRPKKSVTTLSGPKSRESPSQSSLQ
                     RTVIPSHLLSPNSRARNGDKSPLFLPNSSLESNDTVEPSHTIGSAVTSQIEAIERFSS
                     PPFMRHELLARGQEEVRRLAEGGRSGVYRAGDSDDEELQVIAKPPNKGKGRANENIDD
                     DEEVVEADNILSSPNFNLNEFPSSKRPASVARGPSPYGQHPAVVDLENAKKKVTLLEG
                     ELTYSEKARKKAEERPKDFIDPAELSKAKKDIERLKAELKDAQDARISAEDLLAHSGN
                     DEATKISKLREQINGLRERLMAVQAEKGDLEEKLKENPGSKELAEVQKELDEQLKEKK
                     GLELEKESFKLLLSSLNDDLDAVKKELQISNAQNAKLEKKVNDSDSAELVKLRKEIED
                     LRAKLGSVTMEKEELKHQLMNHPDTAELAKVREQVKDFNSVINQALFEKKKLEEYLAN
                     HPDTAALADARSELKSLSSQLEEAKQSLSSSDAEVELLRERIASAERSHKNLVEDNAF
                     MRKQYDEASNRAVAEVQQANLLRDQIKHLTGQLKFGLKQREIFNATVAAQRNDETRKL
                     RAQVKVLLDQSRRTDDDIRHKAQFYKKYKAEYDNIVRTASEQSDKIERLEERVETLVD
                     KLETLRAVKMGAFDVDESEHEEGNRRKTVSPIRFHTPDEGPTAARLPFPDTSADGNVF
                     NVPVQQEAQANGPVIKEGGEGYVCKWRVGDETCQVVCDTVEEIHTHAIAHQRAELEAK
                     GIII"
     gene            215416..218690
                     /locus_tag="CNA00740"
                     /db_xref="GeneID:3253474"
     mRNA            join(215416..215726,215824..215898,215951..216083,
                     216134..216553,216785..216966,217019..217258,
                     217308..217365,217417..218690)
                     /locus_tag="CNA00740"
                     /product="glutamine-tRNA ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41549396|gb|CF695237.1,gi|41549403|gb|CF695244.1,
                     gi|41558960|gb|CF704801.1,gi|41559955|gb|CF705796.1,
                     gi|41559957|gb|CF705798.1,gi|41561520|gb|CF707361.1,
                     gi|41570373|gb|CF716214.1,gi|41570380|gb|CF716221.1"
                     /transcript_id="XM_566493.1"
                     /db_xref="GI:58258160"
                     /db_xref="GeneID:3253474"
     CDS             join(215432..215726,215824..215898,215951..216083,
                     216134..216553,216785..216966,217019..217258,
                     217308..217365,217417..218590)
                     /locus_tag="CNA00740"
                     /codon_start=1
                     /product="glutamine-tRNA ligase"
                     /protein_id="XP_566493.1"
                     /db_xref="GI:58258161"
                     /db_xref="GeneID:3253474"
                     /translation="MPPKFDPNSPENAPLIQLFQSLGLASNSATELVRQPKSGKAFKS
                     LIDEYGLTNNKYDEKQAGALVKLSSVSAKLGSEQKDFLVQKIVKGDVKTPDQVTAAVK
                     FAEKNPDLKANEEAFDKECGVGINITLADLPELLKSYITSLPSPPEGWNSLGPILGGI
                     KGGASDLRWANATEVKSTLESIFVSLFGTKEAAAAAAAAKPKAKAPKAAEKPVKPVST
                     TAAVATKSSSATPAIPTNIFEEGFLSEFHKVGENPQSDPKLKEEHLAWTKGQVYTRFP
                     PEPNGYLHIGHVKAIMVDFGYAKYHGGRTYLRYDDTNPEAEEGRYFQSILETVRWLGF
                     EPWKITYSSDNFDRLYELAVELIRRGKGYVCTCDAEKIKEDRGMGKGNPIPCVHRDRP
                     IEESLHEFERMKNGEYKEKEACMRMKMDLNSGNPYMWDTVAYRVKKAPHHRTGDKWKI
                     YPTYDFTHCLCDSIENITHSLCTIEFIPARESYEWLCDALSVYKARQYEFARLNLQGT
                     FLSKRKIAKLVQNGHVKDWDDPRLYTIIALRRRGIPPGALLSFVSELGVTNIPSTTEI
                     QKFESCVRGYLESSAPRLMMVLNPIKIIIDNVPDDYRVQVEVPLHPKIPAMGTVQTIF
                     TKEVYIDADDFREVDSPDYFRLAPGKSVGLFKAPYPVTCTSFTKDPVTGRVTEVHCTL
                     AGEGFKKPKAYIQWVNAPEAVKIDEVRYFKKLFKSDPPPADYEADVDPDSLEVYSNAV
                     IEPAFYELAKKQISDARKDSEERTKKAVEQAAKPDTSSAPVEGSAAAQHKDEEPVATA
                     EQLVGNENIRFQGMRLAYFTLDRESKLGCLEKEDVKGRSEGDKIILNRIVSLKEDAGK
                     SA"
     gene            complement(218705..>219753)
                     /locus_tag="CNA00750"
                     /db_xref="GeneID:3253892"
     mRNA            complement(join(218705..218974,219023..219290,
                     219353..219427,219542..219641,219751..>219753))
                     /locus_tag="CNA00750"
                     /product="histone binding protein, putative"
                     /transcript_id="XM_566497.1"
                     /db_xref="GI:58258168"
                     /db_xref="GeneID:3253892"
     CDS             complement(join(218800..218974,219023..219290,
                     219353..219427,219542..219641,219751..219753))
                     /locus_tag="CNA00750"
                     /codon_start=1
                     /product="histone binding protein"
                     /protein_id="XP_566497.1"
                     /db_xref="GI:58258169"
                     /db_xref="GeneID:3253892"
                     /translation="MVNIRNIELLNNPAKFDDPYNFRIKFEAIAPLVEDLDWRLIYVG
                     SASSEEFDQELDNCSVGPIPAGINAFDFSAPAPAHHLLPSVEPDEILGVTVIIITASY
                     REKEFVRVGYYVNTYYEDEELKENPPSVVQWDKLHRNVLIEKPKVTRFQNNWDSAPQL
                     NTFDGQQPAAELPPSGGNPELFNAPLPPPVQRATAAGGMDVDQPMA"
     gene            220022..222388
                     /locus_tag="CNA00760"
                     /db_xref="GeneID:3253468"
     mRNA            join(220022..220499,220550..221319,221375..221549,
                     221601..221818,221867..222388)
                     /locus_tag="CNA00760"
                     /product="tRNA (guanine-N2-)-methyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534115|gb|CF679956.1,gi|41566240|gb|CF712081.1,
                     gi|41566251|gb|CF712092.1"
                     /transcript_id="XM_566499.1"
                     /db_xref="GI:58258172"
                     /db_xref="GeneID:3253468"
     CDS             join(220086..220499,220550..221319,221375..221549,
                     221601..221818,221867..222290)
                     /locus_tag="CNA00760"
                     /codon_start=1
                     /product="tRNA (guanine-N2-)-methyltransferase"
                     /protein_id="XP_566499.1"
                     /db_xref="GI:58258173"
                     /db_xref="GeneID:3253468"
                     /translation="MTTQPRYTVPLKEPHPDNHSLHTESTTTIFLPNEGAFLNPVQHY
                     NRDMSVAVIRAWNEMRKEELEEKWRIRLERRGGKPRPKKKKNKKATEGEAKAVTIDAE
                     EEKAEKEGTMEVEGNALAEVKEGEEPVAGPSNGAGVSKFRAPSINILEALAATGLRSI
                     RYAKEIPNVKYVLANDLSPSACEAMRRNVEFNGVGMDYEAPVKEEQEPKAEVVEMPRD
                     EANEEIKEGGAVEHVEKKQEVQPEVKDEVGRRPGCRGRVKINEGDACAFMYNHRSAVG
                     PSARVDVVDLDPYGTAAPFLDAAIGCISDGGLLAITCTDLAVLAGQQYPEKCYSNYGG
                     TNVHAEYTHEAALRLVMHSLASVAARYGRYITPLLSFSIDFYVRLFVRIDTRPEQVKH
                     LASQTGVVFTCQYCQTAVNQPFGKVISKETAKGKEMTAFKTVAGPTAGNGSACEECGG
                     TMHLGGPLWLGPLQDNEFAKRVIKEIESTEKEYKTYNRMLGMLTLASQELPHPWFFTA
                     NRIAKSVHAPSLPMNKILSALLNAGYKISRSHCSPGAVKTDAPRSFIYDIMREEAKEN
                     PVRMDKIAEGSPARKILAKPITHTIDFTPHPDASLERQGKETFYQVNPLPNWGPAPRA
                     KSLGEKRKAEVDAENGEGDAVVGGEGVKRIKVVVEEEEMMNA"
     gene            complement(222721..225008)
                     /locus_tag="CNA00770"
                     /db_xref="GeneID:3253465"
     mRNA            complement(join(222721..224637,224694..225008))
                     /locus_tag="CNA00770"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531517|gb|CF677358.1,gi|41531525|gb|CF677366.1,
                     gi|41576456|gb|CF722297.1,gi|41576460|gb|CF722301.1"
                     /transcript_id="XM_566501.1"
                     /db_xref="GI:58258176"
                     /db_xref="GeneID:3253465"
     CDS             complement(join(222853..224637,224694..224954))
                     /locus_tag="CNA00770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566501.1"
                     /db_xref="GI:58258177"
                     /db_xref="GeneID:3253465"
                     /translation="MALFPSTRSLIFPQFETYRLRSLDPSTDLSFSPLPQPGATQSRM
                     GYNQQHLSFKEVRSRIGWDHLSVSGRRGVYIDKVWGVVGFVIQDDLTPTFVKLADLPE
                     PISISEQQSEFPSVLPLSSTQWAISTGNGSIYILQSSSPESENFTGEIIARYDLHVDG
                     QSGVEPAPFLLRAHHDLSDSDVRLLLTRSLHPNQGKVGYKSVQSTQFQLLEISLNPSV
                     RNGVDSQPGKLEVKWALQGKDLPVWCAWQEDGWLILGEEEFREKVDESGQEETEDEKS
                     KREREEKIARLGLGASLPADESALVNDKKDESMEVDEARGNPYSWTQDAEYLHLTIPV
                     PDSVSRAVINIGFTSTNFSFTLSQTPSDLSPQLMELLSKPTRQLWTSIDVDASTWTFD
                     SSKHIIEVDLKKIDENTRWPSVFFPAEDDDDAYEEVPETLSASTLAAVRETFNTIKTR
                     GPDEPEMMHPAMPALLREEMDFDLDDGEDFGEGSGAYGELGGGNRVGRDVLVGYVEAG
                     SGKASWSKSTNSVLSVPINGSDGNSIIVKQAVDGLVFRPTTDLSKKPWTHISTNPALA
                     FVISSKHDLRFVRHLITSPTSHDPTSPSAFKKPKIDPEPVQSTVLAFDSGSSSAGQGN
                     VYIYYPATSKTNAQQGVLSISGGERGALLGVGCVKVDGKDVVVALCENELVVLKGVL"
     gene            complement(225482..227010)
                     /locus_tag="CNA00780"
                     /db_xref="GeneID:3253464"
     mRNA            complement(join(225482..225654,225714..225934,
                     225997..226007,226060..226163,226226..226293,
                     226348..226435,226495..226600,226695..226798,
                     226939..227010))
                     /locus_tag="CNA00780"
                     /product="prohibitin PHB1, putative"
                     /transcript_id="XM_566503.1"
                     /db_xref="GI:58258180"
                     /db_xref="GeneID:3253464"
     CDS             complement(join(225566..225654,225714..225934,
                     225997..226007,226060..226163,226226..226293,
                     226348..226435,226495..226600,226695..226798,
                     226939..226972))
                     /locus_tag="CNA00780"
                     /codon_start=1
                     /product="prohibitin PHB1"
                     /protein_id="XP_566503.1"
                     /db_xref="GI:58258181"
                     /db_xref="GeneID:3253464"
                     /translation="MAAAQRISRLIVPLAIGATVVQSALYDVPGGYRAVLFDRFSGVR
                     PDATGEGTHFLIPWLQRAILYDVRIKPRNISTTTGSKDMQMVSLTLRVMSRPDIEHLS
                     KIYQSLGLDYDERVLPSIGNEVLKATVAQFDASELITNREIVSARIRDDLLNRAKEFN
                     ILLEDVSITHMTFGKEFTSAVEQKQIAQQDAERAKFVVEKAEQERQASVIRAEGQAEA
                     ANTISKALSKAGDAFIQFKKIETSREIANTLSQNKNVSYVPAANGNMLLQVPSQQQ"
     gene            complement(<227301..>228587)
                     /locus_tag="CNA00790"
                     /db_xref="GeneID:3253462"
     mRNA            complement(join(<227301..227516,227569..227781,
                     227835..227912,227973..228165,228243..228344,
                     228394..>228587))
                     /locus_tag="CNA00790"
                     /product="exosome complex exonuclease rrp4, putative"
                     /transcript_id="XM_566505.1"
                     /db_xref="GI:58258184"
                     /db_xref="GeneID:3253462"
     CDS             complement(join(227301..227516,227569..227781,
                     227835..227912,227973..228165,228243..228344,
                     228394..228587))
                     /locus_tag="CNA00790"
                     /EC_number="3.1.13.-"
                     /codon_start=1
                     /product="exosome complex exonuclease rrp4"
                     /protein_id="XP_566505.1"
                     /db_xref="GI:58258185"
                     /db_xref="GeneID:3253462"
                     /translation="MFSVKAVAPSISQAFTEIVPSTHRKHQAELDAMDLDEDEFGGAG
                     PSKRSIVSPGEVITSSKEYMRGHGTYVEESNVVSSVAGTIERVNKLISVRPLRSRYTP
                     EVGDLVIGRIVEVGAQRWRVDANGRQDAVLMLSSVNLPGGVQRRKIESDALKMREFLA
                     EGDLLVAEVQAFFGDGAMSLHTRSLKYGKLRNGFLLTVPPQLIRRLKSHFYHIPPPCG
                     PTGVDVILGLNGYVWVSNGTSQARREGGEGFDSEGVYSNQNDEIPPQGREAISLVANI
                     IKALASEGVPLTETLIGESYAWAEKNVPSGSGPFDSETERKMLNEIVGLEFLEFA"
     gene            228857..231217
                     /locus_tag="CNA00800"
                     /db_xref="GeneID:3253884"
     mRNA            join(228857..228995,229057..229097,229167..229252,
                     229304..229419,229473..229567,229636..229649,
                     229701..229718,229779..229787,229839..230338,
                     230393..230836,230888..231217)
                     /locus_tag="CNA00800"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544884|gb|CF690725.1,gi|41544894|gb|CF690735.1,
                     gi|41561136|gb|CF706977.1,gi|41561142|gb|CF706983.1,
                     gi|41574347|gb|CF720188.1,gi|41574353|gb|CF720194.1"
                     /transcript_id="XM_566507.1"
                     /db_xref="GI:58258188"
                     /db_xref="GeneID:3253884"
     CDS             join(228949..228995,229057..229097,229167..229252,
                     229304..229419,229473..229567,229636..229649,
                     229701..229718,229779..229787,229839..230338,
                     230393..230732)
                     /locus_tag="CNA00800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566507.1"
                     /db_xref="GI:58258189"
                     /db_xref="GeneID:3253884"
                     /translation="MAKEPRDLLLLVWVHGFKGNDVTFETFPGRICHLLRATHPSLRV
                     ESRVFPMYQTRGELLAATLAFVDWLTELVVNLENDHGQGGGAGKAKVVLMGHSMGGLL
                     CADTVRDIAANTREGDPMWPRVVGIIAFDTPYLGLHPHTFKHHLTQAASYFDQARSIA
                     STIGMVSPTSFGLGFGNSGKKTESTTSEAGFSKPQPSASTKGKKKETTTTVSDMSTSA
                     EQQAATSKSFWSSLSSVPSPSSKTLYGLGAAALGAAALGTAYYRREDFITGWRWGYDH
                     MTFVKNLWDEDGSRKRLEAIDALVREQNVLYRNYYTHLPVEPPVHLVGRTFAILPPAS
                     HPLFPLWRPATNSLAKDEVSAHMGMFNPKTNDGFYDLGLAVVKEIGERIESEGVGRKE
                     GLEERMDEDGEGVWRIEKDKDGKEIWVEA"
     gene            <232095..234071
                     /locus_tag="CNA00820"
                     /db_xref="GeneID:3253460"
     mRNA            join(<232095..232147,232205..232685,232740..232976,
                     233026..233352,233410..234071)
                     /locus_tag="CNA00820"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541053|gb|CF686894.1"
                     /transcript_id="XM_566509.1"
                     /db_xref="GI:58258192"
                     /db_xref="GeneID:3253460"
     CDS             join(232095..232147,232205..232685,232740..232976,
                     233026..233352,233410..233955)
                     /locus_tag="CNA00820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566509.1"
                     /db_xref="GI:58258193"
                     /db_xref="GeneID:3253460"
                     /translation="MSGITNKLENKVDKTFFSGGPGTTGREPFEDSTTSGTTGTHSSN
                     TTNPATSLHGGITHDENVRSGMGATGTPDRTTGSTGSYTGTGVGNENIPAPHSSSTGT
                     NVPGTHTGGGAPIGAQGTSFGQTGEQRGVGGVTAGGVTGSGNPTHAGYGSGATTGLDS
                     SRHGQGIGSGTDKHSSTGYGAHESSFAPPISSTTGSGAKVADYGTGSHTSSHHTGAAA
                     TGAAAAGTGAAAYGHHENKHAGSGHTGSHSHDTSGNHGVGTTDSYGSGLPSALDNKQS
                     VGAGARDSRDRTGHLEEGSALYERSTDQGPVTGGAANTDKFDTDKPRNTSGLTGHGTG
                     KTHNYDGTSSRTAPHSGTEDPYKQQSGGAAGIFATSDKDFTSNTDRLGKGAYHDDQGL
                     FKDNTSGPGGRSALTGREGNYEKNPISGVESAGQKHHTGATSGAGTGATGGAAYEAEK
                     AENKLAGSHSTTGAYDTPTSSHGIAGRDGTTATTGQSGYGTGDRTGTYNETGTTGTHS
                     SSTGESGTAIGGHDTDTGRTTEGTHEKKGIIEKIKEAIH"
     gene            complement(232136..>233980)
                     /locus_tag="CNA00810"
                     /pseudo
                     /db_xref="GeneID:3253847"
     repeat_region   234020..234047
                     /rpt_type=tandem
                     /rpt_unit_seq="caaa"
                     /satellite="microsatellite"
     gene            234964..235639
                     /locus_tag="CNA00830"
                     /db_xref="GeneID:3253459"
     mRNA            join(234964..235089,235173..235302,235385..235639)
                     /locus_tag="CNA00830"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_566510.1"
                     /db_xref="GI:58258194"
                     /db_xref="GeneID:3253459"
     CDS             join(235007..235089,235173..235302,235385..235525)
                     /locus_tag="CNA00830"
                     /codon_start=1
                     /product="mitochondrion protein"
                     /protein_id="XP_566510.1"
                     /db_xref="GI:58258195"
                     /db_xref="GeneID:3253459"
                     /translation="MSAPLGNAAAQQTTSKFQAFLNHPAGPKTIFFWAPIAKWGLVLA
                     GVKDLSRPAEKLSVSQNVALAATGFIWVRYSFVITPVNYSLAAVNFFVGSTGVAQLYR
                     VWDYRRKNPGAVSSA"
     gene            complement(235743..>238630)
                     /locus_tag="CNA00840"
                     /db_xref="GeneID:3253883"
     mRNA            complement(join(235743..236085,236146..236297,
                     236350..236680,236739..236766,236828..236920,
                     236980..237210,237265..237581,237645..238154,
                     238232..>238630))
                     /locus_tag="CNA00840"
                     /product="conserved expressed protein"
                     /transcript_id="XM_566511.1"
                     /db_xref="GI:58258196"
                     /db_xref="GeneID:3253883"
     CDS             complement(join(235852..236085,236146..236297,
                     236350..236680,236739..236766,236828..236920,
                     236980..237210,237265..237581,237645..238154,
                     238232..238630))
                     /locus_tag="CNA00840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566511.1"
                     /db_xref="GI:58258197"
                     /db_xref="GeneID:3253883"
                     /translation="MSNSPTAEPIPPAPPAAQQPVEAHEIPVPDAPSTTIPTAPLDNP
                     EAQTQAPTASIDPNKPSKESAPTALPTNPATHPEEQKEAIKEEHPQVIKREVEKTKAE
                     ERDLKGEKPQGTVVAGLEDDRLWAMLRRFDVQITHVLHPARNLPAAEPDLRPSTLPNL
                     PSHTDVLRSNLERCIAAVGPSSLRGARELQRLMSWSPEERWRTGTYCVVYFTAWIFGY
                     AVAAIMIFLSILVCFPRTRRFLFPPVPPAPFTPPSATDPTNQKGDESLLGNIDGKTVH
                     RTKAEQAEEQAFEATSILKAFTTRLLFDGKKKGKEAGNSNVGEKEEEPESSSSEDEAA
                     VETAPVDGKPQGLESADIVIGGEKITPAEPLNDKEKKKLAQREAKRKRDEMVSKMTKL
                     SEDGLGTVADSIERFANALSPPGPYPDNFARFKIAGAFLIPPAFLLTFVPAWVFGRLA
                     TLGFGVGMWGQPLIIKGINKFVEVVPNWQELLDMRNSILSRVPTDTQLTLHLLRVTEA
                     LGKPLPRPPPPPLSGTPKEAIKDTTPAAVTADDDAEVLEAAQEGATAEVAAKTKHKTK
                     SHITGVFKSAGKHMAGFRGDVKVDGARKQVSMEDWWYEWLGGQLIKLGKIGDKVDKVL
                     FRGNIKDDGNIDSYPAKLNGTSGHIIIDSREEGISMPTISFVPVSGTKAHFVRPVDDI
                     VEIKKSHVSMPRMALGWASGADVEGLGLTIRFKSGVQQAKEFAAGPDAPKDDGETMHF
                     RRVGRREGLFTRLISIGRQRWEVL"
     gene            239200..240716
                     /locus_tag="CNA00850"
                     /db_xref="GeneID:3253458"
     mRNA            join(239200..239361,239419..239620,239674..239960,
                     240022..240337,240388..240716)
                     /locus_tag="CNA00850"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41561766|gb|CF707607.1,gi|41561773|gb|CF707614.1"
                     /transcript_id="XM_566512.1"
                     /db_xref="GI:58258198"
                     /db_xref="GeneID:3253458"
     CDS             join(239289..239361,239419..239620,239674..239960,
                     240022..240337,240388..240589)
                     /locus_tag="CNA00850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566512.1"
                     /db_xref="GI:58258199"
                     /db_xref="GeneID:3253458"
                     /translation="MVAPTYDALKLPAHVKTILVTGAGGFVGQQLVKLLLELHPTVKL
                     ITTDIVQPPSHGVTDTNRLKSVKADLGKQEEIDGLLKGETIGGVFALHGIMSGGAEAN
                     FPLGYAVNVDSNLNLLKSMYNHSLSLPADAPRPLYVFVSSLAVYGGPKCKPTDYVVPK
                     DTPIIPGSSYGVQKTIVELYVYDYGRKGYLDTRSVRLPTVAIRPGAPSSAASSFISGL
                     IREPLQGMEAICPIAESIDDPALDNMPFWCSRTKTVVRNIAYAMCMPESNFKEGEGRS
                     INIPGIKISPRQIIDALIEHGGKDKFNLIKFQKDQAVINICKTWAGEYDNSDFLAMGF
                     EADDPKTGFALAVQDFKDELTASQK"
     gene            complement(<240740..>244842)
                     /locus_tag="CNA00860"
                     /db_xref="GeneID:3253457"
     mRNA            complement(join(<240740..241497,241554..242114,
                     242173..242459,242544..242780,242835..244104,
                     244153..244575,244821..>244842))
                     /locus_tag="CNA00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_566513.1"
                     /db_xref="GI:58258200"
                     /db_xref="GeneID:3253457"
     CDS             complement(join(240740..241497,241554..242114,
                     242173..242459,242544..242780,242835..244104,
                     244153..244575,244821..244842))
                     /locus_tag="CNA00860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566513.1"
                     /db_xref="GI:58258201"
                     /db_xref="GeneID:3253457"
                     /translation="MPLKSEKLHTNHLKIPFNPLLMPRSPTPSGHQGSPTLKQILKAA
                     DILLKPPKALPSNPPELLPRLRACSKALPKEWRRIIPEWSEDDEMDHVGDNDGSDISE
                     ERKKKRRDELVFVVGKRCFAMAKAMQSWLEKEFWPKEQRDGLEDKDFLLGTADLRLIR
                     LMLSHTTFSYLLPLTVQYAESLPIIPAETANALAQVLEATLKLLKVATPPAPDAGPSS
                     RMPTSPTAITQSLLSSHLIPVFLSTLILAYTPSIPAEHYGLLRMAFLQALMSLTPGHA
                     ISSLVNVLKLLVQGRRENAKVNGWVREWPKYPEGIINGLLTAQVRRPGGVRGLMENVL
                     GDTARTDDVTSIEGKRLDHIFNVLVRIPRQVTPEIYYPWLLSELFSMIPLDESSSHHP
                     VAYVNTACYCIQRLWRSNPSIGEWLKNKLHSPWYPKSLFAPADGPAIEVTSWLAIQRS
                     VQNIRLLLIHNPASPDFVEFLVGSILPPLFSLHTFLFFSSQAPNPVLIRPVGSLDASR
                     SRSLADDVSFILTSWGKTVEKDVGVIGLWSLVDAGKGWKPDENGVVPEFFWERQGDGV
                     RLMSGSQGIPDITPEIVFPSLNRDELDPDAIAQRIRDQTEAMPDPTLLCKLIKDINRP
                     DIACQVILRALHLWRIKSPMEKEPSVEAMLHLQLTMKLMTHLGSELFTEPEQLLEWVE
                     LTLSGQADCLEDDLIDEEAEETNQKPLITEVGGEKGKGKKDDDVPPDGNRGLIELACR
                     LLAAEEVKKALSEKDLAILHPILAHLEVISELSPSSSIRLATREAMLILLSIQASANS
                     SAPTDSKKSSKEAFDKALELIKDKAVPVRAHGLNMLKDLVYQPYYDSSLTPVILNTFM
                     SSIEDDDSFVYLCALKGLNGMVDALGGEVFEKLMDSYAGMAKELRRLNDADEVDKMLR
                     LAEAVDQVIERTGDALGLYADKIIPVLMSIFPDTSLSTAIRSSALSLLTTCAKVSYIS
                     LLPWSTDLTNSAIDLIQIESVAVSPFRPGAIQTVEGPPQPSWKGDKKPRNVQLIEDEQ
                     PEQEDEEEERKVPDPWIEDTDPLAYDDSKHPALRRAAIAFLNWVFSVITFKIMSDHSE
                     CTGLEAGEILYKEHPAPDTDADLQEGGIPPGLLERAETVLGYVKSTDEDEVARGHAES
                     AERMLGMLKASIMIRSGGAVEGSGLEDLSESLEKLKVDV"
     gene            244911..246723
                     /locus_tag="CNA00870"
                     /db_xref="GeneID:3253881"
     mRNA            join(244911..245713,245776..246723)
                     /locus_tag="CNA00870"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41552568|gb|CF698409.1,gi|41552580|gb|CF698421.1,
                     gi|41562006|gb|CF707847.1,gi|41562022|gb|CF707863.1,
                     gi|41567477|gb|CF713318.1,gi|41567484|gb|CF713325.1"
                     /transcript_id="XM_566514.1"
                     /db_xref="GI:58258202"
                     /db_xref="GeneID:3253881"
     CDS             join(244949..245713,245776..246576)
                     /locus_tag="CNA00870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566514.1"
                     /db_xref="GI:58258203"
                     /db_xref="GeneID:3253881"
                     /translation="MPHRPSPKPPSSLPSPSRPQESQIEVLYNTAVQSFVRRDHVKTQ
                     ATLARLLESLKKKRIGPYRTWYKLDGAKPDNENSEAAANDDWMVKTLKLLISSTASLY
                     ADPPNNTTALPELLVSMLPPKSPKEILSYLQHRCMSAYYSKGATAHLLPPQLVSTLIL
                     ASLKLSPQRSALDFAHSMTESWIASLPDSLILSISPTSSYRPKDPIERKRVESAREGY
                     LKVVELFIGEVLSREEEWEMARGFLEGEVVMSSKKKETLYKHLRTLESKASLPSLAPS
                     PSSSLILPSSSDSLSIEEEKESKIRSRLSRSSSTSSSSSSSSEATARPGTSQNGGLLG
                     TGLALGQRMEQLRQIRKAGKDRGEESPRPGSIASQASGSGISESTYRLVHSNFRRNSS
                     SRRGNDVPTSRPDNLHHILQSLLGRLPTSLSTTLQSLSPVVLTVITIPLPLLIIFTII
                     RLRRSRFARQQTTVVGGARGGSRNTVLQVQHRLQRVRTQQRGWWDWVLWYLRWWLAKF
                     AGVWKLGTTITYV"
     gene            complement(246774..249404)
                     /locus_tag="CNA00880"
                     /db_xref="GeneID:3253456"
     mRNA            complement(join(246774..247028,247100..247436,
                     247497..247587,247644..247804,247861..248067,
                     248116..248226,248277..248669,248733..248791,
                     249152..249404))
                     /locus_tag="CNA00880"
                     /product="ITR1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41541440|gb|CF687281.1,gi|41541450|gb|CF687291.1,
                     gi|41542108|gb|CF687949.1,gi|41542118|gb|CF687959.1,
                     gi|41563994|gb|CF709835.1,gi|41570039|gb|CF715880.1"
                     /transcript_id="XM_566515.1"
                     /db_xref="GI:58258204"
                     /db_xref="GeneID:3253456"
     CDS             complement(join(246911..247028,247100..247436,
                     247497..247587,247644..247804,247861..248067,
                     248116..248226,248277..248669,248733..248791,
                     249152..249378))
                     /locus_tag="CNA00880"
                     /codon_start=1
                     /product="ITR1"
                     /protein_id="XP_566515.1"
                     /db_xref="GI:58258205"
                     /db_xref="GeneID:3253456"
                     /translation="MSAGPAQPNIYAPIRTSHSGYPSPTHSGSSTPASLEFSDGRLPE
                     SNVERDMSKVAERVALLGEVDDGAVIVEGEDKITKFVWTLVLAAAISGLLFGYDTAAI
                     SGMLVIIKDDLGTILSSWQKEAITSATTLGALLGGLAAGCISDFTGRRLVIVFANVAF
                     IGGSICQAACHTVAVMIAGRFIVGLGVGLASCIVPLYIGELAPTMIRGRLVTINCVAI
                     TLGQVVAYAIGASFQNAHNGWRWIVGLGAMPSFVQLASIGFLPESPRILLLRSDVAGA
                     RAITAKIYPLAKVEQVDRKVEIMKAAVDQSIEYNANSTWFERLKSLVMVGTNRRALII
                     GCGLQAAQQLCGFNTLMYYSATIFAMLGFKNATAVGLIVATVNVLFTLVALKIVDPVG
                     RRRTMLFTLPIMTLALVLAAIFFYYLTLSTNGILIEDHDYPRSLSIPVLLSMLLYVAG
                     YATGLGNIPWQQGELFRLEVRGIGTSICTAVNWSCNMLIASTFLSLMDAATPSGAFGI
                     YAGFCVIGWLFCWMLYPETSGLSLEEVYFVFEEGFGIEKSQQLRKQKLEESAKLKAIF
                     E"
     gene            250471..251820
                     /locus_tag="CNA00890"
                     /db_xref="GeneID:3253455"
     mRNA            join(250471..250656,250706..250847,250898..250969,
                     251026..251443,251507..251820)
                     /locus_tag="CNA00890"
                     /product="palmitoyl-protein thioesterase, putative"
                     /transcript_id="XM_566516.1"
                     /db_xref="GI:58258206"
                     /db_xref="GeneID:3253455"
     CDS             join(250535..250656,250706..250847,250898..250969,
                     251026..251443,251507..251739)
                     /locus_tag="CNA00890"
                     /codon_start=1
                     /product="palmitoyl-protein thioesterase"
                     /protein_id="XP_566516.1"
                     /db_xref="GI:58258207"
                     /db_xref="GeneID:3253455"
                     /translation="MRLRFTFTLALLFSNWTLAAPASDQLVLSNSNAKPRPLVIWHGL
                     GDTALSTGIENFINMTQTIHPGIFVHSVQIPEGGRPDDERKAGFWGNAGEQGEEGCEQ
                     IKRIPELAEGFDGIGFSQGGLLLRHYIQYCNGPPVHNLITFGTPHYGISALIPCPTPP
                     TLSCLLAARAARAGIYRPWAQDHLVQAAYFRDTERLDEFYEVNEFLRDLNGERPFAER
                     NSIEEINRRKGKRGEGKGLKGLDNLVAIIFDEDRTVSPAQSSHFATYAPNNKTEIIPL
                     HEQPLYKEDWIGLKGLDEKGGLRLEHCPGEHMDLGGKRGCGESMVRKWVGWV"
     gene            complement(251842..>254770)
                     /locus_tag="CNA00900"
                     /db_xref="GeneID:3253453"
     mRNA            complement(join(251842..252541,252599..252900,
                     252968..253136,253187..254280,254336..254558,
                     254612..>254770))
                     /locus_tag="CNA00900"
                     /product="ATP dependent DNA helicase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41560986|gb|CF706827.1,gi|41560994|gb|CF706835.1"
                     /transcript_id="XM_566517.1"
                     /db_xref="GI:58258208"
                     /db_xref="GeneID:3253453"
     CDS             complement(join(251858..252541,252599..252900,
                     252968..253136,253187..254280,254336..254558,
                     254612..254770))
                     /locus_tag="CNA00900"
                     /codon_start=1
                     /product="ATP dependent DNA helicase"
                     /protein_id="XP_566517.1"
                     /db_xref="GI:58258209"
                     /db_xref="GeneID:3253453"
                     /translation="MNNSLLHHPSISSFIPRTLTMADQQLSQGNLPVFIDDLIADRTR
                     QFVEFLDDETQAAYNYRESIKRMLDDEQVRLIVDINHIRSYERSYADGLLLQPMEYVP
                     ALDAALMQLVQSLHNPTKHKIEDKQFYVGLIGSFGQQHCNPRTLRSHQIGKMVSLEGI
                     VTRCSLVRPKMLRSVHWSPRTQKFHARTYNDSTIIAPSANLTGTTTVIPKDDGDGHPL
                     LMEYGLSTFRDYQTIGIQEMPERAPAGQLPRSIEVVLADDLVDCCKPGDRIQLVGVYK
                     SSGGGAGARGFITSIIANNIILLSSKQGGGIAQTPLTDTDIRNINTQARRKNVFQLLS
                     QSLAPSIFGHDYIKKAVLLLLLGGEEKNLDNGGHIRGDINILMVGDPSTAKSQMLRFV
                     LNTAPLAIATTGRGSSGVGLTAAVTTDKDTGERRLEAGAMVLADRGVVCIDEFDKMSE
                     IDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVVAAANPIYGQYDVHKDPHRNIALPDS
                     LLSRFDLLFVVTDDTDEQRDRMISEHVLRMHRYIQPGAEEGAPPIENLEQNLDVGGDA
                     VESRISETPVFEKFNPLLHSGVTTTSGRGANKKKEVLSIAFVKKYIQYAKSRIHPVLT
                     KGAADWIVNVYSSLRNDDMAANQKRTSPLTARTLETLIRLSTAHAKSRLSTRVDERDA
                     MAAEEILRFALFKEVVRPERRKRRKINHAGQSVEVDSDEDEEGEEELQAGVERMSMNG
                     DVGVTESQRERAREKNRRVERQAAGPVPEDDEDFEMREAEESLALQEAPRSPPTAPEV
                     AVELSNERLDLFRSKLSHVFEESLDDNGAIEFVELMPKINEGMAEGEVFSVGEMKQAL
                     VRMDEKSEVMFGEDQTIYKI"
     gene            254947..257137
                     /locus_tag="CNA00910"
                     /db_xref="GeneID:3253452"
     mRNA            join(254947..254966,255015..255194,255241..255648,
                     255697..256006,256056..256787,256839..256900,
                     256964..257137)
                     /locus_tag="CNA00910"
                     /product="chaperone, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534469|gb|CF680310.1,gi|41534476|gb|CF680317.1,
                     gi|41547542|gb|CF693383.1,gi|41547553|gb|CF693394.1,
                     gi|41548468|gb|CF694309.1,gi|41548487|gb|CF694328.1,
                     gi|41550175|gb|CF696016.1,gi|41550179|gb|CF696020.1,
                     gi|41555461|gb|CF701302.1,gi|41555464|gb|CF701305.1,
                     gi|41555845|gb|CF701686.1,gi|41555855|gb|CF701696.1,
                     gi|41560907|gb|CF706748.1,gi|41560914|gb|CF706755.1,
                     gi|41566528|gb|CF712369.1,gi|41566607|gb|CF712448.1,
                     gi|41566615|gb|CF712456.1,gi|41569657|gb|CF715498.1,
                     gi|41569670|gb|CF715511.1,gi|41570743|gb|CF716584.1,
                     gi|41570747|gb|CF716588.1,gi|41571398|gb|CF717239.1,
                     gi|41571401|gb|CF717242.1"
                     /transcript_id="XM_566518.1"
                     /db_xref="GI:58258210"
                     /db_xref="GeneID:3253452"
     CDS             join(254958..254966,255015..255194,255241..255648,
                     255697..256006,256056..256787,256839..256900,
                     256964..257017)
                     /locus_tag="CNA00910"
                     /codon_start=1
                     /product="chaperone"
                     /protein_id="XP_566518.1"
                     /db_xref="GI:58258211"
                     /db_xref="GeneID:3253452"
                     /translation="MSDAVALKAEANKAFAAKDYTTAAKLYSDAIALDPSNHVLYSNR
                     SATKAGLKDYEGALEDAEKTIELDPSFSKGYARKGAALHGLRRFPDAVMAYESGLQAE
                     PNNAACVKGLSEVKRAMDTDSSSPFAPGGDMGLGKIFSDPSMISKLENHPKTSALMKD
                     ATFRANMLQLQASGGRNMSTLMGDPRTLTALGVLMGIDIDAMERPEGSNEYPPSSSSA
                     PEPTPAPAPKAEEPKKQPAPVPEPEAEPMEVEEDEEAKAKKEAEEFKAQGNTSYKARK
                     FDEAIEFYSKAWDLYPKDVTFLTNLSAVYFEQGEYQKCIETCEKAVEEGRDLRADYKV
                     FAKAYGRIGSSYSKLGDLAQAIKFFQKSLTEHRTPDILTKLREAEKAKAEADRQAYID
                     PEKAEKAREEGNEAFKKGDFAGAQKHYSEAIKRLPTDPRAYNNRAACYTKLLALPEAL
                     KDAETAISIDPTFIKAYIRKALVQEGMKEYTAALETLQKATEADVEKKHTRELETNMM
                     KVMNEIQQQRSSETEEETYARAMRDPEVAEIMNDPIMRQILSDAQQNPRALNDHMKNP
                     MIAQKIQKLINAGIIRTR"
     gene            complement(<257594..>258539)
                     /locus_tag="CNA00920"
                     /db_xref="GeneID:3253451"
     mRNA            complement(join(<257594..258163,258210..258344,
                     258397..258422,258467..>258539))
                     /locus_tag="CNA00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_566519.1"
                     /db_xref="GI:58258212"
                     /db_xref="GeneID:3253451"
     CDS             complement(join(257594..258163,258210..258344,
                     258397..258422,258467..258539))
                     /locus_tag="CNA00920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566519.1"
                     /db_xref="GI:58258213"
                     /db_xref="GeneID:3253451"
                     /translation="MRINFSPQRAAIFTSFLGLLDIKLGAEIILLFGLINKVAGLYGL
                     ITIFVGGSFAQLLYYAYSVGTLFAFLWGLRVVKSESSAPTLLLSHLYALDHLIVSLFH
                     YIFYLHYWYTVPHDGRRTINSQAQQDLINLALSRGEISEPTDEGGQGADDLRMALAGE
                     IWERERGFAVWTLVAGWILKIYFILVLYSYAAHLASSTYHTLPLTARGKATKLAHPDP
                     GQGASSPRIPGESEDDIELRRAEQAARDGPSKKGKGKRTEGDDEDFSWE"
     gene            complement(258827..260496)
                     /locus_tag="CNA00930"
                     /db_xref="GeneID:3253874"
     mRNA            complement(join(258827..259241,259311..259716,
                     259793..259912,260002..260257,260314..260379,
                     260430..260496))
                     /locus_tag="CNA00930"
                     /product="pelota, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530272|gb|CF676113.1,gi|41530278|gb|CF676119.1,
                     gi|41534978|gb|CF680819.1,gi|41540815|gb|CF686656.1,
                     gi|41543745|gb|CF689586.1"
                     /transcript_id="XM_566520.1"
                     /db_xref="GI:58258214"
                     /db_xref="GeneID:3253874"
     CDS             complement(join(258881..259241,259311..259716,
                     259793..259912,260002..260257,260314..260379,
                     260430..260468))
                     /locus_tag="CNA00930"
                     /codon_start=1
                     /product="pelota"
                     /protein_id="XP_566520.1"
                     /db_xref="GI:58258215"
                     /db_xref="GeneID:3253874"
                     /translation="MKLINKHIEKDGSGYVTLRPEDDEDMWHVYNLISEGDRVRAMAV
                     RRVQTVSSTGSSDSYRVRTNLTLEVTKTTFSPAASSSQGNGQGEKKEPTASLQISGKV
                     VEENEFVKMGAYHTLDLEANRDFRLTKETGWDSVALERIQESTQEGRGAEVGAIVCGE
                     GTAALCLLSEHMTVIRQRIDMPVPRKRKGGTSGHDKAVENFLSTVYQAILRLIPFQTL
                     KAIVIASPGFTRDALYEYIFQQATLQSNKPLLASRSKWIKVHSTTSHVHGLVEALKAP
                     EVAKMLAGAKFAKEGLGLDKFHKMLATDELRAWYGPEHVALAVDRGAVGTLLISDDLF
                     RSSDPATRTHYVKMVESVRAVGGEVLIFSSMHESGQQLNMLTGIAAILTYPLDIEVVE
                     MEEKEEKERIEREKAEKELAEES"
     gene            260680..>261647
                     /locus_tag="CNA00940"
                     /db_xref="GeneID:3253872"
     mRNA            join(260680..260836,260902..260969,261095..261279,
                     261341..>261647)
                     /locus_tag="CNA00940"
                     /product="expressed protein"
                     /transcript_id="XM_566521.1"
                     /db_xref="GI:58258216"
                     /db_xref="GeneID:3253872"
     CDS             join(260704..260836,260902..260969,261095..261279,
                     261341..261647)
                     /locus_tag="CNA00940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566521.1"
                     /db_xref="GI:58258217"
                     /db_xref="GeneID:3253872"
                     /translation="MSIPTTSTPTSGSSPTSSPINRWIPSNPFDLPETRELIAQKVAM
                     GEITDHDVAIMEKGYKWMIYTPPATAISFTFLIWQLMKKQYPRPRMITRLFWGGLSAG
                     AGGLLGFGAAGVAAAMEVEDKVEDVERKSRVFEEITEHSHALQESRLALSRPAPPLAV
                     TSPSLTPAMRQAANRGDSRLPRDFEFPNETEEERKERERRMLEGLKLGKERVEEETKG
                     TLGWVKGLFGSK"
     gene            <262541..266285
                     /locus_tag="CNA00950"
                     /db_xref="GeneID:3253871"
     mRNA            join(<262541..263122,263172..264376,264433..265446,
                     265514..265983,266051..266285)
                     /locus_tag="CNA00950"
                     /product="mRNA export factor elf1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542560|gb|CF688401.1,gi|41542568|gb|CF688409.1,
                     gi|41558612|gb|CF704453.1,gi|41558615|gb|CF704456.1"
                     /transcript_id="XM_566522.1"
                     /db_xref="GI:58258218"
                     /db_xref="GeneID:3253871"
     CDS             join(262541..263122,263172..264376,264433..265446,
                     265514..265983,266051..266082)
                     /locus_tag="CNA00950"
                     /codon_start=1
                     /product="mRNA export factor elf1"
                     /protein_id="XP_566522.1"
                     /db_xref="GI:58258219"
                     /db_xref="GeneID:3253871"
                     /translation="MSPVVAPSTALPPSTHLEKLTALANAPSNVEAKSIADGIALDLK
                     KAPRTLDALQDARIVDVVLAWASSKSGYERESSVVLVERICRSLGSGIEGVFLPLIPA
                     ILNLAMDKGQPVRSAVNSAMTSLIKATAPEGARKVFEVLTRVLEETKGWRTKIAALKA
                     MEGLVKPGAEDYVANELGTVIPVVEHAMHDTKAEVSTAARKAATTLCGILPNADVLKH
                     VNLLVSAMASPAAVPSTIKGLSSTTFVAEVNGPTLAVMVPLLTRALKERSTDTQRMTC
                     VVIGNLVKLVRDPTVAARYLGPLFGGVQQIATGAAFPEIRAFAQTALDILIGAGASAS
                     ATPLPPRDVILSVTEALTVMAPHLQIPGFPAHPSIPLSASLPNSPVIAHAVEYQANVV
                     ADLVDLRRWDAYIWEGKALGSFMKLLQGAEEGAKATAEIRKAFMDIDKAKYSPPEEDD
                     GSEGQLLCDIQFSLAYGGLLLLNHTNLKLRRGRRYGICAANGAGKSTLMKAIRDGKVE
                     GFPPQEELRTIMVEHALQGEDTSMAIIDFIAADPKLTHKTRAEMAAMLLSLGFSEEKQ
                     QDPVASLSGGWKMKLELAKAMLIGADILLLDEPTNHLDVQTVAWLEEYVCSLHDITCM
                     IVSHDSGFLDNVCTDIIHYESKKLVYYPGNLSKFVEKVPSAKSYYTLAATSIKFTFPP
                     PGNLVGVRSNTRAILKLTNCTFTYPGAPRPSIKNASCSLSLSSRVGIVGPNGAGKSTL
                     IKLLTGETVPQEGSVHKHPALRVGYVAQHAFHHINQHLDKTAVQYIQWRYQDGHDREM
                     MEKATRVLTDEDKEMMERPIEGKNGELRKIEYILGRQKLKKSFQYEVKFRGYDHRYNA
                     WIGRDVLIEKGFQKLITQFDDLESSREGAGMRDTGANAVREVLEAVGLDGDIAQYNEM
                     SGLSGGQKVKVVIAASMFNRPQCLFLDEPTNFLDREALGGLAVAIKEWGGAVCIISHS
                     TEFVTALCPEIWHVDGGVLTHQGKVALVEDAFDDPSRPGSRVASKAGTPRTMPSTPGT
                     ATGTATPAESVATDGTVDDVADGLAKLMEKKKKKKKMTRNELKAQEERRRLRKLNWLN
                     YGGEREPDTDDE"
     repeat_region   265888..265911
                     /rpt_type=tandem
                     /rpt_unit_seq="gaa"
                     /satellite="microsatellite"
     gene            complement(<266313..>267788)
                     /locus_tag="CNA00960"
                     /db_xref="GeneID:3253869"
     mRNA            complement(join(<266313..266345,266483..266644,
                     266709..267029,267083..267284,267346..267534,
                     267591..267674,267730..>267788))
                     /locus_tag="CNA00960"
                     /product="pyridoxal reductase, putative"
                     /transcript_id="XM_566523.1"
                     /db_xref="GI:58258220"
                     /db_xref="GeneID:3253869"
     CDS             complement(join(266313..266345,266483..266644,
                     266709..267029,267083..267284,267346..267534,
                     267591..267674,267730..267788))
                     /locus_tag="CNA00960"
                     /EC_number="1.1.1.65"
                     /codon_start=1
                     /product="pyridoxal reductase"
                     /protein_id="XP_566523.1"
                     /db_xref="GI:58258221"
                     /db_xref="GeneID:3253869"
                     /translation="MSATTSPTTLVAGKTVGRLGYGLMGLSSWNLLVDPVPFPQEDAF
                     AAMKTAVDSGANCWSTATFYGPPTDPTANLKLIRAFFDKYPEYISKVVLIVKGGMDVR
                     SRSPAKGDDIEFFRNEIEQVKAILGDKELDVYSLARIGGTAVETTFTNMAQLIKEGAV
                     KAIGVSEMSAASLEKAHKICPISINEIEVSLFSYEPSIRDSVAWCTAHSVPILAYSPL
                     GRGQLTRRYRSLEDIPAGDFRTMFPRFQGQAFYDNQKLVDQVEEIAKKKGVTAGQLSL
                     AWVLAQSEFAIPIPGSRNVDRVRENASATDVKLNNEEVEALNKLASAFEVQGARYPEM
                     FQKDLLTNEESVDPT"
     gene            complement(<268830..273121)
                     /locus_tag="CNA00970"
                     /db_xref="GeneID:3253866"
     mRNA            complement(join(<268830..269018,269072..269177,
                     269236..269385,269448..269790,269848..270461,
                     270518..270958,271014..271189,271247..271434,
                     271494..271609,271665..271716,271770..272244,
                     272298..273121))
                     /locus_tag="CNA00970"
                     /product="two-component sensor molecule, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41551797|gb|CF697638.1"
                     /transcript_id="XM_566525.1"
                     /db_xref="GI:58258224"
                     /db_xref="GeneID:3253866"
     CDS             complement(join(268830..269018,269072..269177,
                     269236..269385,269448..269790,269848..270461,
                     270518..270958,271014..271189,271247..271434,
                     271494..271609,271665..271716,271770..272244,
                     272298..273083))
                     /locus_tag="CNA00970"
                     /codon_start=1
                     /product="two-component sensor molecule"
                     /protein_id="XP_566525.1"
                     /db_xref="GI:58258225"
                     /db_xref="GeneID:3253866"
                     /translation="MPAEDVDNATLAPATPLAIAMQSNDQIKANTKANSKSRTRFAPS
                     RLSSVWRSLVSHLTPPSHPSTTSESALGSSLRNTTDNMYYEDGSAVRHLPLELLNPKV
                     GTDSRHKRKGVSDTKNSGSRGGLRHRLRGSQANSNSRYGDDDDMSAKPSEPVSRIVVD
                     NNFEHFTPAVPRSDSGYGSGRTPATNGTPGGGEIGDDEDEEGTRGQRSDGASTTQRRS
                     SAAAQWIQKNVVVEWVTDRLWPNVKHFLDSSYPEPSKEHSFQKELWFTQKQGALASSL
                     FFLINYALTVGLLPRPFSNFDWIAYLGIGGVFTLPILPLIVLDWPRRHPRIWQPIIFL
                     ACWVFAYILIVEMHLCGFFTDNNQCGSRNFLNLLGFAFGQPTLALLTMKEDRGMAVAG
                     ASIWIILTGGLTMTQKNSPTLFYRNIVFFALFHAFLIGASFLKERSDRQMFALRQQLK
                     IQYRATQSAQVMERRAADSKKRFVSYIFHEVRVPLNTALLAVQNLQGERVFENVQQDQ
                     AEMVDGLISSLSMMEKVLNDVLSFNRMESGKFAQARKPFDFHKSIQLVALSHRTQAQM
                     AGISLEVELDSDIDKIGGIFVGDEMRLRQVASNLVSNSIKFTDQGSVRIVTKLLYPRL
                     EPTPATEPDDPLRQAAINLQRQQEIEESEKARSGTPTRSFPANPHSLPSHPRSRPDSA
                     KGTHGHTLMDLEKGSVTMEQKRMSRESGRDKEKEEEKKKVQKAVVRVEIHDTGVGLKK
                     TDVMDGDLFSPYVQTEIGRRQGGKGSGLGLALVRQIVKLSGGRLGVESEFGKGSMFWF
                     ELPYSLPPPPKARPGSSKGDRMGGIGIGGGAPGVSHPVASGSGGKPAFGLVMPLSSSS
                     NSTFVPLSLNTGIPHGPNLGVMGTDAASAGEGVGGDDERGPPKRPGTMVRIMSGATMM
                     SSTMEKGTSPTSANSERPAIGTTDSTMPLLPVEPRMSAEEAITAGGVPQSPSTSSHST
                     TQEPFIDPFSPISYTTLRERRSSEWSEEMGRAAASVEKLESERAVTGMGLGMGVGQAA
                     EIKLKTRGMQEQPETKEDPPAEMPLSSLVVDDDKLTRMLMSRMLTRLGHHVTTAENGK
                     IASEMIKDMFENKEGAIKFDIVFLDNQMPLMSGVEVARAVREMNCPIYIVGCTGNALR
                     EDQDEYMAAGADTILTKPIHQKHLIEMIRDARRRVAGETQPRYMDYADESPMSPVHMR
                     DPLPRMS"
     misc_feature    270580..270652
                     /note="CT-rich"
     gene            <274164..276111
                     /locus_tag="CNA00980"
                     /db_xref="GeneID:3253864"
     mRNA            join(<274164..274288,274350..274985,275159..275250,
                     275304..275394,275463..276111)
                     /locus_tag="CNA00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_566527.1"
                     /db_xref="GI:58258228"
                     /db_xref="GeneID:3253864"
     CDS             join(274164..274288,274350..274985,275159..275250,
                     275304..275394,275463..276075)
                     /locus_tag="CNA00980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566527.1"
                     /db_xref="GI:58258229"
                     /db_xref="GeneID:3253864"
                     /translation="MFLQDKLPQLKIVQISSSLAVGHALPPSSLPENIPLCPSLPPSQ
                     SQSDLPVDGATDLSHSHFISSASPSSDFNPAQTPNAGQDIAHALKAQWEGKLSPTTSH
                     LFKLIVPLPAPGCQPGQTPTPRPTAFLLHPSQPLSHLSRLISGSLPPPYTHSDISYLA
                     LTGSESDVDTHLRNAEKSSDNSSTNENDYAGRDEGGPFLTERKGEGGRWQEVAWSQST
                     DLSDFIKQSCLNEKFKIVISPERDRDGAQLKGKETEIDYAAHKGAQRLAVMALGGGVV
                     YWGTIIRFTFFTDAGWDMMEPVTWATGFAALLGSAAFLIYHNREVSYSSLLDLSITAR
                     QRKLYAEAGLDLEKWTEMVAEAKALRKEIERIAADYDIEWRGELEGLEKVGSREGAGG
                     GSPRVGLPGVEIGEKKEDVRENVDAKDGSKEGERKEMEEENETKLQGEEGKVETEKID
                     VDKTIDEASELAEESGEQRSRTKAAQRNGEVMDSSDDDKGSKTRKGEEQESDSVTKGR
                     AAAKKVINEK"
     gene            complement(276128..277750)
                     /locus_tag="CNA00990"
                     /db_xref="GeneID:3253447"
     mRNA            complement(join(276128..276664,276721..277268,
                     277321..277750))
                     /locus_tag="CNA00990"
                     /product="RVB1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539683|gb|CF685524.1,gi|41539691|gb|CF685532.1,
                     gi|41545904|gb|CF691745.1,gi|41548952|gb|CF694793.1,
                     gi|41548963|gb|CF694804.1,gi|41549185|gb|CF695026.1,
                     gi|41549191|gb|CF695032.1,gi|41549426|gb|CF695267.1,
                     gi|41549435|gb|CF695276.1,gi|41563368|gb|CF709209.1,
                     gi|41563380|gb|CF709221.1,gi|41571223|gb|CF717064.1,
                     gi|41571232|gb|CF717073.1"
                     /transcript_id="XM_566529.1"
                     /db_xref="GI:58258232"
                     /db_xref="GeneID:3253447"
     CDS             complement(join(276170..276664,276721..277268,
                     277321..277732))
                     /locus_tag="CNA00990"
                     /codon_start=1
                     /product="RVB1"
                     /protein_id="XP_566529.1"
                     /db_xref="GI:58258233"
                     /db_xref="GeneID:3253447"
                     /translation="MSMAASSSTATVQPSGIITQPPPPSTLREQRIATHSHIKGLGLA
                     DDGTAMSSSQGFIGQILAREALGLHLSLLKGGKYSGRPLLLVGPPGTGKTALALALSQ
                     ELGSKVPFCAMVGSEVYSGEVKKTEVLGSCFRRAIGLRIKETKEVYEGEVTELTPSEA
                     ENPLSGYGKTISHVIVGLKTVKGTKQLRLDPSVYESIQKERVVVGDVIYIEANTGAVK
                     RVGRSDAYASEYDLEAEEYVPLPKGDVHKRKELVQDVTLHDLDMANARPQGGQDIMSV
                     MGQLVKGGRTEVTDKLRREINKVVDRYIEQGVAELVPGVLFIDEVHMLDMECFTYLNR
                     ALESPMSPYVVLASNRGISTIRGTEYDGVAGSASEGIRAPHGLPVDLLDRCMIVKTQL
                     YTRDEIRRIVEMRCKVEGIAISSEAVDKLADEGERSSLRYALQLLTPAGIVSKNKGKG
                     EVGVADVEELGELFLDAKRSAGVLRSTEDFEKRY"
     gene            277934..278536
                     /locus_tag="CNA01000"
                     /db_xref="GeneID:3253856"
     mRNA            277934..278536
                     /locus_tag="CNA01000"
                     /product="ribosomal protein, putative"
                     /transcript_id="XM_567232.1"
                     /db_xref="GI:58259638"
                     /db_xref="GeneID:3253856"
     CDS             278049..278438
                     /locus_tag="CNA01000"
                     /codon_start=1
                     /product="ribosomal protein"
                     /protein_id="XP_567232.1"
                     /db_xref="GI:58259639"
                     /db_xref="GeneID:3253856"
                     /translation="MPRLARVLAVPLPPRARLAPLSLPRATLSAPAPAPQSSILSSLR
                     TPTSTFVASRPMALSSPPIPTHILPSLPAFSPLGALRHVAMGAFYQPSQRKRKNKHGF
                     LSRLKGGKNGRKTLLRRLLKGRKFLSH"
     gene            complement(278541..280964)
                     /locus_tag="CNA01010"
                     /db_xref="GeneID:3253445"
     mRNA            complement(join(278541..278889,278940..279056,
                     279105..279228,279276..279630,279866..280469,
                     280521..280964))
                     /locus_tag="CNA01010"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41560497|gb|CF706338.1,gi|41560510|gb|CF706351.1,
                     gi|41572951|gb|CF718792.1,gi|41572955|gb|CF718796.1"
                     /transcript_id="XM_566531.1"
                     /db_xref="GI:58258236"
                     /db_xref="GeneID:3253445"
     CDS             complement(join(278677..278889,278940..279056,
                     279105..279228,279276..279630,279866..280469,
                     280521..280928))
                     /locus_tag="CNA01010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566531.1"
                     /db_xref="GI:58258237"
                     /db_xref="GeneID:3253445"
                     /translation="MSKVASQPANNPPRRPSGGRQPPGPMGGPKETPKHTPQRSQPYA
                     QQQQRAAMSMPPPQGKPIYSHIKSVHQPQRAYPASVSRSQHGAPQQQPPHLRETSRTN
                     MPPPRQTGATMPHKRETWKNQEGDKLEEQFDHLLDSLQVPETVRLKFSTVSPAIKSSI
                     LSSTLTSNPSILSSLGLPLPTSPLQSPKAKKKLSTPLLRKSKSSGELKGDHSTTVNVG
                     GEGFVIVASPRSGEGGIMSPPLQPGGMRGQSLDLGRPSHSSRPSSRLFGHNPSPSLGN
                     KNFAKGLGIAVGEQPEAFISWLSTYKGTDLRMDVARCKKLRMLLRQESTDWVGAFVEM
                     GGYAALRKLYPRPFPALSVLLFSEKKPGDLASRQLIVELWLFIFELFTPLPQTPNKRP
                     TSIRFDEKANPSPRDVTVFIRSLLVPDLPDPTKDQHEFVTQAHRPRVFKAWVGELSDI
                     CRDYFWIMCHASNTLWALEQVDESLVEKPVAPGGATGGVEFEAMNYVTTHFKLLNAFA
                     ARQAKENMDKARQLHYDLMASGMDRILVTFRKASTTYYPCVHLELARYVRLLQEASPN
                     GKLPYLISKMVGPPPEEVTKAQYRSGYAWLPMPSVTSGRI"
     gene            <281127..283597
                     /locus_tag="CNA01020"
                     /db_xref="GeneID:3253853"
     mRNA            join(<281127..281322,281372..281675,281730..282403,
                     282453..283597)
                     /locus_tag="CNA01020"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_566533.1"
                     /db_xref="GI:58258240"
                     /db_xref="GeneID:3253853"
     CDS             join(281127..281322,281372..281675,281730..282403,
                     282453..283564)
                     /locus_tag="CNA01020"
                     /codon_start=1
                     /product="pre-mRNA splicing factor"
                     /protein_id="XP_566533.1"
                     /db_xref="GI:58258241"
                     /db_xref="GeneID:3253853"
                     /translation="MSALNLPKPVNTYAGEDELRNPNGVAGVANGQAVQENEDAEEEW
                     VPPKASDKLKIGIIYPPKEIRNIVDKTAIHISKSPTPLLLEEKIREHQKTDPKFAFLN
                     DADPYHQYYRYMIVKSQEDAEDAAKGIVKPQEEKKMEKKDEGPKATEPKPWEFKVDLP
                     GVTAMDLDILRLTALFHARRGRSFLSSLSVKEGRNYQFDFLRPTHSLYGYYNRMVESY
                     QKIMQPPPGLIDGVIKEANDPDWKWHILDEARNRAEWEKTRRKRENERAKEEEEEAKA
                     FAAIDWQDFVTVETIEFTQNDEQLELPPPTSVEKLKSMSMAEKRMAAMVMEETGAGPT
                     GETAPPAEEMEMEEDEEEEEARLQRIKAEQEQARAREVQRAAMEQRGMKIKKDYVPRG
                     IQRTNAVATAICPNCGQSIPENELTEHMRIELLDPKWKEQKKQLELRRAQAQQLQQGA
                     DVVSSLKNLASARTDIFGDDVDEAERKRREEEERQKRREREKIVWDGHTASAAKTAET
                     FQSQFSLDEQIKKLHNRAGLTDQPSNAPGPQIGPGITQQAHVPTPLAAGLSTPGGGTA
                     YAGATISAAPTGPTTKEYISTPYDPSFGGTPPPPPGSAPSIHPSRLAAMGGNTPYLGS
                     ATPPMAGQVHPRAEDEGAGDRPVFKRPKIEKLPYGQLYTEIDWQSLHPEPISIAVQLP
                     SMPEKPEWKLDGSIITVPDLPVSTLFSTIRERIRRILDTDVPISRMRLDYNNKPMSNS
                     STLASVNLDEGDMLSLVVKKK"
     repeat_region   282707..282755
                     /rpt_type=tandem
                     /rpt_unit_seq="gagaa"
                     /satellite="microsatellite"
     gene            complement(<283616..285681)
                     /locus_tag="CNA01030"
                     /db_xref="GeneID:3253850"
     mRNA            complement(join(<283616..285171,285218..285681))
                     /locus_tag="CNA01030"
                     /product="transcription regulator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41557696|gb|CF703537.1,gi|41557704|gb|CF703545.1"
                     /transcript_id="XM_566535.1"
                     /db_xref="GI:58258244"
                     /db_xref="GeneID:3253850"
     CDS             complement(join(283616..285171,285218..285518))
                     /locus_tag="CNA01030"
                     /codon_start=1
                     /product="transcription regulator"
                     /protein_id="XP_566535.1"
                     /db_xref="GI:58258245"
                     /db_xref="GeneID:3253850"
                     /translation="MSLENRLSPPLSRSETPALGTVGTVLDNATASLPLPNQNFPGEG
                     LAGPGPSTTENHTKKVIREDVERRQYARMGTIMPGTGDGLGIGEECFSWTDIPNVKNF
                     RYHPCALSPTPSPHPVFPFYRTIPYPPPIPPVHLSLLDRSSYLRISPSLLTIYNDRGF
                     RSCRTNVSVREGTWYYEVHIDRGDGEQGARRGAGGEGGNPHVRLGWGRREANLDTPVG
                     CDAYSYAIRDVGGEKVHISRPKPYANKGFRTGDIVGCLISLPRRPSLEDKPVSDPARI
                     KRQRRAFNYKSQAYFESAEYTPSKEMDALIDRDGKLAAAAKVESQAQEINGGDMPKKQ
                     MGATTKNTKKGKKQPEKAHEPVARKLEKLSSSSISFFINGESFGEAFTDLYDFTPLPS
                     LYPPVGGHGKKHHPGDEVLHDDGTLGYYPMVSCFGRAKATCNFGPDFAHPLPEGARPM
                     CERYAEFKEEERLLDEKDEVEDAERLRQILEAEKKMLSKVKPRNQKANSATASGENTP
                     KRKKGPAPKRKREGRDGTEMSTPGVESVRGLTATPAPEAPMSEAGIEWREGTRERSMS
                     VAASLGGQGWGTVKEEISDEREEKKIKKDKEVEVKQENGGNSEDGEFEGINW"
     gene            <286173..>287116
                     /locus_tag="CNA01040"
                     /db_xref="GeneID:3253442"
     mRNA            join(<286173..286293,286347..286531,286679..286957,
                     287021..>287116)
                     /locus_tag="CNA01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_566537.1"
                     /db_xref="GI:58258248"
                     /db_xref="GeneID:3253442"
     CDS             join(286173..286293,286347..286531,286679..286957,
                     287021..287116)
                     /locus_tag="CNA01040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566537.1"
                     /db_xref="GI:58258249"
                     /db_xref="GeneID:3253442"
                     /translation="MSTIRQLLDSQSRALMAAGAVVVAAAALWITSDYRDWITFGTGG
                     TPSNPKGYLKMRKFWFKRLFINNDDLTDGSSLPDEGPSYLPGYVTPRRGGRPERMPRQ
                     VLHHLGSKLQSEHPDILNLAPSKTEGGTGDAIYAKEDLPTLNPKAKQVAYEIAHVHPA
                     DNSLHVHLSPRDAKMLIEKSWAERFPVHELGPPQWVMVYAPRNKEEVDLVEKIMKAAV
                     GWVTGVTI"
     gene            complement(287322..288844)
                     /locus_tag="CNA01050"
                     /db_xref="GeneID:3253440"
     mRNA            complement(join(287322..287723,287787..287956,
                     288010..288351,288417..288689,288754..288844))
                     /locus_tag="CNA01050"
                     /product="sorbitol dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41550464|gb|CF696305.1,gi|41550470|gb|CF696311.1,
                     gi|41564438|gb|CF710279.1,gi|41564455|gb|CF710296.1,
                     gi|41568003|gb|CF713844.1,gi|41568014|gb|CF713855.1"
                     /transcript_id="XM_566539.1"
                     /db_xref="GI:58258252"
                     /db_xref="GeneID:3253440"
     CDS             complement(join(287441..287723,287787..287956,
                     288010..288351,288417..288689,288754..288825))
                     /locus_tag="CNA01050"
                     /EC_number="1.1.1.14"
                     /codon_start=1
                     /product="sorbitol dehydrogenase"
                     /protein_id="XP_566539.1"
                     /db_xref="GI:58258253"
                     /db_xref="GeneID:3253440"
                     /translation="MSTELNPDNTSFVLHGVEDVRFDQRPIPEVHNDQVLIKVVKTGI
                     CGSDVHYLQHGRIGSFVLEEPMCLGHESAGVVVKLGPNVREDLGVEVGTRVAMEPGVC
                     CRSCANCKAGLYELCPYMSFAATPPTIFGTLCRYYVLPADLVHPLPESVSFEDGAMME
                     PLSVGVHSVATLGGCKSDQTVIVFGAGPVGLLCMAVAKALGARRIIAVDINKERLEFA
                     KSYAATDVCIPGSKLDGEDGEAYTARIAGELRQELGIPERGKGAIDLAIEASGAPTCV
                     QIGLAVLKPAGTYVQVGMGAKMTVPVPLFHIISKQLHVVGSFRYGSGDYPLAISLVER
                     GLIDLKPLVTQRFKFENAKEAFETTKVGKDKNGKGVIKCIIDGPE"
     gene            290349..291424
                     /locus_tag="CNA01060"
                     /db_xref="GeneID:3253810"
     mRNA            join(290349..290752,290810..291022,291078..291149,
                     291213..291424)
                     /locus_tag="CNA01060"
                     /product="ribosomal protein S3, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41555396|gb|CF701237.1,gi|41555400|gb|CF701241.1,
                     gi|41556941|gb|CF702782.1,gi|41556947|gb|CF702788.1,
                     gi|41558174|gb|CF704015.1,gi|41558183|gb|CF704024.1"
                     /transcript_id="XM_566546.1"
                     /db_xref="GI:58258266"
                     /db_xref="GeneID:3253810"
     CDS             join(290397..290752,290810..291022,291078..291149,
                     291213..291330)
                     /locus_tag="CNA01060"
                     /codon_start=1
                     /product="ribosomal protein S3"
                     /protein_id="XP_566546.1"
                     /db_xref="GI:58258267"
                     /db_xref="GeneID:3253810"
                     /translation="MSASQIISKRRKFVADGVFQAELNDFFTRELAEEGYAGCEVRVT
                     HARTEIIIRATHTQEVLGDKGRRIRELKALIEKRFKFPENALELYAEKVQYRGLSATA
                     QAESLRYKLLGGLAMRRACYGVLRFVMESGAKGCEVVVSGKLRAARAKSMKFTEGFMV
                     HSGQPARDFIDYAVRHVLLRQGVLGIKVKIMKPSDPAGRQGPAKNLPDDVQITEPKAE
                     GVIEIRSDHKNPPVQAIPPAAAPAPEAQAAEAQY"
     gene            complement(291852..294149)
                     /locus_tag="CNA01070"
                     /db_xref="GeneID:3253747"
     mRNA            complement(join(291852..292143,292223..292261,
                     292382..292520,292581..292606,292678..292751,
                     292850..293090,293146..293361,293436..293653,
                     293715..294149))
                     /locus_tag="CNA01070"
                     /product="C-14 sterol reductase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530175|gb|CF676016.1,gi|41530179|gb|CF676020.1,
                     gi|41535734|gb|CF681575.1,gi|41535737|gb|CF681578.1,
                     gi|41537018|gb|CF682859.1,gi|41537033|gb|CF682874.1,
                     gi|41539409|gb|CF685250.1,gi|41541169|gb|CF687010.1,
                     gi|41541178|gb|CF687019.1,gi|41541303|gb|CF687144.1,
                     gi|41541313|gb|CF687154.1,gi|41543531|gb|CF689372.1,
                     gi|41543538|gb|CF689379.1,gi|41557382|gb|CF703223.1,
                     gi|41558429|gb|CF704270.1,gi|41558430|gb|CF704271.1,
                     gi|41562527|gb|CF708368.1,gi|41562535|gb|CF708376.1,
                     gi|41565335|gb|CF711176.1,gi|41565348|gb|CF711189.1,
                     gi|41571521|gb|CF717362.1,gi|41571529|gb|CF717370.1"
                     /transcript_id="XM_566548.1"
                     /db_xref="GI:58258270"
                     /db_xref="GeneID:3253747"
     CDS             complement(join(292138..292143,292223..292261,
                     292382..292520,292581..292606,292678..292751,
                     292850..293090,293146..293361,293436..293653,
                     293715..294135))
                     /locus_tag="CNA01070"
                     /codon_start=1
                     /product="C-14 sterol reductase"
                     /protein_id="XP_566548.1"
                     /db_xref="GI:58258271"
                     /db_xref="GeneID:3253747"
                     /translation="MDAQEESTTTVITATTHLDLPAHPHIKTYQELNPRSKPTEFFGP
                     CGTGAITLFTPLFTYFFFFACNDAVGCTPTSVQGWKDAFALVGNYPSSAGRLWDWKAA
                     GVYLGWYAFCMICEVVLPGQRVEGNLLRDGRRKVYRMNGLYTLLLALGLLTGVLVQPR
                     GIQAFTWLHDHFVPLISASLAMATFQAVWVYVWSFFSGELLALGGNSGNVVYDFFIGR
                     PLNPTIPGFPSFDLKTFNEVRPGMILWFLLNISCACEQYVRIGKLTDSMWIVLVFEGW
                     YVLDCLLQEHTILNQMDITTDGFGFMLAFGDLTWVPFTYGLQARFLASTPVELGPVAT
                     ALIVGVEVAGMYIFRVANNEKADFRAGKNPKNLEYMQTERGTKLLTSGWWGRSQHPNY
                     FGDWLIALGWCLPTGFNTPLTYFYLVYFVILLLHRQKRDEEACKLKYGKDWDRYCEKV
                     PYKIIPYVY"
     gene            complement(294348..295106)
                     /locus_tag="CNA01080"
                     /db_xref="GeneID:3253816"
     mRNA            complement(join(294348..294598,294702..294777,
                     294850..295106))
                     /locus_tag="CNA01080"
                     /product="expressed protein"
                     /transcript_id="XM_566550.1"
                     /db_xref="GI:58258274"
                     /db_xref="GeneID:3253816"
     CDS             complement(join(294432..294598,294702..294777,
                     294850..295089))
                     /locus_tag="CNA01080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566550.1"
                     /db_xref="GI:58258275"
                     /db_xref="GeneID:3253816"
                     /translation="MSLQPQISTYHTSIPSPIPSSPSFNFHLTRMVNTLMIWVGTGLP
                     TDTAGNVAGGVASMGSVEQVDNKLAGDWSVAMPSRGNIPVTATPLFRSGSTDIALPMS
                     QRLAKKFPSNQIHLSLSLPPSLTNQTGQSIDPYASKMMLVMEKKLGKWIEEILLQEKA
                     "
     gene            <295190..296036
                     /locus_tag="CNA01090"
                     /db_xref="GeneID:3253786"
     mRNA            join(<295190..295606,295667..295817,295876..296036)
                     /locus_tag="CNA01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_566552.1"
                     /db_xref="GI:58258278"
                     /db_xref="GeneID:3253786"
     CDS             join(295190..295606,295667..295817,295876..295958)
                     /locus_tag="CNA01090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566552.1"
                     /db_xref="GI:58258279"
                     /db_xref="GeneID:3253786"
                     /translation="MQKTAGGRLQRRCSLHFPHLLVPHLIQHFIPQSTMADITPPSSQ
                     QNTPQRTIDNSLANPDPAAMDVDLDEDLESIASEGSDKISVPSGAERANQVRQAVEAD
                     ADESGDEGDEEVEAEDEAGAEEKGKVEKKDKAPLGGPTKKRTKRPFKGQSLSTHPHSH
                     AARPRPRTEGPHKADGSLFDSEIVARWNADFGDVLSPSPPCSNTRAAPVPAQAAQS"
     gene            complement(297335..299357)
                     /locus_tag="CNA01100"
                     /db_xref="GeneID:3253699"
     mRNA            complement(join(297335..297615,297673..297692,
                     297748..297787,297854..298026,298091..298184,
                     298240..298274,298363..298546,298602..298672,
                     298729..298885,298948..299044,299107..299203,
                     299275..299357))
                     /locus_tag="CNA01100"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530214|gb|CF676055.1,gi|41533880|gb|CF679721.1,
                     gi|41534109|gb|CF679950.1,gi|41536407|gb|CF682248.1,
                     gi|41536594|gb|CF682435.1,gi|41538468|gb|CF684309.1,
                     gi|41540148|gb|CF685989.1,gi|41547441|gb|CF693282.1,
                     gi|41552142|gb|CF697983.1,gi|41552152|gb|CF697993.1,
                     gi|41555603|gb|CF701444.1,gi|41566785|gb|CF712626.1,
                     gi|41566788|gb|CF712629.1,gi|41574299|gb|CF720140.1,
                     gi|41574305|gb|CF720146.1"
                     /transcript_id="XM_567088.1"
                     /db_xref="GI:58259350"
                     /db_xref="GeneID:3253699"
     mRNA            complement(join(297335..297615,297673..297692,
                     297748..297787,297854..298026,298091..298184,
                     298240..298274,298363..298546,298602..298672,
                     298729..298885,298948..299044,299107..299343))
                     /locus_tag="CNA01100"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530214|gb|CF676055.1,gi|41533742|gb|CF679583.1,
                     gi|41533880|gb|CF679721.1,gi|41534109|gb|CF679950.1,
                     gi|41534116|gb|CF679957.1,gi|41536407|gb|CF682248.1,
                     gi|41536415|gb|CF682256.1,gi|41536594|gb|CF682435.1,
                     gi|41536600|gb|CF682441.1,gi|41538468|gb|CF684309.1,
                     gi|41538476|gb|CF684317.1,gi|41540148|gb|CF685989.1,
                     gi|41540154|gb|CF685995.1,gi|41547441|gb|CF693282.1,
                     gi|41552142|gb|CF697983.1,gi|41552152|gb|CF697993.1,
                     gi|41555603|gb|CF701444.1,gi|41564466|gb|CF710307.1,
                     gi|41566785|gb|CF712626.1,gi|41569159|gb|CF715000.1,
                     gi|41574299|gb|CF720140.1"
                     /transcript_id="XM_567089.1"
                     /db_xref="GI:58259352"
                     /db_xref="GeneID:3253699"
     CDS             complement(join(297493..297615,297673..297692,
                     297748..297787,297854..298026,298091..298184,
                     298240..298274,298363..298546,298602..298672,
                     298729..298885,298948..299044,299107..299147))
                     /locus_tag="CNA01100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567088.1"
                     /db_xref="GI:58259351"
                     /db_xref="GeneID:3253699"
                     /translation="MGKEKVAVVGSGNWGSAISRIAGINTKKHPDVFDDTRVSVWVYE
                     EEFEGKKLTEIINSEHENRKYLPGVKLEDNVVAVPDLKEAVKDATALVFVTPHQFLGK
                     VLDTLEGNVRKDAKAITLIKGVEVQGDDIHIFADVIEQRLGIPCSALSGANIANEVAR
                     DTFSETTIGYRNKEDGELWLKLFQTPKFKVQLIDDVAGVSLCGALKNIVAVAAGFIDG
                     LGYGSNSKAAIMRIGLLEMKHFCQEFFVDVKEESFLQESAGVSDVITSCLSGRNYKVA
                     AAFVGANKSFDQLEAEMLNGQKLQGIHTAKDVHNFLSAKNRSRAYPLFDKVYQISWEG
                     VPVEQLTEGL"
     gene            <299540..301965
                     /locus_tag="CNA01110"
                     /pseudo
                     /db_xref="GeneID:3253676"
     gene            complement(299868..302803)
                     /locus_tag="CNA01120"
                     /db_xref="GeneID:3253685"
     mRNA            complement(join(299868..300363,300417..300504,
                     300555..300628,300679..301210,301259..301778,
                     301841..301932,301991..302080,302142..302803))
                     /locus_tag="CNA01120"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544881|gb|CF690722.1,gi|41544892|gb|CF690733.1,
                     gi|41567692|gb|CF713533.1,gi|41567701|gb|CF713542.1"
                     /transcript_id="XM_567087.1"
                     /db_xref="GI:58259348"
                     /db_xref="GeneID:3253685"
     CDS             complement(join(300178..300363,300417..300504,
                     300555..300628,300679..301210,301259..301778,
                     301841..301932,301991..302080,302142..302245))
                     /locus_tag="CNA01120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567087.1"
                     /db_xref="GI:58259349"
                     /db_xref="GeneID:3253685"
                     /translation="MRSHLSLSLLFSSLVAISVVSAASADEWKGKSIYQLFTDRFAPV
                     SDTAPARSSPIPDECDPIDQTWCGGTWLSIIDKLDYISDMGFDAIWISPVSQNIDRDT
                     PYHYAYHGYWVNDPRALNPRFGTADDLKALSKALHDRGMYLMVDIVVNNIPGTTVNDS
                     FSTSDLVADGSIWTDPSEFHPQCWIDYSNQTSVENCWLGDDKLPLMDVNTENEAVVST
                     LQAWISNLTAEYEIDGLRIDAAKHVPGEFWTGFCGAAGVFCMGEVYTDDINFAAKFQT
                     QNWMDSVLGYPLYYGIVDGFGTPNGNMSRFVDIATQVLGTFPTPGLIGNFIENHDLPR
                     WRNTTADSQLAYNAMTVQFIFEGLPVVYYGQEQDFASGAGDPYNRQALWTSEYANTTS
                     YNHIKRLNEIRHAVISNNTLFDGKNFLDSQTKIVASTDYDVAFRKGPLLAVLTNRGSP
                     SQNVGFGVPTSGWPSQSSVVDLLSCKQFTVGSGGAMLVSYSASGYGGMPYVFAAQSDA
                     SAMGICGDAGMSTYVSPNITSAAFPALAPATGLGSALSLPAAVAGALGLMFIL"
     gene            complement(<304392..>305484)
                     /locus_tag="CNA01130"
                     /db_xref="GeneID:3253619"
     mRNA            complement(join(<304392..304619,304687..304799,
                     304875..>305484))
                     /locus_tag="CNA01130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567091.1"
                     /db_xref="GI:58259356"
                     /db_xref="GeneID:3253619"
     CDS             complement(join(304392..304619,304687..304799,
                     304875..305484))
                     /locus_tag="CNA01130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567091.1"
                     /db_xref="GI:58259357"
                     /db_xref="GeneID:3253619"
                     /translation="MTISTVAFLYPGAMGASLARVLAVRLPHLKLLTSLQGRSQATIS
                     RAESCGLTNVPFADLIAQSDIILSILPPSSAVSLAKEVVAHVATEKKPIFVDANAVSP
                     ETAAQISSIFEAKEIPFIDGCIIGFPATEDFSSIPKLYLSASPEREDLMREVTQTLSG
                     GEEGKGMRVRPMEGSGVGGASALKMCYGGINKAVSGLAAAMVLSHSPGTAKAFLDELS
                     ESQPALTKKLSRAIPDMIPKAYRWVGEMEEISSFITSSILQSASITHPNPADMYQGLA
                     QMFQRVADDVKHSQAGQRGEEVKILLDWAKRGEKELAKKE"
     gene            305835..308253
                     /locus_tag="CNA01140"
                     /db_xref="GeneID:3253812"
     mRNA            join(305835..306452,306495..306575,306625..306741,
                     306798..307029,307082..307186,307235..307927,
                     307983..308111,308166..308253)
                     /locus_tag="CNA01140"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538436|gb|CF684277.1,gi|41538446|gb|CF684287.1,
                     gi|41548336|gb|CF694177.1,gi|41548342|gb|CF694183.1,
                     gi|41551111|gb|CF696952.1,gi|41551118|gb|CF696959.1,
                     gi|41573067|gb|CF718908.1"
                     /transcript_id="XM_566554.1"
                     /db_xref="GI:58258282"
                     /db_xref="GeneID:3253812"
     CDS             join(306161..306452,306495..306575,306625..306741,
                     306798..307029,307082..307186,307235..307927,
                     307983..308111,308166..308172)
                     /locus_tag="CNA01140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566554.1"
                     /db_xref="GI:58258283"
                     /db_xref="GeneID:3253812"
                     /translation="MIPLGSPRRSHILLAALLSLVLVLFLHTHHHPQSHFLSGPISKL
                     KVQFGLYSSSDGLETKDKGIRKRIDKIRGYCEAEDAFEREYGRTNLRLSRAYEGSHER
                     MRLLLQKIMRGEPLTISAIGGSVTKGHQVWQNEIWFHKFWEWLTEFAGEGVEIKQVNG
                     AAPATGSDYFSFCFPLHIPSDSDLVLVELAVNDEGIPEHVENMENLLRGLLDLPNKPA
                     VMLIEAMAFSNGGMGGGGGRMHLPVAQYYDVPVINQRLPLVNHFARHPQLVGPYFAQD
                     WWGNPDTRHINSHGHRDLGMLVASFVKDVACEMISQPTFHVQSPSAFEALSIVALAQP
                     PQTEDKEDAKIEDELLAAEQKWWPEQSRSWRKDPTEEKPVGELMPGLWSTPIEYGILP
                     RLRVLEGWNPHLDYSVPPFHPTCLSTRAKEPHFNLTPSANEGWEYWVHPEHLDKPYLV
                     ARTPGARVTFELETSVGIVKMYALKSKTFGLGTVECWADEERRKSVKIEGYWDNGNVN
                     IGRFAPIRDNLQPGKHTITCELLEETSDPGGGREFRMISMMSV"
     gene            309514..313324
                     /locus_tag="CNA01150"
                     /db_xref="GeneID:3253749"
     mRNA            join(309514..309675,309773..310003,310062..310141,
                     310274..310744,310797..310888,310937..311675,
                     311774..312299,312356..312588,312654..312671,
                     312772..312936,312988..313324)
                     /locus_tag="CNA01150"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530337|gb|CF676178.1,gi|41530341|gb|CF676182.1,
                     gi|41543973|gb|CF689814.1,gi|41543982|gb|CF689823.1"
                     /transcript_id="XM_566556.1"
                     /db_xref="GI:58258286"
                     /db_xref="GeneID:3253749"
     CDS             join(310682..310744,310797..310888,310937..311675,
                     311774..312299,312356..312588,312654..312671,
                     312772..312936,312988..313026)
                     /locus_tag="CNA01150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566556.1"
                     /db_xref="GI:58258287"
                     /db_xref="GeneID:3253749"
                     /translation="MSSTTNSHLMKTTRWGRPFVKDTHDLFCTLVASLNFDTHRNFFK
                     TYPNSFTTDDACLNLASLKFSQSTRTADPKDPTRIVTTTTTTTFSMSREMAKGICQHF
                     MDCHLVENATDIMAGFFKDRGIYMLTPKGLHILERFVSKNGITTDHLLKLFATQPITM
                     KLLHLERRSGDDEVIITRNVIEVLFRRFVGRIPNLTKLNEDEILAHYYSRFYTKTPSL
                     PAGETLDRSEGIIVRKPGGGEKTTSSDDYIFSARAAVNWMLDFTSATGIDEAAEILAH
                     FVRYGLITLVSDKGKIKEENLIQEAEFRVTERAIYKITKEGIAVAKWNETTTNHAAGA
                     SKANLSVETTPGNKARPSHEASPSVSVQRRTSLSDRFRGDFDISGVPGGDNHIKDSHT
                     ARLKQILEEPALRSLFREFLRSNFCEENLSFWLDVQDFKRRFQTTSSAVAAPGSKQAK
                     VSGHAAMEKHQQDLVAMAFVIYNTYLAPASPCELNIDHNLRAELVGYMNQITSDKEAG
                     VKGHIEPGVGDTLHASQLQTMVKLYERIQVYIFRLMATDSVPKFCKTELFLTLMEQFS
                     EYTKDEFAVTDLETKAAALTVDSRKTTAHVDGRQPSPTRSYLTISQAANEKQAAKQKN
                     "
     gene            complement(313266..>314665)
                     /locus_tag="CNA01160"
                     /db_xref="GeneID:3253807"
     mRNA            complement(join(313266..313549,313609..313783,
                     313843..313920,313986..314508,314565..>314665))
                     /locus_tag="CNA01160"
                     /product="LSDR, putative"
                     /transcript_id="XM_566558.1"
                     /db_xref="GI:58258290"
                     /db_xref="GeneID:3253807"
     CDS             complement(join(313545..313549,313609..313783,
                     313843..313920,313986..314508,314565..314665))
                     /locus_tag="CNA01160"
                     /codon_start=1
                     /product="LSDR"
                     /protein_id="XP_566558.1"
                     /db_xref="GI:58258291"
                     /db_xref="GeneID:3253807"
                     /translation="MKCLRSLTLCFHQQTSFIMSYLQDLFGLTGKTALITGATRGIGA
                     RMALALAKAGADIILVQRNTSNTATRDDIIAAGGKADIVVCDLGDAASVAKLIPHVTK
                     ELGRTLDIVVNCGGIQRRHPVENFPENDWNDVLQVNLNTVFTITRDAGRHMLESRGGV
                     AGEPVPEGGAAGNPRGFGKIINISSLVAYQGGLNVVAYAAAKHGVQGIVKSFSNGWAS
                     KGVCVNAIAPGYIATDMNEALIADKDRARQILERIPAGRWGSPEDFEGAIVFLASRAS
                     DYVTGECLVVDGGWMAR"
     gene            315070..316954
                     /locus_tag="CNA01170"
                     /db_xref="GeneID:3253745"
     mRNA            join(315070..315340,315397..315885,315947..315981,
                     316034..316301,316350..316954)
                     /locus_tag="CNA01170"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546805|gb|CF692646.1,gi|41551766|gb|CF697607.1,
                     gi|41551775|gb|CF697616.1"
                     /transcript_id="XM_566560.1"
                     /db_xref="GI:58258294"
                     /db_xref="GeneID:3253745"
     CDS             join(315254..315340,315397..315885,315947..315981,
                     316034..316301,316350..316502)
                     /locus_tag="CNA01170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566560.1"
                     /db_xref="GI:58258295"
                     /db_xref="GeneID:3253745"
                     /translation="MTAFNSANWGLASEREYVPMTTRESGRPSSRLKSTAIRLLPTVV
                     ILALGILIGSNVPWYLSIYSRRPSGAISLLPRALPPIASSTVTDQLVSLGLPPPEEPI
                     PNVVHYVYGLADDQPDFPYFAYLAMRSALVSLKPDVVYFHCINEPKGYWWERVKNWEG
                     WIDDQGNRRGMMEIKRARDVQWIGTSKRPVVHFAHKADIIRLEVLLQYGGIYLDIDTF
                     VLRSFSSASLLQYDTVLALEAHGLTFLRKPASDDEMRPKGLCNAVIIARRGAEFLKRW
                     LDSYEGFREDKWTEHSVEMPWTLAQMYPTLVTVLSERTFFWPLWTDDHIHAVYATKEY
                     DFEESGQLA"
     gene            318264..322491
                     /locus_tag="CNA01180"
                     /db_xref="GeneID:3253784"
     mRNA            join(318264..318397,318610..319032,319738..319944,
                     320005..320108,320161..320295,320547..320603,
                     320804..320915,320968..321100,321157..321470,
                     321522..322491)
                     /locus_tag="CNA01180"
                     /product="serine/threonine-protein kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533597|gb|CF679438.1,gi|41533774|gb|CF679615.1,
                     gi|41541411|gb|CF687252.1,gi|41550752|gb|CF696593.1,
                     gi|41551194|gb|CF697035.1,gi|41551510|gb|CF697351.1,
                     gi|41554980|gb|CF700821.1,gi|41557686|gb|CF703527.1,
                     gi|41559465|gb|CF705306.1,gi|41568939|gb|CF714780.1"
                     /transcript_id="XM_566563.1"
                     /db_xref="GI:58258300"
                     /db_xref="GeneID:3253784"
     mRNA            join(318264..318397,318610..319032,319738..319944,
                     320005..320108,320161..320295,320804..320915,
                     320968..321100,321157..321470,321522..322491)
                     /locus_tag="CNA01180"
                     /product="serine/threonine-protein kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532306|gb|CF678147.1,gi|41533597|gb|CF679438.1,
                     gi|41533774|gb|CF679615.1,gi|41541411|gb|CF687252.1,
                     gi|41550752|gb|CF696593.1,gi|41551194|gb|CF697035.1,
                     gi|41551510|gb|CF697351.1,gi|41554980|gb|CF700821.1,
                     gi|41557686|gb|CF703527.1,gi|41559465|gb|CF705306.1"
                     /transcript_id="XM_566562.1"
                     /db_xref="GI:58258298"
                     /db_xref="GeneID:3253784"
     CDS             join(319014..319032,319738..319944,320005..320108,
                     320161..320295,320547..320603,320804..320915,
                     320968..321100,321157..321470,321522..322297)
                     /locus_tag="CNA01180"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_566563.1"
                     /db_xref="GI:58258301"
                     /db_xref="GeneID:3253784"
                     /translation="MLSSFKQILRHGKHAQQASPSPQPDTKNGRSKTTQAQQPLPPAA
                     VQQQPQQPSQPQQQQQHRRKDEYSAKLTTSTTGQNKIPAASPNYREEAEKIVADERAQ
                     SEKMPVYAGLEEFTLIEKMGDGAFSNVYKAIDRRSGQKVAVKVVRKYELNQSQHGNKH
                     LNANFKKRGPRVTERANILKEVQIMRGIDHPSIVKLLKFFESDEHYFLVLELMEGGEL
                     FHQIVKLTYFSEALSRHVILQVAEGIRYLHEERGVVHRDIKPENLLFERIPIIPSRNP
                     VHRPYDEEKEDEGEFQPGIGGGEIGRVKIADFGLSKIVWDEQTMTPCGTVGYTAPEIV
                     KDERYSKSVDMWALGCVLYTLLCGFPPFYDESINVLTEKVARGYYTFLSPWWDDISHS
                     AKDLISHLLCVDPAQRYTIDEFLAHPWIRDAAPPPPPPTSRAVPSESPMYSPLLASIR
                     AGNREARSPGVGALKEAFDVTYAVHRMEEEGARRRAYNGPGGAGQRGFLQGLNEEAEE
                     EDEQAQVEEARRKHGEAVARQIQEHRGRAAANAAAGIKEPPVANYVGRGGANRREAEA
                     VIYDGRAGQRDRGKGGKSAGGFDLDLNNATLLGRRGKKVAPSPLAQQVQAGQ"
     CDS             join(319014..319032,319738..319944,320005..320108,
                     320161..320295,320804..320915,320968..321100,
                     321157..321470,321522..322297)
                     /locus_tag="CNA01180"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_566562.1"
                     /db_xref="GI:58258299"
                     /db_xref="GeneID:3253784"
                     /translation="MLSSFKQILRHGKHAQQASPSPQPDTKNGRSKTTQAQQPLPPAA
                     VQQQPQQPSQPQQQQQHRRKDEYSAKLTTSTTGQNKIPAASPNYREEAEKIVADERAQ
                     SEKMPVYAGLEEFTLIEKMGDGAFSNVYKAIDRRSGQKVAVKVVRKYELNQSQRANIL
                     KEVQIMRGIDHPSIVKLLKFFESDEHYFLVLELMEGGELFHQIVKLTYFSEALSRHVI
                     LQVAEGIRYLHEERGVVHRDIKPENLLFERIPIIPSRNPVHRPYDEEKEDEGEFQPGI
                     GGGEIGRVKIADFGLSKIVWDEQTMTPCGTVGYTAPEIVKDERYSKSVDMWALGCVLY
                     TLLCGFPPFYDESINVLTEKVARGYYTFLSPWWDDISHSAKDLISHLLCVDPAQRYTI
                     DEFLAHPWIRDAAPPPPPPTSRAVPSESPMYSPLLASIRAGNREARSPGVGALKEAFD
                     VTYAVHRMEEEGARRRAYNGPGGAGQRGFLQGLNEEAEEEDEQAQVEEARRKHGEAVA
                     RQIQEHRGRAAANAAAGIKEPPVANYVGRGGANRREAEAVIYDGRAGQRDRGKGGKSA
                     GGFDLDLNNATLLGRRGKKVAPSPLAQQVQAGQ"
     mRNA            join(319417..319505,319738..319944,320005..320108,
                     320161..320295,320547..320603,320804..320915,
                     320968..321100,321157..321470,321522..322491)
                     /locus_tag="CNA01180"
                     /product="serine/threonine-protein kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532300|gb|CF678141.1,gi|41532547|gb|CF678388.1,
                     gi|41533585|gb|CF679426.1,gi|41534308|gb|CF680149.1,
                     gi|41541404|gb|CF687245.1,gi|41550743|gb|CF696584.1,
                     gi|41551184|gb|CF697025.1,gi|41551505|gb|CF697346.1,
                     gi|41554972|gb|CF700813.1,gi|41557675|gb|CF703516.1,
                     gi|41559449|gb|CF705290.1,gi|41563476|gb|CF709317.1,
                     gi|41568927|gb|CF714768.1,gi|41568939|gb|CF714780.1"
                     /transcript_id="XM_566564.1"
                     /db_xref="GI:58258302"
                     /db_xref="GeneID:3253784"
     CDS             join(320094..320108,320161..320295,320547..320603,
                     320804..320915,320968..321100,321157..321470,
                     321522..322297)
                     /locus_tag="CNA01180"
                     /codon_start=1
                     /product="serine/threonine-protein kinase"
                     /protein_id="XP_566564.1"
                     /db_xref="GI:58258303"
                     /db_xref="GeneID:3253784"
                     /translation="MPVYAGLEEFTLIEKMGDGAFSNVYKAIDRRSGQKVAVKVVRKY
                     ELNQSQHGNKHLNANFKKRGPRVTERANILKEVQIMRGIDHPSIVKLLKFFESDEHYF
                     LVLELMEGGELFHQIVKLTYFSEALSRHVILQVAEGIRYLHEERGVVHRDIKPENLLF
                     ERIPIIPSRNPVHRPYDEEKEDEGEFQPGIGGGEIGRVKIADFGLSKIVWDEQTMTPC
                     GTVGYTAPEIVKDERYSKSVDMWALGCVLYTLLCGFPPFYDESINVLTEKVARGYYTF
                     LSPWWDDISHSAKDLISHLLCVDPAQRYTIDEFLAHPWIRDAAPPPPPPTSRAVPSES
                     PMYSPLLASIRAGNREARSPGVGALKEAFDVTYAVHRMEEEGARRRAYNGPGGAGQRG
                     FLQGLNEEAEEEDEQAQVEEARRKHGEAVARQIQEHRGRAAANAAAGIKEPPVANYVG
                     RGGANRREAEAVIYDGRAGQRDRGKGGKSAGGFDLDLNNATLLGRRGKKVAPSPLAQQ
                     VQAGQ"
     gene            <322732..324628
                     /locus_tag="CNA01190"
                     /db_xref="GeneID:3253714"
     mRNA            join(<322732..322878,323199..323294,323529..323581,
                     323649..323699,323784..323893,323980..324059,
                     324196..324262,324337..324628)
                     /locus_tag="CNA01190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566566.1"
                     /db_xref="GI:58258306"
                     /db_xref="GeneID:3253714"
     CDS             join(322732..322878,323199..323294,323529..323581,
                     323649..323699,323784..323893,323980..324059,
                     324196..324262,324337..324539)
                     /locus_tag="CNA01190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566566.1"
                     /db_xref="GI:58258307"
                     /db_xref="GeneID:3253714"
                     /translation="MHLSLHSYCSYVCSPFATRNTITTVLDKKSNDDEGLSNNRACSS
                     EQGQCLNRLYRSSWAQSLQERSPSPRPFHRDALTSQEDGNDELPCHCQSSPSQSRRMG
                     FGTWCRRWCRHSCFFGMQGHSGRFFRGQATVLQRSWTGGRGGGLHQRRLAKRRQKDNR
                     WQRGGCRIRSSWYDRTQPEIPANLLLLKQASAVGVYWGATELREPETAKQISSSVLKL
                     LSTGDIRPIVHSTPYKGVEGVVQGLKDIEERKVWGKGVVIIREEETKAKL"
     gene            complement(324612..328130)
                     /locus_tag="CNA01200"
                     /db_xref="GeneID:3253718"
     mRNA            complement(join(324612..325042,325110..326558,
                     326621..327579,327662..328130))
                     /locus_tag="CNA01200"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41573074|gb|CF718915.1"
                     /transcript_id="XM_566568.1"
                     /db_xref="GI:58258310"
                     /db_xref="GeneID:3253718"
     CDS             complement(join(324902..325042,325110..326558,
                     326621..327274))
                     /locus_tag="CNA01200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566568.1"
                     /db_xref="GI:58258311"
                     /db_xref="GeneID:3253718"
                     /translation="MGSGRKKLPDDEARHERKGVGGGPGETRRGSVMGSGMQHQDHDR
                     ASERKEVFLCKRASMGMGGGAIRGGGTSLFDRRPSLLTNTPAKHVMLSQAIDPPASPL
                     SAAPGATEQPLPPAAGRRRTTVSLHSLADAALADASHRPQLTHRSSITLPPISSLLPG
                     ASAPVPASKSSAQKLPSRNQATSGQPSVKGWSPATLSPKNTGAPVVLPRTRAVYRPIE
                     APVHPLVPDQHVALEYNVRRYTRADSSGRPSSSSQAQSSCCNIAPAAPTSRPTCRGKA
                     PAEQPMPQPHPQTQLHRRYPLQGLQLDKTYPEWSIHGWHEDAQRLLQPPRTLTPPSVY
                     AKSRSISRGAYSSGSEFDKPARPPPGWGDNVHGTSQAYAPPFLQANTLYPPPLRPINS
                     EAKPRQRSYRFITHDTEPSTEQKNHAVTRALGTEEECNGPQTKAKESSSLGNKCSIGS
                     APSSPPSCHPIKGIIPSASPTPVINNHPLTRSTPSTWSITSHLNITTYRSNSHQSSQS
                     PITPKAAFENELDSTSNSSSSSSAPSEYEDDGFELSDMSDRGHEPGRALVHGGMGSRE
                     NIGEDEKGENLSAKLRLQIPPFYSTPSGSPLKSVSSENVTPSSSNYTPTSSTKRARIL
                     TSTSTCNPMSTSSWDAERENGVLKGCTSGNTVTVESTGRNDGKVRQKEQRRNRERRRE
                     QNAVAQKKFRWKKKQMAEKMAADLESANETTLKLQEQLEERDSLVSNLQSELSLYKRK
                     FGECTLI"
     gene            complement(329815..332642)
                     /locus_tag="CNA01210"
                     /db_xref="GeneID:3253737"
     mRNA            complement(join(329815..330069,330145..330594,
                     330650..331327,331381..331684,331733..331884,
                     331934..332401,332449..332642))
                     /locus_tag="CNA01210"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537319|gb|CF683160.1,gi|41537326|gb|CF683167.1,
                     gi|41545206|gb|CF691047.1,gi|41546043|gb|CF691884.1,
                     gi|41560286|gb|CF706127.1,gi|41561839|gb|CF707680.1,
                     gi|41561850|gb|CF707691.1"
                     /transcript_id="XM_566570.1"
                     /db_xref="GI:58258314"
                     /db_xref="GeneID:3253737"
     CDS             complement(join(330004..330069,330145..330594,
                     330650..331327,331381..331684,331733..331884,
                     331934..332401,332449..332607))
                     /locus_tag="CNA01210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566570.1"
                     /db_xref="GI:58258315"
                     /db_xref="GeneID:3253737"
                     /translation="MSSSIITKPKPHRRSSAMSSISIEQPPLLGLPHEILEQIFLALS
                     LPGRSKLARTCSALRDIYAASAQLQYLAILETSAYLDYPRVLKAVEPVEEEPLSAMSS
                     PPSSPEAALTTVPIAFRSPHTGNLRSTIPSVSLAPWPKQPPEVSPFDHVGSLAAKNRR
                     LRDREERWETMEFKEKRTFKVQGQEGVYELQEGIFLLCNDTSTDDEERRPDTIRLIPL
                     PSADDPDLEDPPISVKGHKLPMSIADLTMDPSQDLIVVSEYNPAPSDPSRPLPTHRYH
                     LLTMSSFTPHPLASLPTLDFPPVTQTLPRTRQLLQVMGDTLAVLVAKYIPVWILDALN
                     IDPEVLGHRTQEEEIVVWNWKSGRVLSRLPFTEKQWFSSFAMLSPTTFMVTSTMSSIP
                     SGGPAFPWKRDEHRPTIQIYSILSDPKRSVIPVQPLQSEIMDDTTPRPVCVAVLEMPT
                     LQEDVRVTEFDVRPDPAYPPRSGQTKDDEVEYTLLKHKPFTQDPLKGILVFDYRLQER
                     IPMNPNTRDVVRNWPFEVFVRRETLVKLGQEGEKRLGQAWESGSVLKMGVRDVQQTFT
                     WDEWGEKEARMVDRIMTIRSWVCSCSGYRYISILSEDKSPFAEYDLDEPPEDDQPTLD
                     GHYPYRPEKSHILLYDFNPYTISKELSRQEPYPESDDVDPPRRRTVCGETFVPPFTEG
                     KGWKSRVVTSPTILSKKSIFEEDVRSELPYREVWREYGGWANGIMIDDQRIIVVNTNA
                     RRNGDWSSISQEMTVLCM"
     gene            <332855..>333379
                     /locus_tag="CNA01220"
                     /db_xref="GeneID:3253731"
     mRNA            join(<332855..333017,333078..333257,333315..>333379)
                     /locus_tag="CNA01220"
                     /product="cyclophilin, putative"
                     /transcript_id="XM_566572.1"
                     /db_xref="GI:58258318"
                     /db_xref="GeneID:3253731"
     CDS             join(332855..333017,333078..333257,333315..333379)
                     /locus_tag="CNA01220"
                     /codon_start=1
                     /product="cyclophilin"
                     /protein_id="XP_566572.1"
                     /db_xref="GI:58258319"
                     /db_xref="GeneID:3253731"
                     /translation="MNKTTDQAASSNLNKKSSVYVSGFAPEVDEEQLLQAFVTFGDII
                     EIKIPHEPHDPKKHRGYAFITFSSAADAQEAIDNYDLNQLPGYQGSGKFLKCSLAQPS
                     KYVDESGRNDRAIWETEEWKAEHAGERPEEATE"
     gene            complement(333448..337375)
                     /locus_tag="CNA01230"
                     /db_xref="GeneID:3253709"
     mRNA            complement(join(333448..333689,333747..334282,
                     334333..334522,334573..335171,335219..335972,
                     336022..336119,336172..336304,336358..336779,
                     336853..336918,336971..336990,337043..337064,
                     337127..337132,337190..337375))
                     /locus_tag="CNA01230"
                     /product="ubiquitin activating enzyme, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535551|gb|CF681392.1,gi|41535920|gb|CF681761.1,
                     gi|41535926|gb|CF681767.1,gi|41539632|gb|CF685473.1,
                     gi|41539640|gb|CF685481.1,gi|41542941|gb|CF688782.1,
                     gi|41543073|gb|CF688914.1,gi|41543084|gb|CF688925.1,
                     gi|41543712|gb|CF689553.1,gi|41545533|gb|CF691374.1,
                     gi|41545538|gb|CF691379.1,gi|41553621|gb|CF699462.1,
                     gi|41553637|gb|CF699478.1,gi|41560876|gb|CF706717.1,
                     gi|41565386|gb|CF711227.1,gi|41565391|gb|CF711232.1,
                     gi|41572344|gb|CF718185.1"
                     /transcript_id="XM_566574.1"
                     /db_xref="GI:58258322"
                     /db_xref="GeneID:3253709"
     CDS             complement(join(333534..333689,333747..334282,
                     334333..334522,334573..335171,335219..335972,
                     336022..336119,336172..336304,336358..336779,
                     336853..336918,336971..336990,337043..337064,
                     337127..337132,337190..337235))
                     /locus_tag="CNA01230"
                     /codon_start=1
                     /product="ubiquitin activating enzyme"
                     /protein_id="XP_566574.1"
                     /db_xref="GI:58258323"
                     /db_xref="GeneID:3253709"
                     /translation="MAAPMQVDEAVPGDSIDEGLYSRQLYVLGHEAMKKMATSNVLIV
                     GMKGLGVEIAKNVALAGVKTVTIYDPSAVEIADLGTQFFLREEDIGRPRAEVTAPRLA
                     ELNSYVPIKILPGAGEITPEMIEPYQIVVLTNATVRKQVEIDEYCRQKGIYFIAADVR
                     GLFGSVFNDFGKDFACVDPTGENPLSGMIVEIDEDEDAIVTCLDETRHGLEDGDFVTF
                     SEIKGMEGLNGCEPRKISVKGPYTFSIGDTRGLGKYKSGGLFTQVKMPKILQFKTLKE
                     SLTNPEFFITDFAKWDRPAALHVGFQALSAFYEKAGHLPRPRNAADAEQVISLAKEIH
                     SAAGGEDVLDEKILTELSYQATGDLSPMVAVIGGFVAQEVLKACSAKFHPMQQNMYFD
                     SLESLPATLPSEADVQPLGSRYDGQIAVFGKAFQEKISNTREFLVGSGAIGCEMLKNW
                     SMMGLATGPNGIIHVTDLDTIEKSNLNRQFLFRAKDVGKFKAESAAAAVADMNPNLKG
                     KIIAHDDRVGPETENVYGDEFFANLDGVTNALDNVSARQYMDRRCVFYCKPLLESGTL
                     GTKANTQVVVPHLTESYSSSQDPPEKSIPSCTVKNFPNAIEHTIQWAREAFDSFFVNP
                     PTTVNLYLSQPDFVETTLKSSGQHHEHLKQIEKYLVKERPMSFEECIMWARLQYENNY
                     VNEIKQLLFNLPKDQVNANGTPFWSGPKRAPTALAFNIDDPLDMEYLIAAANLHAFNY
                     GLKGERDPALFRKVVESMNVPEFTPKSGVKIQINENEPVENNGNDDEDDIEAIVSSLP
                     PPASLAGFRLQPVDFEKDDDSNHHIDFITAASNLRARNYGITLADRHKTKLIAGKIIP
                     AIATTTALAVGLVCLELYKLIDGKNKLEDYKNGFVNLALPFFGFSEPIAAAKQKYGET
                     EWTLWDRFEIEGNPTLQQFLEWFQENHKLEVQMVSQGVSMLWSSFVPSKKAADRMRMR
                     MSELVEHVGKKPIPPHVKNLLVEVMVNDENDEDVEVPYVLVHI"
     gene            complement(337524..339280)
                     /locus_tag="CNA01240"
                     /db_xref="GeneID:3253609"
     mRNA            complement(join(337524..337884,337939..338016,
                     338068..338089,338144..338307,338366..338626,
                     338697..338818,338878..339280))
                     /locus_tag="CNA01240"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530539|gb|CF676380.1,gi|41530543|gb|CF676384.1,
                     gi|41538322|gb|CF684163.1,gi|41538327|gb|CF684168.1,
                     gi|41543065|gb|CF688906.1,gi|41543075|gb|CF688916.1,
                     gi|41552044|gb|CF697885.1,gi|41552049|gb|CF697890.1,
                     gi|41560814|gb|CF706655.1,gi|41560819|gb|CF706660.1"
                     /transcript_id="XM_567092.1"
                     /db_xref="GI:58259358"
                     /db_xref="GeneID:3253609"
     CDS             complement(join(337800..337884,337939..338016,
                     338068..338089,338144..338307,338366..338626,
                     338697..338818,338878..339120))
                     /locus_tag="CNA01240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567092.1"
                     /db_xref="GI:58259359"
                     /db_xref="GeneID:3253609"
                     /translation="MVPLSVSATAFFLASHLLIFLPQASASPSPIDVAGASEASVILD
                     HVGRDPVERAVLGSATTLSKRASGYTNPEDNGGYMLTIVNGTYPAGMGEPLNVILSGD
                     SDAEVLVKSADDGGFLNYMLSAGLGEECLGQHLGADQQANLGDDQGNVTEVEELRYNY
                     GNPYIGTCQETFNGGLHLRYWIQNTTGAYFMAVSVEKSLTEGHDIVVNGYNIGRDELV
                     GNLTGQSIDTRTLSNTSTLSGSATYNNYTYQTDVEYVPGLLENSSDGINHYLTVEEDG
                     YPAIDGLVAVLTVRITDRPASSSFAFPTLSITPVALLVPLLSAILTLF"
     gene            <339498..340821
                     /locus_tag="CNA01250"
                     /db_xref="GeneID:3253768"
     mRNA            join(<339498..339687,339757..340092,340143..340350,
                     340401..340529,340583..340821)
                     /locus_tag="CNA01250"
                     /product="ubiquinone biosynthesis methyltransferase,
                     putative"
                     /transcript_id="XM_566576.1"
                     /db_xref="GI:58258326"
                     /db_xref="GeneID:3253768"
     CDS             join(339498..339687,339757..340092,340143..340350,
                     340401..340529,340583..340691)
                     /locus_tag="CNA01250"
                     /codon_start=1
                     /product="ubiquinone biosynthesis methyltransferase"
                     /protein_id="XP_566576.1"
                     /db_xref="GI:58258327"
                     /db_xref="GeneID:3253768"
                     /translation="MASTKSLLRSTRAFPCITSSHVRYIATSVPRRESQSTPGQTPPS
                     SKTTHFGFREIPEEQKETLVGGVFSSVASSYDLMNDSMSLGIHRLWKDSFVSSMLPRL
                     PPSFHRNPNDPVTEKPVFKCLDVAGGTGDIALRILDRAKDKFACRDIEVEIVDLNEGM
                     LNEGRKRVAKTMYYNTPQIKFTHGNAQHLPSHIADNSIDLYTIAFGIRNCTSLPAVLS
                     EAYRVLKPGGKIGVLEFGKVTNPLFREIYRQYSFQFIPVMGKILAGDSESYQYLIESI
                     ERFPSQPEFAKLVQEAGFKTGQMREGRGGAWTDYTNGIATVWTGVKV"
     gene            complement(341238..342924)
                     /locus_tag="CNA01260"
                     /db_xref="GeneID:3253979"
     mRNA            complement(join(341238..341464,341521..341659,
                     341718..341959,342013..342137,342200..342280,
                     342437..342529,342591..342703,342848..342924))
                     /locus_tag="CNA01260"
                     /product="expressed protein"
                     /transcript_id="XM_567249.1"
                     /db_xref="GI:58259672"
                     /db_xref="GeneID:3253979"
     CDS             complement(join(341419..341464,341521..341659,
                     341718..341959,342013..342137,342200..342280,
                     342437..342529,342591..342703,342848..342866))
                     /locus_tag="CNA01260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567249.1"
                     /db_xref="GI:58259673"
                     /db_xref="GeneID:3253979"
                     /translation="MAGDKIQLYEFEGSVWSNAPKIALEEGGLKKDKDVRWTTINLPE
                     GENFEPSYLKINPAGTVPTLVVGNDTFTDSISAVAEIVKIAPQRPRGKVSSGASIIEE
                     IHSAAIDPNATFLIATDDEDRKTKINGVPKGFLAGRQKTLNKLVENPPEEFKEFLTKK
                     QADNKQLLEFFIAEPDEQTRKAHYAQGQQLWNSVGNALRGFITEALTKNNQGPYVGGN
                     EPSEVDFHLITWLARTITNTGVEPGTNADQAIKKLQAKTGGGALDDSIKLYWETWSAR
                     ESFKTLGVH"
     gene            complement(343821..345760)
                     /locus_tag="CNA01270"
                     /db_xref="GeneID:3253767"
     mRNA            complement(join(343821..344416,344470..344941,
                     344991..345132,345188..345252,345300..345760))
                     /locus_tag="CNA01270"
                     /product="U1 snRNP 70K protein (short form), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533060|gb|CF678901.1,gi|41533076|gb|CF678917.1,
                     gi|41538500|gb|CF684341.1,gi|41538511|gb|CF684352.1,
                     gi|41541612|gb|CF687453.1,gi|41541616|gb|CF687457.1,
                     gi|41545113|gb|CF690954.1,gi|41545117|gb|CF690958.1,
                     gi|41568914|gb|CF714755.1,gi|41568929|gb|CF714770.1"
                     /transcript_id="XM_566577.1"
                     /db_xref="GI:58258328"
                     /db_xref="GeneID:3253767"
     CDS             complement(join(344221..344416,344470..344941,
                     344991..345132,345188..345252,345300..345714))
                     /locus_tag="CNA01270"
                     /codon_start=1
                     /product="U1 snRNP 70K protein (short form)"
                     /protein_id="XP_566577.1"
                     /db_xref="GI:58258329"
                     /db_xref="GeneID:3253767"
                     /translation="MSHLLPPNLLKLFAPRPQPPFLKPLTRDERIRGPNNLGGVAGLA
                     KRIKEEAEDAEVKQGMGMNPEKALDEQKEENVKMELKQDGEDGEVAEDSGKEKKKKTA
                     RDKIAEMGIIGEEAVKMRKELRKKRQEEYKKNAESNYKPQDDAQAIGDPYKTLFISRL
                     SKKANETDLRREFEMYGPIERIRIVRNRKGKSNGYAFIVYERERDMKAAYKDAEGIPI
                     HHKKILVDVERGRTVKGWKPQRLGGGLGGRPKPVAPEASPAPYVAPSNLRGGRGGFRG
                     GGRGGGAGFRGGFQGNRGGFGGGNRGGFGGGDDRGGFAGRGGFRGGFQNRGDRGPGGF
                     GQQQGGFGGPGGPGGYGGQGGGYGGGGGGFGGPGQQNGVQGGQGGGGFGGGGGYKRDY
                     DNAGGPGGYGGGGGGGGGGFGGGGGGYQDRDPKRMRY"
     repeat_region   344279..344317
                     /rpt_type=tandem
                     /rpt_unit_seq="cca"
                     /satellite="microsatellite"
     gene            346021..347625
                     /locus_tag="CNA01280"
                     /db_xref="GeneID:3253773"
     mRNA            join(346021..346416,346473..347044,347108..347158,
                     347221..347625)
                     /locus_tag="CNA01280"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41573719|gb|CF719560.1,gi|41573732|gb|CF719573.1"
                     /transcript_id="XM_566579.1"
                     /db_xref="GI:58258332"
                     /db_xref="GeneID:3253773"
     CDS             join(346070..346416,346473..347044,347108..347158,
                     347221..347579)
                     /locus_tag="CNA01280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566579.1"
                     /db_xref="GI:58258333"
                     /db_xref="GeneID:3253773"
                     /translation="MSVDPIVIIGAGPSGLLLARYLQLHHIPVVIYERDSSPTHRPQG
                     GSLDLHDETGLKALKETGLLDEAKSYMRAEGEAMKIVDKSGKIWYDENGKEVKAHTEF
                     QDGEPVTGRPEIDRTDLRNILIKCLNSDTIKWDHAVSSCSKISSSHYQINFISQPYIT
                     TPYLIGADGAFSRVRPLIHSTLPSYSGVSMYELTIPPKNMTPELKTYVGQGCLLALDE
                     GMTVLPQMNSGGLCKVYVGLRCPENWTDENPLPDKGKREWLANLFQGWHDQVRDVIMA
                     SEEDKLVIRRIWQFDPDLKWDTDLTGVTVMGDAAHVMSPFAGEGVNQALADALELGIS
                     LVSLFTVPTPRASSPPFPLSLLPISQPRSKPLISSPSPADLHHALRHFERKMMRRARK
                     EMIGSKENMDMFFGENAARNLTHWMSTFMIRFVWQTVTEWPVDFLKAIWD"
     gene            348209..>350911
                     /locus_tag="CNA01290"
                     /db_xref="GeneID:3253694"
     mRNA            join(348209..348392,348457..349378,349432..349581,
                     349633..349687,349746..350650,350698..>350911)
                     /locus_tag="CNA01290"
                     /product="rRNA processing-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532142|gb|CF677983.1,gi|41549604|gb|CF695445.1,
                     gi|41549616|gb|CF695457.1,gi|41550916|gb|CF696757.1,
                     gi|41554662|gb|CF700503.1"
                     /transcript_id="XM_566585.1"
                     /db_xref="GI:58258344"
                     /db_xref="GeneID:3253694"
     CDS             join(348251..348392,348457..349378,349432..349581,
                     349633..349687,349746..350650,350698..350911)
                     /locus_tag="CNA01290"
                     /codon_start=1
                     /product="rRNA processing-related protein"
                     /protein_id="XP_566585.1"
                     /db_xref="GI:58258345"
                     /db_xref="GeneID:3253694"
                     /translation="MSDPRFASVKTDPRFRRPKQKNLKVEIDERFRDVLESEEFGGKT
                     KGGAKVDKRGRPVTASHKADQLKRFYRLKSPEAAEGEGEGFIDYARGEGALYSSGSED
                     ESDEDESEVEEEELEVGGKKKVRLPAMSESESESDDDHLDIDLSENEETSVFPPETDE
                     IPSDNESETEPVDPTKRIAVVNLDWDNMQAADLYAVFNSFLTRPATKGEVKAPSALGK
                     LLRVRIYPSEFGKERMAKEEQEGPGGGIFIGSKKKRDNKKERISIARKEESDDEEGNE
                     EEDDEEEENEVSDEDSDEEDEGDTEEENEDNYDKPARKSNDKLHKEIDGLEIFSDVGS
                     EAGSEDIDMDQLRQYQLERLRYYYAIATFSSVAAAEYVMNECNGTEFEQTANILDLSY
                     VPEDMTFDEDSVKDEADKEPKAYKGNDFVTDALRHSKVKLTWDQDDPNRIKMTRRTLT
                     REEIEEQDFQNLVAASGSEVEESDFDDDEGAGGESKKDKKKKMKERKEKLRNLLLAGG
                     DDEDGVTDVWGKAGTAWANELEDIKSAALKDRSKSASKKAKKGEDLEITFRPGLSVAK
                     GDGGEENMTSLERYQLRMKEKKQRKKEKMELKAAARERGDEEKTDGQDEFFGSDSSEE
                     EEEQQPKPKSKPKSLEPTLPDEDDLAAIVGTNEPDSNFSMKDIIKTEKEAGKKRRRRK
                     GKKGEQERDVELGPDDWKIDVKDDRFKALHEEPEFAIDPSNPHFVKTKAMQDLLAERT
                     RRRNNQKKIEPEGRKSATGVKNVEQKEQDLDSLVASVKRKMDQNQHKAKRKRTRK"
     misc_feature    349109..349231
                     /locus_tag="CNA01290"
                     /note="GA-rich"
     gene            complement(349463..350631)
                     /locus_tag="CNA01300"
                     /pseudo
                     /db_xref="GeneID:3253920"
     misc_feature    349932..349973
                     /locus_tag="CNA01290"
                     /note="GA-rich"
     gene            351228..354148
                     /locus_tag="CNA01310"
                     /db_xref="GeneID:3253681"
     mRNA            join(351228..351438,351491..351571,351630..351631,
                     351684..352640,352668..353033,353085..353331,
                     353381..353536,353588..354148)
                     /locus_tag="CNA01310"
                     /product="phosphoribosylamidoimidazole-succinocarboxamide
                     synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41543546|gb|CF689387.1,gi|41548076|gb|CF693917.1,
                     gi|41565811|gb|CF711652.1"
                     /transcript_id="XM_566587.1"
                     /db_xref="GI:58258348"
                     /db_xref="GeneID:3253681"
     CDS             join(351270..351438,351491..351571,351630..351631,
                     351684..352640,352668..353033,353085..353331,
                     353381..353536,353588..354084)
                     /locus_tag="CNA01310"
                     /EC_number="6.3.2.6"
                     /codon_start=1
                     /product="phosphoribosylamidoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="XP_566587.1"
                     /db_xref="GI:58258349"
                     /db_xref="GeneID:3253681"
                     /translation="MAAPSETTIQLSPEAEAQYERITRNLQEVTSGEVIRKVLSEGKV
                     VKAYWGTAPTGRPHIAYCVPLLKIADFLTAGVNVKVLLADLHAFLDASKSTLETVQYR
                     VKYYSKLLITVFTVLGVPTDKLEFITGSSYQLKPDYTLDVYRFHALTSTREAEHAGAD
                     VVKESESPLMSSLLYPGLQALDEQYLDVDFQFGGVDQRKIFMYAATFLPKLGYSKRAH
                     LMNAMVPGLSGGKMSASDPKSKIDFLDTAADIKSKIKAALCPPGEVENNGVIAFIKTV
                     LIPIQALRIEQAERRGEKAPVGEGSFVKPGAPEGTIFSISRPEKFGGDIHFKSYEDLE
                     KAYVAGDIHPGDLKTGVQEALIQFLGPIRKSFDEDKEWQEVERTAYPSSSVAPTAEEP
                     KKAVSNKIVSLKKKDVRSKPPTEEERAALRAAKEKEKAAKAAAKAVNEGTAPPVPPVE
                     DITASQLAQSSKEAVQITTSNATSSCVTSTNLSKLKLLAKGKVRDIYALPGKEDEDKL
                     LFVATDRMSAFDVIMNNGIPSKGITLTTLSLFWFDKLKNIIPNHVLHPSPSACFSTPA
                     QAWEQFPRSLDEYRDQLEGRSMIVKKCEVVKIEAIVRGYITGSAWSEYKKSQTIHGIQ
                     MPAGLVESQKLPKALFTPSTKADQGEHDENIHPDKVKDICGPELAAKIEKAAIQLYTE
                     AAAYALERGLILADTKFEFGLLPDPSSPNKTTLILIDEVLTPDSSRYWAAADYVVGQP
                     QPSFDKQYLRDWLIKEGLRGKEDVTLPEHVVSETRSKYEEARDRVMGLGEFGKHGQKG
                     KIAGDEVALQTDQATDAIEEEARKQL"
     gene            complement(354147..>355270)
                     /locus_tag="CNA01320"
                     /db_xref="GeneID:3253704"
     mRNA            complement(join(354147..354284,354336..354549,
                     354603..354862,354924..355129,355179..>355270))
                     /locus_tag="CNA01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_566589.1"
                     /db_xref="GI:58258352"
                     /db_xref="GeneID:3253704"
     CDS             complement(join(354256..354284,354336..354549,
                     354603..354862,354924..355129,355179..355270))
                     /locus_tag="CNA01320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566589.1"
                     /db_xref="GI:58258353"
                     /db_xref="GeneID:3253704"
                     /translation="MGKFSEFLASSKGDHKADVPPPPSYGESSTSARPLTPPPPFPHS
                     FGCIHLARSDRIRLIGLPPVVYDDVEQAILRVWVPGLQGKFPMYQSLEWKLSGYPWSG
                     QGAEAVQARRLLCHVLHALSKHGWYLHMSVDLSKKQFDKDTLILHSVYPQERYFFSIS
                     FNEGDKVRIIDPPNDHVKQAFMTAVRTWPRGIQNEREKEPGCYQFKLKGLPWYTSDGD
                     QIIHARLLSCTILAAMDSVGFELKGSVDMSTGTSEHANDMDTWFFASK"
     gene            355988..357520
                     /locus_tag="CNA01330"
                     /db_xref="GeneID:3253698"
     mRNA            join(355988..356045,356096..356126,356174..356238,
                     356289..356487,356536..357054,357113..357292,
                     357339..357520)
                     /locus_tag="CNA01330"
                     /product="actin ii (centractin-like protein), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542243|gb|CF688084.1,gi|41542251|gb|CF688092.1,
                     gi|41544570|gb|CF690411.1,gi|41544577|gb|CF690418.1,
                     gi|41564898|gb|CF710739.1,gi|41564901|gb|CF710742.1,
                     gi|41565155|gb|CF710996.1"
                     /transcript_id="XM_566591.1"
                     /db_xref="GI:58258356"
                     /db_xref="GeneID:3253698"
     CDS             join(356023..356045,356096..356126,356174..356238,
                     356289..356487,356536..357054,357113..357292,
                     357339..357455)
                     /locus_tag="CNA01330"
                     /codon_start=1
                     /product="actin ii (centractin-like protein)"
                     /protein_id="XP_566591.1"
                     /db_xref="GI:58258357"
                     /db_xref="GeneID:3253698"
                     /translation="MATEFDDVLTNQPVVIDNGSGNIKAGFAGEEQPSCYIPSFVGRP
                     KHPRVMAGAIQDNLFIGRRAQEFRGLLKIKYPMEHGVVMDWDDMERIWGWVYGEGLKA
                     LSEEHPVLLTEAPLNPRQNRDIAAQIFFETFNVPAFFTSVQAVLSLYSSGRTTGIVLD
                     SGDGVTHAVPVFEGFSMPHAVRRIDLAGRDITDHLQLLLRKAGHNLHTSAEKEVVRTI
                     KEKTCYLALNPAKVEKDQGGAWEEFKLPDGKVIQLGTERFLAPEILFNPELVGQEYPG
                     VHQVIVDSINRTDLDLRKSLFSNIVLSGGSTLCTGFGDRLLNEVKKLAVKDVKLKIYA
                     PPERKYSTWIGGSILAGLSTFKKMWVSADEYKEDPDIIHKKAF"
     gene            complement(357523..359374)
                     /locus_tag="CNA01340"
                     /db_xref="GeneID:3253710"
     mRNA            complement(join(357523..357959,358212..358602,
                     358653..358731,358786..358871,358932..358990,
                     359047..359162,359236..359374))
                     /locus_tag="CNA01340"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41567174|gb|CF713015.1,gi|41567183|gb|CF713024.1,
                     gi|41570808|gb|CF716649.1,gi|41570819|gb|CF716660.1"
                     /transcript_id="XM_566593.1"
                     /db_xref="GI:58258360"
                     /db_xref="GeneID:3253710"
     CDS             complement(join(357587..357959,358212..358602,
                     358653..358731,358786..358871,358932..358990,
                     359047..359162,359236..359283))
                     /locus_tag="CNA01340"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_566593.1"
                     /db_xref="GI:58258361"
                     /db_xref="GeneID:3253710"
                     /translation="MPQLKTYSEKPVVLLTNDDGPPCASSPNIYAFCKLLQSRLGWDV
                     RVVIPDCQKSWVGKSYAISDIVTANYFYPLEPDGLKGEITQTRRPLKEGESMEWVLLS
                     GTPATCANIALHNIYPGQIDLVISGPNHGRNSSTAFALSSGTLGATLAASLSVPIPGP
                     LTSPSLHEDHMPCIAISYGVVTRPVSDRVLELATETAVDVCQQLFDNWGEDKEVGGKG
                     LVPIYSINIPLVEAALEKNERKIVSTEMWRNAYGRLFKTTKLSKALYDPGDDPVQIAH
                     GYMKSQDKPNTVQTSTSLPSHPHTSKTSTAGPAALPTPAPPSPITPKNTKDEEQQLKF
                     HFAPNMHPLLFPPEGSVPEGTDAWAFAKGWISVTPMRAEYACLGAASIE"
     gene            <359679..368152
                     /locus_tag="CNA01350"
                     /db_xref="GeneID:3253726"
     mRNA            join(<359679..359891,359956..360111,360167..361947,
                     362000..362643,362693..362787,362839..363059,
                     363114..364266,364316..364467,364522..365229,
                     365282..365496,365553..365602,365653..366573,
                     366622..366796,366847..367892,367952..368152)
                     /locus_tag="CNA01350"
                     /product="splicing factor Prp8, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530773|gb|CF676614.1,gi|41531259|gb|CF677100.1,
                     gi|41532725|gb|CF678566.1,gi|41532729|gb|CF678570.1,
                     gi|41534086|gb|CF679927.1,gi|41534091|gb|CF679932.1,
                     gi|41540370|gb|CF686211.1,gi|41540377|gb|CF686218.1,
                     gi|41570506|gb|CF716347.1,gi|41570511|gb|CF716352.1,
                     gi|41572950|gb|CF718791.1,gi|41572954|gb|CF718795.1"
                     /transcript_id="XM_566595.1"
                     /db_xref="GI:58258364"
                     /db_xref="GeneID:3253726"
     CDS             join(359679..359891,359956..360111,360167..361947,
                     362000..362643,362693..362787,362839..363059,
                     363114..364266,364316..364467,364522..365229,
                     365282..365496,365553..365602,365653..366573,
                     366622..366796,366847..367892,367952..368020)
                     /locus_tag="CNA01350"
                     /codon_start=1
                     /product="splicing factor Prp8"
                     /protein_id="XP_566595.1"
                     /db_xref="GI:58258365"
                     /db_xref="GeneID:3253726"
                     /translation="MSTVPPGFGAPPPGFTPQPNGNGDGMEGDFFGQLSQEEIDKKAR
                     KWRQSQKRRFNSKRRQGGGGGVDFGKADLPPEHIRKIIKDHGDMSNRKFRNDKRVHLG
                     ALKYVPHAVMKLLENIPMPWEQVREVPVLYHISGAITFVNEVPRVIEPVYHAQWASMW
                     LAMRREKRDRRHFKRMRFPPFDDEEPPMDYGDNVLDVEPLEAIQLELDEEDDEAILEW
                     FYDPKPLVDTPQVNGSSYKYFQLALPQMANLYRIGRQLLSDYSDNNAFYLFDKKSFFT
                     AKALNIALPGGPKFEPLYRDMDAFDEDWNEFNDINKIIIRNVIRSEYKVAFPHLYNSL
                     PRSVYIGVYHEPKNVYIKTDDPDLPAFYFDPLINPISQRVVQEAHTPLVSHEDQVFGF
                     GNDEDVEFELPEEVEPFLGERDLENENTSDAIALYWAPYPYNLRSGKMKRAQDVPLIK
                     NLYLEHCPDGQPVKIRVSYQKLLKVYVLNALHNKPPKAMVKRNLFRSLKNTKFFQATT
                     LDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNLNLKPIKTLTTKERKKSRFGNAF
                     HLCREILRLTKLIVDAHVQFRLGNVDAFQLADGLQYMFAHVGQLTGMYRYKYKLMKQI
                     RMCKDLKHVIYSRFNTGPVGKGPGVGFWAPGWRVWLFFMRGIVPLLERWLGNLLARQF
                     EGRNSKGIAKTVTKQRVESHFDLELRAAVMHDILDMMPEGVKQNKAKTILQHLSEAWR
                     CWKANIPWKVPGMPAAIENIILRYVKSKADWWTSVAHYNRERIRRGATVDKAVVRKNL
                     GRLTRLYLKAEQERQNGYLKDGPYITSEEGTAILISTAHWFESRKFAPIPFPPLSYKH
                     DTKLLVLALEKLKEAYSVHGRLNQSQREELALVEQAYDNPHECLSRIKRLLLTQRAFK
                     EAGIEFFDTYDKLIPCYDVEPLEKLSDAYLDQFLWYEADKRRLFPSWVKPSDSEPPPL
                     LVYKWCQGINNLTDIWDTSEGESVVMMETVLARVYEKVDLTLLSRLLRLIMDHNLADY
                     ITSKNNTTLTFKDMSHINTYGMIRGLQFSSFVFQYYGLVLDLLILGLERASEIAGLPE
                     APNGFLQFKNREIETKHPIRFYSRYVDRIHMLFRFTAEESRDLIQRYLSVQPDPNNEN
                     VIGYNNKRCWPRDCRMRLIKHDVNLGRAVFWNVKNSLPRSLTTIEWEDTFVSVYSKDN
                     PQLLFSMCGFEVRILPRVRTQHGEAYSLKDGVWNLTQESTKERTAQAFLRVSDQGIQD
                     FNNRIRQILMSSGSATFAKIINKWNTCLIGLMTYYREAVVHTNELLDSLVKAENKVQT
                     RVKIGLNSKMPSRFPPCVFYSPKELGGLGMLSMGFVLIPQSDLRWSKQTDSGGITHFR
                     SGMTHEEDQLIPNLYRYLQPWEAEFLDSARVWSEYALKRKEATASNRRLTLEDLEDSW
                     DRGIPRINTLFQKDRHTLAYDKGWRVRQYFSQFFRLRNQPFIWTNQRHDGKLWQLNNY
                     RVDVISALGGVEGILEHSLFKGTAFPTWEGLFWEKACLQNGTRLLRADGSEVLVEDVQ
                     EGDQLLGPDGTSRTASKIVRGEERLYRIKTHEGLEDLVCTHNHILSMYKERSGSERAH
                     SPSADLSLTDSHERVDVTVDDFVRLPQQEQQKYQLFRSTASVRHERPSTSKLDTTLLR
                     INSIELEDEPTKWSGFVVDKDSLYLRHDYLVLHNSGFEESMKNKRLTNAQRSGLSQIP
                     NRRFTMWWSPTINRANVYVGFQVQLDLTGVFMHGKIPTLKISLIQIFRAHLWQKIHES
                     VVMDLCQVFDQEMEALQIETVQKETIHPRKSYKMNSSASDILLFSSYKWQISRPSLLT
                     DNRDTMDGTTSNKFWLDIQLRWGDFDSHDIERYARAKYLDYSSDSQSIYPSPTGNLIA
                     IDLAYNLYSAYGCYFPGLKPLLQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPY
                     LNSSNYSELFSNQIIWFVDDTNVYRVTVHKTFEGNLTTKPINGAIFIFNPRTGQLFLK
                     IIHTSVWAGQKRLGQLAKWKTAEEVAALVRSLPVEEQPKQVIVTRKGMLDPLEVHLLD
                     FPNIVIKGSELQLPFQATLKMEKFGDLILRATQPQMVLFNLYDDWLKSISSYTAFSRL
                     ILILRALHVNNEKSKIILRPDKNTITESYHIWPSLSDDEWMKVEVALKDLILADFGKR
                     NSVNVASLTASEIRDIILGMEIAAPSVQRQQMAEIEKNTEAAAQVTALQTKTTNIHGD
                     EIVVTTTTQYEQQTFASKSDWRVRAISATNLPLRVNHIFVGNDDVKDDAGSYTYVIPK
                     NVLRSFIVNADLRTQVVAYLYGTSPPDNKQVKEIKAVAWIPQRGTNNGVDLPVTLPKH
                     DFLLKDLEPLGWIKTQSQELNHLSPQDVTTQAKIMAAHPEWGPQSICVTCSFTPGSVS
                     LNAWDLTVAGFEWGRKNEDVTGQNPGFNPSMANRVQLLLSDRILGMTLVPEGGIWNYG
                     VGLTQSWSEKIPYTMTLDKPEAFWAPCHRPNAFLNFASMEGDDAADVENSLE"
     gene            <368410..374889
                     /locus_tag="CNA01360"
                     /db_xref="GeneID:3253748"
     mRNA            join(<368410..369529,369580..372019,372069..372454,
                     372504..372672,372721..372972,373021..374021,
                     374077..374210,374270..374889)
                     /locus_tag="CNA01360"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41554533|gb|CF700374.1,gi|41554545|gb|CF700386.1,
                     gi|41554951|gb|CF700792.1,gi|41555271|gb|CF701112.1"
                     /transcript_id="XM_566597.1"
                     /db_xref="GI:58258368"
                     /db_xref="GeneID:3253748"
     CDS             join(368410..369529,369580..372019,372069..372454,
                     372504..372672,372721..372972,373021..374021,
                     374077..374210,374270..374752)
                     /locus_tag="CNA01360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566597.1"
                     /db_xref="GI:58258369"
                     /db_xref="GeneID:3253748"
                     /translation="MEDNHVSEHPPESTTPASHLFDSIDSEGGAADDPFAQFGSEQDD
                     YAPQRQVQEEEHKPGFQATTEGEAPTPVAQVEGSRTPIPANVLEKQTEEKAAYAPEET
                     EEVQGGGKTQEFIGEQQGSHITSSPVQEPTAGHLFGPVSDGSGEDLFAQLAESEKDEF
                     TQPEQSQDILKSEGIDQSEAQGQTEVSVPHEEKDYSDLLAEFEAENGMLEPPIGGPVK
                     SHSESKGEGIQSLLGQSDTKNDQTPAASSLFIDDPNDSVFDNIIPESDSEPQEAPLST
                     TAGTLTNPSIQGLFSNDTTDFLNQGQIITEAQEAGGLDQSGVEPLDFDIPQGWYDDDG
                     QWQWYTEEEKEQVKFAMMGPTSWQETEQAPPPLTAGAGATLTPVVPRSPALQSQAAMS
                     ENAARRTPQPEPIAAFDSSIYEPPVPASTQLATSTASYFPANQSGYTSAPPANVPPQV
                     TRSATLPASSFSVTAAAPSPHVSSNPKSYNAYDPPVSTKPYHHRSYAPATQPTPSPYN
                     PASLGNVFTSPTDATLAKSEPPKPRPQPQRAVSTAYDPPFLRTQEKISRPASAVSTGV
                     SSAFGVSPIVPSHQIQAPPLPPSGPPKRSKGESRPPSRGPAFAPPPITPFGSPPPVPP
                     LSVPPSGPPRRPTGTSRPPSRGPAYAPHPKPQSSVPPVPPLPTLPVEVPGSHTEDNSV
                     AHGRDSLNFPGSSEVNEPSFTRPNVCSPEGGDEDRPPSRGSQAISPSLAPHTLSVSAE
                     PIQAPPSAPPGQSIGTTELRGHNQTSAPSPMTHIPASSLSEKPTSYAPPEFQQKAQQP
                     QPSSYEQVPYTHDGWEADRSLISAQLSSYEPTPHAPSDSHSDHEAETFKAIASAPAAE
                     SYEPSSYAPTQSDYYKPGPEATTQPTSYKPDPYAPSSTSAVGLQSQSSPYARTTSPAH
                     SSAYGTSPPTNHIPSMAASGNTFVHAPYAGQSAYQSQNESSVRQSNLSMNRSSMPSST
                     SLYVPSQSSSNYNPVGSPAQSPTYGMSPPSTNYFQSMPAQRSASIDTSYVPQQVLEQK
                     PISEDPLARTTLASRNAPIAVFGFGGVLITAFPGASESDNFAKGHARIPSYGYASGRG
                     QLWIRNISEVVAPGALKSDQSAFPGPLVNDISGPKGAAGEKKKKEAVLAYLRDRAEEV
                     ERGLPYLKSSASRARREDEGRLVLLRLLEALVIGEGKLAGNPKVEDAIRVALSNPSSP
                     NVPTAPGHVTTLSNGLYPSTSSKSASPVAANPSQLSRLSTLLAQGQKKEAAEYAIDHG
                     LWSHALVISSAVGAELWKDTVMRFTAAELSARSEGTAGIRASYALIGGMSHSSLDDLI
                     NAATITEDPSQDQWREVISSVLFHAKPADLACLDELGSRFLQMGLVNAAHACFLLSPL
                     SPFLDTTPASYERGIMMTHNTRDEESTIFVEIAEYARSLVPVPKGQEQITVGLPQLLP
                     YKLARAWRLAELGEVALAKRYCAAIEAGAKPLTKSAQIQSLLPPAFMASLEDLLERLT
                     GTPSIDPANVLGGGRKSSKPGFDKLGSWIEGRLTKFIAGEEGEKAIPKPAASSGKAEG
                     PFAHFSSVSPDPSGSISRNPSMADVGSYSASNGFLGVQPMSRTTSPAVQGQYNPYGQQ
                     SQPYGAPPKSTLDVRSLSPATSHSAQAHNNLYTSQSQPSSSTSSSYGDSQGRRTDFGG
                     GFTPWASNAGSEVQAEDGEMTPHAYEAPVGDDQAEFITPMAGLSIGPSTSGTLNYTPR
                     ASQPAYDLGDEGEDLGFGNTSLSKGRPTKTVGEGEGKGEASGGKPTKGGKEEPKKEEP
                     TQPAKQEQHQSSSWLGRLWGKKEGGPVKANLGEETSMVYDPDQKRWVVKGAKGASAAP
                     AAPPPPPRAQTASPSHTSRPAPSTRAMSAAPPPPGPSSSDGSFSTLPRSANVPPPPAG
                     MSASTFAEGPDGGIRRMKSSLTMSQGQGPPSGPLSGPPSGPPSQPPSRTSSASATSAS
                     LDDLLSGSRPASKRPGSAMKKGARNRYVDVFQSEGS"
     gene            375851..376708
                     /locus_tag="CNA01370"
                     /db_xref="GeneID:3253888"
     mRNA            join(375851..375939,376155..376207,376271..376325,
                     376392..376460,376529..376708)
                     /locus_tag="CNA01370"
                     /product="expressed protein"
                     /transcript_id="XM_567227.1"
                     /db_xref="GI:58259628"
                     /db_xref="GeneID:3253888"
     CDS             join(375931..375939,376155..376207,376271..376325,
                     376392..376460,376529..376624)
                     /locus_tag="CNA01370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567227.1"
                     /db_xref="GI:58259629"
                     /db_xref="GeneID:3253888"
                     /translation="MPVNRAVMKKWFPVEVMPIFGIVGIACVGATAYLWKLSQGPEVV
                     WDRSSDWRPWDKVKHDENLKYITVNPEFWAQRRAQAAGTKTGERAVDAI"
     gene            377082..380656
                     /locus_tag="CNA01380"
                     /db_xref="GeneID:3253591"
     mRNA            join(377082..377357,377408..377489,377547..377660,
                     377712..378306,378361..380229,380303..380362,
                     380422..380656)
                     /locus_tag="CNA01380"
                     /product="peptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530324|gb|CF676165.1,gi|41533326|gb|CF679167.1,
                     gi|41533339|gb|CF679180.1,gi|41533542|gb|CF679383.1,
                     gi|41533547|gb|CF679388.1,gi|41534727|gb|CF680568.1,
                     gi|41534736|gb|CF680577.1,gi|41534828|gb|CF680669.1,
                     gi|41535577|gb|CF681418.1,gi|41535595|gb|CF681436.1,
                     gi|41543070|gb|CF688911.1,gi|41544938|gb|CF690779.1,
                     gi|41544943|gb|CF690784.1,gi|41545018|gb|CF690859.1,
                     gi|41545698|gb|CF691539.1,gi|41546510|gb|CF692351.1,
                     gi|41548368|gb|CF694209.1,gi|41548374|gb|CF694215.1,
                     gi|41556517|gb|CF702358.1,gi|41556527|gb|CF702368.1,
                     gi|41564471|gb|CF710312.1,gi|41564482|gb|CF710323.1,
                     gi|41565174|gb|CF711015.1,gi|41565177|gb|CF711018.1,
                     gi|41575685|gb|CF721526.1"
                     /transcript_id="XM_566599.1"
                     /db_xref="GI:58258372"
                     /db_xref="GeneID:3253591"
     CDS             join(377257..377357,377408..377489,377547..377660,
                     377712..378306,378361..380229,380303..380362,
                     380422..380453)
                     /locus_tag="CNA01380"
                     /codon_start=1
                     /product="peptidase"
                     /protein_id="XP_566599.1"
                     /db_xref="GI:58258373"
                     /db_xref="GeneID:3253591"
                     /translation="MVAFHASSALLSFALLAPGFANAFNLDDIKRGSDSVLPGRYIVE
                     FDSDAHLTSAGLKRAATPHEYFYKELDARSSSYTVHQEYDCDLFYGASLSISSDVDLE
                     SLLDIAGVIDLRAVHLLTLPAEPLSKENTQWSASSHSSSSSSASATASAASTSAPFSN
                     LPQIQADVVQASGNKGKGIKIGIIDGGVDYTREPLGGCFGPGCKIAGGYDFVGDDYDG
                     TNDPVPDNDPYDNCYSHGTFISGIIGANENVYGAVGVAPESSLYVYRVFGCNGAASDD
                     IVLAAMQKAYDDDMDVINLSLGEPSGWTESTLSVFASRLVARGTILTISAGNQGQVGG
                     FYSYSPSAGKGVINVGSSDSSIYPAHLATVSTGYGPIAYYNYKAYSDKTLPLYTFDSD
                     IYGCTLPDDVPDLSPYLVVVRRGGCSLSEKAQNVYNAGGTAIFVVNDETSLPIYQNFP
                     LIDFALISDDDGNYLLNQLNTSANTTVSFSFNPIALPNIWTANTTSYFSEIGPTNDLY
                     FAPSVLAPGTNVVGVTPTAFYNWTIADGTSYSSAYAAGAAALYLAAKGTNNVSPSDVL
                     SAFEVTAQQLPVSVSDSSLVSVAVQGAGRVQLSDAIYAVADISPSEITLNDTANFDKL
                     HVLTIKNPGKKWVTYKLSHEPAGTALAFQSGLNQSNDQPLPQVSNAASVNIFPSSLTL
                     WPGQSLLTTVKFTAPTGLDAQTFPIYSGFIKVTGGGSTVKVPYMGVAANMKDMPVLDP
                     TDWYLGMNSPAIVDVDGNVQQGPATYTFSNVSYPSVLYRLAGGTPLLVIDLIDANANL
                     TFTPDYTTRKRSPTFEQETENDERRRSLSARRLKSTGASFAATTKSKGLHSLWCHLTH
                     YKASGCSKTGSTFQQVSIIGNLYVGEYLPRSTDNVDGQGGDYSTFELSSATFSNGTTI
                     PNGDYKFLMRALHITGDNTNESDYESWVSQSFTVAQ"
     gene            380876..382694
                     /locus_tag="CNA01390"
                     /db_xref="GeneID:3253576"
     mRNA            join(380876..381194,381266..382402,382457..382694)
                     /locus_tag="CNA01390"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531995|gb|CF677836.1,gi|41532002|gb|CF677843.1,
                     gi|41538777|gb|CF684618.1,gi|41538791|gb|CF684632.1,
                     gi|41542301|gb|CF688142.1,gi|41546804|gb|CF692645.1,
                     gi|41546810|gb|CF692651.1,gi|41548735|gb|CF694576.1,
                     gi|41548741|gb|CF694582.1,gi|41552211|gb|CF698052.1,
                     gi|41552228|gb|CF698069.1,gi|41555060|gb|CF700901.1,
                     gi|41555750|gb|CF701591.1,gi|41555756|gb|CF701597.1,
                     gi|41556144|gb|CF701985.1,gi|41556151|gb|CF701992.1"
                     /transcript_id="XM_566601.1"
                     /db_xref="GI:58258376"
                     /db_xref="GeneID:3253576"
     CDS             join(380984..381194,381266..382402,382457..382509)
                     /locus_tag="CNA01390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566601.1"
                     /db_xref="GI:58258377"
                     /db_xref="GeneID:3253576"
                     /translation="MSGDPPGPPPGRPPVANVPYIPQPGAPAAPSFRPPAAPGFGFPP
                     GPSPGMPFSVGGFPHPLLPPGWSEHRAPDGITPYYYNAQTRESTYIRPTFPPFPLGTT
                     PPTGSPVHGAVTPGGTGAGEEKTKKKKKEKPKDKVPIPGTGWMRITTTEGNVFYFEKE
                     NKRSEWTVPDEIKEAVTQLEEEERKKKKEKDKVEQERLEQKRIEKLKELERIRAEIDA
                     ERRKKEEAEKERKRKQGEGGEDDAPEEKKARVGDQEQVEEDVVGPEGEDDKEAWMKAV
                     AAEFAEKDAQTKKDLEEQDEKTKKEEAEAAKKVFAVPEKVNFSVEEGRALFKALLIEK
                     DISPFAPWDQSLPLFINDPRYVLLSSTKDRREVYEEYCREVGRAKRLKKGSSAEEKKA
                     EPEKEYQALLDKEVTSTRTRWDDFRKKWKKDRRFYAFGRDDHQREKVFKQHLRDLGER
                     KRAAAQKAEEDFNSSL"
     mRNA            join(381233..382402,382457..382694)
                     /locus_tag="CNA01390"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531995|gb|CF677836.1,gi|41538777|gb|CF684618.1,
                     gi|41546804|gb|CF692645.1,gi|41548735|gb|CF694576.1,
                     gi|41552211|gb|CF698052.1,gi|41555060|gb|CF700901.1,
                     gi|41555065|gb|CF700906.1,gi|41555750|gb|CF701591.1,
                     gi|41556144|gb|CF701985.1"
                     /transcript_id="XM_566602.1"
                     /db_xref="GI:58258378"
                     /db_xref="GeneID:3253576"
     CDS             join(381238..382402,382457..382509)
                     /locus_tag="CNA01390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566602.1"
                     /db_xref="GI:58258379"
                     /db_xref="GeneID:3253576"
                     /translation="MKVLTHVSIAPDGITPYYYNAQTRESTYIRPTFPPFPLGTTPPT
                     GSPVHGAVTPGGTGAGEEKTKKKKKEKPKDKVPIPGTGWMRITTTEGNVFYFEKENKR
                     SEWTVPDEIKEAVTQLEEEERKKKKEKDKVEQERLEQKRIEKLKELERIRAEIDAERR
                     KKEEAEKERKRKQGEGGEDDAPEEKKARVGDQEQVEEDVVGPEGEDDKEAWMKAVAAE
                     FAEKDAQTKKDLEEQDEKTKKEEAEAAKKVFAVPEKVNFSVEEGRALFKALLIEKDIS
                     PFAPWDQSLPLFINDPRYVLLSSTKDRREVYEEYCREVGRAKRLKKGSSAEEKKAEPE
                     KEYQALLDKEVTSTRTRWDDFRKKWKKDRRFYAFGRDDHQREKVFKQHLRDLGERKRA
                     AAQKAEEDFNSSL"
     misc_feature    381419..381463
                     /locus_tag="CNA01390"
                     /note="GA-rich"
     misc_feature    381591..381763
                     /locus_tag="CNA01390"
                     /note="GA-rich"
     gene            complement(382812..384548)
                     /locus_tag="CNA01400"
                     /db_xref="GeneID:3253607"
     mRNA            complement(join(382812..383465,383535..383685,
                     383763..383970,384024..384143,384205..384385,
                     384470..384548))
                     /locus_tag="CNA01400"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530173|gb|CF676014.1,gi|41530327|gb|CF676168.1,
                     gi|41531535|gb|CF677376.1,gi|41534989|gb|CF680830.1,
                     gi|41549418|gb|CF695259.1,gi|41562321|gb|CF708162.1"
                     /transcript_id="XM_566605.1"
                     /db_xref="GI:58258384"
                     /db_xref="GeneID:3253607"
     mRNA            complement(join(382812..383465,383535..383685,
                     383763..383970,384024..384143,384205..384424,
                     384470..384548))
                     /locus_tag="CNA01400"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530173|gb|CF676014.1,gi|41530178|gb|CF676019.1,
                     gi|41530327|gb|CF676168.1,gi|41530334|gb|CF676175.1,
                     gi|41534989|gb|CF680830.1,gi|41549418|gb|CF695259.1,
                     gi|41562321|gb|CF708162.1"
                     /transcript_id="XM_566604.1"
                     /db_xref="GI:58258382"
                     /db_xref="GeneID:3253607"
     misc_feature    382896..382917
                     /note="AT_rich"
     CDS             complement(join(382957..383465,383535..383685,
                     383763..383970,384024..384143,384205..384385,
                     384470..384542))
                     /locus_tag="CNA01400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566605.1"
                     /db_xref="GI:58258385"
                     /db_xref="GeneID:3253607"
                     /translation="MPDSDSDSSTDFFISKRKPNLKATNSEEDPEGSGRKKKKRLNSR
                     KPQSKLPEWARQTNEQRRERKRSSVARASTETRDRERSTSLFTTTAAEDGGGKKKERR
                     RVELTPPPVISEKKNQELRELVQRMYGGGSALDLLDDDDLEPQAISPVASSPQKEEVV
                     DIVVKMELDPVKKANAPAAAVRMYERPTTLKLRREETMFRALEVMGDKLQRAPDDIIL
                     IYEGKRVYSRDTARQLGILGGSSVEMKGYEKSYWDRLEAERLRRIENFDLDFDRSPSP
                     QLIPQAHAEVSAASKSKSQPQSVGASQLYAGLAPLVVEPPSNPYTQNLARANSDSPAV
                     AEDSIKLVVRGADGKEARMKVAKTVTAHTVLRFYCKKIDRPKDDANKMELVFDGETMG
                     KDMTVGDMDCEDGDMLEVRIL"
     CDS             complement(join(382957..383465,383535..383685,
                     383763..383970,384024..384143,384205..384424,
                     384470..384542))
                     /locus_tag="CNA01400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566604.1"
                     /db_xref="GI:58258383"
                     /db_xref="GeneID:3253607"
                     /translation="MPDSDSDSSTDFFISKRKPNLKATTPPPIRSPSPAPSDSEEDPE
                     GSGRKKKKRLNSRKPQSKLPEWARQTNEQRRERKRSSVARASTETRDRERSTSLFTTT
                     AAEDGGGKKKERRRVELTPPPVISEKKNQELRELVQRMYGGGSALDLLDDDDLEPQAI
                     SPVASSPQKEEVVDIVVKMELDPVKKANAPAAAVRMYERPTTLKLRREETMFRALEVM
                     GDKLQRAPDDIILIYEGKRVYSRDTARQLGILGGSSVEMKGYEKSYWDRLEAERLRRI
                     ENFDLDFDRSPSPQLIPQAHAEVSAASKSKSQPQSVGASQLYAGLAPLVVEPPSNPYT
                     QNLARANSDSPAVAEDSIKLVVRGADGKEARMKVAKTVTAHTVLRFYCKKIDRPKDDA
                     NKMELVFDGETMGKDMTVGDMDCEDGDMLEVRIL"
     gene            384256..386639
                     /locus_tag="CNA01410"
                     /db_xref="GeneID:3253618"
     mRNA            join(384256..384685,384741..385518,385581..385960,
                     386052..386639)
                     /locus_tag="CNA01410"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41555440|gb|CF701281.1,gi|41555445|gb|CF701286.1"
                     /transcript_id="XM_567090.1"
                     /db_xref="GI:58259354"
                     /db_xref="GeneID:3253618"
     CDS             join(384502..384685,384741..385518,385581..385960,
                     386052..386524)
                     /locus_tag="CNA01410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567090.1"
                     /db_xref="GI:58259355"
                     /db_xref="GeneID:3253618"
                     /translation="MKKSVELSESESGIVRGGKRDEERHILARLEFASALHDAPAPPP
                     AAPSHALHRRQGVLSLRGRKAAARSPQKDTPVRPHTLQHPRTTARRRPARGKKVEETL
                     PVRYPCSPPGGQAGSEAQDRQRKTRKGARGMEGAKAEGAGGDERDGRGKQAVEHHQVK
                     KRFEAYRSVLRFPSLQITQDTTPTCNQMPPDPPWRTPLGRTFFHLPSPVGEYTQHESN
                     KAEGESAKGSSYTDILKRTFKDFSDVSVGSDVEIVHLHRQYPPKASAAAEEELEEGEL
                     EQDDWTVDIEPMRGYVEDDSNSIIFDDDDDGEPPNEPADLPSFHGECWNCLQQGHSLT
                     HCPYPRNHLQINHSRELFFYARDNLPPPRTERYLHDYLNMRVTVQEKERRLELLGKFR
                     PGKIGKELDHAARMLVDDSDSGEMLVDEIQWDKREYEWIQNIAKWGYPPGWTTALNPI
                     EFLKDRISSLEAYDTAYRLTPEPGEELVIFGADDDEDDEGSSMRDVTLGNADEREKSK
                     EEGDDGSEMSIVSDSPSPSSLPLSPASSRSPPTPSDIPPPPSPPPDLPPPPPPPPCDL
                     PPPPPPNRWADYHTDMFASSRLVVYDETRPFVLGTYAR"
     gene            complement(386630..388660)
                     /locus_tag="CNA01420"
                     /db_xref="GeneID:3253572"
     mRNA            complement(join(386630..386889,386972..387188,
                     387264..387382,387463..387676,387746..387904,
                     387961..388165,388232..388365,388427..388660))
                     /locus_tag="CNA01420"
                     /product="oxidoreductase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530389|gb|CF676230.1,gi|41530398|gb|CF676239.1,
                     gi|41533815|gb|CF679656.1,gi|41533826|gb|CF679667.1,
                     gi|41541511|gb|CF687352.1,gi|41541520|gb|CF687361.1,
                     gi|41545246|gb|CF691087.1,gi|41545251|gb|CF691092.1,
                     gi|41545791|gb|CF691632.1,gi|41545799|gb|CF691640.1,
                     gi|41567568|gb|CF713409.1,gi|41567573|gb|CF713414.1"
                     /transcript_id="XM_566607.1"
                     /db_xref="GI:58258388"
                     /db_xref="GeneID:3253572"
     CDS             complement(join(386757..386889,386972..387188,
                     387264..387382,387463..387676,387746..387904,
                     387961..388165,388232..388365,388427..388625))
                     /locus_tag="CNA01420"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_566607.1"
                     /db_xref="GI:58258389"
                     /db_xref="GeneID:3253572"
                     /translation="MSNVFPYPARKVQGYPTFLPEQPQPIGSLLDDNEYKQNKNPPKL
                     FQPITIRGVTFHNRAFVAPMCMYSSDQGRATDHHFVHLGSMALRGWGSIMVEATAVVP
                     EGRISPEDMGLWDDSQIAELQRIVKYIHANKGIIGIQIAHAGRKASTPAPWNEREANE
                     KGHSKGSVVPEENGGWPSKVVAPSEISFLEGDYPDPIEASIEYLESLKKAYADTVERC
                     SKIGFDFIEIHGAHGYFLHEFVDPISNKRTDKYGGSLENRLRLPLEIAEIVRQKWDKP
                     LFYRLSATDWLEESLGKEKNANGEWVWWGIEQTTAFVGKLAELGVDLVDVSSGGNDLR
                     QKIAPGPSYQLPFAAHLKKTYPDLLIGSVGIITDAEQANDILEQGKADVILIGRQLLR
                     NLDWPLDAAVELGVAVAPAVQYERAWTRMLVKRETHDHTSKKHGVTELQGQEGQETKT
                     PPGEHSSIP"
     gene            complement(388903..389784)
                     /locus_tag="CNA01430"
                     /db_xref="GeneID:3253561"
     mRNA            complement(join(388903..389590,389661..389784))
                     /locus_tag="CNA01430"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534913|gb|CF680754.1"
                     /transcript_id="XM_566609.1"
                     /db_xref="GI:58258392"
                     /db_xref="GeneID:3253561"
     CDS             complement(join(388925..389590,389661..389705))
                     /locus_tag="CNA01430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566609.1"
                     /db_xref="GI:58258393"
                     /db_xref="GeneID:3253561"
                     /translation="MKNLIFRTSLTMTLGFLETLLDKKTKSRISETFVNISAKFVDEQ
                     MLCGESLGVLDHCCRLFEIVGLPPPTAEVELDEYLYKAFFRGVIIILRDFKSNLPRND
                     RSNNYTQIVHDNLGLLDAVWLFIHTADFYLLETFWDVAMMLVEVCEADAEGLVVALWC
                     QALEVEVDKAEDEDRNGDMKWRELSRKRKQRFISNGNRLFDARDTRIGHEDLPRATMS
                     DLNEAWKYGKELLCPRMP"
     gene            389898..390676
                     /locus_tag="CNA01440"
                     /db_xref="GeneID:3253631"
     mRNA            389898..390676
                     /locus_tag="CNA01440"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534922|gb|CF680763.1"
                     /transcript_id="XM_566611.1"
                     /db_xref="GI:58258396"
                     /db_xref="GeneID:3253631"
     CDS             390227..390532
                     /locus_tag="CNA01440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566611.1"
                     /db_xref="GI:58258397"
                     /db_xref="GeneID:3253631"
                     /translation="MYGAEDSELKAVRASKRPERRKKRPKEIVFPDLDLSKIRREVVN
                     RPHRRRSRGAVIQQLKLRCDGPEKSENQVVGVSEAGYEESGIGAGYEARYGSRSAKS"
     gene            complement(391049..395055)
                     /locus_tag="CNA01450"
                     /db_xref="GeneID:3253629"
     mRNA            complement(join(391049..391461,391512..391637,
                     391692..391799,391871..392229,392381..393997,
                     394082..395055))
                     /locus_tag="CNA01450"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534568|gb|CF680409.1,gi|41534578|gb|CF680419.1,
                     gi|41540592|gb|CF686433.1,gi|41540603|gb|CF686444.1,
                     gi|41565508|gb|CF711349.1,gi|41565514|gb|CF711355.1,
                     gi|41566411|gb|CF712252.1,gi|41566417|gb|CF712258.1,
                     gi|41566424|gb|CF712265.1,gi|41566927|gb|CF712768.1"
                     /transcript_id="XM_566613.1"
                     /db_xref="GI:58258400"
                     /db_xref="GeneID:3253629"
     CDS             complement(join(391247..391461,391512..391637,
                     391692..391799,391871..392229,392381..393997,
                     394082..394926))
                     /locus_tag="CNA01450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566613.1"
                     /db_xref="GI:58258401"
                     /db_xref="GeneID:3253629"
                     /translation="MADPASPPSFDAIFAQQPVRRSSSTSTSSFANYTYSALQQHQQF
                     NSDAPLVDEPQSLSEQTRKQQRDPSKDSSNKRYLDMMSGLADGYGVINGRRQESLRKE
                     SLPFNPQEDSTLIATAPKRGERNGLGRNGYSSPIGDIMFGPEQIIRNQPQRPSQQPSW
                     GEGRISEQSVHYASVQQPQYSSFQSSGPGAGSTGMDYLPPGTASSMNDTMLSNQVSPY
                     LSHDAASEGRPQQQQQQQQGEWGQEFIGVEQQQQYAQGEGQSNGMEDMLTMGDESPFE
                     NELQRVISNTSHPSQYPSRTTSPFPQQSQSNIVPTSTGNHVRTESFPASRSPSPFPPQ
                     QASQTEAPNHVVSPPSMGQPTYPRASSSPRTNPNSPFFNKPQSPPALIIPNSPVLPSI
                     VTQSTSNNHSKGLNQSHTRHANNGAGGLFPPSNPALEHLTGMAGISPIAPNADGPMIC
                     IQPSTPISGLKEGRGLFDAALRRAGGAQRQGPQGQGESQQDQQQDGFNVPPPQSHPLP
                     RTSSSDQINQDVEMQGMDFAAQMQSYEQQGWASDTLRIAGPSRPRAKSDSIIPSPTAD
                     SFDRQAFLAFIGAGNAQPPPSNVEMQPGYVDVSEQWRNTVSAWKAGLGGGELSSQPTL
                     DPRLLPGRESNEAVYQQLLMQQQTGQLPRLDPDQLHQLTQIEAQRARFSLNTNVAPPK
                     YEPGEFSPTSMAFYQSMGLYPHATPEMSGTVSAPWSQTAFGQVPGPGLVGHPATAGPA
                     QQHFLTPTLSHATVRRRSFGGGEHPAMGAGTPGYGMEFSSPFMGKSVGQIRGVNMGHR
                     RAARSEDFGRGGTGWGVGAGGSTAEFLQSITGDDGSLLPPSNRGHAMSHSRHSSTSSI
                     RSASPALSISSQGSSFSHHSPRMDMPDSMYPGHPIIAPATPLQVSGLYEEQQAPARVA
                     KMKVTSVATEVASTSRRTNSGIFKCPVPGCGSTFTRHFNLKGHLRSHNDERPFKCLYE
                     GCPKAIVGFARQHDCKRHMLLHEGLRLFECEGCGKKFARLDALTRHHKSEQGQECAIT
                     HPLPTNFDGSPMSESQYKTYKGIKSTPEGSGRRQSSTASGSGSGSGKKRSKKSETSEE
                     D"
     gene            396060..396620
                     /locus_tag="CNA01460"
                     /db_xref="GeneID:3253627"
     mRNA            join(396060..396092,396145..396159,396240..396348,
                     396419..396620)
                     /locus_tag="CNA01460"
                     /product="expressed protein"
                     /transcript_id="XM_566615.1"
                     /db_xref="GI:58258404"
                     /db_xref="GeneID:3253627"
     CDS             join(396072..396092,396145..396159,396240..396348,
                     396419..396522)
                     /locus_tag="CNA01460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566615.1"
                     /db_xref="GI:58258405"
                     /db_xref="GeneID:3253627"
                     /translation="MNTAGSVAYGWGALIVAAGVSFYYAKKEIDARRKEAQIKGTRPM
                     EKLSWEERIAREQQQGVQPSSITDQLKQASANKPSGGT"
     gene            complement(396591..>398960)
                     /locus_tag="CNA01470"
                     /db_xref="GeneID:3253625"
     mRNA            complement(join(396591..397020,397077..397261,
                     397315..397340,397390..397563,397621..397925,
                     397985..397989,398058..398092,398145..>398960))
                     /locus_tag="CNA01470"
                     /product="glycosyltransferase, putative"
                     /transcript_id="XM_566618.1"
                     /db_xref="GI:58258410"
                     /db_xref="GeneID:3253625"
     CDS             complement(join(396644..397020,397077..397261,
                     397315..397340,397390..397563,397621..397925,
                     397985..397989,398058..398092,398145..398960))
                     /locus_tag="CNA01470"
                     /codon_start=1
                     /product="glycosyltransferase"
                     /protein_id="XP_566618.1"
                     /db_xref="GI:58258411"
                     /db_xref="GeneID:3253625"
                     /translation="MLSLLSSRYTRYSPLLLLFLLGSTFLLFERSSSSSSTLPRSSIY
                     DYTSPATHCFWPGTDASDESAATSQPKIPANKGNVGKMKEWIGWGDSEEVDEDVPSGE
                     GFAWEGQLPDVVPVRGIERYMLAHIEELQQGYDAKHDYEEYGLKIGNISLSAYTAELL
                     ETYKEYLLPPGTPPPNPPPSFLPIVLSRLSLRPPIAPLPPRPNQVMTTEKSVDDLPWQ
                     FQRWKEIMPEWEIKYYDDNALKNWVRGMFGGTKAEKIWKNLPRQVLKTDVFRYMAMLV
                     EGGIYTDSDTAPIIHADQWGHPYNHHTSPLLTHLSRILSISTSPHLPSSHPLSSFSPD
                     DAGTIDEELDVDVSTGKSTIYDGPLVDDGAELGQPSLVVSVESDAIDFGWHNWREVGL
                     SRAVQITQWTFMARPGHPVFLDALGRTLRKSEEMARKEKEAKKNGEEFIPETALEWTG
                     PGVFSDCVYRYLISRYGFKPDDLIHKKDPLRVGDVLILPAGSFSSVSPFGDEQQRNWA
                     ASWHGFFGRWRGADPGVQEFERLKKLKKEAEEAEKKAKEEAEEAERKAKEAEQQANET
                     SEQADKSAQDAEEKAKEAAEEAARKAQEASDKVEALGEEVEKAKEVAEGKSDGQDGGN
                     GEFTESREETEEEMLV"
     misc_feature    397783..397874
                     /note="GA-rich"
     gene            <399139..>401471
                     /locus_tag="CNA01480"
                     /db_xref="GeneID:3253846"
     mRNA            join(<399139..399654,399913..399977,400009..400626,
                     400676..400710,400783..>401471)
                     /locus_tag="CNA01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_567233.1"
                     /db_xref="GI:58259640"
                     /db_xref="GeneID:3253846"
     CDS             join(399139..399654,399913..399977,400009..400626,
                     400676..400710,400783..401471)
                     /locus_tag="CNA01480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567233.1"
                     /db_xref="GI:58259641"
                     /db_xref="GeneID:3253846"
                     /translation="MPPFGHTATTKRWRPNFRESVVAFHDASYFSLKTRILAQIITFV
                     APDRQSSIEPSERPIETSNEHLGHFQKQHLQKCLHHRPKTSHLALLGHLERVQTLSSS
                     WASWFSALLPFSPLMRKDKASSKRRVRNLSNARQVLGCARERRARRLICRQDGQLNSS
                     RKGKGDGKKITMLLSSQLVSFCFGIQKPLFFYHLFVALQHPVLHIMTRNSLPHIQSRP
                     DVISAPPNAPHDTHKKEASSDSSNRGGPSVDANIGRNKQAARQYSGVFSPLGTTFGLE
                     TPQLATPEVTSPDTSMIAVHGSVLGSPFPPEMGRGKHGRCPFSDWECFAVTQQKQVGI
                     VNAGSTNPADTISDHDAEVEVSEAAKDSSPVHNDRIIAIDFDDVCTQNMLAMITEHNT
                     EYGTDLTLDDLETYVFWQNHVARKVKILNQLLPKTAPIPGFAAALRTLHSFGHPIHIV
                     TSRPESDREAVAEWLEQEGITIGLGPEDVIAAAWFTGTYSSAYPEIGEKGDTESAIER
                     ENVLNDKLKDIWKEGVGKGKGGLGKLKVLRRINAALFIDDHHGNLEPIVKAEPPIPCL
                     LFGAYGWNRSRSGLTSPVELMDYDERMSRGLAFPFEEIITGKDHGLHRTKTWSDVIKW
                     VKEWDREAMDVVCYDT"
     gene            complement(401404..403091)
                     /locus_tag="CNA01490"
                     /db_xref="GeneID:3253623"
     mRNA            complement(join(401404..401629,401690..401932,
                     401989..402058,402107..402246,402300..402525,
                     402587..402687,402740..402851,402914..403091))
                     /locus_tag="CNA01490"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542783|gb|CF688624.1,gi|41542798|gb|CF688639.1,
                     gi|41547497|gb|CF693338.1,gi|41547509|gb|CF693350.1,
                     gi|41552720|gb|CF698561.1,gi|41563151|gb|CF708992.1"
                     /transcript_id="XM_566620.1"
                     /db_xref="GI:58258414"
                     /db_xref="GeneID:3253623"
     CDS             complement(join(401605..401629,401690..401932,
                     401989..402058,402107..402246,402300..402525,
                     402587..402687,402740..402851,402914..403001))
                     /locus_tag="CNA01490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566620.1"
                     /db_xref="GI:58258415"
                     /db_xref="GeneID:3253623"
                     /translation="MATVTTTAATSLLFKQATIAGAQVPPMAIGTWSWGDKTWGYESK
                     DFENIKEAWSASVKAGLTFFDTAEAYGNGESERIIGRLIKEGTSEENKARLYITTKFL
                     PFPTRNGFFLFNPPVVEHLKASLERLGLDSVPLYQLHSSISLNSHEKIAAGLAQCVKL
                     GLAKAIGVSNFSKDELIKMSDLLEKHGVKIASNQIEFSLLRQLPEENRLLEEMKKRGI
                     ACLAYSPLAMGRLTGKYNASNPIPPGRRFSSQYSWEQLEPLISELGTLANKYEVTHSA
                     VALNWVMCKGAIPLGGARNKSQAEQNAKAVTFKLTDEEVDRLSSLGFSGKNTWFWQRG
                     "
     gene            complement(403338..404990)
                     /locus_tag="CNA01500"
                     /db_xref="GeneID:3253634"
     mRNA            complement(join(403338..403557,403608..404018,
                     404070..404431,404484..404563,404621..404990))
                     /locus_tag="CNA01500"
                     /product="alternative oxidase 1"
                     /note="supported by cDNAs and ESTs:
                     gi|41533435|gb|CF679276.1,gi|41533744|gb|CF679585.1,
                     gi|41533754|gb|CF679595.1,gi|41537582|gb|CF683423.1,
                     gi|41537589|gb|CF683430.1,gi|41538491|gb|CF684332.1,
                     gi|41538496|gb|CF684337.1,gi|41546714|gb|CF692555.1,
                     gi|41546721|gb|CF692562.1,gi|41548457|gb|CF694298.1,
                     gi|41548471|gb|CF694312.1,gi|41550785|gb|CF696626.1,
                     gi|41550792|gb|CF696633.1,gi|41551014|gb|CF696855.1,
                     gi|41551021|gb|CF696862.1,gi|41551423|gb|CF697264.1,
                     gi|41555525|gb|CF701366.1,gi|41555529|gb|CF701370.1,
                     gi|41558956|gb|CF704797.1,gi|41558963|gb|CF704804.1,
                     gi|41560800|gb|CF706641.1,gi|41560805|gb|CF706646.1,
                     gi|41562317|gb|CF708158.1,gi|41565257|gb|CF711098.1,
                     gi|41565496|gb|CF711337.1,gi|41565503|gb|CF711344.1,
                     gi|41567424|gb|CF713265.1,gi|41567428|gb|CF713269.1,
                     gi|41572178|gb|CF718019.1,gi|41572185|gb|CF718026.1,
                     gi|41573983|gb|CF719824.1,gi|41575760|gb|CF721601.1"
                     /transcript_id="XM_566622.1"
                     /db_xref="GI:58258418"
                     /db_xref="GeneID:3253634"
     CDS             complement(join(403467..403557,403608..404018,
                     404070..404431,404484..404563,404621..404882))
                     /locus_tag="CNA01500"
                     /codon_start=1
                     /product="alternative oxidase 1"
                     /protein_id="XP_566622.1"
                     /db_xref="GI:58258419"
                     /db_xref="GeneID:3253634"
                     /translation="MSAILLRSGNVARSTILAGGPSIGGPMTLRSAYSSTRTFSIFTK
                     AKIQSGNMNRASLSLRPSVREAEKSQGPVVGSEGKGVEGPHYQDQASHNVLSDASTTG
                     AWTMFNPIYTEKELNTVQVVGRAPVTFGDKAAHKTVKFLRKCFDLLTGYTPYEVPASV
                     LAQKPIPIAELRSKGKLLSDQKWLFRIILLESIAGVPGMVGGTLRHLRSMRLLKRDGG
                     WIHSLLEEAENERMHLLTFMTIAQPGIFTRALVLAAQGVFYNAFFLTYLISPRIAHRF
                     VGALEEEAVRTYTHCISDMEAGLIPEWKDMPAPAIAIDYWRLPASSSLLDVIRAVRAD
                     EATHRFVNHSLANLDQKRDFNPFALSEASPEERGSKWGYTREESARFALEQQQKLMTA
                     SEKSKGLVE"
     gene            complement(406515..410222)
                     /locus_tag="CNA01510"
                     /db_xref="GeneID:3253879"
     mRNA            complement(join(406515..406912,407219..407552,
                     407610..407744,407858..408033,408096..408378,
                     408428..408572,408628..408800,408849..408958,
                     409014..409113,409175..409271,409323..409407,
                     409469..409559,409614..409869,409929..410222))
                     /locus_tag="CNA01510"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535339|gb|CF681180.1,gi|41551389|gb|CF697230.1"
                     /transcript_id="XM_567140.1"
                     /db_xref="GI:58259454"
                     /db_xref="GeneID:3253879"
     mRNA            complement(join(406560..406942,406993..407552,
                     407610..407744,407858..408033,408096..408378,
                     408428..408572,408628..408800,408849..408958,
                     409014..409113,409175..409271,409323..409407,
                     409469..409559,409614..409869,409929..410222))
                     /locus_tag="CNA01510"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535346|gb|CF681187.1,gi|41548883|gb|CF694724.1,
                     gi|41548890|gb|CF694731.1,gi|41551397|gb|CF697238.1,
                     gi|41561497|gb|CF707338.1"
                     /transcript_id="XM_567141.1"
                     /db_xref="GI:58259456"
                     /db_xref="GeneID:3253879"
     CDS             complement(join(407512..407552,407610..407744,
                     407858..408033,408096..408378,408428..408572,
                     408628..408800,408849..408958,409014..409113,
                     409175..409271,409323..409407,409469..409559,
                     409614..409869,409929..410066))
                     /locus_tag="CNA01510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567140.1"
                     /db_xref="GI:58259455"
                     /db_xref="GeneID:3253879"
                     /translation="MTFDTSPTLLSSRVFRGASPDPTYRGISWSNEGQCMVVTPRTIT
                     ILTPHIASSLPPPRNPLTSQQSMKISEAQKLSNIKPGIQATDSGYNNNNQQLKARRLE
                     GGGVQWWSTAINVEINEEREWLYGWGDVSDNYLSMVETDSKGATVRQATWSPSGLSNL
                     GSCLLVVLTTSLQVSVYAPVENPLTQRWVEIADLTMLTKELLPPKEILNGLTSRGMLE
                     MRASSISWSPSLPLSSMLGVDGSILAVSDRIGKLALWTYGHQKRFQRLASISIGSPAN
                     WIADISWSDWTVKGDTCEALLALVFTDGSVQLLKIQQHAKQKLDSLSGWSCTIGEPIS
                     VDDSDRRPITAVKWVKDVLVWTKAGSVHMFANDESQSVPWKGMRNLRLERVGDWANAN
                     GLSACVGIHLINSSTLMITLSSLTTHFVYSFDESPEIAPTVENLRLTWPLRQMSLEPL
                     PISQPYLVERWRELTSNHAGWTLQTSGWAAVGEYGNSLTWITEPINLHTLHVSADADR
                     NSHFFMANFDNVIPPEKPVLSALEEIVEKPPNRQSMVWQACISFPFLCCGWNGRSEIH
                     GGAQKLARRRLGKLGAQFPSHLSCAHDMVYIGIPSVCKRIPNT"
     gene            complement(410561..412849)
                     /locus_tag="CNA01520"
                     /db_xref="GeneID:3253644"
     mRNA            complement(join(410561..411414,411466..411847,
                     411907..411966,412023..412102,412151..412193,
                     412250..412849))
                     /locus_tag="CNA01520"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535027|gb|CF680868.1,gi|41535037|gb|CF680878.1,
                     gi|41560662|gb|CF706503.1,gi|41560668|gb|CF706509.1,
                     gi|41561040|gb|CF706881.1,gi|41561047|gb|CF706888.1,
                     gi|41569389|gb|CF715230.1"
                     /transcript_id="XM_566624.1"
                     /db_xref="GI:58258422"
                     /db_xref="GeneID:3253644"
     CDS             complement(join(410778..411414,411466..411847,
                     411907..411966,412023..412102,412151..412193,
                     412250..412466))
                     /locus_tag="CNA01520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566624.1"
                     /db_xref="GI:58258423"
                     /db_xref="GeneID:3253644"
                     /translation="MVMFSLDAFIFSTICLLSHLPAAFAFGVQSYPNLFFDASTIVNN
                     EWFNGIDSRWARAMSEYWAQTLIQYGPWSVTNKSIAAKSGDKKDYLSWAVYHWPDCSN
                     VQNTTELTTEEVWDECDYVVRDGQVNPDTELVKDKEALQNMSNSIYLSAMAYLHTGDS
                     QYTTHINHALHTFFINNETRMNPNLNYAQVIRGPGDQMGRHTGVLDLACMAKIVSGVQ
                     VMRSIKPVEWQQETETGMMQWASEQLDWLYTSELGLAELNATNNHGTFAVNQVCALNV
                     LLNQSDACATALDDFYNGIYLDQIDANGDQPLESARTRPYHYRAYNLMALVTNAQFGD
                     FVGLSPSAWERRSAANATIVDAVHYAMLQNYTTSDELNQEKALNPVVAAISAKYGDPD
                     NKYADFLKSTDPYFPGQPWFALNEGLSDAGIKQGLLETTYGPVPPQPTLGAGSPDDLE
                     YGKKRDWKPRGAGWPTGAPRAP"
     gene            complement(413728..415020)
                     /locus_tag="CNA01530"
                     /db_xref="GeneID:3253655"
     mRNA            complement(join(413728..413825,413886..414105,
                     414159..414270,414318..414760,414818..414875,
                     414933..415020))
                     /locus_tag="CNA01530"
                     /product="glutamate biosynthesis-related protein,
                     putative"
                     /transcript_id="XM_566626.1"
                     /db_xref="GI:58258426"
                     /db_xref="GeneID:3253655"
     CDS             complement(join(413766..413825,413886..414105,
                     414159..414270,414318..414760,414818..414875,
                     414933..414951))
                     /locus_tag="CNA01530"
                     /codon_start=1
                     /product="glutamate biosynthesis-related protein"
                     /protein_id="XP_566626.1"
                     /db_xref="GI:58258427"
                     /db_xref="GeneID:3253655"
                     /translation="MENNEKVLVGCIGGSGLYHLDNLTFVKTVHIETPWGKPSSPINI
                     SSLPSGALVAFISRHGSHHSITPSEVPCRANIAALKHIGCEAIIAFSAVGSLREEIAP
                     GHFIIPDQIIDRTKGIREDTFFRGEGLVVHSMFGEPFSQKLNAFVAPRVEKILKETGD
                     VVLHTGKTVVCMEGPAFSTRAESLMYRQWGGDIINMSVIPEAKLAREAELDYTLICTS
                     TDFDAWRTGYDPVTVEEVVKVLHTNAGNSRAVAAGILQDVHDVVVEGKTLTDIKGSMK
                     FACVTRKDIQPEASRKKLSYILPYFSD"
     gene            complement(416019..418212)
                     /locus_tag="CNA01540"
                     /db_xref="GeneID:3253469"
     mRNA            complement(join(416019..416160,416228..416894,
                     416951..417355,417408..417531,417585..418212))
                     /locus_tag="CNA01540"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41574069|gb|CF719910.1,gi|41574077|gb|CF719918.1"
                     /transcript_id="XM_566498.1"
                     /db_xref="GI:58258170"
                     /db_xref="GeneID:3253469"
     CDS             complement(join(416062..416160,416228..416894,
                     416951..417355,417408..417531,417585..418149))
                     /locus_tag="CNA01540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566498.1"
                     /db_xref="GI:58258171"
                     /db_xref="GeneID:3253469"
                     /translation="MAVSKKSRKSEPSAAFTAADGLVLDQSEIMRAMLAAQKGKQKEE
                     SEGNDESDEEDDDVSNEGEDEGESSGSEAESSVAAQRNLKRRRSLSFELDAEGEEDKE
                     NEESEPRPQPSSGAGMLSRTALATKDMTPKPRSKPQPNGLASASKPSADVTFESLGLS
                     HPLITALASINIKKPTEIQAACVEPILSGRDCIGGAKTGSGKTMAFALPIVERIARDP
                     FGVWAVVLTPTRELAYQLSEQFLVIGKPLGLTTATIVGGMDMMKQAQELEARPHIIVA
                     TPGRLCDLLRSGGVGPGKLSRVRTLVLDEADRMLTPSFAPELAYLFSQIPAKRQTCLF
                     TATVSEAIMELANKEPPAGKQRPFVYRVASDTLTVSNLKQKYLFIPSQIRDPYLLYIL
                     QNPLEDIDVALRVDPKKAKAREREAALGKKGKKPRQAKEEEDAPSVPSTVIFTQRCAT
                     AHLLHLLLNSLDIPSVPLHSHLTQPQRLLSLARFRAHEVPVLVTTDVGSRGLDIPEVA
                     MVINWDCPRRSDDYVHRVGRTARAGRGGVAVTIITERDTELVKIIEDEVNVRLEELKL
                     DEDKVLEGLNKVSLARRMATMEMHDSGFGERQATNKAKQIKRMKRDAAAAGKA"
     gene            418415..420712
                     /locus_tag="CNA01550"
                     /db_xref="GeneID:3253467"
     mRNA            join(418415..418721,418780..420220,420274..420712)
                     /locus_tag="CNA01550"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540476|gb|CF686317.1,gi|41540482|gb|CF686323.1,
                     gi|41543288|gb|CF689129.1,gi|41543299|gb|CF689140.1,
                     gi|41552040|gb|CF697881.1,gi|41552056|gb|CF697897.1,
                     gi|41565223|gb|CF711064.1,gi|41565231|gb|CF711072.1"
                     /transcript_id="XM_566500.1"
                     /db_xref="GI:58258174"
                     /db_xref="GeneID:3253467"
     CDS             join(418477..418721,418780..420220,420274..420645)
                     /locus_tag="CNA01550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566500.1"
                     /db_xref="GI:58258175"
                     /db_xref="GeneID:3253467"
                     /translation="MSPQQPANPSAASHNAQLLQSHDLVASLPTPYLRLLVLFARPIA
                     LFKHVLQVFLWSPGRRVESWMVVGAWWALCLGSQPAFRFLLPPLVFLPLLPLATLRLK
                     HTQKTPTENSPSSPATHDTLLLTLSDLNEIYALLPISPLPAMSDVYARFRQLGPVRLI
                     RGLAVLWGTWLVLGQLVVGYKTLLALIGTVILLLPSPPLAHFINLLSGSLFFRQAVAL
                     AFLFTFGSPPETSYRFKLNFSLWGWFKSKWTASRRPSLAFAFRPKMSGKVPSGSALEV
                     EREKSEGKEESHIKVESPIYFRFEIHENQRWWMGLDWTSALLPQERPSWCDSHLLPVS
                     PPQAFTLPAPVSVVINTATMKDRYARVMRSAEWKWLDDDWSIVRSGPGASAAPGTQTN
                     PVLPPENDPDSGHSLHQGQHHNQPQSPQARTASRPSSFISAFGSPTAYSPSSTEDSTS
                     SAGSRAQSIAEQAFTKGLERLKARAVSGTAPPATASSPRRSGESVRGRTGSYDATDEE
                     GSEGTPSTQIGQQPGSAPLPSETIPERDAATDADGWVYGDNKWENVGSKGGLGKFTRR
                     RRWRRRAICIETVRKLSPSDDPAITISPSATESGANTPTPATFAAAPSSPLKSKPAIG
                     LSEAQTKGTTASEEVLESVKESTIPEHKIGPYGASSSGSAPVSRDEMLRMRLKKAMGS
                     VGA"
     gene            complement(420796..422133)
                     /locus_tag="CNA01560"
                     /db_xref="GeneID:3253843"
     mRNA            complement(join(420796..421740,421797..421839,
                     421890..421975,422030..422133))
                     /locus_tag="CNA01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_567142.1"
                     /db_xref="GI:58259458"
                     /db_xref="GeneID:3253843"
     CDS             complement(420896..421720)
                     /locus_tag="CNA01560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567142.1"
                     /db_xref="GI:58259459"
                     /db_xref="GeneID:3253843"
                     /translation="MNGAQTDLFDAVNKSNPTNTNVTTSSGNVNVSEALGSSVAVSSA
                     TVSASEGRSSLVISSPIVSSVSSSTNVMATTSLTSQSVPSATTFSADVVAALQTSSSP
                     SDSTRSSSASQTSAPSSAAKTSHALDGTADPSTTLKTTLTRTITMYRSSTTSTTSASS
                     SSDASPSNSSFMASTSVITSESSSVSIPSSISVAILYSPLVSTLSLSTSSLSSTFTAA
                     ATSPATTEIPPIVADANLSSTKSSTCKRKRSGIRKHGIKEGRRKERVLGRAIGGAT"
     gene            complement(<422125..423228)
                     /locus_tag="CNA01570"
                     /db_xref="GeneID:3253620"
     mRNA            complement(join(<422125..422653,422724..422960,
                     423052..423228))
                     /locus_tag="CNA01570"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41573787|gb|CF719628.1,gi|41575848|gb|CF721689.1"
                     /transcript_id="XM_567250.1"
                     /db_xref="GI:58259674"
                     /db_xref="GeneID:3253620"
     CDS             complement(join(422125..422653,422724..422827))
                     /locus_tag="CNA01570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567250.1"
                     /db_xref="GI:58259675"
                     /db_xref="GeneID:3253620"
                     /translation="MFFAPMTLVQLCSALIFMLLPVSAHIALWDPAMYGWDDDPNQSG
                     PVTPLMDLTFDQWWFHGYINSPPANNSIMELPAGGTYHGQVACNKALTSYGQDPAKQT
                     GIYACDGTGPSGGIGAMHTSDAWESSDPQDVKGCAIGIAYESNVAKIQPENFTVISVN
                     YTCPWKKQVEFQIPSDLPPCPKGGCHCMWGWVHAADAGEHCSLCISQTHN"
     gene            complement(423471..426325)
                     /locus_tag="CNA01580"
                     /db_xref="GeneID:3253808"
     mRNA            complement(join(423471..423868,423953..424038,
                     424103..424181,424244..424302,424359..424464,
                     424519..424857,424909..425135,425188..425325,
                     425377..425471,425527..425680,425728..425928,
                     425985..426046,426095..426325))
                     /locus_tag="CNA01580"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543383|gb|CF689224.1,gi|41543386|gb|CF689227.1,
                     gi|41543722|gb|CF689563.1,gi|41543733|gb|CF689574.1,
                     gi|41549379|gb|CF695220.1"
                     /transcript_id="XM_567143.1"
                     /db_xref="GI:58259460"
                     /db_xref="GeneID:3253808"
     CDS             complement(join(423524..423868,423953..424038,
                     424103..424181,424244..424302,424359..424464,
                     424519..424857,424909..425135,425188..425325,
                     425377..425471,425527..425680,425728..425928,
                     425985..426046,426095..426276))
                     /locus_tag="CNA01580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567143.1"
                     /db_xref="GI:58259461"
                     /db_xref="GeneID:3253808"
                     /translation="MRHSSLALLSSLLLLSLPTFAFWPFKEKRFKDEAFINAGPLGLS
                     KLGGRVAAIGDWDGDSKLDLFTLSDEAKTVQIHLWNGDKYKYIPSHTLSLSERIINVV
                     PGDYNHDGHLDLLLMYDKSEGGGWWGSKVERLGMGVYLGGGPDGGFQEESWTLPLSTP
                     SQPMVYDADGSLRPSLLGYQPTETGEGVVCWRNNGTGFTLEIPQLRPIDQICTMANPH
                     SSAFVDIDGDCLPDLVLHCSRSKTVSFIQIWLNRGDAGYILARSYDLPSGSGPISFAD
                     TNRDGSVDIIFPTCTHKSTSTGLGRDCSINIAQNKQVPLCSTEGSQWSTDGLLKCRGW
                     GDMCLSDEKFEFSFDESDPSFTSIPLSELLPDSSNPGILLHPPSDSSIPLPLRPGDFN
                     VDGFPDFLFVTSDDTKSSKSTQVNILENVPCAKGVIGCTKGVRRGWRLGHGKGWYDLE
                     GITDAVGASWLDLDEDGSLDIMVQRSGDQIGHKVTFIQNNFYHDAFFLKTEVLNGVCD
                     GKCEPVAGGKSYNPLGVSYSGATYKFTVLDTAGHRVAQQVAQLPQTGYHALQTPYAFF
                     GLGRTNNYVEKLFIGVSLAPPNHITFLESLIPNSQVIINPPYPAAISSPDEKREEPRS
                     PVKARSTEWKSQLYLKPGEWVPWVGAAVLGTVIVLGTVVLGLNEREKREDERDRQRAL
                     HAINFQAL"
     gene            426526..428033
                     /locus_tag="CNA01590"
                     /db_xref="GeneID:3253890"
     mRNA            join(426526..426716,426768..426921,426978..427194,
                     427239..428033)
                     /locus_tag="CNA01590"
                     /product="peroxisome assembly protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41552419|gb|CF698260.1,gi|41553588|gb|CF699429.1,
                     gi|41553596|gb|CF699437.1"
                     /transcript_id="XM_566502.1"
                     /db_xref="GI:58258178"
                     /db_xref="GeneID:3253890"
     CDS             join(426576..426716,426768..426921,426978..427194,
                     427239..427983)
                     /locus_tag="CNA01590"
                     /codon_start=1
                     /product="peroxisome assembly protein"
                     /protein_id="XP_566502.1"
                     /db_xref="GI:58258179"
                     /db_xref="GeneID:3253890"
                     /translation="MGEVYEGESPAESSRAPKVNQLDADELDDALVSMLGEKVLRSID
                     NFKPKVSWDFKPEIELVIKLVIFRLGICDSLSRSSPGAKLQNLKLIHHPQLGIKTIRS
                     ALLLYLLLHPPIFPSYLLKRIRQHALSKQWPDLPNYDWRKKAWKALGRIELASKIWEA
                     SGWAGFLWDGKYPSLLMRILGLRLVPSQPHLTKLVSYEFMNRQLVWSAFTEFLMFVIP
                     LLPTVPPFLRLSPSRFFKPISTFLSQPTDIDYSSLPPIPLDRRGLNCGDNEPRKHGGP
                     LAHLPKTTCPICYIRHSAAPVPLSSTSQGSSLTLPPIPGSSEAAFGHEASETDGEEEC
                     GIFMPARTDCDGGCLWCYYCIGEELYRHRKTNLQKIYRSKQMRNGRQELEKTDEEVKW
                     NCLRCGDGVTKAWRADSQDEAQLLYG"
     gene            428499..432266
                     /locus_tag="CNA01600"
                     /db_xref="GeneID:3253614"
     mRNA            join(428499..428750,428799..428936,428989..429085,
                     429141..429261,429311..431849,431901..432266)
                     /locus_tag="CNA01600"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41567944|gb|CF713785.1,gi|41567953|gb|CF713794.1"
                     /transcript_id="XM_567251.1"
                     /db_xref="GI:58259676"
                     /db_xref="GeneID:3253614"
     CDS             join(428723..428750,428799..428936,428989..429085,
                     429141..429261,429311..431849,431901..432181)
                     /locus_tag="CNA01600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567251.1"
                     /db_xref="GI:58259677"
                     /db_xref="GeneID:3253614"
                     /translation="MDNNAIQIAVRVRPWHPEKELPFVQRPSTQPFFQGDGNFGQLPQ
                     KAAAGSLREVVDVIDHRMLDFDKPLEEPGKRGPFVMGRRYKNRKYVFDQVFGMGAEQE
                     EVFTKTAKPLLPGVLDGYNATVFAYGATGCGKTHTISGTEEQPGIIIRTMRELFDLVE
                     ETKDKYDTYFEMSMVEIYNETIRDLLGDDYPNCPYGGLKLLENEKERVTIDKVTLKRP
                     TSVEEVMSLVMLGNDRRSTSFTERNSVSSRSHLVLQINVGRNERGTDIDVANSIVRQC
                     STSATLSIIDLAGSEKASVNRGQRMKEGANINKSLLALSGCISALCQRPVRGVRVHVP
                     YRDSKLTRLLKFSLGGNCRTVMINCISPSSKDIEETNNTLLWADKAKKVSTKVSRNTA
                     GVELRTAQWLQKIVTLEETIKTLRSQLDNSHNAKSGLQQKRLEKARAESREELGKVEA
                     ELDALLPIIVEGSEMEALWSASVLQVEALEARLQDITVEVKDGRSEEDAKKEKDHLRS
                     LILQQDDAFRFNHEIQAGIQNKSLKYITLTNLLKKAEEKMFGEDIEEALYQHQLKVAE
                     HKAHTARSVAAARERGLRDYISQQAEALAKAASAFSRFSNQLRSEIIAVQSMQSGDDL
                     ASLKSRFLALGNQVDQSTAVLFGKSHSLPAAPSQHRLPVSLAAPSPRRVSVGRHAHSP
                     MRQNASPKSVLRKNLFAGMSVPEKAIEAKPRQIRWPDETGEGKIDDRSIAPDCPIFSS
                     PGSGGEDSVLEEETNPVSMIPPSLRPASSATSCASMSPAPSTSNTSASEEIPAWKQMR
                     MARGLIPQSQSGDNVGGNLSFDSKSPTSGSSRAGRTGFVGSSAKPGRPGPLSEMSIQT
                     SAQPSPPSSSSTSSLLKPTASSAAKANSSSAFANIKIAMPASATAGTMLPPPVPPHRR
                     DSMIGPDRHGRPKQRLSMIPGHAEASFSGVGKGLPSGGLSTLSGGARIVSNDSKRRMS
                     VQAGSVGSTYSPPVRAPSISSRPSLSNLRGAASCGDTSVSTSRGLSTRPSVNRLNVGD
                     VSALAPLPRPSLSTRYSMTRLNSGVTTGEGGGKPVWR"
     gene            432711..434037
                     /locus_tag="CNA01610"
                     /db_xref="GeneID:3253463"
     mRNA            join(432711..433160,433220..433246,433304..434037)
                     /locus_tag="CNA01610"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41547467|gb|CF693308.1,gi|41547477|gb|CF693318.1,
                     gi|41570547|gb|CF716388.1,gi|41570555|gb|CF716396.1"
                     /transcript_id="XM_566504.1"
                     /db_xref="GI:58258182"
                     /db_xref="GeneID:3253463"
     CDS             join(432732..433160,433220..433246,433304..433993)
                     /locus_tag="CNA01610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566504.1"
                     /db_xref="GI:58258183"
                     /db_xref="GeneID:3253463"
                     /translation="MPRGYSSSIGSASTYSPLLINPSSQPESSFVPPPTNGHRLSLRY
                     AYPLVPLASLDALYTLHHHISTSQGLPGDVLTIGIARALVLFAVGCTQRWRARGGWVG
                     VVKAVSIFMAIWEACRRVLSRNLENDGNEGLETNLIWFLMAFGGLGIVEYLVFLLLLR
                     LSPPPLRINPLALRLPRSYTQTDMPFAFHTESAILTPGSLRAQRRMHGRNISNVSRTT
                     VRSDWSRSERGVQGERDVFRVNDQFMEDGEDTDEDEGGSGEPVYEYDDYTSDGHDGFP
                     EGDDASSVSSSSIIDLPPPLSPAALSVPTFPASLSISSRLGALDRSPVIGPLVRRTRS
                     ARFLGRSWGSSTGREVDGEAELGQAGSSIGRDWCTREMDEGYGTFND"
     gene            complement(434064..>438229)
                     /locus_tag="CNA01620"
                     /db_xref="GeneID:3253886"
     mRNA            complement(join(434064..434505,434572..435002,
                     435083..435500,435561..>438229))
                     /locus_tag="CNA01620"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41566773|gb|CF712614.1,gi|41566780|gb|CF712621.1"
                     /transcript_id="XM_566506.1"
                     /db_xref="GI:58258186"
                     /db_xref="GeneID:3253886"
     CDS             complement(join(434163..434505,434572..435002,
                     435083..435500,435561..438229))
                     /locus_tag="CNA01620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566506.1"
                     /db_xref="GI:58258187"
                     /db_xref="GeneID:3253886"
                     /translation="MPKPTFIQTVLRKPARSYADPNAPPPWSDSYRDADRYPASAASR
                     YAPVDDYRPAYAHSHICHQDAGPSRRVSRAPSSVVSASAASDTSFRTTRFPKPSGKAT
                     HHVVLRNGEIVHAPVGESVSEIGTASAAPSVRSSRRKEKPPPPVQAQPGNVPAKTTKK
                     RKPKPVIDRSDSSLCSTPPALHSRLSETSSASSSPLVPISPVAPTLPRVTQSAAEKQL
                     KAAKQPTRPPISVPANAPTALLTPPASRQSTPSSSSQSVTPPTPIPPKIELVQQVSNS
                     DSDSEVFYTPRSSFSFSFDAAAPVAIDAPLPEPIETPRAVDMAEPMLDPVVTPKPRPK
                     TEILLGAPVFNLLPPTPAPIPDPISTPFHSQPTSPIDRSALHPDHLPHTTSRPTLAPR
                     VINPPRNTAEQPPPLPSKDDEDMESASGQAGSDDEEESARQPHRRAGGSRTPKSSSRP
                     CSRAQSIRSSSRRSHNAFEGISRSTSEASFGSGGGGGGGRDGASGASRASSIVAGFGK
                     GGWAAAAASTGSRSGATTPVMYLPPNGTTGWEGFPPTPAGASNSPPRRQSKFTPLPAA
                     SLPSFDKLINSPSLAGGSIHSPSNASANGGNVPQALYDPSVSASVSASASVPVSYSSP
                     SEYSQGSASDNLPLPSRSYAPKLYSSETRQSSSSSRLSEADADGQEDNRQGLNTTRSE
                     LQRPEAPVYPPRTPSPLPPSSSSPGRLSQSSRPTSPSLLTSESTWRPPQSQSQSQSPI
                     PTRPTTPRAGFEPPSFLDPDILTILPEMTPQDSERLYRSSPPPERSRSRLSMYHDNGG
                     GHLSHSRKSSIFRGSRSEVGHGPTAGHVHGGSEAGEEDDGLAELPLPSMIKRSKSAAG
                     YRFTGGSKWEGSSYGDGMLMESHGRDQESAPGYTNLILPLGAYKQSNPAKSAPDLDAR
                     ILGLPHATMASITLHSTFDHHNATPAHLRDQLPPLVEFSSHSKPPGKTGKNQVLVQVY
                     AVAVDQVDVRAVDEKGRGDVGKYVPGRSFVGRALVVGTDEKEVVRGDVVMGLLDIRKS
                     GALAEYILVDRRRVSRAPFPTLLTLEQLSILPLQGIAAARCVRGSLNRQFRAIIINAH
                     TGIAALVCQVMSRAGVYVTAIVPGGDDSHEAHQKCIENGAKGVLMGSPAAVMINLEEN
                     GYDFVFDTQGGQRVYDTAKRALKSGGKLVSTKRPETTLNRVPPHLASRPSGIKTLRTV
                     FGSKRKDSKFIAFEYVSPIGSGEPEIDASGMDCRDVMEEPCMATFRPVLEGENAVVPF
                     ERGADVFKRQGWDECGVRVVRIIN"
     gene            <438381..439981
                     /locus_tag="CNA01630"
                     /db_xref="GeneID:3253461"
     mRNA            join(<438381..438659,438695..438828,438872..439981)
                     /locus_tag="CNA01630"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41547195|gb|CF693036.1,gi|41573725|gb|CF719566.1,
                     gi|41573734|gb|CF719575.1"
                     /transcript_id="XM_566508.1"
                     /db_xref="GI:58258190"
                     /db_xref="GeneID:3253461"
     CDS             join(438381..438659,438695..438828,438872..439961)
                     /locus_tag="CNA01630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566508.1"
                     /db_xref="GI:58258191"
                     /db_xref="GeneID:3253461"
                     /translation="MVTPPKHLAIAAALPPHRDTLYRAAIPAPANLPFLPRLPLATLL
                     LLRPAPLPADHHLRAWARQHGVRVEWVRADEMDEEKLGMGRTEVALALKTILDPALYP
                     LCIADVDGVSHTTLVVACLRKLQGWHMDSIVDEISRFAPNYEDLPLVAFISSFCAPPS
                     SSSASAGAPSTADQFTLPPPPYPAWLWPCPPSAQPRPKPRDRSSSTPAATPVSFNPLP
                     FPHPLVARKHPTMRLVFPPLPPHAQTQLQSQPPGQQQQQQTLTALPLNSPGPIVPILP
                     SPAHSDISRMPSLRHHREKSTTSSPTHTQSPPPPPPPATKDDAQTSVSPGPNAGAGVG
                     RTDTVSDRAGSPEQGVLGVAANIVNASLNGIAGVLSSAGVTPPQAEEQAKSAKQAAVE
                     TPKDEEREGERERGDLTEGKAANQTITTSMNAFNMNREPTLSSSEMAESSTSGVTASA
                     DDVDDQDHLRESEGEEDEDDYDEEEEEEEEEEEDIRATSQYISALDLAGF"
     misc_feature    438473..438519
                     /locus_tag="CNA01630"
                     /note="C-rich"
     repeat_region   438990..439079
                     /rpt_type=tandem
                     /rpt_unit_seq="ccccg"
                     /satellite="microsatellite"
     repeat_region   439875..439909
                     /rpt_type=tandem
                     /rpt_unit_seq="gga"
                     /satellite="microsatellite"
     gene            complement(440022..442308)
                     /locus_tag="CNA01640"
                     /db_xref="GeneID:3253450"
     mRNA            complement(join(440022..440137,440202..440405,
                     440461..440472,440535..440680,440752..440793,
                     440852..440909,440976..441148,441199..441354,
                     441426..441744,441879..442041,442104..442121,
                     442172..442308))
                     /locus_tag="CNA01640"
                     /product="glutamate carboxypeptidase protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530702|gb|CF676543.1,gi|41536964|gb|CF682805.1,
                     gi|41539339|gb|CF685180.1,gi|41539345|gb|CF685186.1,
                     gi|41542571|gb|CF688412.1,gi|41542577|gb|CF688418.1,
                     gi|41545287|gb|CF691128.1,gi|41546450|gb|CF692291.1,
                     gi|41546451|gb|CF692292.1,gi|41549029|gb|CF694870.1,
                     gi|41549034|gb|CF694875.1,gi|41552897|gb|CF698738.1,
                     gi|41552910|gb|CF698751.1,gi|41554047|gb|CF699888.1,
                     gi|41557120|gb|CF702961.1,gi|41557124|gb|CF702965.1,
                     gi|41558803|gb|CF704644.1,gi|41563240|gb|CF709081.1,
                     gi|41569475|gb|CF715316.1,gi|41569484|gb|CF715325.1,
                     gi|41571875|gb|CF717716.1,gi|41571882|gb|CF717723.1,
                     gi|41572121|gb|CF717962.1,gi|41572127|gb|CF717968.1,
                     gi|41574341|gb|CF720182.1,gi|41576355|gb|CF722196.1"
                     /transcript_id="XM_566524.1"
                     /db_xref="GI:58258222"
                     /db_xref="GeneID:3253450"
     CDS             complement(join(440084..440137,440202..440405,
                     440461..440472,440535..440680,440752..440793,
                     440852..440909,440976..441148,441199..441354,
                     441426..441744,441879..442041,442104..442121,
                     442172..442257))
                     /locus_tag="CNA01640"
                     /codon_start=1
                     /product="glutamate carboxypeptidase protein"
                     /protein_id="XP_566524.1"
                     /db_xref="GI:58258223"
                     /db_xref="GeneID:3253450"
                     /translation="MADPKFLQYVDDHKDDYINRLSKAVSIPSVSGNLSYVKDVEAMG
                     EFLLEQLTSLGVKAEKRAIGTHTLEGKEVDLPPVIIGQIGQDPKKKTLLVYGHYDVQP
                     ALLEDGWLYPPFELTPDPNGSGRLYGRGSTDDKGPVMGWLNVLEAHKKLGIELPVNLK
                     VCFEGMEENGSVNLDKFIESEKNKFFAGVDCMCISDNYWLDTKTPCLTYGLRGINYYE
                     IKISGPDRDLHSGVFGGTVHEPMTDLIALMSKLVTPDGQILVTGIKDLIAPVTDDERA
                     KFEAIHFQMEDIHAAVGGEVTISDDTVTTLMGRMRNPSLSLHGIEGAFSAPGSKTVIP
                     CCVKGKFSIRLVPNLTVAGVTDLVVKYVEEEFKKLGSKNKMEVYLTHGGEPWIADPNH
                     YSYRAAHKATESVYGQVPDYTREGGSIPVTLDFANILNLNVLLLPVGRGDDGAHSTNE
                     KIDTDNYIRGTKLLGTYMYELAAAQA"
     gene            442577..444745
                     /locus_tag="CNA01650"
                     /db_xref="GeneID:3253603"
     mRNA            join(442577..442633,442702..443129,443189..443557,
                     443744..443867,443921..444254,444319..444745)
                     /locus_tag="CNA01650"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541095|gb|CF686936.1"
                     /transcript_id="XM_567093.1"
                     /db_xref="GI:58259360"
                     /db_xref="GeneID:3253603"
     CDS             join(442592..442633,442702..443129,443189..443557,
                     443744..443867,443921..444254,444319..444389)
                     /locus_tag="CNA01650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567093.1"
                     /db_xref="GI:58259361"
                     /db_xref="GeneID:3253603"
                     /translation="MANPFSLINAPRPDDGSPPRQSGSSKFVILGPNIGQYFEVSSSE
                     GSSCSSSPSTPSHSPNRLNHQHSFDTSKGRSPSPTECDEIDRVEYSSPAIEMEACQMS
                     GWDSSVSELSEGDSETETSMIITPDRDIRDGQSQRLDIRDIVRWKYTLISLVKHIPNR
                     LLSCRTTSSHTVVPRDFNRRCSESCSVTSASSSSFHAPQPGELNQHGDTVACEACGRG
                     TTITNAKKIMPCQVNLFCALLFPIADYNGEGCHVCLLLLIYPRCRYSNPKSSQMSCMF
                     LLNRYQDITPAIVEAFLPRNSLSHRTLQPIHILLDRFDGRTKDYLYIEAATPQAAQTI
                     LKTCQNTFLSGGALTSGRRRPVTITPVSHSELIEELRPHSAQELHSLLALCQAAIDSN
                     SGSKQSTSKYIKSRHGPYYALMSTMSKMNGEQSPSYWDMFYVASGKKDFLDFSSGPLW
                     HSLTT"
     gene            complement(444795..448886)
                     /locus_tag="CNA01660"
                     /db_xref="GeneID:3253448"
     mRNA            complement(join(444795..446261,446315..446473,
                     446528..446865,446916..447136,447214..447941,
                     447993..448886))
                     /locus_tag="CNA01660"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545995|gb|CF691836.1,gi|41546003|gb|CF691844.1,
                     gi|41569718|gb|CF715559.1,gi|41569725|gb|CF715566.1"
                     /transcript_id="XM_566526.1"
                     /db_xref="GI:58258226"
                     /db_xref="GeneID:3253448"
     CDS             complement(join(444822..446261,446315..446473,
                     446528..446865,446916..447136,447214..447941,
                     447993..448847))
                     /locus_tag="CNA01660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566526.1"
                     /db_xref="GI:58258227"
                     /db_xref="GeneID:3253448"
                     /translation="MPTPENKPAGKDSDPSSSFPISSPSFWAEAANIPIPPVDHKHPR
                     SSPAEADTGEVSSRVQDDSPLPKRPRTSTKSPDHGLTFLPNPQDIDPDDPQAYLANPE
                     YAPNRFGDIGDYMRKKEIKVQAQNASIAASVASGTLPQIFAGLSFYINGNTQPSMEQL
                     RKLLLQRGGTVYPVLRNKTMVDYIIAPVLTLKKHEEFKRHKVVKEGWVVESCRQDKLL
                     DWRKWRLQPDGEGSEAGAKGLESFFAQKAKARQDFVEPIEESSNDPIDKKLAAPVDED
                     TARNVPSEVINVTPTKPIPMQLQRLLTPRKQRHAPIPISPGQPPPSPTFSAPVSPKIQ
                     KPEGAWEHYYKKESNEHAAKALQSDTWRAQNTAEQGNAGGFIDGYYQNSRLHHLSTWK
                     AELKVLVRDAQKRSEEALAKAAVKELAEGGEERGQAVHSLAKSVLPSIPLPAVPSDSA
                     NRVIFHVDFDAFFVSCGLATRPHLKGKPTVVCHSSGRGVGSTSEIASCSYEAREKGVR
                     NGMSLGRARELVGPDLKTMPFSLAFYTVLMAYADELQAVSVDEALIDVTSHVAARAAL
                     PQETAVGQKREERDPAVELAEKIRDDVREVTDGCEVSIGIAHNILLAKLATRHAKPAG
                     VYHLISEAIPSFVHRLSVEDFPSVGYSTKSKVEAAFKTTKAGELLDISKGRWKSVLGE
                     KTGEMLWGYLRGIDSRKLEGDKVRKSVSAEMNYGIRFQTQVQAEQYVHDLAAEVSKRM
                     KNVGVKGRQITLKLLKRHPDAPVEPPKFLGHGWCETYNRSSTLSAPGGGPTDDPKVLG
                     TEGVKLLRSLSIDPVELRGVGIQVTKLDTEGTERGQVDRPTGQRTLNFAKQSKNDTEP
                     VAGPSRLPAQAQNTEIDGLDAEFLAALPPSLASEVCRDHALNNSNATKAVAVQPSRTP
                     PLEIISIPSSTPPLKAESPRSLRPPSPQADTSPEKPISKLRGPNEAAHIARQLRPKTK
                     VQMKAGMVAEGPLFGAWSKAREKTVEVELDKTRHQKSTIVDLTNTSSPQGTGSDNKAE
                     LDEDQIVPGYTLAYLRSLGIDPDVLLALPKAMRKEVIVQEEENARRRQALFQPGDRSR
                     SRGTSTSVSPVKLGGVGAYRGRSTSRSIPPQQRQSVKIIRPPKPALMNSTELPDVLRT
                     IELWIESREDSPPADKDAIKVAAFLKKCLNDGEGKVGDGVEKVVEVLRWMRMIIKEKW
                     AQDEGLNEGASEAGREWWRIWRQMRDEVNLICVKKFGAGLRI"
     gene            <450063..>450305
                     /locus_tag="CNA01670"
                     /pseudo
                     /db_xref="GeneID:3253936"
     gene            451436..453670
                     /locus_tag="CNA01680"
                     /db_xref="GeneID:3253861"
     mRNA            join(451436..451528,451599..451911,452076..452180,
                     452232..452364,452423..452704,452757..452849,
                     452910..453043,453098..453425,453476..453670)
                     /locus_tag="CNA01680"
                     /product="heterotrimeric G protein alpha subunit B,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538678|gb|CF684519.1,gi|41538682|gb|CF684523.1,
                     gi|41542308|gb|CF688149.1,gi|41553131|gb|CF698972.1,
                     gi|41553139|gb|CF698980.1,gi|41553341|gb|CF699182.1,
                     gi|41553354|gb|CF699195.1,gi|41555984|gb|CF701825.1,
                     gi|41555997|gb|CF701838.1,gi|41556502|gb|CF702343.1,
                     gi|41556512|gb|CF702353.1,gi|41566482|gb|CF712323.1,
                     gi|41566492|gb|CF712333.1,gi|41571059|gb|CF716900.1,
                     gi|41571071|gb|CF716912.1,gi|41574003|gb|CF719844.1,
                     gi|41574010|gb|CF719851.1"
                     /transcript_id="XM_566528.1"
                     /db_xref="GI:58258230"
                     /db_xref="GeneID:3253861"
     CDS             join(452138..452180,452232..452364,452423..452704,
                     452757..452849,452910..453043,453098..453425,
                     453476..453521)
                     /locus_tag="CNA01680"
                     /codon_start=1
                     /product="heterotrimeric G protein alpha subunit B"
                     /protein_id="XP_566528.1"
                     /db_xref="GI:58258231"
                     /db_xref="GeneID:3253861"
                     /translation="MGCTQSTEDAAAKARSAEIDEQLKRDRANLRNEIKMLLLGAGES
                     GKSTVLKQMRLIYNKPYDAEERDSYREIVYSNTVQSMRVLLEGVQFMDIPIDTSNQSR
                     WELIMAAPPQIEGDVFPPKLTDAVAGLWKDYGVQQAFFRRNELQLNDSAPYYFDAIAR
                     IAQPNYMPTDQDILRARVKTIGITETHFKIGELTYKLFDVGGQRSERRKWLNIFDSVT
                     ALVFLIAISEYDQKLYEDETVNRMQEAMTLFESVANSRWFTKTSIILFLNKIDIFREK
                     LLVSPLSNTFPDFRGGNDYDMACSFLLEKFVGLNNNPSKSIYAHYTDATDTKALKFVI
                     SAINDVIIQVNLRDCGLL"
     gene            <454107..>455202
                     /locus_tag="CNA01690"
                     /db_xref="GeneID:3253446"
     mRNA            join(<454107..454154,454306..454515,454565..454691,
                     454759..454906,454970..455045,455107..>455202)
                     /locus_tag="CNA01690"
                     /product="carboxyl-terminal proteinase, putative"
                     /transcript_id="XM_566530.1"
                     /db_xref="GI:58258234"
                     /db_xref="GeneID:3253446"
     CDS             join(454107..454154,454306..454515,454565..454691,
                     454759..454906,454970..455045,455107..455202)
                     /locus_tag="CNA01690"
                     /codon_start=1
                     /product="carboxyl-terminal proteinase"
                     /protein_id="XP_566530.1"
                     /db_xref="GI:58258235"
                     /db_xref="GeneID:3253446"
                     /translation="MSEAPSKWVPLEASPDWSEPLGLPQSLAFQDLFSLDPSFLSFIP
                     APHRAVLLLFPSKGKLQEERSKEDRDDGKQFKGEGIWWIKQTIPNACGSIGLLHSLLN
                     LPERGPDALNPDSKLAQFKAESLPLTGLERAKLLDETTFFTEAHTSAASTGQSVVPTD
                     LDVDEHFIAFVEGVDEKGEKRIVELDGGRNGPLDRGASNNFLEDVAKVVQEKYFERAE
                     GDVNFNMIVLAGKSDD"
     gene            complement(455193..457381)
                     /locus_tag="CNA01700"
                     /db_xref="GeneID:3253444"
     mRNA            complement(join(455193..455432,455477..455992,
                     456060..456245,456313..456438,456489..456609,
                     456663..456880,456941..457060,457124..457198,
                     457277..457381))
                     /locus_tag="CNA01700"
                     /product="negative regulation of gluconeogenesis-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535939|gb|CF681780.1,gi|41535949|gb|CF681790.1,
                     gi|41576163|gb|CF722004.1,gi|41576177|gb|CF722018.1"
                     /transcript_id="XM_566532.1"
                     /db_xref="GI:58258238"
                     /db_xref="GeneID:3253444"
     CDS             complement(join(455331..455432,455477..455992,
                     456060..456245,456313..456438,456489..456609,
                     456663..456880,456941..457060,457124..457198,
                     457277..457330))
                     /locus_tag="CNA01700"
                     /codon_start=1
                     /product="negative regulator of gluconeogenesis"
                     /protein_id="XP_566532.1"
                     /db_xref="GI:58258239"
                     /db_xref="GeneID:3253444"
                     /translation="MAPAYPANPLLLEEPLIRTSYELLRRSHRSAQRQVEKDFNAINS
                     GLQAILKSMEKGSITDEGRMEIVKKVDQVTERANGLKRKLDDLQPSASRPNTLRARLD
                     YLEQNFPGSTTPSKKTKPKGESNRAAASKADKADAASNDMQIDEEDATPLPSNEADKS
                     EPTPDSSTLDRYIVDYLIRKGRLNSATALATSQGIEELVDIKLFAELAKIENALVEKH
                     SCTEGLAWCGENRGTLKKTKNNLEFTLRLQEFIELCRKRDITTAIAYARKYLSGWASA
                     HMSEFQKGMSLLAFGEKTGVAPYRKLYDQSRWEAVRDQFRETFLDLYAQPSQSLLALA
                     LSAGLASLRLPSCVQNVRPNKSTGGDNTSVNPVVPLLPAVPPLHNLETTLFSPASSTH
                     LTAPLGGIPSSPTTDLHAHPEAVTGNIDCPTCDENMRVLASEVPMSHHVNSTIVCRIS
                     GQVMDSENEPLAFPNGYVYSSKALAEMAKNNFDVVTCPRTRESCAFGRLRKVYIS"
     gene            <457615..458648
                     /locus_tag="CNA01710"
                     /db_xref="GeneID:3253443"
     mRNA            join(<457615..457695,457772..457888,457957..458114,
                     458177..458257,458309..458390,458442..458648)
                     /locus_tag="CNA01710"
                     /product="retrograde transport, endosome to Golgi-related
                     protein, putative"
                     /transcript_id="XM_566534.1"
                     /db_xref="GI:58258242"
                     /db_xref="GeneID:3253443"
     CDS             join(457615..457695,457772..457888,457957..458114,
                     458177..458257,458309..458390,458442..458534)
                     /locus_tag="CNA01710"
                     /codon_start=1
                     /product="retrograde transport, endosome to Golgi-related
                     protein"
                     /protein_id="XP_566534.1"
                     /db_xref="GI:58258243"
                     /db_xref="GeneID:3253443"
                     /translation="MVLVLVIGDLHIPNLVHDLPAKFKKLLVPGKIGQIICTGNVCDK
                     ETYDYLRTTAPEVHVVRGEFDENPHFPLSLIIQHQSLRIGVVHGQQVVPAGDPDMLAA
                     LARQMDVDVLISGGTHRFESFEFEGRFFVNPGSATGAWSSLWNGEVTPSFALMDIQGP
                     VIVTYVYQLVDGEVKVDKVEYRKPDPTSEIQSQSTRSEVAARW"
     gene            complement(461722..464271)
                     /locus_tag="CNA01720"
                     /db_xref="GeneID:3253848"
     mRNA            complement(join(461722..462709,462766..463053,
                     464052..464271))
                     /locus_tag="CNA01720"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41554864|gb|CF700705.1,gi|41554871|gb|CF700712.1,
                     gi|41558504|gb|CF704345.1,gi|41558512|gb|CF704353.1,
                     gi|41565390|gb|CF711231.1,gi|41565393|gb|CF711234.1"
                     /transcript_id="XM_566536.1"
                     /db_xref="GI:58258246"
                     /db_xref="GeneID:3253848"
     CDS             complement(join(461855..462709,462766..462939))
                     /locus_tag="CNA01720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566536.1"
                     /db_xref="GI:58258247"
                     /db_xref="GeneID:3253848"
                     /translation="MSASAIPAYRHNSASPVSSRKAVKASASASASSSRPPTRSSQDP
                     YYGHEETAVLAARFITHLFQCPNIPAPSTPGAPTPTLAHFVAYALHRTRLPSVVTFAA
                     LLLLQRLKRRYPAARGSSGHRLFISAFMIASKVICDDTYSNQSWGIVAQKMFALKEIN
                     QMEREMCGYLEWNLNFGEREMLEFEMDLRALHGPRAVARASSSSSSRSDIVLTDSPCN
                     SYPTPETTPDPQVSSRPIRPVPSPYKTRCYSHVPPMAPAFLSPPLSPHHAHLSPQPPR
                     LSSANSSLQSSPASDDCKTPSPITVMATTRPISSTKSFDMTKAFEATARTRGVSVVRR
                     GDDSVAVW"
     gene            466562..468968
                     /locus_tag="CNA01730"
                     /db_xref="GeneID:3253441"
     mRNA            join(466562..467081,467139..468106,468154..468328,
                     468392..468628,468678..468968)
                     /locus_tag="CNA01730"
                     /product="cleavage/polyadenylation specificity factor,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41565425|gb|CF711266.1,gi|41565430|gb|CF711271.1,
                     gi|41575267|gb|CF721108.1,gi|41575273|gb|CF721114.1"
                     /transcript_id="XM_566538.1"
                     /db_xref="GI:58258250"
                     /db_xref="GeneID:3253441"
     CDS             join(466848..467081,467139..468106,468154..468328,
                     468392..468628,468678..468899)
                     /locus_tag="CNA01730"
                     /codon_start=1
                     /product="cleavage/polyadenylation specificity factor"
                     /protein_id="XP_566538.1"
                     /db_xref="GI:58258251"
                     /db_xref="GeneID:3253441"
                     /translation="MAYQAHQAYQQAPYYPPPPVQPTTDVFRRQYADRLRALTFNSRP
                     IIQDLSMLAMAARDRNDWNGMQAVVEEIELAVLRALPQQKLPLLYLLDSISKNVGPPY
                     TTRLLQAIVPRLYIKTYREVDGVTKTKMEEMIGLWRTGGPGGSELYGSHVREQVEREL
                     FGSAGIQNFKVPNRQQVQVLLNAALDNKRREVAMRPGDVVLGRQMNALLGIGELLSTT
                     NVQPQELSMIVEQLKSMAPPSVAPTPTQVSVTPSWGPSPSVNDLAPSNLPPFPPKLPA
                     VNGNGYTNVALPPFPSNIPTPLGTISTPPVTSSQTPIPGNQRSLTPVMAPASLAPVSS
                     IVPSVPSIPVDVARILQTLNKSGIGSQPQTPDVDRGTPGPNMVPAIEAYEDMILRLDI
                     KLKSIDLNAPHKLSFAHLSHRCQQCGMRFPSANAAFDAHMDWHFRRNKKERESGGRGA
                     HRRWLPRVEQWINDATTLPSTAASSSQTEKATVSAERLAQLRQKWVKVPQDSKKAASV
                     CPVCKEAFRAEWSDSEEEWIWKNALAINGIFYHATCRAEQTSALKRLKAADPNRRTSS
                     SASPRTTPSNEGLKPEAQKRKVEGMDIEHEEGSKRVKVEEIVGDI"
     gene            469179..470591
                     /locus_tag="CNA01740"
                     /db_xref="GeneID:3253439"
     mRNA            join(469179..469541,469595..469771,469832..470016,
                     470065..470339,470391..470591)
                     /locus_tag="CNA01740"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41552740|gb|CF698581.1,gi|41552745|gb|CF698586.1"
                     /transcript_id="XM_566540.1"
                     /db_xref="GI:58258254"
                     /db_xref="GeneID:3253439"
     CDS             join(469226..469541,469595..469771,469832..470016,
                     470065..470339,470391..470532)
                     /locus_tag="CNA01740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566540.1"
                     /db_xref="GI:58258255"
                     /db_xref="GeneID:3253439"
                     /translation="MRIPFLAASFPFVLLPFATARSSQQPLQVYLYPSPQSSTNQQLT
                     PPTLSYTQAKAVLDHHLRQDSSVFDEIPEDESMWVHLLGLWDSRETGKARVVVVDGGV
                     EAQDVLPPSLPSEPSFYLDDNVRSHYLLKPYVHSARKTFESIGDALPAFSKSIKDMFD
                     LAGTKAAEILFQELSCLSALADSLPWIDRAGEHPWNAVTITGLKDAQKGSELWETGRK
                     TVQAGLESMTGFDSPPLLLIIRPSSSKVLLPRSAMTNSLQGRSLSSQTCYSSNEACTE
                     ATNCNDRGRCAIKSAENDLECWACKCKNGYTGEECQKEDYSTSFIILIFSTVLLLALA
                     GGSIALLSTIGETKLPSTLNLAVSGGVKHN"
     gene            complement(<470675..>471073)
                     /locus_tag="CNA01750"
                     /db_xref="GeneID:3253988"
     mRNA            complement(join(<470675..470734,470805..470875,
                     470934..470966,471019..>471073))
                     /locus_tag="CNA01750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566541.1"
                     /db_xref="GI:58258256"
                     /db_xref="GeneID:3253988"
     CDS             complement(join(470675..470734,470805..470875,
                     470934..470966,471019..471073))
                     /locus_tag="CNA01750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566541.1"
                     /db_xref="GI:58258257"
                     /db_xref="GeneID:3253988"
                     /translation="MSSTQDEAILRNARETIDSLYDLSQLLQTGLDKSTLSICVGMIE
                     QGANPDTLAAVIKELRSENEALNSQSNA"
     gene            471294..>473648
                     /locus_tag="CNA01760"
                     /db_xref="GeneID:3253833"
     mRNA            join(471294..471834,471904..471980,472042..472584,
                     472635..>473648)
                     /locus_tag="CNA01760"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41559226|gb|CF705067.1"
                     /transcript_id="XM_566542.1"
                     /db_xref="GI:58258258"
                     /db_xref="GeneID:3253833"
     CDS             join(471342..471834,471904..471980,472042..472584,
                     472635..473648)
                     /locus_tag="CNA01760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566542.1"
                     /db_xref="GI:58258259"
                     /db_xref="GeneID:3253833"
                     /translation="MRKRRTTPRSNISKNANISKQLATTLPEGETQSTRKIQAASVEK
                     QKPVIELLGAGRSTLVSNDEDYLSPQVPPKPIISLEHPSSTTSTIKVATTFPHIVFDD
                     LWIDILSFFAQVYLALYEMTLGIGKWWAGTEIEDSHRGKETKEKEIKAKRRRRRVEPS
                     SNSSDSATGRFFPGMVNLSGTLCYMNSVLQSVASIPSLIIHLEKVIDLAVEVDIPTHV
                     TDALLDVIRDLNTPNKRPPPALRPHNLLTALYPLPAIRRLLSTHEQQDAHELFLVLAE
                     AVSDEVVKVAAEVAKVRGIGEIISLQGYLSGKNDGSDQPRRAGDMEGAKRRQRIRGVA
                     QPWEGLLARRRVCQRCGWSEAIRMDTLGGIELPVPLHGNTTLDACIMEYLAPEILSDV
                     TCEMCSLKLTLDYYTSEVERLSGSSCKKTSTKEENEPGSDNQVSASRKKKAREARRAE
                     TRLREMVNSNTVSDFGEPNLTPLPSSGLTAQIPVKWLTAKTASTRQCVIVRPPQSLQL
                     HFIRSEFTMYGTVQKKTAKVSFPLLLDLTRFVSDGVWEERGGIKNMLASVSTEKTIPP
                     ITGQRVIYQLESAILHYGFTHSSGHFVSIRRKPSPSLTKEEKSFRPLQVAKNCPDGCK
                     CQDCVYFGQVRDLENTKVPGRGWLRISDADVEEVGEEALHEAGGAVVMLFYERVMEYV
                     AKKVVHDERLQGDGDSQDAGGLEDNI"
     gene            complement(473367..474659)
                     /locus_tag="CNA01770"
                     /db_xref="GeneID:3253839"
     mRNA            complement(join(473367..473730,473800..473887,
                     473943..474069,474128..474258,474318..474406,
                     474465..474540,474607..474659))
                     /locus_tag="CNA01770"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_566543.1"
                     /db_xref="GI:58258260"
                     /db_xref="GeneID:3253839"
     CDS             complement(join(473689..473730,473800..473887,
                     473943..474069,474128..474258,474318..474406,
                     474465..474540,474607..474647))
                     /locus_tag="CNA01770"
                     /codon_start=1
                     /product="endoplasmic reticulum protein"
                     /protein_id="XP_566543.1"
                     /db_xref="GI:58258261"
                     /db_xref="GeneID:3253839"
                     /translation="MAFIKLDYTVSQSKPSSVPNPPGYLAPFTAKQSASASSKHFQAN
                     EEALAKQARKSTELKMKRAWDLALSPAKSLPMQAIMLYFSGSGIQIFSLGMIFMLLTQ
                     PISAVLNIFQAFEPFRPTPSSTSRKGIKAAAEESTYAPLIGPMVLYVACQGLILALGL
                     YKCSSMGILPTGSGDWLHFETRSDPPEWSAVRSQLLG"
     gene            <474943..476247
                     /locus_tag="CNA01780"
                     /db_xref="GeneID:3253782"
     mRNA            join(<474943..474972,475006..475262,475315..475495,
                     475552..475573,475659..475711,475766..475888,
                     475938..476247)
                     /locus_tag="CNA01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_566544.1"
                     /db_xref="GI:58258262"
                     /db_xref="GeneID:3253782"
     CDS             join(474943..474972,475006..475262,475315..475495,
                     475552..475573,475659..475711,475766..475888,
                     475938..476072)
                     /locus_tag="CNA01780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566544.1"
                     /db_xref="GI:58258263"
                     /db_xref="GeneID:3253782"
                     /translation="MQRCSLLYCVRIYVQTLRPKFAITNIHMHHFASAVAALLLLGFS
                     RAQELSCSSPKVNIDPCLSPSPGGLFVFRQRFEPDVGDDFGSWNIDGLEVLTCDTQQP
                     QNDTAYAPTYNHEEIGSFCLKSTLFSEENAFANSEKAWAQSEVGEGVEEVWERACSGT
                     WQEDAEVPLDLGTGILRRFTKSESQSLVEWDPDIGQIIPSEDISYSLAELTSALSMGG
                     NFPVVICDNTTLSTILWPLLVRGSFATGTFEPTSMLQRESNCPQDGIM"
     gene            477122..479331
                     /locus_tag="CNA01790"
                     /db_xref="GeneID:3253740"
     mRNA            join(477122..477348,477404..477724,477786..477967,
                     478030..479331)
                     /locus_tag="CNA01790"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531126|gb|CF676967.1,gi|41531133|gb|CF676974.1,
                     gi|41531174|gb|CF677015.1,gi|41546667|gb|CF692508.1,
                     gi|41546673|gb|CF692514.1,gi|41551495|gb|CF697336.1,
                     gi|41551504|gb|CF697345.1,gi|41556611|gb|CF702452.1,
                     gi|41556624|gb|CF702465.1,gi|41556666|gb|CF702507.1,
                     gi|41556673|gb|CF702514.1,gi|41567239|gb|CF713080.1,
                     gi|41567242|gb|CF713083.1,gi|41567445|gb|CF713286.1,
                     gi|41567762|gb|CF713603.1,gi|41567770|gb|CF713611.1,
                     gi|41568171|gb|CF714012.1,gi|41568180|gb|CF714021.1,
                     gi|41571763|gb|CF717604.1,gi|41572071|gb|CF717912.1,
                     gi|41572717|gb|CF718558.1,gi|41572732|gb|CF718573.1,
                     gi|41575684|gb|CF721525.1,gi|41575700|gb|CF721541.1"
                     /transcript_id="XM_566545.1"
                     /db_xref="GI:58258264"
                     /db_xref="GeneID:3253740"
     CDS             join(477225..477348,477404..477724,477786..477967,
                     478030..479040)
                     /locus_tag="CNA01790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566545.1"
                     /db_xref="GI:58258265"
                     /db_xref="GeneID:3253740"
                     /translation="MPEDLSFLDQLEDWLEAQIPNNLHDLPSKMFDTVEKLTNDLFET
                     LNVHGPPSISIPFPPFGAKEVPTVPLPPPPPPSSTISCCQNAVHRSGRFVKTHPIAVG
                     AVISVGLGFTGLLAYHGASFFAKGRKEKRQFGVNGVVRDGMLKEAIVILAPSPMPHIL
                     VPLAASLLRAGYIVLIAVTNNRDAQSLEKRLNGLEERSALRVLVYDPDDPSTFPPFHR
                     SLLATLTLRFPVSGRYTAGDPYNPQPSQLAHIHAFLSLYPLHPSPPSQPGALPALPTL
                     LAPNPDGSKPMLVNFYPSGSVPTTPVTFASQILSSNHVLLGRNLAASSGARVISIYIG
                     DVDLPTLPAILSHGKTLSRRQIAKERLAQVASPQQKVSIIRDYIYGSFNAVFSVVIGS
                     LGLGTAVRDYKTFEKGVLKAIKSSHGQLFFIGQRSFLPFFVAHLPIPSSFLPPLLAYL
                     PAMPSCTGPAASEHVKSAGYKNKTSVAKQGATSRQDANGEKERLSASEGSEHEAGEDL
                     ISSVHTGTSTSSRGVGSESSEGASGLGGSWVGLEDAV"
     gene            479514..481520
                     /locus_tag="CNA01800"
                     /db_xref="GeneID:3253581"
     mRNA            join(479514..479945,480009..480044,480098..480266,
                     480325..480587,480645..480727,480781..480857,
                     480909..481265,481326..481433,481499..481520)
                     /locus_tag="CNA01800"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41563433|gb|CF709274.1"
                     /transcript_id="XM_567095.1"
                     /db_xref="GI:58259364"
                     /db_xref="GeneID:3253581"
     mRNA            join(479514..479945,480009..480044,480098..480266,
                     480325..480587,480645..480727,480781..480857,
                     480909..481306)
                     /locus_tag="CNA01800"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539820|gb|CF685661.1,gi|41539827|gb|CF685668.1"
                     /transcript_id="XM_567094.1"
                     /db_xref="GI:58259362"
                     /db_xref="GeneID:3253581"
     CDS             join(479575..479945,480009..480044,480098..480266,
                     480325..480587,480645..480727,480781..480857,
                     480909..481217)
                     /locus_tag="CNA01800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567094.1"
                     /db_xref="GI:58259363"
                     /db_xref="GeneID:3253581"
                     /translation="MLHRRHPISHPVPPSPSRQHRDYLGTTSTTGIPIPPTSSRTSTP
                     GRPASNPVHWELDAREQTSLYDHGLNRPGRSSMSKGTDIGWDTAESRKNLTNRMGMGL
                     RNVRHGMKDALRMDRSVNLVWHDRELKTLIIKSMLINLLSLLLLSLSSLIFSPILVHP
                     ASTDMQTRTKAIGMWYNILLSWPVFVVCFWVNANWGPGISKRAQVLLHPTYRHQPSVW
                     GTPSKSTQMATGYTAKLFSSATRVLLISDFTLVSRLIGAIPLIGRPCALAYMSIISSY
                     YCFEWTFSTKNWSLDYRIEYLQARLAYMFGFGLPVTLMTSFGPPLVTMAIFALVYPFF
                     VIQALQSSPPRNATLLPLNPSSRPLTPSFRVKSSNALPADPFGEPTYCDLEAPSGREK
                     EWEFKVPIFWFANHALRGLKWLEDAVAKDRSGRKDIFGLGSQG"
     misc_feature    481962..481995
                     /note="AT_rich"
     gene            484380..486759
                     /locus_tag="CNA01810"
                     /db_xref="GeneID:3253592"
     mRNA            join(484380..484398,484454..484623,484685..484863,
                     484917..485298,485355..485398,485451..486759)
                     /locus_tag="CNA01810"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534742|gb|CF680583.1,gi|41534747|gb|CF680588.1"
                     /transcript_id="XM_567096.1"
                     /db_xref="GI:58259366"
                     /db_xref="GeneID:3253592"
     CDS             join(484522..484623,484685..484863,484917..485298,
                     485355..485398,485451..486435)
                     /locus_tag="CNA01810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567096.1"
                     /db_xref="GI:58259367"
                     /db_xref="GeneID:3253592"
                     /translation="METMQDIIDNNALVRDSVSFRISTKFATAPINLALACRKINKAL
                     TGPKAKRRTAVNVDLVKQAWEALERCWEEFDDLLKVGPNHKYILGEEVARFADGWKIF
                     LFEAQNVIYNNLEARRQKLSNTAVQLTARITESASPSTANSPETMHADLVTIDHLLDI
                     AKSKCEVKTRQIVDLVKTYVGTRFFEWDASLVRDGTYYAAMWLVKQGGSSEDVAVCIQ
                     ALNELRWAHAKAWERSADLRKEWLEKHVVDDPQEQNKTWDSVITNLEKLGEDKTTTEA
                     PQRQHEVLEQPNMPRHNTCNPGIGNEKSQSQLQDNSKRLKQTHASLDHHIHQQQQQPH
                     SSQIYAYPDSQHHLQQSLPNSYLDQRHVDIIPPGSNTSYSSQPSGISGPQYQTEGNHT
                     PTTDSTFTSSHTTLPINDTKVNVMDMSSSYHHVNMREGLFEDDSFHSSHGAQQTQMYE
                     EAETRNGSVPSHHGLVGHGHGNIMLGENGYRAYEKFDGQTGYMAAEGYPQSRQIHQVY
                     DYHHDPSHLHPHVQDAHTQGTGQGDYNSYQHPTEELQGQFVLQYDGTHLFTPYSN"
     gene            complement(486751..491945)
                     /locus_tag="CNA01820"
                     /db_xref="GeneID:3253806"
     mRNA            complement(join(486751..487254,487304..487359,
                     487412..488963,489015..491333,491708..491945))
                     /locus_tag="CNA01820"
                     /product="transcriptional activator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533526|gb|CF679367.1,gi|41534036|gb|CF679877.1,
                     gi|41536955|gb|CF682796.1,gi|41551841|gb|CF697682.1,
                     gi|41551850|gb|CF697691.1"
                     /transcript_id="XM_566547.1"
                     /db_xref="GI:58258268"
                     /db_xref="GeneID:3253806"
     CDS             complement(join(487080..487254,487304..487359,
                     487412..488963,489015..491104))
                     /locus_tag="CNA01820"
                     /codon_start=1
                     /product="transcriptional activator"
                     /protein_id="XP_566547.1"
                     /db_xref="GI:58258269"
                     /db_xref="GeneID:3253806"
                     /translation="MDKLPWRTTSGGKKGPFTVDAGGGQGVYNGKVNSARVPERPPSA
                     ASSRLSNPPTPAMSPSIPINRHNFPYPPQGYQSFSQPSSIGHSGSGSFHGNDHSSIAT
                     TPTPMTPIDIVGVSSSVPRNSFSQGVQPSSHSQLSSSRSKRSVPMISTTPVEPPPSSW
                     GASFPDQQGENDANSKPFDWTSLPNPANWFSPLGTVQKTTCNDDPIDPAVFASLADLV
                     ERNQGKMNDSASIDFMGALNANTSPKAARSTAHSTSHPGGTSLLSRRLQHQQQTSSDG
                     QNIHSSSQSSANSPGILHNSGGLSGFPGPQQQYNHVTFAQPGKVSKGASNQPLTPWPL
                     SERAMGSSETPVTTPGGSDFGVNSPFEMGITGSWQQESMAKHELQGSNSSSRYPPIAP
                     RRREAPQHPAPVFQTHRGSVPSSEHASRAGSEAPHDGPMPGGVSLNGLPPLPNGLSLE
                     HLAQYGAAGLEMALRVGMGIGMGLSQQTQQTKQTVDVASPPWPLTKSVPTPSFSQNPS
                     SPEASSRKGRKDSNIVSDILQDDFLTARVPSTPLMTPPLNGFGSFPVTRRPSQSDATS
                     PLPEVGPPEQVAEKDPLAAQVWKAYARARDTLPNGQRMENLTWRMMHLTLKKKEEEQA
                     AKEKEEREKEDKEAAEKEAAEAAAAATAAAATAAAAAAAAELPPVEERRGRTKGKSRI
                     VGFAGATSSNSQSPNGMDIDWRAASRSRSRIPMDIDWRASSRSRSRSAAPFRNPFSEA
                     HAHHLLAAGGTPIAEMGQYMAGHGSLNIHAANAHSTSHHGNQNQYHHASSLPGPSSMM
                     LQSLSQLPEKEGEQDEVQQAVEHMNGADLYPASAPQNRSALEHLQMSLASGLNPSEEA
                     TSNLPGINGPGLYTHSQENFHPHYGFLPRRVRKTSFDHTVKLLEEGEPSSSPQFMSNP
                     RKRHAEASPQGGANSPLPEGDSGFPTSNFTFSFPQSYENFFDLAAASATPSGTQENND
                     VNHEGDDDLADLTDWASHPVTADTSAFGSPSAFGHIEPGMSLPSMPQATGDNPFDFQQ
                     LMHLYLNANSSASPFTHINPSQVLGAVPGQAANEFSPSAVSPQSGAPTPSNNSSGNNI
                     RPLPKAVGGKAVDNRQMPPPNRSSSTPNLAALRMSSQSESSKHGRTASTNASGNAGSG
                     SSKGNKGSSGNNKSRPGTPTSENEGGPGSIMPSGENPTMCTNCQTTNTPLWRRDPDGQ
                     PLCNACGLFYKLHGVVRPLSLKTDVIKKRNRAGPGPKESNPSRKNSVASSKNVSVRSK
                     PSSPTVASSANSGGGSKKARHASDAPVE"
     repeat_region   489112..489179
                     /rpt_type=tandem
                     /rpt_unit_seq="ctg"
                     /satellite="microsatellite"
     misc_feature    489194..489257
                     /note="CT-rich"
     misc_feature    493662..493704
                     /note="CT-rich"
     gene            493722..494793
                     /locus_tag="CNA01830"
                     /db_xref="GeneID:3253789"
     mRNA            join(493722..493891,493942..494230,494281..494793)
                     /locus_tag="CNA01830"
                     /product="expressed protein"
                     /transcript_id="XM_566549.1"
                     /db_xref="GI:58258272"
                     /db_xref="GeneID:3253789"
     CDS             join(493772..493891,493942..494230,494281..494606)
                     /locus_tag="CNA01830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566549.1"
                     /db_xref="GI:58258273"
                     /db_xref="GeneID:3253789"
                     /translation="MTQSPFSTFGYQTAMPSGSSFKPKRKRMSWGPEEEENGAKHMRM
                     LSPTLNHPGFPLPELVADHSNNASDDDQVMDMDQDMPDSSSAVGPPSPAEGYAQNSYS
                     YGASGSGGFGFGPGAEEDEFEMDMMDDMGTIQSKNYPSLTPHPNPHHFSNPGNNHNLR
                     GTSPLAAQPFSTALPAPPARGIFQPTVSGPLAPDASDIERARSQHGPWCQSIPKLIMS
                     EYPDASGRRSMWTVCGDCGACEKTQD"
     gene            complement(494775..495681)
                     /locus_tag="CNA01840"
                     /db_xref="GeneID:3253820"
     mRNA            complement(join(494775..495155,495215..495269,
                     495324..495379,495429..495681))
                     /locus_tag="CNA01840"
                     /product="expressed protein"
                     /transcript_id="XM_566551.1"
                     /db_xref="GI:58258276"
                     /db_xref="GeneID:3253820"
     CDS             complement(join(494827..495155,495215..495269,
                     495324..495379,495429..495609))
                     /locus_tag="CNA01840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566551.1"
                     /db_xref="GI:58258277"
                     /db_xref="GeneID:3253820"
                     /translation="MSESSPKDTLSALNESLDALEAALAPLEAKPWSQTVEKLSPLER
                     TKMDVLGAYLINDLVWVYLKTKGIDPTKHDVTAELERIKTYYSKVSSAEGHEEIRPKV
                     DAAAAHRFVSSSIPRTQHLPPTTSAELAANQRALRVAEEEEEESIRRLGKPSRFRHIQ
                     ERGQLKLIPGQEVETIGDEDVMIGGEDGQREAENFLREFANEIEGR"
     gene            complement(498616..500840)
                     /locus_tag="CNA01850"
                     /db_xref="GeneID:3253769"
     mRNA            complement(join(498616..498800,498857..499198,
                     499266..499447,499512..499571,499628..499811,
                     499871..499884,499942..500131,500224..500466,
                     500524..500840))
                     /locus_tag="CNA01850"
                     /product="alcohol dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530177|gb|CF676018.1,gi|41530189|gb|CF676030.1,
                     gi|41532609|gb|CF678450.1,gi|41532622|gb|CF678463.1,
                     gi|41536403|gb|CF682244.1,gi|41536411|gb|CF682252.1,
                     gi|41541350|gb|CF687191.1,gi|41541355|gb|CF687196.1,
                     gi|41544626|gb|CF690467.1,gi|41544633|gb|CF690474.1,
                     gi|41546854|gb|CF692695.1,gi|41546863|gb|CF692704.1,
                     gi|41548322|gb|CF694163.1,gi|41548335|gb|CF694176.1,
                     gi|41558144|gb|CF703985.1,gi|41576361|gb|CF722202.1,
                     gi|41576372|gb|CF722213.1"
                     /transcript_id="XM_566553.1"
                     /db_xref="GI:58258280"
                     /db_xref="GeneID:3253769"
     CDS             complement(join(498678..498800,498857..499198,
                     499266..499447,499512..499571,499628..499811,
                     499871..499884,499942..500131,500224..500466,
                     500524..500745))
                     /locus_tag="CNA01850"
                     /codon_start=1
                     /product="alcohol dehydrogenase"
                     /protein_id="XP_566553.1"
                     /db_xref="GI:58258281"
                     /db_xref="GeneID:3253769"
                     /translation="MPPPASRASIVRLLSLTANQGCRGCGRTHSVLDHAHNHGHTQSH
                     VPLGLRGMATPVDLPIRGGPPPGNTDYAFEMAASNLRFGAHATSEVGMDFANLIKEMP
                     AVDRSQAKIGVFTDPNVAKLPVIEIVEESLLRAGLNFVMWDKCAVEPTDKSWQEAIDF
                     SRSSHLTHFLAVGGGSSMDTAKAANLFTNYPKADLFEFINAPIGKGTPITKKLSPLIA
                     IPTTAGTGSETTGTAILDIPSRKFKTGIASRALKPTLGIVDLLNTTTCPKEVAIAAGL
                     DVLFHSLESWTAVPYHQRTPRPANPINRPAYQGSNPISDIFSKWALETTVKYLPRIAR
                     DPFGDEEARAQMLLAASTAGIGFGNAGVHMCHAFSYPISSLNKGRPKETQYHHPSYNP
                     DVPLIPHGVAVSLTAPAVFNFTAPSSPDRHREALLVFLGKDRAHEATGLKDEDLGPKL
                     SEEIRRFLDIVEVPRGLSKVGYTGNDITSLVDGCLPQRRVLDLAPVLAKNNNAEEREQ
                     LAHIVELSMNW"
     gene            complement(501049..502641)
                     /locus_tag="CNA01860"
                     /db_xref="GeneID:3253824"
     mRNA            complement(join(501049..501541,501595..501978,
                     502028..502328,502381..502641))
                     /locus_tag="CNA01860"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536267|gb|CF682108.1,gi|41541632|gb|CF687473.1,
                     gi|41545920|gb|CF691761.1,gi|41545926|gb|CF691767.1,
                     gi|41559162|gb|CF705003.1,gi|41559164|gb|CF705005.1,
                     gi|41561725|gb|CF707566.1,gi|41561736|gb|CF707577.1"
                     /transcript_id="XM_566555.1"
                     /db_xref="GI:58258284"
                     /db_xref="GeneID:3253824"
     CDS             complement(join(501082..501541,501595..501978,
                     502028..502328,502381..502570))
                     /locus_tag="CNA01860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566555.1"
                     /db_xref="GI:58258285"
                     /db_xref="GeneID:3253824"
                     /translation="MAPLDVFITTWNTGLQGSKAQSQDLTSWLLPVLRNASNPELPEG
                     FIPDLYAIGIQELLPLHLAMAGLTEPVLLALTSRIENLLSAHASSLSPNKTPERYSLV
                     ARVAHVGNALWIFSRDSTMDGRIGKPSTATLGLFWGGMGNKGAVGVRLPVRRGKIGGW
                     ENLTFVNAHLEAYDHNIPRRNAQYQRILSSLVFNSTDPLTTSQQIFDTSHLFFMGDLN
                     YRLSKQPPPGALQENNMFGNVLELEKSRMGMLDTDTLRQEQREGRAFGGLREGDLTRF
                     APTYKRIVGQVEGYSKKRIPGWTDRILFASHTDPPHLFSPEASLDPVPSNVADTTTIL
                     HFNSTIELVISDHKPVHAILSLPEVSHETPSPHLAPTLPPAPSPHHPRPLPTQREVLL
                     IEKFFGTLLDRLVGWPWCIIVLLGFGNTRTGMGVSAFVAMIWGIWWSGIYSG"
     STS             502827..503703
                     /standard_name="Hind32"
                     /db_xref="UniSTS:470883"
     gene            503015..506305
                     /locus_tag="CNA01870"
                     /db_xref="GeneID:3253797"
     mRNA            join(503015..503078,503140..503168,503222..503272,
                     503322..503542,503596..503737,503793..503966,
                     504022..504353,504406..504715,504765..504983,
                     505037..505897,505956..506048,506106..506305)
                     /locus_tag="CNA01870"
                     /product="gamma-adaptin, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538421|gb|CF684262.1,gi|41541012|gb|CF686853.1,
                     gi|41541020|gb|CF686861.1,gi|41545888|gb|CF691729.1,
                     gi|41545897|gb|CF691738.1,gi|41547851|gb|CF693692.1,
                     gi|41547861|gb|CF693702.1,gi|41556365|gb|CF702206.1,
                     gi|41565500|gb|CF711341.1,gi|41565504|gb|CF711345.1,
                     gi|41571465|gb|CF717306.1,gi|41571472|gb|CF717313.1"
                     /transcript_id="XM_566557.1"
                     /db_xref="GI:58258288"
                     /db_xref="GeneID:3253797"
     CDS             join(503054..503078,503140..503168,503222..503272,
                     503322..503542,503596..503737,503793..503966,
                     504022..504353,504406..504715,504765..504983,
                     505037..505897,505956..506048,506106..506213)
                     /locus_tag="CNA01870"
                     /codon_start=1
                     /product="gamma-adaptin"
                     /protein_id="XP_566557.1"
                     /db_xref="GI:58258289"
                     /db_xref="GeneID:3253797"
                     /translation="MSGHYNLKALIKAIRSCKTLADERSVIQKESAAIRTSFKEEDTF
                     ARHNNVAKLLYIHMLGYPAHFGQIECLKLVASPRFSDKRLGYLGIMLLLDENQEVLTL
                     VTNSLKNDMNHSNVYAVGLALCTFANISSEEMSRDLSNEVEKLLGSSNAYIRKKAALC
                     ALRIIRRVPDLLDHFTSKAKSLLQDRNHGVLLAGITLVTEMCEINEDVCAEFRRATGL
                     LVKHLKNLVSTGYSAEHDVLGIADPFLQTKILRLLRLLGKGDVASSETMNDILAQVAT
                     NTDSSKNVGNSILYETVLTVLEIEADSGLRVMAINILGKFLANRDNNIRYVALNTLNK
                     VVSMDTNAVQRHRNTIIDCLRDGDISIRRRALELSYALVNESNITMMTRELLSFLEVA
                     DNEFKLGLTTEICLAAERFAPNKRWQIDTILRVLKIAGNFVRDEILSAFIRLVSHTPE
                     LQFYTAQRLYAALSSDLSQESLTLATVWVIGEFGDILLQGGTIDDGDKVKQVSDSDLV
                     DLLEHVLNSPYADSLIRQFVMTALAKLSVRISELSTPNQNTLQDRIVVILASFSSNLE
                     LEIQQRAVEFGSLFAMREVKMGVLERMPPPEIKATIMGTVSERKPVGSTRTDKDMIVD
                     LIGDDSAPSTAGLPVAATGPSTQDLLADIFGTGASDIASPGAGSPTAPRSNANDIMSL
                     FNTTPAAAASPPVTSSLPAASTGGSLFDLVSPSPTLSSAPAPAPAPTSAAKPQLQSYT
                     AYDKNSLKITLTPKVSPAQPGVVQILARFTTNGTEKIEGVNLQVAVPKTQQLQMQAMS
                     SQEIAPGGVETQQMRIHVPAGATIRLRMRISFTRAGQSLTDQQDFAGFPAGLTGSK"
     gene            complement(506411..507344)
                     /locus_tag="CNA01880"
                     /db_xref="GeneID:3253752"
     mRNA            complement(join(506411..506748,506800..507025,
                     507082..507171,507223..507344))
                     /locus_tag="CNA01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_566559.1"
                     /db_xref="GI:58258292"
                     /db_xref="GeneID:3253752"
     CDS             complement(join(506488..506748,506800..507025,
                     507082..507171,507223..507299))
                     /locus_tag="CNA01880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566559.1"
                     /db_xref="GI:58258293"
                     /db_xref="GeneID:3253752"
                     /translation="MSAPEATGTRQRTNKVETPTNENQNPASLSANPNKKVPRNKPHV
                     KPPFVDMSMNKFLTYLVLSLFLLFAFYMWRFTVWAHQAGGYWALITGHHMSPAEVAAK
                     QAASSASASSSVASSTASATTSGHPQKIKAKPTQDAGDGDDNIQSQIFNLASALGITP
                     AELSSAIRPLVDPSVPNPAEKAKQDAQLLQAKMASQQHENENQEGSVLDMLGEALLD"
     gene            507664..510353
                     /locus_tag="CNA01890"
                     /db_xref="GeneID:3253829"
     mRNA            join(507664..507925,507981..508192,508244..510114,
                     510176..510353)
                     /locus_tag="CNA01890"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537041|gb|CF682882.1,gi|41538886|gb|CF684727.1,
                     gi|41538890|gb|CF684731.1,gi|41569754|gb|CF715595.1,
                     gi|41569763|gb|CF715604.1"
                     /transcript_id="XM_566561.1"
                     /db_xref="GI:58258296"
                     /db_xref="GeneID:3253829"
     CDS             join(507740..507925,507981..508192,508244..510114,
                     510176..510237)
                     /locus_tag="CNA01890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566561.1"
                     /db_xref="GI:58258297"
                     /db_xref="GeneID:3253829"
                     /translation="MAEDHNEGVSNTPLDLLINAIAGNHYPIPHDHTHEHDHDHDVSL
                     DHLLSQRKDSAEDSQQHASSHKRARSQEVVSSRQRKVPKPLGSQAMFYPGFAPADKAP
                     GSLDENNSHRFNTLEVWHPTTGQKSYGKERRMLNPPPILRLSGPASSCISSITMVSVV
                     SPNITQPVAICAPQTHHMGRPPDITPHLGTPGVEDKKKERREEQKKLRTAALNAGFAA
                     TLPKNRNATDLKDRTLLKDGLTFPGLWIGEEAGKMKEFRLELKIYAEPTEKGLSSPST
                     QDFAQSSYHLGNPDNDHETAHTFADMLEPPSMDALQPLAEAVQQSSQQGHDTLSEHFP
                     EVEPSLAATNLHNDNDAENPGNSPLPITQATTEEQPLGSFLSGPIRIVSKPSRKTSKT
                     RSLAICFPRDSVFSLWTRIHGQTVRTKWMNLEANFNGHGPRLTSRTAKWTPFRFEVLD
                     HANAPFAYRTARNKFDETDHLEGQQLTYGSIVVLVDLQTGVKSDPVKVVRVESGKSVV
                     GQYDGQPVSELQRIGLVRTIDGQEDMSEGCRWYLSAPGARIGGGELSAESAPGIRMRR
                     QRANAKAASQLKELNEERGKEKEIEGTSHDEPHLTSSFLQDPQTLSAIENVSGSSTET
                     NHNQQSVLSIELSLPEGVHSADTFDHTDHPPVIDPSFENMAPLVDSQQQTKNPKGQSS
                     FQRRSNKTRRLALAAAVLAEDDDNAVQTLLSWVKAERSEEVSSGADGLDTQPDEVRSV
                     IVDSVADWMSWTIGGAASFSFTFKPTEHNEERVEAP"
     gene            complement(510433..>512806)
                     /locus_tag="CNA01900"
                     /db_xref="GeneID:3253759"
     mRNA            complement(join(510433..510808,510862..511546,
                     511612..>512806))
                     /locus_tag="CNA01900"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41576061|gb|CF721902.1,gi|41576072|gb|CF721913.1"
                     /transcript_id="XM_566565.1"
                     /db_xref="GI:58258304"
                     /db_xref="GeneID:3253759"
     CDS             complement(join(510514..510808,510862..511546,
                     511612..512806))
                     /locus_tag="CNA01900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566565.1"
                     /db_xref="GI:58258305"
                     /db_xref="GeneID:3253759"
                     /translation="MSTLDRAQEKLKNGWGKEEREAPLPMRPWPNHIGGYCAPASDPR
                     WKGKRRKPTPAVKDDGFWEGVLGRTSTPVYQGITSKAYEIPIFPHIAKHPSFLSIPSK
                     CSSSSSNRALWSDRYRPLRASEVIGNEVEATYLRDWLSTLAVGGQHAKGSKIVRQVVK
                     KPRSALVDGFIVDDLGLYGDTPNSEEDGEDEFPHLEDLPDPPISHDLNARPDKYPSLA
                     SHLANTILLTGPTGSGKTAAVYAAAHELGWEVFEVYAGMGRRTAANLMKWVGELGKNH
                     TVLPQDGKSQGTINDNEKKGKSRGRGKGLSSFFDKGSFQSSKVSLSRGIASDPIDIES
                     NGESDKIPVTEAANVSGGEPGIKFKESLLLIDEADILFEEEGSFWPAVIALASESRRP
                     IVLTCNDHQRIPRIQLPLQAILQFHPIPSFIALPYLQAISSQESQLRGKPCNPCVETI
                     FRGAIHQTPEKDVLSDQCLPPNGHERIPFFDLRQAMMQLQFGLTDQILQRGCAKKYGT
                     PDEDEKKDDLQLMTERMEVISFSDAFIDIRPRVLMEVSSSSISNKYITSADASLYKLY
                     DVDKLQPTSDEELDVAALLKPEMYETYPILAMIDRSSDIAGSLVQAVGGHLPPFGDLG
                     LARAKYIRSMLPLLDPLIPLSEPLLPHSTLFLYTLPTMQSIISADDIFEALEQQAVDR
                     GDEKINPRTGKPMRRVAGYTYTRYWDLEGAENEARRISRLIW"
     gene            complement(513936..516668)
                     /locus_tag="CNA01910"
                     /db_xref="GeneID:3253717"
     mRNA            complement(join(513936..514179,514231..516282,
                     516341..516422,516474..516517,516575..516668))
                     /locus_tag="CNA01910"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535817|gb|CF681658.1,gi|41535822|gb|CF681663.1,
                     gi|41539818|gb|CF685659.1,gi|41539832|gb|CF685673.1,
                     gi|41548460|gb|CF694301.1,gi|41548474|gb|CF694315.1,
                     gi|41550455|gb|CF696296.1,gi|41566413|gb|CF712254.1"
                     /transcript_id="XM_566567.1"
                     /db_xref="GI:58258308"
                     /db_xref="GeneID:3253717"
     CDS             complement(join(513997..514179,514231..516282,
                     516341..516422,516474..516517,516575..516640))
                     /locus_tag="CNA01910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566567.1"
                     /db_xref="GI:58258309"
                     /db_xref="GeneID:3253717"
                     /translation="MAKRTADNQKTKDDVEEEGNEEPGIRAAPLAAVEGRPVRGLPKR
                     RGLGGASAPTPTPAPAPVADIPPAPTSGTSSPVPPSGTSNAFTGFSFGASTSSTPSFS
                     FGQSSASSPASTTPAAAPKPFAGFSFGSAAATGSSTSAPVTEPTGTATPAFSFSQKPV
                     EPTQTKALQPSKPFAGFSFGAPAAAAPSTGDNASEPPRFSFGAKPTSDVTKEVPAHEP
                     IKSKAAPFSFGTASSAPVASGSKEATQVQGFSFAKTLIATATSTTSKPTLTEASETAP
                     AKPSFSFGPMATTFGTGTAPTSNSAPPAPAAEAAPAPSTSSSSSESETSYYTSLRGLN
                     QSFLTFFSTTIEKDQFIDLTTVLPKLLVQYEEHLTGIETKAGWKPDATSKDKIETTAA
                     PEPPKATGFTLPKAPSAGSFSLPKAPSTSSAAPATGGFTPSAPATAPSKSSIFSFPAA
                     DTTPKKSSDEVNKIVSEAIADKPEEEKMAEKTGFGFSFGTDSTKPKESSAFKFEAPKK
                     STSLFASSPATPAKSAAGNEAAPLGKFGPGGSQPQLSFGAKAGTSPAANTTSSFNFNV
                     GKPSTPAGAGTSFSFGTSSSPSVAAGASTTSASVFGGTSTRSAPTFSFGATTPSASSS
                     SSFVFGKSPVVQPSGDAPKFGASLQPFGSTSSVSTPAPAVNESNTEGEEATEPSSPSK
                     NLASVAGAGEENEDTVIEQRGKLNRLEDGEYKLEGLGQFKLKRTKNEEDRKRRLLMRT
                     DGNGNVILNMAVKSTFNPSVEGPYLKFLGFNMDGKPTPYALRVKNAEAANTLLEGLKK
                     EVEEIKDDKS"
     gene            516864..519423
                     /locus_tag="CNA01920"
                     /db_xref="GeneID:3253733"
     mRNA            join(516864..517961,518019..518258,518311..518954,
                     519002..519067,519122..519303,519369..519423)
                     /locus_tag="CNA01920"
                     /product="cactin, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529985|gb|CF675826.1,gi|41529993|gb|CF675834.1,
                     gi|41546554|gb|CF692395.1,gi|41563014|gb|CF708855.1,
                     gi|41575041|gb|CF720882.1,gi|41576349|gb|CF722190.1,
                     gi|41576356|gb|CF722197.1,gi|41576679|gb|CF722520.1,
                     gi|41576685|gb|CF722526.1"
                     /transcript_id="XM_566569.1"
                     /db_xref="GI:58258312"
                     /db_xref="GeneID:3253733"
     CDS             join(516876..517961,518019..518258,518311..518954,
                     519002..519067,519122..519303,519369..519406)
                     /locus_tag="CNA01920"
                     /codon_start=1
                     /product="cactin"
                     /protein_id="XP_566569.1"
                     /db_xref="GI:58258313"
                     /db_xref="GeneID:3253733"
                     /translation="MPRSPEHDSKFEKDSGRERAGDRRDRDRDRYRDDYDRRESSSRR
                     DESERNRDRDRRDKDDRGQGKDRERERRRDKGRGDYYDSDRDRDRDRDRRDRKRERSR
                     SRERSYKKERKHRDSRSPSPSSKTRRKEAKAAAKAAAKREAELEQSRALAELSMYSAT
                     DNPFHDANLGEQFQWHKKRDKEKKAGLTAEEIARKDALRRQEAKEELERLNKRRADRE
                     VELQLREEEETRQRRLAEDAAMAEWIAKEDDFQLEQSRRRAGIRLREQRAKAIDFLAI
                     NLRFTDPKSSHQTAAIGALTNPRASEIEREEEEEGWGWADAGFEFEIDEPWKIFENLT
                     LDDCVELEQDIKMYLSLEKSPINIEFWQAMQIVCEHYLSQLRDPEHAVGGPLSDPEVE
                     EATNKIVSGLSLQRLVELENKANGLLRSGQPVDSDFWDLILKKIHVEKAIAKLNSIHE
                     IVLKNRLEQFKRRQREDAAKVQAELGGVLVSNENAFGGDIRADAGPVPTGGDEADDEE
                     EDEDDYIEDYDREMSPPIAEPRTMGLDERRLPIVNEEDELRALFSARHSITSSNFIPT
                     QARASAHTSQSISRPSAADLEAERIYREEAEREARDLGSDESEEEFGDLDAGLEVPST
                     YDWSDRYRPRKPRFFNRVHTGYEWSKYNQTHYDTDNPPPKVVQGYKFNVFYPDLIDKS
                     KAPTYYLKSIPDDPDTQIIVFTAGPPYEDIAFRIVRRQWEYSHRKGFRSTFDRGVLQL
                     YFNFARTFYRK"
     repeat_region   516909..516974
                     /rpt_type=tandem
                     /rpt_unit_seq="cagaga"
                     /satellite="microsatellite"
     misc_feature    519725..519745
                     /note="AT_rich"
     gene            520400..522844
                     /locus_tag="CNA01930"
                     /db_xref="GeneID:3253715"
     mRNA            join(520400..520782,520845..521132,521185..521845,
                     521902..522239,522298..522844)
                     /locus_tag="CNA01930"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544473|gb|CF690314.1,gi|41544479|gb|CF690320.1,
                     gi|41547836|gb|CF693677.1,gi|41547843|gb|CF693684.1,
                     gi|41551915|gb|CF697756.1,gi|41551923|gb|CF697764.1,
                     gi|41571397|gb|CF717238.1,gi|41571403|gb|CF717244.1,
                     gi|41572182|gb|CF718023.1,gi|41572187|gb|CF718028.1"
                     /transcript_id="XM_566571.1"
                     /db_xref="GI:58258316"
                     /db_xref="GeneID:3253715"
     CDS             join(520565..520782,520845..521132,521185..521845,
                     521902..522239,522298..522709)
                     /locus_tag="CNA01930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566571.1"
                     /db_xref="GI:58258317"
                     /db_xref="GeneID:3253715"
                     /translation="MNNIRQDSGPSPTPESSFGSPRRRASSPRPHRPSADGLLFNNER
                     QVPPPIYLRNSSPRGLSSRGEVKIHIPAWGIAFVRPPRPLEVHPLETTPNHPIRPPSK
                     DTVLSGGLEIIMKERRRVKAISVGVQSVCRLYMGQSRGWEEDGIFERGVEVLSGDEEG
                     IWLEKGSQSFSFSILLPGTLATTDSHTFGRVSYIITARVEGIESSTSSFSSIFKFKTL
                     SNSFPSSTSGIPNIADFERVIARSNKFAADVALGRARSASMSRSGTSDRVSTPEPGID
                     RSSIDDQAVSDVIDSGSPPFDGLYTRRHSSDLSPVSTPLSLSSSLPDTSFRPNRNGNT
                     QTEKAGWLEGDLKGSRELSIYAVSPSTGGVCQLDVRKEGSVDGLGSWKFNAAAEVFSV
                     SSVILLSISIPAPSAKTTIFLARLVLTQSYTITSPRTPNVPPSSPESQQKFVLYQVGR
                     QHKQGEVAPGRSADALWRGIEAAGAGGEEGWKIKAVARIPGHDKIRPTTYDGTITPIK
                     VSHELTLQLYYSMDGLSVTGQCVEGPGALRLMQVRIPIFLPSCHCVSDALHLPTYNRS
                     NTSPWETIDEFMASQPDDRACMCGWTFAELGEAALRKMRMTERDEAEEHLRQLATEGN
                     KGRREDYDNGDAVI"
     gene            complement(522835..>523446)
                     /locus_tag="CNA01940"
                     /db_xref="GeneID:3253684"
     mRNA            complement(join(522835..523174,523231..>523446))
                     /locus_tag="CNA01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_567146.1"
                     /db_xref="GI:58259466"
                     /db_xref="GeneID:3253684"
     CDS             complement(join(522917..523174,523231..523446))
                     /locus_tag="CNA01940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567146.1"
                     /db_xref="GI:58259467"
                     /db_xref="GeneID:3253684"
                     /translation="MPSLESAGSFSTLSEATASGASTATHSSTGSASQSATSTSYVYS
                     YATSKIVKVAVATGVIVLCLAAIVLFFKVSSWIRLRQRLRRQRLLTLTLKSEQQANAY
                     EIAAWADEPSTVPARSVGIREDKEKKSKKEREELRAWKRGGANAWALQEWEGVAA"
     gene            <523921..524743
                     /locus_tag="CNA01950"
                     /db_xref="GeneID:3253753"
     mRNA            join(<523921..524058,524135..524172,524316..524390,
                     524614..524743)
                     /locus_tag="CNA01950"
                     /product="expressed protein"
                     /transcript_id="XM_566573.1"
                     /db_xref="GI:58258320"
                     /db_xref="GeneID:3253753"
     CDS             join(523921..524058,524135..524172,524316..524390,
                     524614..524698)
                     /locus_tag="CNA01950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566573.1"
                     /db_xref="GI:58258321"
                     /db_xref="GeneID:3253753"
                     /translation="MVRSALASLARPLSRQSTQSTSLSAKRYASHGPTYNPPSGYLFG
                     ERPPKDGKRVKESWENIYYVGMFGGMVFMGVVYAYKPDTSIQSWALKEAKERLEARGE
                     EYQYKPKSA"
     gene            525715..527150
                     /locus_tag="CNA01960"
                     /db_xref="GeneID:3253765"
     mRNA            join(525715..526241,526307..526403,526454..526791,
                     526839..527150)
                     /locus_tag="CNA01960"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41557985|gb|CF703826.1,gi|41557990|gb|CF703831.1"
                     /transcript_id="XM_566575.1"
                     /db_xref="GI:58258324"
                     /db_xref="GeneID:3253765"
     CDS             join(525760..526241,526307..526403,526454..526791,
                     526839..526950)
                     /locus_tag="CNA01960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566575.1"
                     /db_xref="GI:58258325"
                     /db_xref="GeneID:3253765"
                     /translation="MACRPSLYALSRLSFIPNTRPFTSAHFPRQKSTSRQRLYALLGL
                     SLSLPAGYYFFQSSPSLSPSVYSDQELKSSKSLTPFHKLVTIKIPSSSYGFFDKPYRL
                     DGEVADVKGGEVVIQHVMVKSPDIQIERPYTLINDPNAANGEREMRMVVKRVRGGEVG
                     RVVHTTKEGEMLGVRGPIPTFSIYPQRYDKIIMISTGTAVSPFLQLLAKLSPSNAPRL
                     ELIQALPALSSSTPPFSHESLDRAAPIKWDWVDTNEDPSFLPSLEKKFGEKLKITRFP
                     QGAVPAGAVQAALEGMNRERVLVLVCLPPWLMRPLCGGMTRNLDQGPVTGVLRELGLG
                     SKQVYKLE"
     gene            complement(<526317..>527902)
                     /locus_tag="CNA01970"
                     /pseudo
                     /db_xref="GeneID:3253691"
     gene            527744..528337
                     /locus_tag="CNA01980"
                     /db_xref="GeneID:3253774"
     mRNA            join(527744..527942,528014..528337)
                     /locus_tag="CNA01980"
                     /product="expressed protein"
                     /transcript_id="XM_567144.1"
                     /db_xref="GI:58259462"
                     /db_xref="GeneID:3253774"
     CDS             join(527839..527942,528014..528125)
                     /locus_tag="CNA01980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567144.1"
                     /db_xref="GI:58259463"
                     /db_xref="GeneID:3253774"
                     /translation="MLSLEDHLRRERTVFRRLSSTMMMNDAAYSRRRKQIPSLSSLLA
                     IFPQPLRILLVLFPFSPSLPIVYASLS"
     gene            complement(527948..>531769)
                     /locus_tag="CNA01990"
                     /db_xref="GeneID:3253770"
     mRNA            complement(join(527948..528259,528313..528572,
                     528629..529075,529132..529276,529338..529543,
                     529604..529794,529843..530646,530706..531045,
                     531101..531312,531365..531467,531518..>531769))
                     /locus_tag="CNA01990"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537177|gb|CF683018.1,gi|41555081|gb|CF700922.1,
                     gi|41561193|gb|CF707034.1,gi|41561207|gb|CF707048.1,
                     gi|41571537|gb|CF717378.1,gi|41571545|gb|CF717386.1,
                     gi|41574011|gb|CF719852.1"
                     /transcript_id="XM_566578.1"
                     /db_xref="GI:58258330"
                     /db_xref="GeneID:3253770"
     CDS             complement(join(527980..528259,528313..528572,
                     528629..529075,529132..529276,529338..529543,
                     529604..529794,529843..530646,530706..531045,
                     531101..531312,531365..531467,531518..531769))
                     /locus_tag="CNA01990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566578.1"
                     /db_xref="GI:58258331"
                     /db_xref="GeneID:3253770"
                     /translation="MLAPYHLQPLIPQLRPAPDLLQFDTQHSLAPRSSSPPQSPVRSS
                     NNNNEHREIRCVEGYGYNLYVGASDGTVEWWVCEGSMYPQANGWVMRHKHTLFPRRPV
                     SKMYILPKVSKLFVISDGTMHALTLPSLEVVPSTIIPTMRGVVSVILNDDELDYGQGS
                     EEKTDMTVVIVRRRVLGIYRLGNRLQSIKEIPLPSAPTAHALFQTYLCCALLSPETSQ
                     IVNCVVDLSDASLTEVLPVSQVPPLEGEGGEGQEAVNANIVVIPDEKEFLVTSYTGTS
                     TMGVFLNGQGDPVRGTITWTSHPLSITVESNWIIALLSDQTISIHSLSDLDGPAQVIS
                     LPPGTNATSLSYSPYGVRVSDVFSGEKLKPSKMRFLSGKIAPTVESPATVEEHGKRQG
                     DSIKEKEDDPPAGSGLTPPSSPKPTLEHTADKSPAFITAMCETFLVTPSSILSLIPTP
                     DIMLLENLCEEHQLSEAASLVSDIRRRYRKGTIEPSPSPIDTLNASHLIRYLSLVLAS
                     HLTLSASFEKAAEYWVKGKVDPRWVVRLFEGLRGKMIGSEEEGEIFSGLANTFMDMDL
                     VDDSTSSIKRNYSPHLTPSTSLSPASTDLRQALENEANKMLAEVLSKIRGTRRKGGGA
                     RGLDSRKIDMVVDTTLAKLLTLLANDSQEPTEQLLALLSSSNDIIMSEVEPFLEKRKY
                     VLAKVKEKNGEWGRVLDILRELVESGDQDPMCKDPVQEVALALTNVQDVDTWTDHVLW
                     LTAKRPEKALDVIINHPPATLSPANFLPRLQPYPETHQAYLEHIVVKQRSPSRDLHQQ
                     LLCSLLDEIQRTIVDDGVKYHLDELQEEYKKETERIAGIKGKERETFIYFFARLAPDT
                     PIKRLRLKLAFFLHGSPFYDITQAEQRLEGMERLVYEKAIVYGKLGKHRPALQLLALT
                     LSDPLSAQTYATASGEILPPRLARSASSISGIGALEAWATLGEVGKRKKVKDDGGKLE
                     EALVQDLLDVYMQDGTPLSLHCASTLLNTLPHLLPLYPILGSMPASWPLNIVSPFFVR
                     SIRRGTHKRWEGMVRKGIARGEFAEVEERWLEEMRGMVFSYNPIRRNHS"
     gene            <532441..535089
                     /locus_tag="CNA02000"
                     /db_xref="GeneID:3253796"
     mRNA            join(<532441..532577,532625..533827,533877..534012,
                     534061..535089)
                     /locus_tag="CNA02000"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41553967|gb|CF699808.1,gi|41553977|gb|CF699818.1"
                     /transcript_id="XM_566580.1"
                     /db_xref="GI:58258334"
                     /db_xref="GeneID:3253796"
     CDS             join(532441..532577,532625..533827,533877..534012,
                     534061..534561)
                     /locus_tag="CNA02000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566580.1"
                     /db_xref="GI:58258335"
                     /db_xref="GeneID:3253796"
                     /translation="MSYGAMTGISFTNGGGFSFEGKPRSVKWGNGGMMGSFGARFYGD
                     AGGDSPVIPFSTSVTMEPSSFAASAQAFGLPGSMSSSYHRRSYAAAVAGSRDPHNLST
                     SFASMSFQPMSLGTSYNRSQVQGLMARSDAELTKAYECCGKTHSGLHSLLEHVEDCHP
                     FSDPNMPPEDSFSPVTHAMDLDLDDVPEEPAQPPAPGSSQSSLSPDPIAAVPVPSYPL
                     PTSKTPTDSVGKSPLKLSDVLKSPPEGESMVKASNLTLTRTQSSSSSPPDGSLATPTT
                     STQPSPVFLQPKINPARPAFMSMGTNAMRPAAQQKRFDRAFNEVVAGRKEDEPKGDMP
                     TAVAPGVLFASAVSSLGIPTVPPGTKTTETTTPKEGEAEVKPAATDATTSAAAAQPSS
                     TSTGAAAPSAPKVFPEPALPQPSLFSSHKPWRCPNPGCNKAYKQSNGLKYHQQKGQCD
                     FAIHDAVDLGLTLEEAEERNRPFVCAVGAGCTKRYRQMNGLKYHYLNSGEHGLYGLRM
                     LQNGTHPHPPSLPAPPPVRARPNPPSSSGVTSGVSAPQRPAGAPYAIPSQATNTINGA
                     GQGRVIGQGGHGQNHHALPRMGTWPNQSRPANGPNPINGKPAPNHALGPQKVQPQARP
                     NPPPQPQPVTKGRDAVLFSAISEDPMDIMSRMDS"
     gene            535276..537531
                     /locus_tag="CNA02010"
                     /db_xref="GeneID:3253805"
     mRNA            join(535276..535815,535875..536114,536173..536259,
                     536302..536498,536559..537531)
                     /locus_tag="CNA02010"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537019|gb|CF682860.1,gi|41537032|gb|CF682873.1,
                     gi|41549728|gb|CF695569.1,gi|41549733|gb|CF695574.1,
                     gi|41572596|gb|CF718437.1,gi|41572599|gb|CF718440.1"
                     /transcript_id="XM_566581.1"
                     /db_xref="GI:58258336"
                     /db_xref="GeneID:3253805"
     CDS             join(535397..535815,535875..536114,536173..536259,
                     536302..536498,536559..536704)
                     /locus_tag="CNA02010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566581.1"
                     /db_xref="GI:58258337"
                     /db_xref="GeneID:3253805"
                     /translation="MVLPEARPLHLPLSSIIPPSGPNPGPPHTLPVPSYILGPLPPTS
                     PLHLALRYLDLADDATREDCASNARHGSNSQGSNSQNMTRGEHDGKGALNTPTRVLLV
                     TGPKAAFQDAIESEDERWFREHGGWMSVIQKLKRIDMRFCPSAKHLQLLLTLLSKNQS
                     RQANADSHTLDGCPGLVILWNVAELFMVSSTDTELQENKVKEDKNGNSPGCSSGKQFN
                     ASICISDYLNVLAAARETANHFSSIDPSYARGLSTQLVVMEPNLTAHSSLPVLPPSAQ
                     GESSGVSSRQAPREKRIFVVDGARHLMGESNVAVIQQQGEEQEVPTEYELTVGRAQGT
                     FAMKRQRRKGGDWTAQQDELHGWEWEWE"
     STS             536295..537492
                     /locus_tag="CNA02010"
                     /standard_name="D1S3691"
                     /db_xref="UniSTS:474269"
     gene            complement(537861..540734)
                     /locus_tag="CNA02020"
                     /db_xref="GeneID:3253827"
     mRNA            complement(join(537861..538047,538101..538160,
                     538209..538457,538520..539626,539679..539888,
                     539944..540192,540249..540270,540312..540353,
                     540485..540563,540655..540734))
                     /locus_tag="CNA02020"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550302|gb|CF696143.1,gi|41550311|gb|CF696152.1,
                     gi|41561480|gb|CF707321.1,gi|41563873|gb|CF709714.1,
                     gi|41574378|gb|CF720219.1,gi|41574388|gb|CF720229.1"
                     /transcript_id="XM_566582.1"
                     /db_xref="GI:58258338"
                     /db_xref="GeneID:3253827"
     CDS             complement(join(538021..538047,538101..538160,
                     538209..538457,538520..539626,539679..539888,
                     539944..540192,540249..540270,540312..540353,
                     540485..540563,540655..540718))
                     /locus_tag="CNA02020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566582.1"
                     /db_xref="GI:58258339"
                     /db_xref="GeneID:3253827"
                     /translation="MSTQSGRSTTSKSSSRKKPLSCAECRRLKLKCELVFPCRHCVKR
                     GLASICPEGELVNGSRRTKILASTEDLHSRIAALEEALKTATSSQHPLLQDSLYANRK
                     EIRQRRSSSSSPESSIQLPSDCLTSFSHLTLGDDPHFSRYYGAASSVYLSKQQSIPVS
                     CERFVPSDESVAPRQPHAISNDYTDLFPPFSSVHSQLDIDGIFHQYLPPPEIGLTLAE
                     VYFHTFGWFTNIVQRPSWNDVFFHHVYRESASIRSNPVKPQRLAVVLLVFALGALMDL
                     SKPPHNEEARHYFNGARACLSLDPSHSVTYVQCIYLYGSYLMNRGEDTSGGDTFWPLL
                     RMGMAVCEAIGLHRDGSNWGLEEDQAMVRRIVFWEIHGYDVLQSTALGRGMCISDASI
                     DCQVPLAETDSGFHARAYALTKIWSQINEKQVRIKPFVYSEVAEIDKALCAFQDDLPY
                     HLSPSLPPSPDDLTNLARHKEAFQRNTLLLYINEAKLTLHRGWFIRALREYPDEPLSS
                     PFKHSYLSCLEACRGVVFLVRNMLILHGQLIHRRWHFFFHLFAACVCLAAAVIRAPAS
                     SLVRSILTELESGINLFKIADREELITVNRLREKAVRAMQNISSASFNELETETEDLD
                     LLGARTTLRRAAPKVSTHEQSGVIPLTVPLFYENTSIPPNAERTETMTAMLDVDDMNQ
                     GNLEWNDFDMDTFLREIGAI"
     gene            <541259..>546240
                     /locus_tag="CNA02030"
                     /db_xref="GeneID:3253830"
     mRNA            join(<541259..542415,542466..542608,542701..542761,
                     542953..543194,543237..543549,543615..543850,
                     544106..544933,544984..545092,545143..545407,
                     545460..545991,546050..>546240)
                     /locus_tag="CNA02030"
                     /product="ubiquitin carboxyl-terminal hydrolase 2,
                     putative"
                     /transcript_id="XM_566583.1"
                     /db_xref="GI:58258340"
                     /db_xref="GeneID:3253830"
     CDS             join(541259..542415,542466..542608,542701..542761,
                     542953..543194,543237..543549,543615..543850,
                     544106..544933,544984..545092,545143..545407,
                     545460..545991,546050..546240)
                     /locus_tag="CNA02030"
                     /EC_number="3.1.2.15"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 2"
                     /protein_id="XP_566583.1"
                     /db_xref="GI:58258341"
                     /db_xref="GeneID:3253830"
                     /translation="MPLPADSSSTSIPHRSSSISEHADSPVIVDEPEIGLPEAPYRPP
                     EAVIDPPEDDPPPYTPGIVAEHIGEDGDMQVDSKFTAKDFNAWQSNLESYDQMEIDQS
                     TSQSSMPQLGPGVLPRRWLAIAHEHELVRPYIEALPPPSKKFHSQTHAQVAAGQASLP
                     PPSQRPTPVFASNNPFAQDSPRIATLEDIIQALPGDGDDSEHWYFCSTCWGWLKIKAG
                     HGLPPGLQSMEEWEASVIEQKAYPDIESFEKAREQRRDEWARLVGIQNSRLVAPQEHH
                     HFHQFNTLLPSSKLARIDRVVVEEHLNVFPHITVGLDPEESWESFNLPHSPSRLFLSD
                     SSDVWISVDEGLVPGQLPVGLVNAFTAEKMSNPNPGLDGVQSVNEAWNLIATLLINPL
                     FKGQRGWVNLNNAKFQSKIGAGLASSHIMYHIGFACQQEPDVHVEGLDRGDTLFVGVP
                     KAKYMTATAPFPDNVREACHILGVTKYDTAETLETAYDLQIMFDEHNTPRYLGALERI
                     SEASVVGKSSLELKVAVERSLDKYTDAQMTDEVLKAYSLIGYTRQHAEDISIPPQGAP
                     DDYILSMHKSAIQASTSSQQRQDLNRALVLIGKDRRSEQLKSMGEKGQTFVSVQEAYE
                     ALSAPRDAVDDGLIMQYEMAVNEYPGKADHYRMCLSVIADAPGEERPGLKQFLQTGSR
                     GKLRAMYSIDQVAKVPIQNLMYPLEKIFLQDCKTSVVRQLRLLFLQLYKTELPAVRPD
                     EELAYLAITRPEIDSMVEQTQEPPTELSASTATATDSAQITPNLLDSIPSVPELTTLP
                     SPSSTIFASPPESPRQDLTGTPIPLEQDEITEEMELDADKENIRSPESSSTRSRDTSS
                     TSTILGKRGNQDRERDNSRSPGEERVKYKQAEGSGNNATRGKSESESALEFELGTGSR
                     VETTQADQVESPSLGTATEIAHLELTTPAGSPSQTRKEEAEVLALTQPEDKYESPSAP
                     PSLPPRPQARKQETLSSGLRFGLQQDAAEVLINVLSQLELALEQPGEDGKEASNLIKN
                     LYSCKYRQQTVYESSSPSSDDQPTYDAQTPVESVFTHPIIGVEEEGKDLYDCLAELYL
                     GGSAIEYEGKKGFMMDLMDEFPPMLYIQMRRSQYDPVTGRDRKTNTHISFPQTLCMSR
                     FLTSAPAEKREESIALTREIIRMRTRLHSLRNHTPLSIPSTYKHASSALRQLASSGLD
                     IPELNEVLSPELCDALDREGDEVIKEIEELQQELPKLKERMDEIWRDVHEEEEEDEHV
                     KAYDYELVSVYMHRGKTSGSGHYWTYQAHLPGHKFYNYNDEKVTVVPASEVLQDRTGS
                     DANPALLCYARKGWDLVDSLHREILEHSSPEVEELVLT"
     gene            complement(546301..548734)
                     /locus_tag="CNA02040"
                     /db_xref="GeneID:3253695"
     mRNA            complement(join(546301..546810,546862..547378,
                     547439..547511,547572..547667,547724..548042,
                     548108..548565,548615..548622,548667..548734))
                     /locus_tag="CNA02040"
                     /product="ferric reductase transmembrane component,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534586|gb|CF680427.1,gi|41534600|gb|CF680441.1,
                     gi|41534605|gb|CF680446.1,gi|41534616|gb|CF680457.1,
                     gi|41538354|gb|CF684195.1,gi|41538360|gb|CF684201.1,
                     gi|41548930|gb|CF694771.1,gi|41549056|gb|CF694897.1,
                     gi|41549061|gb|CF694902.1,gi|41554416|gb|CF700257.1,
                     gi|41554431|gb|CF700272.1,gi|41556170|gb|CF702011.1,
                     gi|41556174|gb|CF702015.1,gi|41556995|gb|CF702836.1,
                     gi|41557004|gb|CF702845.1,gi|41559079|gb|CF704920.1,
                     gi|41560254|gb|CF706095.1,gi|41560261|gb|CF706102.1,
                     gi|41560569|gb|CF706410.1,gi|41560577|gb|CF706418.1,
                     gi|41564197|gb|CF710038.1,gi|41564207|gb|CF710048.1,
                     gi|41567794|gb|CF713635.1,gi|41567805|gb|CF713646.1,
                     gi|41572670|gb|CF718511.1,gi|41572679|gb|CF718520.1,
                     gi|41575247|gb|CF721088.1,gi|41575987|gb|CF721828.1"
                     /transcript_id="XM_566584.1"
                     /db_xref="GI:58258342"
                     /db_xref="GeneID:3253695"
     CDS             complement(join(546368..546810,546862..547378,
                     547439..547511,547572..547667,547724..548042,
                     548108..548565,548615..548622,548667..548723))
                     /locus_tag="CNA02040"
                     /EC_number="1.16.1.7"
                     /codon_start=1
                     /product="ferric reductase transmembrane component"
                     /protein_id="XP_566584.1"
                     /db_xref="GI:58258343"
                     /db_xref="GeneID:3253695"
                     /translation="MSSSTEHLRRYIPIPTQYQIYNSYTEDPKWQKKFTIIWTSFLAF
                     SLLLSIPYIIHHFRIGRLYSGLAIRESLDPSQNVSDSSHGNAKRSHSQNKWRGTFIGR
                     AVTGVGAIVQSITLWTLPMPDLSWLKGEVGDCCRRAYFTLSVSQIVLVLGYAGAVIAC
                     FVVGASLTQNSNRPGFLALSQLPLIVLLSLKSPLPLPIFVPSLSYEHYNFLHRWTGRT
                     LFLSATVHGAMWIHQFVVTDQYDQIAAAKSKRGILAYALMGMVVITSLKPIRRKCYQL
                     FWMAHIMFFVGFFAAISYHTPYSRPWIWPCVAIYAYDLVVRMLRYRIKDATLVPVDKT
                     LTMIHIPDCDAGWLPTQHVLLRVLSGSGIFESHPFTITNAPSTAFSASPRGIILYAKV
                     AGDWTKKLHDLARDVKSLEVGDDLEEKESFLANKAQNEGGVNADEEGIDHPGKRVQVM
                     IDGPYGGLKMDLGQYESVLLVGGGSGITFILGSIEEALRVREKGRGPAKVDVAWIVKD
                     LCTIEALAPSLLHLYTLAQRLRLTLTYNLYLTDPPHPLPSTPSLLPASTTLSPYRPEV
                     AQLVRESLPLPLTKAQETLLEQGRELITGDDDGHQTQHHGEGRGHAGGLAVVACGPEG
                     IVMEAKSAVAGLGIAERVRCGGVGFHGECYLL"
     gene            <548888..549945
                     /locus_tag="CNA02050"
                     /db_xref="GeneID:3253648"
     mRNA            join(<548888..549000,549039..549251,549288..549621,
                     549672..549945)
                     /locus_tag="CNA02050"
                     /product="L-cystine transporter, putative"
                     /transcript_id="XM_566586.1"
                     /db_xref="GI:58258346"
                     /db_xref="GeneID:3253648"
     CDS             join(548888..549000,549039..549251,549288..549621,
                     549672..549866)
                     /locus_tag="CNA02050"
                     /codon_start=1
                     /product="L-cystine transporter"
                     /protein_id="XP_566586.1"
                     /db_xref="GI:58258347"
                     /db_xref="GeneID:3253648"
                     /translation="MQPHPLAAFLVNLTGVTYFIAWSYSFYIQLVHNFKRKTTHGLSP
                     DFVWVNPLGFLALTLWNWGAYFSPVARKQYQDRHHGHLPQVSTSDLAFSLHALIISTI
                     TLAQVFCSSDQHSDEASPLISDSVHNSAAGDDSESSNLVIFHSPIRPSPVAQLFLGGI
                     VISPFVYAIFVWTGKAQFLDWLYYVGNIKVVISAVKYIPQVVLNHRMRAVNGFAIGVI
                     ICDIIGSVLSFSQLVISSVFIDHDPSGIIANPAKLGLAGLSFTFDLVFIAQKYWLYRI
                     KKDDEERT"
     gene            551397..>552994
                     /locus_tag="CNA02060"
                     /db_xref="GeneID:3253688"
     mRNA            join(551397..551485,551568..551768,551827..>552994)
                     /locus_tag="CNA02060"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41567951|gb|CF713792.1"
                     /transcript_id="XM_566588.1"
                     /db_xref="GI:58258350"
                     /db_xref="GeneID:3253688"
     CDS             join(551427..551485,551568..551768,551827..552994)
                     /locus_tag="CNA02060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566588.1"
                     /db_xref="GI:58258351"
                     /db_xref="GeneID:3253688"
                     /translation="MRFREIIITPTWEAIGPFPSGTRELPFLGSPLAAYSTSSADPDI
                     EFAHRPYSPEETWPSELGNGGRVSWSRFEAKGDWLEISYPNVNWDQLRSDHGWSALQY
                     MVLLRTRLTIPKSGHKRLTPVLINMLQLSEFALVRQGADPHTSGPVRWYQGNSYGFGG
                     PAPGLDSTIKPAAVRFERSLLLEPGVYIMLARAVYDIRQFGDPGPGNPPIIKMSSVNM
                     VHDTEKHVTQLPEEMGTFPSVLSGWLMGEWASVGVRVPEGALETTVIDVNSAKVIYKS
                     RDAEPLERVLAVEIVSNISIVPGQTRLIPMRIRQQTPLSLEARTLSISIDFQSGGQTR
                     VLQWSFPLHHVTYDSHNLTTNNPHFWITCASPSLITDSHLNHLPAHVSSAMIVPPKHS
                     VRHDEEKPVILALHGAGVDVKNSEWGERMPEVPGVWAVLPIGKNEWGEDWHGGSMEDA
                     WAARAAVEVLLRKAGIALSDKTVSV"
     gene            553148..554846
                     /locus_tag="CNA02070"
                     /db_xref="GeneID:3253701"
     mRNA            join(553148..553223,553288..553698,553751..554229,
                     554289..554354,554412..554533,554584..554651,
                     554703..554846)
                     /locus_tag="CNA02070"
                     /product="expressed protein"
                     /transcript_id="XM_566590.1"
                     /db_xref="GI:58258354"
                     /db_xref="GeneID:3253701"
     CDS             join(553153..553223,553288..553698,553751..554229,
                     554289..554354,554412..554533,554584..554651,
                     554703..554757)
                     /locus_tag="CNA02070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566590.1"
                     /db_xref="GI:58258355"
                     /db_xref="GeneID:3253701"
                     /translation="MRTCTVVAASGWLTIQHYVPYTDYTSNRYADPALMGILHSSLAP
                     YHNDLHSSNLSDIPILAIHGADDDNVPPRHSRAHAALVSSWAGEKDSFIKVLEIPKRG
                     HWWDDVLSSSDVVDFIQKLPPRQSWDEQRKKGYTLTTANPQECGGRAGIRIVELDTPG
                     RLARLDVNARQWKSNQTAETLDIRGMNVRRIEIKSLQSSQHFQTYVRCRPYGFSPVNN
                     SILGPLAPARAYGPMIRILSSPASFHLIIPSSGEAQPHHLSIAKRIAHDLYVYHKADC
                     DIIADQEGLERVAKGKIGPGSIIVIGRPENNRYTEWMAAEGKIPIQFPTKGVMAISKD
                     KVVSDRGAGFIALHPHPTHSGSLSLLIAGNDELGLELATRLFPTRTGVPLPDWAMICP
                     RSRWQGANGLIGAGFWGGEWEYNEAMSWMDR"
     gene            complement(554903..556323)
                     /locus_tag="CNA02080"
                     /db_xref="GeneID:3253598"
     mRNA            complement(join(554903..556077,556165..556323))
                     /locus_tag="CNA02080"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41574380|gb|CF720221.1,gi|41574383|gb|CF720224.1"
                     /transcript_id="XM_567147.1"
                     /db_xref="GI:58259468"
                     /db_xref="GeneID:3253598"
     CDS             complement(join(554981..556077,556165..556312))
                     /locus_tag="CNA02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567147.1"
                     /db_xref="GI:58259469"
                     /db_xref="GeneID:3253598"
                     /translation="METPHSLNRRKRETREDGTDLPESSPRAPLVAWKHDQRIRNAIL
                     QATEDELIDPPIPTQQPRPISSKLSHSSTTINDPVRPRKRICRNHRSLPPCLRNALPS
                     SSASHSLAGSSGVLSEASIKDISGSASAKTQLDLLLEQFRLQVSPMKRATEEGSQPEG
                     RPKRHGKENQTNSARRKSKEKERGQQKALQDKKAKKGDVPLQKHAELSTSAKMRGDSS
                     SSILSHNSSATDISFISAPTHHTSFDRRMSHSSSISSIRSPLSPVKPGAAPRIGLGSQ
                     NKPSKIPPPRISTLKTFKTPFLEPRQGIRSSPRLIESARPAIPQTPARDRACSRVPTT
                     PSIRTTVSGSSSRATPTRPNSSGPQTRSAKKLASNPSGFTNFDVGEDEPEGDRSFDSF
                     DGIFNEGGPEIEMLLRQVDGTQ"
     gene            <556311..>557566
                     /locus_tag="CNA02090"
                     /db_xref="GeneID:3253707"
     mRNA            join(<556311..556653,556706..556759,556827..556948,
                     557006..557086,557146..557216,557267..557453,
                     557504..>557566)
                     /locus_tag="CNA02090"
                     /product="vesicle-associated membrane protein 712,
                     putative"
                     /transcript_id="XM_566592.1"
                     /db_xref="GI:58258358"
                     /db_xref="GeneID:3253707"
     CDS             join(556311..556653,556706..556759,556827..556948,
                     557006..557086,557146..557216,557267..557453,
                     557504..557566)
                     /locus_tag="CNA02090"
                     /codon_start=1
                     /product="vesicle-associated membrane protein 712"
                     /protein_id="XP_566592.1"
                     /db_xref="GI:58258359"
                     /db_xref="GeneID:3253707"
                     /translation="MLGRVGGAKEDETWTKTVSMRMFLPLLLEDGGGRRPPRRSGARK
                     VNDVAFANGVPIYTSRRTRSKKYLMVIPSSHCATATQPLSHTTMSLIHALIARGTTVL
                     AEHATGTAELKPAAQITILSKIPPNNSKLTYVWQDRLIHYVSSNGVIYLVMADDSVGR
                     RMPFAFLADLERRFTAQYESDDIVSAGAHSLEEFEPELAKLMHQYTSSPPADPLRQAQ
                     SDLNNVKDIMVQNIDSILQRGERLDLLVDKTDTLAGQAYAFRRGARSVRRQQWWKNMR
                     IMALSGVVGLLLLYLFIAQFCGASLGHCRS"
     misc_feature    556400..556424
                     /locus_tag="CNA02090"
                     /note="GC_rich"
     gene            complement(<557674..>558995)
                     /locus_tag="CNA02100"
                     /db_xref="GeneID:3253719"
     mRNA            complement(join(<557674..557862,557919..558052,
                     558103..558313,558370..558451,558513..558625,
                     558674..558751,558814..558853,558910..>558995))
                     /locus_tag="CNA02100"
                     /product="multidrug resistance protein, putative"
                     /transcript_id="XM_566594.1"
                     /db_xref="GI:58258362"
                     /db_xref="GeneID:3253719"
     CDS             complement(join(557674..557862,557919..558052,
                     558103..558313,558370..558451,558513..558625,
                     558674..558751,558814..558853,558910..558995))
                     /locus_tag="CNA02100"
                     /codon_start=1
                     /product="multidrug resistance protein"
                     /protein_id="XP_566594.1"
                     /db_xref="GI:58258363"
                     /db_xref="GeneID:3253719"
                     /translation="MEGLQRLLQGGRGMGMGGAAGGQTVVADNGETVHISALALLKML
                     KHGRAGVPMEVMGLMLGEFVDDYTISCVDVFAMPQSGTTVTVESVDHVFQTKMLDMLK
                     QTGRPEMVVGWYHSHPGFGCWLSSVDVNTQQSFEQLHPRAVAVVIDPIQSVRGKVVID
                     AFRSINPAALATGQESRQTTSNIGHLNKPSIQALIHGLNRHYYSLAIDYKKTEAEQGM
                     LLNLHKRGWTEGLKMKDFEEMEQGSQKAIENMLNLAVAYTKSVQEESTMTEEQLKTRH
                     VGKLDPKRHLSEAAEKAMEDQVIQSLAMGVLAEL"
     gene            559251..559336
                     /locus_tag="CNA02110"
                     /db_xref="GeneID:3253556"
     tRNA            559251..559336
                     /locus_tag="CNA02110"
                     /product="tRNA-Thr"
                     /codon_recognized="ACA"
                     /db_xref="GeneID:3253556"
     gene            complement(561835..564070)
                     /locus_tag="CNA02120"
                     /db_xref="GeneID:3253562"
     mRNA            complement(join(561835..562058,562136..562774,
                     563147..563242,563312..563834,563897..563942,
                     564009..564070))
                     /locus_tag="CNA02120"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41547232|gb|CF693073.1"
                     /transcript_id="XM_567148.1"
                     /db_xref="GI:58259470"
                     /db_xref="GeneID:3253562"
     CDS             complement(join(562614..562774,563147..563242,
                     563312..563789))
                     /locus_tag="CNA02120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567148.1"
                     /db_xref="GI:58259471"
                     /db_xref="GeneID:3253562"
                     /translation="MSSQNPARSIQDRPGDNAVFPTDDIWDRATPDDSFSSKTGDSED
                     EEGEDLPARDTPFGDRERQGGDSQTTRDEGINAELFCAAQKGRCRMNKSVKTALNKFL
                     SAQRKALMEFCVQHDVRLATAERYANSQNHRRESGTWQLWRRSRMRRTALLEKFGEEI
                     LKNVSRKEMDEASRELSRTDVFSIICSFFAVCTVILLLILLIHSSMMLCRSWHQRISL
                     AVSACRRAFSSTARSRMSINLIPTIR"
     gene            564248..565916
                     /locus_tag="CNA02130"
                     /db_xref="GeneID:3253735"
     mRNA            join(564248..564427,564474..564590,564645..564815,
                     564867..565916)
                     /locus_tag="CNA02130"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537623|gb|CF683464.1,gi|41537632|gb|CF683473.1,
                     gi|41538804|gb|CF684645.1,gi|41538806|gb|CF684647.1,
                     gi|41558246|gb|CF704087.1,gi|41558251|gb|CF704092.1,
                     gi|41565442|gb|CF711283.1,gi|41565449|gb|CF711290.1,
                     gi|41569565|gb|CF715406.1,gi|41569574|gb|CF715415.1"
                     /transcript_id="XM_566596.1"
                     /db_xref="GI:58258366"
                     /db_xref="GeneID:3253735"
     CDS             join(564419..564427,564474..564590,564645..564815,
                     564867..565847)
                     /locus_tag="CNA02130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566596.1"
                     /db_xref="GI:58258367"
                     /db_xref="GeneID:3253735"
                     /translation="MSEYQALKARALEMQREKEEAMKMELAAKQEREKQLAREQEERR
                     KRLEEASKEARRRELMRAHEELNRKTGGAGNRVSQAEYDPFAEDVKPIATANIPKPSA
                     RSGPSKISKTSLNKPASSSSTKASTSNKSGNSKNGGPSKGSSPPVTAVLGRKEKAARL
                     FAQKAKKSAADSLFSVRSLVESREPAQVRVTPRAGPSQVPPTSMKTEMRGKANGGGRN
                     AAVRSRLMMNGKEELRKLCPDRDVRDRRSIDEISRDLKAKRLLTDESSPQKNSRPLTA
                     SMSKLSIPSSKAREKRPISNPPSEKRRRYSLDDSTDSESESSSSRQAKRRPKKRSRSP
                     PSQFSEPSAAFISAEIQALFRRPGRSGPKYADDFSDASSDDMEAGLSDVEIEERRAAK
                     IARLEDEAAEKEEREHKLRKEALKKQKLKGGKA"
     gene            complement(565930..567800)
                     /locus_tag="CNA02140"
                     /db_xref="GeneID:3253573"
     mRNA            complement(join(565930..566310,566368..566435,
                     566498..566861,566907..566984,567032..567135,
                     567188..567800))
                     /locus_tag="CNA02140"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534676|gb|CF680517.1,gi|41535432|gb|CF681273.1,
                     gi|41535438|gb|CF681279.1,gi|41543979|gb|CF689820.1,
                     gi|41543988|gb|CF689829.1,gi|41550454|gb|CF696295.1,
                     gi|41561413|gb|CF707254.1,gi|41561590|gb|CF707431.1,
                     gi|41566659|gb|CF712500.1,gi|41566667|gb|CF712508.1,
                     gi|41569260|gb|CF715101.1,gi|41569271|gb|CF715112.1,
                     gi|41575880|gb|CF721721.1,gi|41575893|gb|CF721734.1"
                     /transcript_id="XM_566598.1"
                     /db_xref="GI:58258370"
                     /db_xref="GeneID:3253573"
     CDS             complement(join(565940..566310,566368..566435,
                     566498..566861,566907..566984,567032..567135,
                     567188..567750))
                     /locus_tag="CNA02140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566598.1"
                     /db_xref="GI:58258371"
                     /db_xref="GeneID:3253573"
                     /translation="MLAPTVAKIPPTPDLPRDHHGPPAKPLASLQETAAPKYFRNPWP
                     SYRTASMWDAYQAYQRGASIAPHPSFFQGSRFFDGEEPYRDQEEDDYESEPIWTESDS
                     IKKRKIYIRPEFSDIRPGDEKDDWRDPPVGLVEPDWGGNSKTGERVTWLGHAGVLVQI
                     PWRIMDQEQTSRGGATCGILFDPIFSYRCSPTQYIGPARYMDPPCSVSMLPEIHICCI
                     SHDHYDHLDYNTIMDLWKYHQATIHFFVPIGLKPWFTASGIPYHRVTELDWWREAIVS
                     FEASPDVDYDPHYPPDDYENKKSIAEDLTKTDTSALTLKVAFTPAQHRSGRSVLDHMT
                     TLWGSWCVGVVEAADAGKVLKRGMNDWKGFKIYFGGDTGYRYASAPEGDSDAICPAFQ
                     QIADYYAPFNLALLPLSTGSSLPFLRTVLSLSLDQYILTSSLHCSPADSLDIHLIIKS
                     ERTLGIHWGTFCDADEARGTRVDFGRCRRSYGVSPEWDTIEAEKGRFVITDIGQTLIF
                     PTTTDDN"
     gene            567924..569580
                     /locus_tag="CNA02150"
                     /db_xref="GeneID:3253599"
     mRNA            join(567924..568113,568163..568354,568411..568538,
                     568590..568663,568713..569116,569170..569580)
                     /locus_tag="CNA02150"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534459|gb|CF680300.1,gi|41534464|gb|CF680305.1,
                     gi|41566796|gb|CF712637.1,gi|41566805|gb|CF712646.1,
                     gi|41576170|gb|CF722011.1"
                     /transcript_id="XM_566600.1"
                     /db_xref="GI:58258374"
                     /db_xref="GeneID:3253599"
     CDS             join(567998..568113,568163..568354,568411..568538,
                     568590..568663,568713..569116,569170..569572)
                     /locus_tag="CNA02150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566600.1"
                     /db_xref="GI:58258375"
                     /db_xref="GeneID:3253599"
                     /translation="MLFAPATSPPNVRHPYPRPSPGTEFLHFLFHLARLAFAPIIIPL
                     RLLYQTLTAPLTISLLLKLVLLFSLSLISLVLSVLAVGAFFWTWSTGGPIEAEGWLVY
                     GSRKFRLPHTNLQVPLSSIIEDVRYDIQVEMELLRPRKGSDVLDNFMLSLDLMSAKYP
                     QTALMSAAQPTLAPSPLPESFITLPSLATRFIPPCVLPWPFRSFCPSKIIGYGDPVDQ
                     KVLQRRAKAGFLELASTKDIVPLRKDLMEGVLLKPSSAPESVIGSIFLSIGREDSFTG
                     DTEGESHSTEVKTTGWVVVRFIPRPSGIRWLISVHPFPPILLLPPLSLSLTLLSSIFG
                     CAIITGIRRKPSNSRKSKRSLKAPSRSHRIRDSNARSGQEGTERQARVQYRAVRTRRA
                     SNHTDADSTTYSESRIPTENTNSASTSEIGDRNSIVISDDESTSSR"
     gene            complement(569656..570227)
                     /locus_tag="CNA02160"
                     /db_xref="GeneID:3253438"
     mRNA            complement(join(569656..569998,570158..570227))
                     /locus_tag="CNA02160"
                     /product="expressed protein"
                     /transcript_id="XM_567234.1"
                     /db_xref="GI:58259642"
                     /db_xref="GeneID:3253438"
     CDS             complement(569863..569916)
                     /locus_tag="CNA02160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567234.1"
                     /db_xref="GI:58259643"
                     /db_xref="GeneID:3253438"
                     /translation="MLSGYAVNSRYFKRNIE"
     gene            complement(<570890..572466)
                     /locus_tag="CNA02170"
                     /db_xref="GeneID:3253606"
     mRNA            complement(join(<570890..570902,571336..571446,
                     571497..571718,571779..571910,571976..572039,
                     572159..572279,572349..572466))
                     /locus_tag="CNA02170"
                     /product="peroxisome organization and biogenesis-related
                     protein, putative"
                     /transcript_id="XM_566603.1"
                     /db_xref="GI:58258380"
                     /db_xref="GeneID:3253606"
     CDS             complement(join(570890..570902,571336..571446,
                     571497..571718,571779..571910,571976..572039,
                     572159..572279,572349..572435))
                     /locus_tag="CNA02170"
                     /codon_start=1
                     /product="peroxisome organization and biogenesis-related
                     protein"
                     /protein_id="XP_566603.1"
                     /db_xref="GI:58258381"
                     /db_xref="GeneID:3253606"
                     /translation="MSTLATNIILHPKVNRSLAILATTVGRDKVTRLLQYLARLVSWY
                     LLSRGRMESASRFEGLKTGLANGRKVMRLFRPAEFLQSAVNLAQRPVTSLKGPGQIAH
                     LAQIGRQIGYAGFHTADMIVWLAQVRFLKFDKVTTQRYVRLMYKFWFAGIVCSLVSSS
                     ASLVRLRADSRRFALSSQVAKEEEKEGRSGEEAARQMAERRERGRALLAQRQSILSQL
                     VSDSLDVWIPATGLGYTNLNEGTLGAFGLNT"
     gene            <572742..574482
                     /locus_tag="CNA02180"
                     /db_xref="GeneID:3253584"
     mRNA            join(<572742..573484,573530..573845,573894..573921,
                     573973..574088,574136..574195,574252..574482)
                     /locus_tag="CNA02180"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538356|gb|CF684197.1,gi|41538361|gb|CF684202.1,
                     gi|41563220|gb|CF709061.1,gi|41563229|gb|CF709070.1,
                     gi|41563470|gb|CF709311.1,gi|41574361|gb|CF720202.1"
                     /transcript_id="XM_566606.1"
                     /db_xref="GI:58258386"
                     /db_xref="GeneID:3253584"
     CDS             join(572742..573484,573530..573845,573894..573921,
                     573973..574088,574136..574195,574252..574446)
                     /locus_tag="CNA02180"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_566606.1"
                     /db_xref="GI:58258387"
                     /db_xref="GeneID:3253584"
                     /translation="MRLLDLSNLRKMFKRLPRTLLQPSSRPPQVCSQCRNLSQLRAPV
                     HISQFPRYASTISDRQTKQARMSKLPVSHKPPKRRLEAASQPLRNAASITRGPVLQCI
                     AHTTAEKYDLIALGTTLQSLGVRWDEVPEGDPDRALVIGPWKGRGGAERLISGKDVRS
                     TSTIAKSPAVEWAENEGVDLRDMGFGYGERGEIWVFSSGSFVTWGLTEEEGKAFLRQV
                     IRGGRNVEIDRVSPKECELEEVDFVVDPTAKTHILGNLILLGRPPQLSTFHYSPSLAS
                     LLARYTLSLSLSRSSSLSVLEERLDNHLASVSILPRTLEMYGRQPLPRKEVIRKMGEL
                     MTLRMAVNTAGGGLDDTPEFYWSEPELESYFDSVASEFEIKERIDVFNKKIDYAQEVQ
                     STLRALLTESSGHRMEMIIILLISVEVVIVLIREGPDLIHKLLEIVGVAPAEAEDITE
                     NIQKVADKLPSIGAISSPAIRHTTTHWADGSERYV"
     gene            574947..575041
                     /locus_tag="CNA02190"
                     /db_xref="GeneID:3253971"
     tRNA            574947..575041
                     /locus_tag="CNA02190"
                     /product="tRNA-Ser"
                     /codon_recognized="UCU"
                     /db_xref="GeneID:3253971"
     gene            complement(575209..575303)
                     /locus_tag="CNA02200"
                     /db_xref="GeneID:3253966"
     tRNA            complement(575209..575303)
                     /locus_tag="CNA02200"
                     /product="tRNA-Ser"
                     /codon_recognized="UCU"
                     /db_xref="GeneID:3253966"
     gene            580593..582335
                     /locus_tag="CNA02210"
                     /db_xref="GeneID:3253762"
     mRNA            join(580593..581051,581119..581345,581402..581655,
                     581714..581847,581897..582041,582101..582335)
                     /locus_tag="CNA02210"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531529|gb|CF677370.1,gi|41531537|gb|CF677378.1"
                     /transcript_id="XM_567145.1"
                     /db_xref="GI:58259464"
                     /db_xref="GeneID:3253762"
     CDS             join(580698..581051,581119..581345,581402..581655,
                     581714..581847,581897..582041,582101..582273)
                     /locus_tag="CNA02210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567145.1"
                     /db_xref="GI:58259465"
                     /db_xref="GeneID:3253762"
                     /translation="MKIDSLSTPGHSTIDDESFIPHLLTFQRQYFSLYPPYLLTFPDS
                     FLLASPLGQDFLLRCILGENVEADEPDLDQPIQRERWVKLYQPEKTYQTKVWKKIMAS
                     LEAGIKSVERLDNSEWAIDDRFYDHMVTLMVSSNPIPLDNGPQTSYRTFLYDMPDATF
                     HGTFGHDKPQNDARITLLEEQIAIQGGTTGLRTWTAALHLGHHILNHFSTLFSLPRDP
                     DRGFIELGAGTGFVSILLAQMGFKVVATDLESPANQTGEQSENGNSVITPLGRLQSNI
                     ELNQYDVKPQSLHLNWYDARRPRDTDPSLEAWSKIQELHWDIVAADVIYDPDLVRPLV
                     DTIDVLLGNHDGPEKLRAVISATIRNQETFDLFLETCDKHNLRVDILSLPTMSAQAST
                     FWDSALDAGTRVLIMRITKHPITSRGNIISRQSYDF"
     gene            complement(582327..583057)
                     /locus_tag="CNA02220"
                     /db_xref="GeneID:3253567"
     mRNA            complement(join(582327..582404,582458..582572,
                     582624..582693,582900..583057))
                     /locus_tag="CNA02220"
                     /product="60s ribosomal protein l30-1 (l32), putative"
                     /transcript_id="XM_566608.1"
                     /db_xref="GI:58258390"
                     /db_xref="GeneID:3253567"
     CDS             complement(join(582381..582404,582458..582572,
                     582624..582693,582900..583032))
                     /locus_tag="CNA02220"
                     /codon_start=1
                     /product="60s ribosomal protein l30-1 (l32)"
                     /protein_id="XP_566608.1"
                     /db_xref="GI:58258391"
                     /db_xref="GeneID:3253567"
                     /translation="MAPVKKSKSAKSSESINTKLQLVVKSGKFTLGYKQALKQLRSGK
                     AKLILISKNCPPLRKSEIEYYAMLSKTNVHHYDGSNVDLGTAAGKLYRVGVMSIQDAG
                     DSDLLQQQESA"
     gene            <583368..>583774
                     /locus_tag="CNA02230"
                     /db_xref="GeneID:3253632"
     mRNA            join(<583368..583534,583648..>583774)
                     /locus_tag="CNA02230"
                     /product="chaperone, putative"
                     /transcript_id="XM_566610.1"
                     /db_xref="GI:58258394"
                     /db_xref="GeneID:3253632"
     CDS             join(583368..583534,583648..583774)
                     /locus_tag="CNA02230"
                     /codon_start=1
                     /product="chaperone"
                     /protein_id="XP_566610.1"
                     /db_xref="GI:58258395"
                     /db_xref="GeneID:3253632"
                     /translation="MASPLVVGLGLLGAGLAGRVGYQMMRASRGGAQEFLKGGFKAKM
                     DRSEAIQVLGLREPITSNKLKDAHRRLMLANHPDRGGAPYLAGKVNEAKALLE"
     gene            <584479..>585804
                     /locus_tag="CNA02240"
                     /db_xref="GeneID:3253630"
     mRNA            join(<584479..585176,585227..585475,585528..>585804)
                     /locus_tag="CNA02240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566612.1"
                     /db_xref="GI:58258398"
                     /db_xref="GeneID:3253630"
     CDS             join(584479..585176,585227..585475,585528..585804)
                     /locus_tag="CNA02240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566612.1"
                     /db_xref="GI:58258399"
                     /db_xref="GeneID:3253630"
                     /translation="MALDQDATDEQLYADLPSPLHLSPSELIETYHPNVLAPLVRCSK
                     LPFRHLTSLYETHITHTPMILAEEFSRAQIARTSDFSTSSNERGVYWMAPNNGKCRGK
                     GEYITRVGHPEDVRPAKEPWKTYHSPPSTERLPPSPAPPNPQAQLVRGCLIAQFASPN
                     AKSLADAAELISPYVDGIDLNCGCPQRWAYNEGIGCALLRKPELVRDMVRGVKDRMGW
                     GWPVSIKIRIDSEQEKTEQLISNALQAGISHLTIHGRTRHQPSTDPVNLPGIKFAVDC
                     VKGEVPCVANGDVWELEDARQMRLHTGVQGVMAARGLLANPALFAGYDKTPEDCVSQF
                     INLGLDYGFNFSLFHRHLAYMLESHLSRVEKVWFNSLTSQASAIEWLNERAINFKEKR
                     GTIWDARRGYNITDV"
     gene            complement(585837..588247)
                     /locus_tag="CNA02250"
                     /db_xref="GeneID:3253628"
     mRNA            complement(join(585837..586310,586361..586517,
                     586574..586776,586825..587074,587124..587246,
                     587297..587463,587511..587598,587656..587822,
                     587876..587934,587985..588247))
                     /locus_tag="CNA02250"
                     /product="ammonium transporter MEP1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540529|gb|CF686370.1,gi|41540537|gb|CF686378.1,
                     gi|41542259|gb|CF688100.1,gi|41542271|gb|CF688112.1,
                     gi|41548365|gb|CF694206.1,gi|41548373|gb|CF694214.1,
                     gi|41553795|gb|CF699636.1,gi|41553805|gb|CF699646.1,
                     gi|41556704|gb|CF702545.1,gi|41556717|gb|CF702558.1,
                     gi|41561457|gb|CF707298.1,gi|41561461|gb|CF707302.1,
                     gi|41572128|gb|CF717969.1,gi|41572134|gb|CF717975.1"
                     /transcript_id="XM_566614.1"
                     /db_xref="GI:58258402"
                     /db_xref="GeneID:3253628"
     CDS             complement(join(585903..586310,586361..586517,
                     586574..586776,586825..587074,587124..587246,
                     587297..587463,587511..587598,587656..587822,
                     587876..587934,587985..588090))
                     /locus_tag="CNA02250"
                     /codon_start=1
                     /product="ammonium transporter MEP1"
                     /protein_id="XP_566614.1"
                     /db_xref="GI:58258403"
                     /db_xref="GeneID:3253628"
                     /translation="MVNITYGALLSSSDGAVHFEPLGTDIISTLAGQPTAFDPGDIAW
                     VLTCSALIVFMLPGLGYLYSGLARRKNALSMLFLSLVSLGIVSFQWFFIGYSLVFSET
                     GGSFWGDGRNIGFRQVLERPIPEANGKLPEIVFATFQLMFACLVPAVLLGAAAERSRI
                     LPAMIFMFCWTTLVYDPLAHWIWSANGWANKWGVLDYAGGVPVEIASGTAGLAYSYFI
                     GKRRGYGTDRVLFKPSNVGNVVLGTVFLWVGWLGFNGGSCYCASLKAALAIFNTNLAG
                     SVGGVVWLIMDFRLERKWSMVGYCTGAIAGLVAITPAAGYVGAPAAALIGLVSAAVSN
                     LATRLKVTMRVDDPMDIFAVHALAGIVGVLMTGLFAQSSVAANDGFSDIDGGWLDRHY
                     VQLGKQIAWACVGMAWTFVVTYAIMFFINLIPGCHFRATDEAEIVGMDEVELGEYVAD
                     YAFHQRDLEGEYEAHTLSQCPSATKLHLQEFRHNKDGESSSSSQPKELPPTMPRGGAV
                     VGDLDGDTAVESQHSRSRSRGRSQHRVRIEKEGDNEAMEMSDVRHTKTSDQRQEGSNL
                     EGSYMDHRE"
     gene            588796..590576
                     /locus_tag="CNA02260"
                     /db_xref="GeneID:3253626"
     mRNA            join(588796..588813,588878..589044,589107..589794,
                     589852..589994,590047..590576)
                     /locus_tag="CNA02260"
                     /product="8-amino-7-oxononanoatesynthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532334|gb|CF678175.1,gi|41532341|gb|CF678182.1,
                     gi|41534069|gb|CF679910.1,gi|41535048|gb|CF680889.1"
                     /transcript_id="XM_566617.1"
                     /db_xref="GI:58258408"
                     /db_xref="GeneID:3253626"
     mRNA            join(588802..589044,589107..589794,589852..589994,
                     590047..590576)
                     /locus_tag="CNA02260"
                     /product="8-amino-7-oxononanoatesynthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532334|gb|CF678175.1,gi|41534069|gb|CF679910.1,
                     gi|41534080|gb|CF679921.1,gi|41535048|gb|CF680889.1,
                     gi|41535054|gb|CF680895.1,gi|41573642|gb|CF719483.1"
                     /transcript_id="XM_566616.1"
                     /db_xref="GI:58258406"
                     /db_xref="GeneID:3253626"
     CDS             join(588931..589044,589107..589794,589852..589994,
                     590047..590445)
                     /locus_tag="CNA02260"
                     /codon_start=1
                     /product="8-amino-7-oxononanoatesynthase"
                     /protein_id="XP_566616.1"
                     /db_xref="GI:58258407"
                     /db_xref="GeneID:3253626"
                     /translation="MTQLDDRLDDFLRGRKQKGRFRSLKEYDTSPHSGLTDFSSNDYL
                     SLTSSESLRSAYLERLANSPQILGSTGSRLLSGCSPAHSALENRLSTLFNSPSALLFN
                     SGWDANVSFFATVPQASDWVICDELVHASVHSGLRSSRVPPEKRLIFPHNSPEGLEKV
                     LQQIARNPSSGHDSTVFLALESLYSMDGDMAPLPLLLDIFEQYVPRTRQCVVVDEAHS
                     TGVYGEHGKGLVYALGEEGGWAPGDGNKRGKSRVDVRLMTFGKAVGCSGAVLLCSPTV
                     RTFLINFARPFIFSTAMPHSTVIALQCVWDLLLGLEGNKRRESLMAIAAYIHSLLNDL
                     LRNTPAEILRLPPNSGAQFTFHIPPHDTESVSSSPLSPILGLLTPTPHALSAFLLEKG
                     FIVRPVVPPTVPPGAERVRICLRASMDKKVIDQLMAALREWVESKMNVGVMRAKL"
     gene            591219..593843
                     /locus_tag="CNA02270"
                     /db_xref="GeneID:3253624"
     mRNA            join(591219..591246,591322..591543,591606..591742,
                     591795..591875,591928..593434,593487..593843)
                     /locus_tag="CNA02270"
                     /product="3-isopropylmalate dehydratase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535904|gb|CF681745.1,gi|41541598|gb|CF687439.1,
                     gi|41541605|gb|CF687446.1,gi|41559705|gb|CF705546.1"
                     /transcript_id="XM_566619.1"
                     /db_xref="GI:58258412"
                     /db_xref="GeneID:3253624"
     CDS             join(591332..591543,591606..591742,591795..591875,
                     591928..593434,593487..593838)
                     /locus_tag="CNA02270"
                     /codon_start=1
                     /product="3-isopropylmalate dehydratase"
                     /protein_id="XP_566619.1"
                     /db_xref="GI:58258413"
                     /db_xref="GeneID:3253624"
                     /translation="MPAPITTPRTLYDKVFDDHVVHSGEGDTLIYIDRHLVHEVTSPQ
                     AFEGLRNAGRKVRRPDCTLVTVDHNIPTISRKNFKNVNTFIGEADSRAQVAALEDNVK
                     EFGLTYFGMNDKRQGIVHIIGPEQGFTLPGTTVCCGDSHTSTHGAFGALAFGIGTSEV
                     EHILATQTLPQAKSKNMRINVEGTLAEGVSSKDIVLHIIGVIGTAGGTGCVIEFSGST
                     IRALSMEARMSICNMAIEGGARAGMIAPDEITFEYLKGRPLSPREGEEWDKAVEYWKT
                     LKTDPGAKYDIEVEIKAEDIVPTLTWGTSPQDVVPITGVVPNPDDFPEAQRGNIVRAL
                     EYMGLTSGTPMEKVKIDKAFFGSCTNGRIEDMRSAARVILASQKNGGPSKVADGVYAM
                     IVPGSGLVKQQAEAEGLDVIFKKAGFDWREAGCSMCLGMNPDQLKPGERCASTSNRNF
                     EGRQGAGGRTHLMSPAMVAAASLTGYLTDVRTLMGSHANDDGLKITSYFDYLTPVEVP
                     AQPTEPTEETEEGKTPVKAAAAGSAGLPKFNVLRGIAAPMWEANIDTDKIIPKQFLKT
                     LLRTGLGKALFWPLRYDVETNEEIPDFVLNKEPYRHASIIVCTGPNFGCGSSREHAPW
                     ALNDFGIRCVMAPSFGDIFKTNCFKNGMLPLQLPQADLDTLYEDASAGLEITVDLENQ
                     VIVRPNGKPSIPFSVDPFRRHCLINGLDDIGLTLVHRDEIEKFEGKRTAVWPWLDGVG
                     YAKKGQKVIAVPVRKGARKTDW"
     gene            594060..594154
                     /locus_tag="CNA02280"
                     /db_xref="GeneID:3253953"
     tRNA            594060..594154
                     /locus_tag="CNA02280"
                     /product="tRNA-Ser"
                     /codon_recognized="UCU"
                     /db_xref="GeneID:3253953"
     gene            594490..598347
                     /locus_tag="CNA02290"
                     /db_xref="GeneID:3253635"
     mRNA            join(594490..594637,594700..594881,594931..595351,
                     595398..596412,596465..596656,596714..597230,
                     597289..597513,597571..598347)
                     /locus_tag="CNA02290"
                     /product="isoleucine-tRNA ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535024|gb|CF680865.1,gi|41535032|gb|CF680873.1,
                     gi|41537978|gb|CF683819.1,gi|41537993|gb|CF683834.1,
                     gi|41539229|gb|CF685070.1,gi|41539244|gb|CF685085.1,
                     gi|41540768|gb|CF686609.1,gi|41540779|gb|CF686620.1,
                     gi|41546275|gb|CF692116.1,gi|41547735|gb|CF693576.1,
                     gi|41552108|gb|CF697949.1,gi|41552701|gb|CF698542.1,
                     gi|41552709|gb|CF698550.1,gi|41558639|gb|CF704480.1,
                     gi|41558646|gb|CF704487.1,gi|41565650|gb|CF711491.1,
                     gi|41565659|gb|CF711500.1,gi|41566015|gb|CF711856.1,
                     gi|41566022|gb|CF711863.1,gi|41568124|gb|CF713965.1,
                     gi|41568133|gb|CF713974.1,gi|41568225|gb|CF714066.1,
                     gi|41570883|gb|CF716724.1,gi|41570889|gb|CF716730.1,
                     gi|41573459|gb|CF719300.1,gi|41576517|gb|CF722358.1"
                     /transcript_id="XM_566621.1"
                     /db_xref="GI:58258416"
                     /db_xref="GeneID:3253635"
     CDS             join(594616..594637,594700..594881,594931..595351,
                     595398..596412,596465..596656,596714..597230,
                     597289..597513,597571..598281)
                     /locus_tag="CNA02290"
                     /codon_start=1
                     /product="isoleucine-tRNA ligase"
                     /protein_id="XP_566621.1"
                     /db_xref="GI:58258417"
                     /db_xref="GeneID:3253635"
                     /translation="MSFRTHDPSKPIHIPTTEDEVLQYWRDIDAFKTSQKLSEGKPEY
                     SFFDGPPFATGKPHYGHLLAGTIKDIVTRHAHSTGHHVERRFGWDTHGLPVEHEIDKT
                     LNIKGKEDVMAMGIDKYNAACRDIVMRYSNEWKSTVERMGRWIDFETGYKTLDPTFME
                     SVWWVFGQLWKKDQVYRGLRVMPYSTGCTTPLSNFEAGEDYRMTSDPAITVSFPLADD
                     PTTSVLAWTTTPYTLPSNLALCVNPEFTYIKIHDFERDQNFILLESLLGTVYKEYQGG
                     KKPDPKKEPKFKKVGTFLGKDMVGWRYVPMFDYFTEQYEDRAFRIIADTYVTDSDGTG
                     IVHQAPAFGEDDHRICVANEIVRDDEIPPCPIDESGRFTSEVPEHQGKHVKEADSALI
                     KDLQKKGRLITRSDIMHSYPFCWRSGTPLIYRAIPSWFVRVANISDKLVKNNEKTRWV
                     PGAIGEGRFGGWLRNARDWNISRNRYWGTPIPLWVSEDYEEIVCVSSIAELEELSGQK
                     GISDLHRESIDSITIPSKQGKGTLRRIEEVFDCWFESGSMPYAQSHYPFENVERFQKS
                     YPADFISEGIDQTRGWFYTLLVLGTHLFETAPWKNLIVTGLVLAADGKKMSKKLKNYP
                     DPMEVVNKYGADCVRLFLVNSPVVRADNLRFREEGVREILTNVILKWINSLNFYLGQV
                     ELFEQTTGDKFVYDHDAKKSTNVMDRWILATCQTLIQHVETEMAAYRLYTVIPKLLDL
                     ISDLTNWYIRFNRSRLKGSGGVEDTRAALNTLYEALLTLCLTMSSFTPFTCETVYQAL
                     RPTSPAPEDPAQDVRSVHFLPFPKIRAEYFDPIIERQVQRMRAVIDLGRLIRDRKTLK
                     VKMPLKELIIFHHDQEYLDDVRSLESYIAAELNVVNIVYTSEESAVGIKYRATADWPS
                     LGKKLRKDIGKVRSHLPKMSTDECKAFVAEGKIVVNGVELVAGDLVVTRFAEVPTGEV
                     KYDTASDNDVIILLDIRRHPELENMSLLRSLTSRVNKLRKEAGLKPSDKVDIFYEYDA
                     GEEDAIRPAISGNEEYLNKQIGGVPVELSQKGEDKEVLKREVRMKEAEGLGQGERFVL
                     SLALRA"
     gene            complement(598436..>601223)
                     /locus_tag="CNA02300"
                     /db_xref="GeneID:3253640"
     mRNA            complement(join(598436..598858,598935..599004,
                     599084..600475,600524..600747,600809..>601223))
                     /locus_tag="CNA02300"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546769|gb|CF692610.1,gi|41546783|gb|CF692624.1,
                     gi|41556449|gb|CF702290.1,gi|41570622|gb|CF716463.1,
                     gi|41570626|gb|CF716467.1"
                     /transcript_id="XM_566623.1"
                     /db_xref="GI:58258420"
                     /db_xref="GeneID:3253640"
     CDS             complement(join(598746..598858,598935..599004,
                     599084..600475,600524..600747,600809..601223))
                     /locus_tag="CNA02300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566623.1"
                     /db_xref="GI:58258421"
                     /db_xref="GeneID:3253640"
                     /translation="MRPACLQLRSPPASLSTSPITSSSPPAAMHSALTPNTAAFLEYI
                     SPGDAPTSAPPAALFNNMPVPGRDTPEDTPPSASTHDSQLNEHPAPSDDSDSLTPEIA
                     LGPADDPANKDTLAGNGANKRKAGRPSAVVDDDDEDASDSDLPSGHEDKKQHGAGRAA
                     AGSASGSGRKGGRKSGGGEGDGKRELNKSERRKEQNRAAQKAFRERREAKVKDLEDKV
                     AELENKAYGTQIENENLRGILKRLQEENVALKQSAFTFSMPVNSRSSTNSNNGNFSVP
                     APQNPKPLTPPQSNNDDSLKSVNDVPMLAHRHSSTNTVSDNSSESLVSLRSSDRTPPA
                     LFSDHFNTYALGAIPVPPPSSSSQPVQKYPSASNGQQSMSSNSNSSGVISPPSADQSE
                     FNALWESLYPNDVGNLLSQNTNQNQGGPFTLLNSQPDSMSFASAGNSMNDLFNFGAPS
                     ASISTSARPSVNPAPASVTQSANHITQNLGATGQASDWNRFAFREPTAEASAPNWDVT
                     DNSVNEFLASLSGDTTTDTTANDYLNNDDEAFNAQLRKIFGTDNSPSAAFNLPSTSFS
                     PNNYLNMSPSPVMPLSNSQSPQSSDSRSNTNISSGRGNDISMIDSPEYSMGSSRTSVS
                     HESTDLQQGKISAIRSLKEYACKADNEVIHVVDEKGRVIKPSELWMRFGMQHENPTEH
                     LLIDDLCDQMRAKATCKDGKLQLDITDAAVLFQRGEGQPHSYAEKMVKKAANHSS"
     gene            601422..604832
                     /locus_tag="CNA02310"
                     /db_xref="GeneID:3253579"
     mRNA            join(601422..601612,601660..602298,602351..603007,
                     603066..604832)
                     /locus_tag="CNA02310"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41568491|gb|CF714332.1,gi|41568496|gb|CF714337.1"
                     /transcript_id="XM_567149.1"
                     /db_xref="GI:58259472"
                     /db_xref="GeneID:3253579"
     CDS             join(601424..601612,601660..602298,602351..603007,
                     603066..604682)
                     /locus_tag="CNA02310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567149.1"
                     /db_xref="GI:58259473"
                     /db_xref="GeneID:3253579"
                     /translation="MNNQNQQPPVNLSDPHLQARLALLAAQQQGLADRQPVSQDHIAA
                     MAAAMGSMQGQNRDAIMKQLQALQNSQAHRAKLAAQQTANQQPQPGPSAPSPANQPGL
                     SAPSPITAPSPSNPLHQDSFQHPGMPRSGSGDNLLNQQQQQQQQQQQQQQQQQQQQQQ
                     PFMSQQQRELFLAQQRAHQQQSMAGPSDGSVRPPSQAQPNLPGQPQGQSPRQPLSHVQ
                     QRQNFLKTFMGYFQNIGQQPPPAIFDNGEREGAFKVGDGWMDVIDLLMAVMKAGGIMN
                     AMQQPADSPTWRNLLAVKNIPTTLPYPIPAPKPPNSDPNAPPTMTTDPVQYLTAAYFA
                     YIHGFETHMQKTRQASYARQQAMAIAQGRPPPPPPVMPSLAGFRLPGQAPSPAESWSS
                     AQAQTPAPAVPSLPPPLNTSAQPPPASTAPTPTHPAPSPSDSSTKSSTTSGPPRARKA
                     SSKKEKKDLSVNTNVPSPIDGEAETPTGSSGGKKRKRKNANAPQPETASTPAPPPIVS
                     TPAPEPPAEPTKRARYRVEYRPINFPVQTFAGWEPSMVSSTFPKHSLRQGTRPIHDLA
                     VVDMEAILMGLRSRMPKELGYAVTVLNMLSMSHPEENINGLPLHHLREIFIELLDLTE
                     EAAFGDGGRSGWLKSWHDLNDVKEESAADDKNSCMDNLNKMPFFELERLGRDFDFSVY
                     KDEEEYQWRKEETSGSTGIVLACINMLRNFSMLPDNQELMASYPQMINLLASISDARL
                     CRLPGENCTKIKRPFSIIELARIRRDCVSILVNIGEYVELPRVPSSSSLAIFRLLSTF
                     IASGWESNALSEPVYGPTLSSSIRDVGPPTVVPSIDRALAAFSLLAQPDANREALGSS
                     VPPSELIDMYESLLKLLPVTKRQFEAMHSIEETLGYNETLALCLYSLAFLSPLHVRAS
                     MRNVPGSVPLLTRIIFDTALQKSDYRSNPFGILCRRLCETLGVLNGTVSPAGTVEGPS
                     GMGFGAGGIEGSGWKFASGRVENGWLAGKEEGVLGAILGVKGMSWAALGELDGMVWGG
                     DSI"
     STS             601812..602034
                     /locus_tag="CNA02310"
                     /standard_name="AGC21"
                     /db_xref="UniSTS:470885"
     repeat_region   601885..601951
                     /rpt_type=tandem
                     /rpt_unit_seq="caa"
                     /satellite="microsatellite"
     misc_feature    603042..603064
                     /locus_tag="CNA02310"
                     /note="AT_rich"
     repeat_region   604682..604708
                     /rpt_type=tandem
                     /rpt_unit_seq="taa"
                     /satellite="microsatellite"
     gene            complement(605010..605104)
                     /locus_tag="CNA02320"
                     /db_xref="GeneID:3253545"
     tRNA            complement(605010..605104)
                     /locus_tag="CNA02320"
                     /product="tRNA-Ser"
                     /codon_recognized="UCU"
                     /db_xref="GeneID:3253545"
     gene            605457..>607899
                     /locus_tag="CNA02330"
                     /db_xref="GeneID:3253825"
     mRNA            join(605457..606188,606246..606386,606441..606614,
                     606673..606837,606901..>607899)
                     /locus_tag="CNA02330"
                     /product="mRNA-nucleus export-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41575305|gb|CF721146.1"
                     /transcript_id="XM_567235.1"
                     /db_xref="GI:58259644"
                     /db_xref="GeneID:3253825"
     CDS             join(605712..606188,606246..606386,606441..606614,
                     606673..606837,606901..607899)
                     /locus_tag="CNA02330"
                     /codon_start=1
                     /product="mRNA-nucleus export-related protein"
                     /protein_id="XP_567235.1"
                     /db_xref="GI:58259645"
                     /db_xref="GeneID:3253825"
                     /translation="MAHYVPTSFKPMRSLVAAAGIQLSPSPSSDHNEGTFETEDGELL
                     LGNIIIDEFPADGDRPPVKGEHFQPPGLFNTSMMPTIVTTDGKLHVELKTKDDKAAIS
                     EKGQGEGLMLPQHVLLETSSAVQAAEDGGDDGEEGDHSLGGDDFWEGLHFVDDDIIRG
                     SRRYFNPEPEDNLEVEATFLATADSRKVCQNCKRPGHQASKCPHIICTTCGAMDEHER
                     RDCPLSKVCYGCGRRGHHKSECPDPISRNKRWAGCERCGSREHTDKNCPTLWRIYTYR
                     SDSGRRETIKLKEKAEGWVKEAIGGDAMEDWCYNCARTGHFGDDCPQRRGSLVRLTAP
                     SAFSREIARRGPFFSAPKSFLPNPTHSRWEDDDPSAIPYTSAYDSFAGSNAGRRGREK
                     EKQQMMARDTDFNDEDDWFSGDRNRNIGKGAGTPRNNPRGGRGGKRPWDSEMRGKEWD
                     RDRYDRERASREFFDRDREPPRSRGQAPPRRRSRSPNRRDGSRDNAVQETAPNSAPPK
                     AVYRPAINIRDRAIDSPSVREGERGAKAGSKALVSRALSGQNSSNSTPRGQRSSNSPS
                     ALPSLLSRIESPTPSNSTSRSRKGRGKEQERDWENEWRRRGNGGGKVANWGKDLDKET
                     EGLSLKKKTKDDISRGSSGQKYYGGYM"
     STS             609669..610502
                     /standard_name="Eco18"
                     /db_xref="UniSTS:470884"
     gene            complement(610990..>611663)
                     /locus_tag="CNA02340"
                     /db_xref="GeneID:3253646"
     mRNA            complement(join(610990..611132,611186..>611663))
                     /locus_tag="CNA02340"
                     /product="expressed protein"
                     /transcript_id="XM_566625.1"
                     /db_xref="GI:58258424"
                     /db_xref="GeneID:3253646"
     CDS             complement(join(611005..611132,611186..611663))
                     /locus_tag="CNA02340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566625.1"
                     /db_xref="GI:58258425"
                     /db_xref="GeneID:3253646"
                     /translation="MLRSQLRLPRVPLQSVYAVPSRPSRRFSHAFPTDVPPLRQRIRP
                     LVPFFIYWTIITSLVVHLMRTRQDTEASLARQQAKITVLSDLIAKLQRGETVDEGEMQ
                     RELEMVGLRERTSATLALDKEMRIVGDVGWRDMLFGKRERTAEDEAKEERVIEEWASV
                     INETANAPPPPSSANSSPRQVEQPQNRAGVAKRAPGSNVYL"
     gene            612949..617216
                     /locus_tag="CNA02350"
                     /db_xref="GeneID:3253678"
     mRNA            join(612949..612988,613185..613805,613872..614019,
                     614075..614281,614395..614604,614675..615101,
                     615286..615411,615465..616101,616152..616240,
                     616304..616829,616889..617216)
                     /locus_tag="CNA02350"
                     /product="Ras guanyl-nucleotide exchange factor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533833|gb|CF679674.1,gi|41540050|gb|CF685891.1,
                     gi|41547298|gb|CF693139.1"
                     /transcript_id="XM_566627.1"
                     /db_xref="GI:58258428"
                     /db_xref="GeneID:3253678"
     CDS             join(613194..613805,613872..614019,614075..614281,
                     614395..614604,614675..615101,615286..615411,
                     615465..616101,616152..616240,616304..616829,
                     616889..616978)
                     /locus_tag="CNA02350"
                     /codon_start=1
                     /product="Ras guanyl-nucleotide exchange factor"
                     /protein_id="XP_566627.1"
                     /db_xref="GI:58258429"
                     /db_xref="GeneID:3253678"
                     /translation="MHRPNAKQLTLGCLLPPTPSELVSPVTPSPMSPASFHTATAGTP
                     DTLARVTSEEDDRSRYGAKGPDVPPVALPGYQHSLSYLDSLQELNPDPAQAALLQSAR
                     LKLSSKDKEAMRKIRFTMMEQNFSDSASSNSVSPSSPRFPQYSAAGPSKGQELRTRRS
                     ILSKFVVTEPRGDSGEDEDVERLETMKRWQSQPALSRERHCMTNFLSTPACSVDYAIA
                     VVGHEGVGKTTIIAEALRGWGMSNPLSIYSPDGHLIFSCCSQIAAGGKLKTGCKVEFF
                     EMGINALDLTPGAASIWPSSALKVSGAVCCYDARREETLEGLKNCIEQLSATSTPIVI
                     IACKSDPDAELRVIAAHGNSMGEPCNVGLIEVTIKTHEGKLKMRNAVRWLLYKLEQRQ
                     RRQQRQLSALNIAQSLVSGVQAPTAVGSIDVTKSTIGSLASLDSDADCLGDRSMWEQT
                     LSTASKTSEAPLIGQTPGVEEEIREDQKSTSYGVGKLVTPDKERIMNDGSLGCLDNLE
                     ESTRREKKQTGRVQAKHDTIADQIAEGSFFLTYRRFCHPQDLMLEFLKRFREIEDYAV
                     SSDVKNWALLKLTGALVDWTNRYPGDCVSMSTPIIFSEIIILLSKHTFMAHLISDLIL
                     VQDALPKTTDPDESWSMRSHDVTSHNVEKSIQVLIDKEGGSKLDDNEEEDEVGSLGHK
                     AASELSASTGSLQLEEVQRQGSGSDSHRVRIPSGVSVLGEEGSLSSEGQHSHTRPAGS
                     SYRMNSMQVSDEVADARWGNALNMVMRMEPRVFATELTRMQWELFLDIRPRDVFRHTL
                     GKETGGPVRKSINFFNHLSRWISTIVLASSKAKHRARVIERFIFIAHQLRRLNNYDSL
                     YAVISGLREASVHRLSASQALIQLSPIAEQDYHSHLKLMDPRSGYTQYRKALQADIDN
                     GRGAIPLLNNILGLVSRLQGVRPNDCREEDGKIQWDKFMRFGEILSMIQECQTRGPMV
                     NGQVGQGFKKVIEETIILSDEDALWERSQSLENSGGTIGGKMLRRLANLGF"
     gene            complement(617222..>619401)
                     /locus_tag="CNA02360"
                     /db_xref="GeneID:3253682"
     mRNA            complement(join(617222..619090,619141..>619401))
                     /locus_tag="CNA02360"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538734|gb|CF684575.1,gi|41538747|gb|CF684588.1"
                     /transcript_id="XM_566628.1"
                     /db_xref="GI:58258430"
                     /db_xref="GeneID:3253682"
     CDS             complement(join(617282..619090,619141..619401))
                     /locus_tag="CNA02360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566628.1"
                     /db_xref="GI:58258431"
                     /db_xref="GeneID:3253682"
                     /translation="MSLSSQTTLISPSAKHTNPPLHRRPSQHARRKSLHAAHPHAHAH
                     AHTHAHGHAHGRRGSEGEAGRRALAAGLAMHTLDQSKKKKQGERPLPRGNRSDTHLPR
                     LTRTDSTMSIASHSSATSNVSRPSAKSRRTTESIQMIDDQGKEVDPNEDEWESGEDVK
                     QTKKGKGKQQEPSSAAMRRTVSDTTSDPKGKRTQSIAEAMARGDLVDIQDPDHRPLLT
                     QRTTGFAGTVQPPDPQVAAEMPHVDHPIITNPIKRVASSKSLVGPISAITSIDTTPDV
                     GLPTEPPRGLQSATSEPKRPSSGPSLRSISGSGLPRDPTDQRDEAQARDKLTDSPSYP
                     FPKMASPTESEQKASPKDDHPEKKIPTASRSQATSSKAARSLRHRPSNSSLRSIQSLR
                     APPHPLNSPISYTGRNAAHESPSRGSYDKRDRVPSMHQPPVPQPQVSYEVAQGQGWDQ
                     IPEEDVQRENAPVSNQSNVDAGTTHSQNLRRSSVASTRSLRSIFAGTLAPPSAASSTP
                     QPHKRLTALEAASAASKRPTTDNPVLYHHSLSHASGSAESCFLISRFLPPKKIRRPKW
                     EVDIHDQERIENGGVGLTNGDYRSAHETLVSTFRELGTGAMHQKRGLPRTASGYSLLP
                     TGLTLSSVAAATGVSNGHQDNQGLGTIKARDGARLEVARGGSGGMTPFEMSVERVLKQ
                     RPGRVTL"
     gene            619698..623370
                     /locus_tag="CNA02370"
                     /db_xref="GeneID:3253690"
     mRNA            join(619698..619915,619965..620123,620176..620391,
                     620448..620575,620628..620725,620787..620797,
                     620846..620962,621013..621165,621222..621327,
                     621396..621725,621778..621904,621961..622321,
                     622376..622545,622610..622828,622892..623370)
                     /locus_tag="CNA02370"
                     /product="saccharopine dehydrogenase (NADP+,
                     L-glutamate-forming), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534149|gb|CF679990.1,gi|41534154|gb|CF679995.1,
                     gi|41536186|gb|CF682027.1,gi|41539016|gb|CF684857.1,
                     gi|41539030|gb|CF684871.1,gi|41539033|gb|CF684874.1,
                     gi|41539605|gb|CF685446.1,gi|41541171|gb|CF687012.1,
                     gi|41541175|gb|CF687016.1,gi|41543472|gb|CF689313.1,
                     gi|41543482|gb|CF689323.1,gi|41543609|gb|CF689450.1,
                     gi|41543614|gb|CF689455.1,gi|41544051|gb|CF689892.1,
                     gi|41544840|gb|CF690681.1,gi|41545805|gb|CF691646.1,
                     gi|41545812|gb|CF691653.1,gi|41547107|gb|CF692948.1,
                     gi|41547563|gb|CF693404.1,gi|41551177|gb|CF697018.1,
                     gi|41551469|gb|CF697310.1,gi|41551482|gb|CF697323.1,
                     gi|41551634|gb|CF697475.1,gi|41551645|gb|CF697486.1,
                     gi|41555917|gb|CF701758.1,gi|41556268|gb|CF702109.1,
                     gi|41556427|gb|CF702268.1,gi|41556434|gb|CF702275.1,
                     gi|41557326|gb|CF703167.1,gi|41557336|gb|CF703177.1,
                     gi|41558059|gb|CF703900.1,gi|41558066|gb|CF703907.1,
                     gi|41558703|gb|CF704544.1,gi|41558709|gb|CF704550.1,
                     gi|41563544|gb|CF709385.1,gi|41563555|gb|CF709396.1,
                     gi|41569533|gb|CF715374.1,gi|41569544|gb|CF715385.1,
                     gi|415"
                     /transcript_id="XM_566629.1"
                     /db_xref="GI:58258432"
                     /db_xref="GeneID:3253690"
     CDS             join(619700..619915,619965..620123,620176..620391,
                     620448..620575,620628..620725,620787..620797,
                     620846..620962,621013..621165,621222..621327,
                     621396..621725,621778..621904,621961..622321,
                     622376..622545,622610..622828,622892..623285)
                     /locus_tag="CNA02370"
                     /codon_start=1
                     /product="saccharopine dehydrogenase (NADP+,
                     L-glutamate-forming)"
                     /protein_id="XP_566629.1"
                     /db_xref="GI:58258433"
                     /db_xref="GeneID:3253690"
                     /translation="MRTLPLTRSPFITRRCLTTLGLRREDPSRIWERRTPLTPHAVQS
                     LLADAKDQLKVEVESCKRRCFPDSLYSDAGAKIVPSLSKDVDVILGIKEPRLSDIRNL
                     VEASKNEGKKRTWMMFSHTHKGQEYNIPLLSAFLHPTQTLIDHELLTAPAPGKDGKPQ
                     LKRVAAFGWFAGAVGAGEALSLTGLALLRRGLATPLLSLSRPYSLGSLAAFKEALKKA
                     GEEVKTSADLKGQEPIVIGVTGAGNVSSGATEMLNELGVVWVGPEDLADLRQSGSPNK
                     IYACAITPASYLQRIEGGIFDKQEYYKSPDKYMSIFAAKIAPHLTTLINGVGWSKGFP
                     RAITRPSLNKLIEKENGKQKLVAVQDITCDKEGGLEFVDQFTTVDNPYFEGPGDILIS
                     AIDILPTELAADASSYFSSALYPYIQGLLFPSGQGDKNDITETLSRAAIVKDGVLQSQ
                     HEWLGEKIEQWKTGGAVAPDSLKQEKLRKGGKKKVLLLGSGLVAGPAVDVFAARPDVH
                     LIIASNNLAEGQSHIRGRPNVEAMALDVADDASMSEIVEEADIVVSLLPAPMHLRVAK
                     HCLDHSRHLVTASYVSPELQALHSQAIEKDVIFLGECGLDPGIDSMAAMRILERAKRE
                     GKQVKSFVSWCGGLPELSASKVPLRYKFSWSPKAVLTAAQNDASYKLEGKHVKIPGNE
                     LLARRFPEVKLWDGLPLEGLANRDSMPYAKKYGLGPAEGLTDLFRGTLRYQGFSSLLE
                     SFRLLGLLRSDPLPGSPKSWTEFLSMTVERELGLSKGLKGEDVSSAVQDLVGEGSKDV
                     IRALKLFSLFPGSDTSLLPLPNLPTPSPIDFFAHLLSRKLAYLPDERDTCLLHHSFTI
                     STPSGDTQKVTASLRHMATPTQSSMSITVGKTLAFAALRIADGEVKVRGVTGPYEPEV
                     WAGVLSSLEGAGVVIEEKWH"
     gene            complement(623351..625027)
                     /locus_tag="CNA02380"
                     /db_xref="GeneID:3253533"
     mRNA            complement(join(623351..623794,623847..624278,
                     624331..625027))
                     /locus_tag="CNA02380"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41569766|gb|CF715607.1,gi|41569768|gb|CF715609.1"
                     /transcript_id="XM_566630.1"
                     /db_xref="GI:58258434"
                     /db_xref="GeneID:3253533"
     CDS             complement(join(623439..623794,623847..624278,
                     624331..624886))
                     /locus_tag="CNA02380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566630.1"
                     /db_xref="GI:58258435"
                     /db_xref="GeneID:3253533"
                     /translation="MRSSPKLTLTLGNPQSRDNDPAVESAGTWTCRVCGYVNERKGLG
                     KSGKCGLCGVPYAQAVASPSVSATPSRAGTPNSSGFTPPSSTADDKEGESKVACPACT
                     FLNSALLRNCEICATPLPRLPQLNTIREKPEKQQVVRLSFRKGGDKEAYKKLSSVLGD
                     KAWEREGRSSAQTTSSNGERSGAGIDGILQSIDLSAKAQDTHMQTAFADLEALMLRAG
                     EMVRLAQSLNQKLSSQQQAGASSPTGSPQGQTTEEEATMIRTSLVQLGLATPALTKEM
                     VKNERAYHEGLAKELGGLLTGRDGESGLMVGEGGRGVVALDEVWGLWMRARGVALLSP
                     QALIDTLPYLPNYTSPSIHSLRLPSSLMVLHTPTFSTLSILSRTLSRLEPSFPNSDPF
                     EKSFSLLEFASTESLPIGLAQEFVGLMESQAGLVRDDQAGQGDGGVRWYRDIISP"
     gene            626188..627879
                     /locus_tag="CNA02390"
                     /db_xref="GeneID:3253194"
     mRNA            join(626188..626778,626830..626971,627019..627169,
                     627221..627308,627359..627879)
                     /locus_tag="CNA02390"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535681|gb|CF681522.1,gi|41535689|gb|CF681530.1,
                     gi|41541593|gb|CF687434.1,gi|41541600|gb|CF687441.1,
                     gi|41575375|gb|CF721216.1"
                     /transcript_id="XM_566631.1"
                     /db_xref="GI:58258436"
                     /db_xref="GeneID:3253194"
     CDS             join(626413..626778,626830..626971,627019..627169,
                     627221..627308,627359..627715)
                     /locus_tag="CNA02390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566631.1"
                     /db_xref="GI:58258437"
                     /db_xref="GeneID:3253194"
                     /translation="MTHPGCVLCGLVRSCGSGSNPSSPVLSPQDSTTPLPSSSRTPSL
                     ATSFADSGVPGPYHHPFERTQSPAPDGRRTGNRVGGREIVYHDKDITVYKAEGKERLC
                     QGGRHIIIVVNEHLQSVYEFGASDIPLLSHILDTAAQILNSVAAAGDDLESGKGKEKL
                     HVGFVGSIIKDPQSPHAHLHAHAYLTPIDTKLSGASLWRRNVVFGSLNWWSIEDLRAE
                     IREATSNNRVKTGYEYRQAPIDKVPDAGAAIAPAYALNPTYSDVPSPVSQSKQHALQQ
                     QQPQPSSYRPQPGPSSVSKDRLSPLPTHPLEEVGSIESVVSMSTVTPQTSNSGRTSRE
                     DKGKGKEQEQAISDWEEVQYGSEGSERLSDRII"
     gene            628241..630385
                     /locus_tag="CNA02400"
                     /db_xref="GeneID:3253633"
     mRNA            join(628241..628399,628502..629249,629308..629508,
                     629559..629749,629801..629970,630026..630079,
                     630133..630385)
                     /locus_tag="CNA02400"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534189|gb|CF680030.1,gi|41534199|gb|CF680040.1,
                     gi|41537467|gb|CF683308.1,gi|41540488|gb|CF686329.1,
                     gi|41540500|gb|CF686341.1,gi|41540767|gb|CF686608.1,
                     gi|41540780|gb|CF686621.1,gi|41554269|gb|CF700110.1,
                     gi|41558583|gb|CF704424.1,gi|41565649|gb|CF711490.1,
                     gi|41565651|gb|CF711492.1,gi|41571514|gb|CF717355.1,
                     gi|41571524|gb|CF717365.1,gi|41573835|gb|CF719676.1,
                     gi|41573843|gb|CF719684.1"
                     /transcript_id="XM_567252.1"
                     /db_xref="GI:58259678"
                     /db_xref="GeneID:3253633"
     CDS             join(628583..629249,629308..629508,629559..629749,
                     629801..629970,630026..630079,630133..630178)
                     /locus_tag="CNA02400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567252.1"
                     /db_xref="GI:58259679"
                     /db_xref="GeneID:3253633"
                     /translation="MLATNLISLVLVLPTLALAGHNSPFNGHSPSRRHHHARAASFAL
                     THASPTSNELLKRTYHDAIEHKMARKRAGKKFAKRGADGSQCRVKGQSYVPTGVSSTS
                     AISSTAASSIASSPSPASTDAIASTSASAVAPDSSASASTSTSDESAPTSSAWIDNQQ
                     NWVDATSSSEQAAATSASSSSPSSSSGTSVVSYAGLTPNGNKAGVSAGDSLPWVASKL
                     GWWYDWSATPSGDCGSAVTVPMLWGGGIADATDASRLVAFEALSQSPSYIIGFEEPDC
                     AAGSGSSGLDVATGIALWDSLIAPKGEAGTILVGPSMCKQAAESGWLGPFMEGVSRKP
                     DIMNIHVNKNSAAGIQLDIDHYWNTYGLPIWVTEFACVDDSTDFVPCTDQDEINSFIN
                     TAVDIFETDSRIAGYAYSNGYGLSENWMMVKDGQLSESGQTYLAAISKYH"
     gene            complement(631963..632599)
                     /locus_tag="CNA02410"
                     /db_xref="GeneID:3253528"
     mRNA            complement(join(631963..632081,632151..632273,
                     632338..632383,632449..632599))
                     /locus_tag="CNA02410"
                     /product="transcriptional elongation regulator, putative"
                     /transcript_id="XM_566632.1"
                     /db_xref="GI:58258438"
                     /db_xref="GeneID:3253528"
     CDS             complement(join(632051..632081,632151..632273,
                     632338..632383,632449..632590))
                     /locus_tag="CNA02410"
                     /codon_start=1
                     /product="transcriptional elongation regulator"
                     /protein_id="XP_566632.1"
                     /db_xref="GI:58258439"
                     /db_xref="GeneID:3253528"
                     /translation="MSAGKKAQTQPPEDDYVLLESADGYTFVVSRKIACASGMLKSML
                     DEDAAFEESKNKTCRIQQRGVILAKVIEYLAYKVQWSECLAEEVNEDFSDRIDPYIAL
                     ELLTAADFLDC"
     gene            632814..635958
                     /locus_tag="CNA02420"
                     /db_xref="GeneID:3253529"
     mRNA            join(632814..632903,632945..633112,633169..633288,
                     633335..633478,633531..633825,633870..633991,
                     634043..634327,634370..634471,634531..634640,
                     634697..634838,634893..635047,635104..635407,
                     635455..635595,635653..635958)
                     /locus_tag="CNA02420"
                     /product="rsec15, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538599|gb|CF684440.1,gi|41538606|gb|CF684447.1,
                     gi|41540858|gb|CF686699.1,gi|41540871|gb|CF686712.1,
                     gi|41542246|gb|CF688087.1,gi|41542248|gb|CF688089.1,
                     gi|41559959|gb|CF705800.1"
                     /transcript_id="XM_566633.1"
                     /db_xref="GI:58258440"
                     /db_xref="GeneID:3253529"
     CDS             join(632844..632903,632945..633112,633169..633288,
                     633335..633478,633531..633825,633870..633991,
                     634043..634327,634370..634471,634531..634640,
                     634697..634838,634893..635047,635104..635407,
                     635455..635595,635653..635865)
                     /locus_tag="CNA02420"
                     /codon_start=1
                     /product="rsec15"
                     /protein_id="XP_566633.1"
                     /db_xref="GI:58258441"
                     /db_xref="GeneID:3253529"
                     /translation="MIRRQRPTFTTSELELQLQQINLDPTSSTTENLEALAPLIKSIQ
                     DTDSEQLYLRSLDNFVEEKEREIEEICQENYEDFVSSVSTLLTIRQGTVHLRRRIGEL
                     DGQMGDVGRALGEKKRALLEQKKVARNMDDAIETLQTCLRLLDLVHRIDEMVREGKYW
                     GALRSLEDLLHLPPPSISQTPFYAHILSSLPSLRLSIKDAVTASTKTWLFDVRESSAK
                     VGKLALEQMALRTRKWRMKREREGGVRLARVGGPLELVHNERVEFDALDNDEIKVDFK
                     PLYHCIHIYEALGQKPELQRSYQEDRKTQATLILTSRLSTTPSTLVNTLPLLMQELVG
                     FFIIEAHVLDTMPDFRTQRDVDELWDEMCRRIVEVMGQGLKGCSEPGVFLSSKTEVLL
                     FVQTLEVYGYNITELNGLLITLFERYSELLLRKFGADFDQIVSDDDNQPMMVNDHEEF
                     DQVAGVCWLAKGEAESLAMQGFPQPMPFSQTYPMCCINIRNFVDQFYQFTDGVAQQHL
                     DVDEVLRRSLDGLLSDHVSKQIAKKLQTMLNLSQIAQVVINLEHFCTACNELESVLMN
                     LRASQRGGPIKLASGASFNSTLSAAQSRIDSIINSKLESFFELAEYNWMPVRPQSTVE
                     EPSTYVFEMITFLTAYVDSVLIGLKEEFKTGAYRNALMRINRWLMDTLTGQEVVRLNE
                     SALASVLADVSFIETEIKRLGKSELDHVFDEVKHTINIILSDAVQAYMEPSIRSMSYP
                     SVKPLSLAMILAKLSKAASSQGGQANMFKAARRRGEADEVARLAGK"
     gene            <636106..637625
                     /locus_tag="CNA02430"
                     /db_xref="GeneID:3253638"
     mRNA            join(<636106..636196,636266..636340,636426..636699,
                     636760..636865,636940..637007,637059..637625)
                     /locus_tag="CNA02430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567150.1"
                     /db_xref="GI:58259474"
                     /db_xref="GeneID:3253638"
     CDS             join(636106..636196,636266..636340,636426..636699,
                     636760..636865,636940..637007,637059..637572)
                     /locus_tag="CNA02430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567150.1"
                     /db_xref="GI:58259475"
                     /db_xref="GeneID:3253638"
                     /translation="MITRRLASTVSVPPETKSPRKIVLVGAGFLGSYVVKALIADPRN
                     RIQIVSRHPQSLHSKLSTLGAQILPPASVDITSPSSTSELRKAFKGASAVVSLAGLLV
                     GSDKQMKALQEDGARRVGEAASEEGVGRVVGVSAIGADLRGVTAYWRTKAKGEDAIRE
                     YHPTATIIRPSLLFGPGDSFFSRFATLAKYLPFLPVFGGGITRFQPVYVGDVARAVEI
                     CCRDDPIVVSQVAGRIIEAGGPDIFTYREMMELVLRYTHLEGRRAIISLPYWLGSVQG
                     FFLEKLPETMFTVTRDQVKQLRNDNIVSPHPPMFAQNFEDLLKAFPSSAPSSAPPGDA
                     GLQSVYDILPTYLGVGKREEGKRTHGRKSASLDEVKGMGKR"
     gene            complement(637734..>638185)
                     /locus_tag="CNA02440"
                     /db_xref="GeneID:3253590"
     mRNA            complement(join(637734..637848,637894..637992,
                     638028..>638185))
                     /locus_tag="CNA02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_566643.1"
                     /db_xref="GI:58258460"
                     /db_xref="GeneID:3253590"
     CDS             complement(join(637770..637848,637894..637992,
                     638028..638185))
                     /locus_tag="CNA02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566643.1"
                     /db_xref="GI:58258461"
                     /db_xref="GeneID:3253590"
                     /translation="MTPPPVLDKAPAKSAQLFPYHLPLSPEWAEYSDWYSQTAMTSAA
                     AGMFIKQPIIVWGAFALAVFGYVNQQPLRQPKDATAPLLVLGMALAGVVGSILPKTML
                     APQTQSVPA"
     gene            <638287..639521
                     /locus_tag="CNA02450"
                     /db_xref="GeneID:3253595"
     mRNA            join(<638287..638348,638409..638638,638691..639521)
                     /locus_tag="CNA02450"
                     /product="aspartate-semialdehyde dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41549544|gb|CF695385.1,gi|41549550|gb|CF695391.1"
                     /transcript_id="XM_566645.1"
                     /db_xref="GI:58258464"
                     /db_xref="GeneID:3253595"
     CDS             join(638287..638348,638409..638638,638691..639496)
                     /locus_tag="CNA02450"
                     /codon_start=1
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="XP_566645.1"
                     /db_xref="GI:58258465"
                     /db_xref="GeneID:3253595"
                     /translation="MSPRPQIKVGVLGATGTVGQRFIELLAAHPYFALHALGASSRSA
                     GQQYARVVRWKLPSPIPDAVRHMVVHECRPDAPGFAECGVVFSGLDADVAGDIENAFR
                     AADLVVYSNAKNYRRDPLCPLIVPLVNPSHLSIIPYQREQLGLKKGYIVTNANCSTTG
                     IVVPLAALEKAFGPLDTVIVTTLQAISGAGYPGVSSLDIMDNVVPLISGEEDKIEWET
                     NKILGGVTPDNKAFDLHAPKQINVSATCTRVPVIDGHTGCVSVKFARSPPPSVAEVEN
                     AFREYTCDAQHLGVPSAPAQAIVVHDAPDRPQPRLDKNLHNGACVSVGRIRECPVFDI
                     KFVCLIDNVRLGAATSSIINAEIAVEKGLIQ"
     misc_feature    638370..638392
                     /locus_tag="CNA02450"
                     /note="GC_rich"
     gene            complement(<639648..>645332)
                     /locus_tag="CNA02460"
                     /db_xref="GeneID:3253511"
     mRNA            complement(join(<639648..639659,639719..639951,
                     640005..640077,640139..641188,641248..641359,
                     641424..641848,641899..642070,642126..643231,
                     643285..643342,643395..643522,643681..644262,
                     644437..644740,644799..645078,645140..>645332))
                     /locus_tag="CNA02460"
                     /product="kinesin family member 21A, putative"
                     /transcript_id="XM_566647.1"
                     /db_xref="GI:58258468"
                     /db_xref="GeneID:3253511"
     CDS             complement(join(639648..639659,639719..639951,
                     640005..640077,640139..641188,641248..641359,
                     641424..641848,641899..642070,642126..643231,
                     643285..643342,643395..643522,643681..644262,
                     644437..644740,644799..645078,645140..645332))
                     /locus_tag="CNA02460"
                     /codon_start=1
                     /product="kinesin family member 21A"
                     /protein_id="XP_566647.1"
                     /db_xref="GI:58258469"
                     /db_xref="GeneID:3253511"
                     /translation="MSLSRRQSIAPPSPLSPSSITRPNSSAGQSTFGHTRASLSSDAS
                     SIAAGAKETPNTLENRNVKVVLRIRPSDPDDPSIPPRFRSVLVHPTSKSDIRVDVDPA
                     ALTGHGPSISTGGKKYSSFSFDYVLGESAQQTDLYQCTAGESVDEFMKGHNVTFLAYG
                     QTSSGKSYSMGTTGDNIDYSGTEFTPRTGLIPRTVQSIFERAEDNKQKSGPGASWEAR
                     LSFLELYNEEIIDLLSGAGISISIREERDGRIVWSGVREVKTPTRQLRRPSSMIGFPA
                     SGPRSPTLPHSRSGPPSSFSRMTPSRPQSAINPSASTEEFVVITSKFNMVDLAGSERL
                     KRTAAQGDRMKEGISINSGLLALGNVISTLSDPVKSRGHIPYRDSKLTRMLQDSIGGN
                     ALTTMIACISPIEANIGETLNTIKYASRARNIRNSAKVNQVEAGWDDVEYLQNAVLKL
                     RKQLYDRYLAKCSENMRLSSELKSRGPGDGDALTKFNETVEPVILEYEKVVSALNQQL
                     EELRGEIALMNEMSEERSRLLQDAQERQLQSETYLAELRMRMVKLADRNASSEAYIQD
                     LEAKLKTYADKEDTHILVATELKKEIAKLRESGTTSAKNVSELEARLTTSEALRENLA
                     TQVEKYERDAAIHEKAFRELEAHIAHLEAADHNKRLLEELAQKNSKITELEDQLKAKG
                     QSHFEQKEKELSETVEDEQSTQKGLDSKFALSEIPSGSNTGPVAPPCERADASALAVG
                     IDGPKTILDKEMPPSQADRESSQLEQLKKELKELSAKYSESETRIADLTAKISEASLV
                     QGVTDDMVKVSQTTTEELSQTHNQDEDGVGRKGMAVSRAESNSSLDSDEEQTSMRRAS
                     LPLLSRSNISVKQGFRGGRGYLVSKGNRPQSLSQELFSAQSLATSPCAMWSQPVTKSL
                     LSSPTVQVRPSSRSSQSLETELRFVHRVIDERDKELRDREAYILQLEKQLEIAVAHDI
                     LSRKTSAKINVEADMPQTPVTSGIQVYPRDVPLPPSPQAHFIPVMSVDMVHISEEDGE
                     SSETSKGRDYESSSVGVSPRSVERFKEVADSTNQCKNGDAKVAQQFRIEKLIKDMAEK
                     EASQRRIIEQQFIQIADLQKTIKKLKEKLMEGDPYVVDIGSLWEERDVLIVEKAKQSC
                     PIPSSASFPHSKESFASDAFALDRLRDEHAAELEALMAGHSQTTDMSQLEFTKRLETC
                     QKEIEDNQITINTLRARIESVEREHRLSLTKWDQASKSKDIAHHDELESLKTMHSEVV
                     ASLEAAHTQALETLQAEQDFVSREMESSLSENEEQRRQLKMKADEALFELSRVRDERA
                     VERYNDARQISELSENNARLENIKVELENANAELMATCAELTRKKTSELEQKSGRKAV
                     VRPPQGPPPTVPLPPTPQGSFAVNGAVHADDVRGSIKLTVSSEQEQGGAKRQSESSEM
                     LNEAGAQAVYDAAVAERDGLESEMEREREKIKEIEAKLEDEKVKVNNLALDLRASQKM
                     ANNLRVHLDEARQETKRSTAACREHVAELEARREQMGKISQDQRSQRDSLQAAQAQVA
                     SLKMQLERAVDNKVGKKGLRIKS"
     STS             644859..645642
                     /standard_name="Xba22"
                     /db_xref="UniSTS:470886"
     gene            complement(646141..650569)
                     /locus_tag="CNA02470"
                     /db_xref="GeneID:3253671"
     mRNA            complement(join(646141..646808,646883..647544,
                     647803..648697,649670..650002,650054..650569))
                     /locus_tag="CNA02470"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543186|gb|CF689027.1,gi|41543198|gb|CF689039.1"
                     /transcript_id="XM_567151.1"
                     /db_xref="GI:58259476"
                     /db_xref="GeneID:3253671"
     CDS             complement(join(646566..646808,646883..647544,
                     647803..648697,649670..649720))
                     /locus_tag="CNA02470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567151.1"
                     /db_xref="GI:58259477"
                     /db_xref="GeneID:3253671"
                     /translation="MWDKKLSAFVLGERSERLRNHLRHIQRQVDHWHRHQLSRSSSNR
                     LTQIPSQKEDETDYMESNERNTPRHEEYALYPRPESDIGDLWSLFNQPPGSQLSLSHP
                     HHSHSEFPLWGPTPLTYLHEFISRHSSPNHPLLPPSCPTLSIFISNQILDPLLAHATL
                     ISTSLVSLYLHDLRFLDHLDVLRAFWLAGDVGFTERVSSALFGKDSAGAGEAVGLGKR
                     ARIRARLGLGEDDDKQDRDSDWGIGLGIGLSERSRWPPGGAELAYALRTTLLNHEDND
                     RKKSTGSVWQDVGDRVSFAVRELPEEENSGKRARWLNPQVDLVLRTMYWDVIHQFELF
                     NEPHKIGVDLRPSSGLPCYRLQERSTHSLFPKGSIAQRRLQILRFRMTHFVNVFGRYV
                     LDIAIGSNWDAMKRRLERLRKDCTGKAHNRQGTSEEESDEAWVESTLHDEEIDEIAPG
                     GIRRLQSIHSIVLYHNMVLDKICRACLLGPQSGQQVTFKILMVLFGLVLDLGKTVKEV
                     ERGVRGWEDGVEKVDEIEKEWHEKEATFLHALERLSLRSTHPKTNTMERDGIDQDLQV
                     LHSSAPETANGGHGNPEGLAGNDLRELWLRLTFKEGGGIAVRGIRKNEDD"
     gene            650743..652049
                     /locus_tag="CNA02480"
                     /db_xref="GeneID:3253539"
     mRNA            join(650743..650932,650984..651200,651253..651349,
                     651394..651855,651915..652049)
                     /locus_tag="CNA02480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566634.1"
                     /db_xref="GI:58258442"
                     /db_xref="GeneID:3253539"
     CDS             join(650897..650932,650984..651200,651253..651349,
                     651394..651855,651915..651966)
                     /locus_tag="CNA02480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566634.1"
                     /db_xref="GI:58258443"
                     /db_xref="GeneID:3253539"
                     /translation="MSRPEEISPPEIFYGDTEAAKYTANTRIKNIQSQMTERALQLLA
                     LPEDQSAYVLDIGCGSGLSGELLDEEGHVWVGVDIAPSMLEVALEREVEGDLFLQDIG
                     QGFGFRPGTFDGAISISVIQWLLNADSSSHSPPQRLNRFFTTLHACLRNPSRAVFQFY
                     PSSDDQVTMITTAAQRAGFGGGLVVDYPNSRKARKMYLCLMVGQQEIPKALDGDEMDV
                     DEETIGKRRDEIKNERRRRREARRKTKKGNKDVKAKEWILKKKDLYRTRGKEGVPRDS
                     KYTARKRKTYF"
     gene            complement(652165..654177)
                     /locus_tag="CNA02490"
                     /db_xref="GeneID:3253544"
     mRNA            complement(join(652165..652851,652899..653021,
                     653087..653216,653274..653454,653507..653666,
                     653796..653986,654053..654177))
                     /locus_tag="CNA02490"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533647|gb|CF679488.1,gi|41533656|gb|CF679497.1,
                     gi|41556178|gb|CF702019.1,gi|41556187|gb|CF702028.1,
                     gi|41558507|gb|CF704348.1,gi|41564976|gb|CF710817.1"
                     /transcript_id="XM_566635.1"
                     /db_xref="GI:58258444"
                     /db_xref="GeneID:3253544"
     CDS             complement(join(652776..652851,652899..653021,
                     653087..653216,653274..653454,653507..653666,
                     653796..653986,654053..654055))
                     /locus_tag="CNA02490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566635.1"
                     /db_xref="GI:58258445"
                     /db_xref="GeneID:3253544"
                     /translation="MSQPESSVAPPRESYDERAASPLPRDYAEDKYSTRPPPARYDDE
                     LRDDSYSAKGGDTYRSDRPAFEAPRRPAQAPPPVNPNPVLGVFGLSIRTRERDLEDEF
                     MRYGDVEKVVIVYDQRTDRSRGFGFITMRTVDDAARCIEKLNGLSLHGRNIRVDYSAT
                     QKPHSSTPGQYMGAKRPVRDDRYGRGRYDDRRGGYGDRRHDDRRDYYGSSSSRHDDRD
                     GGYRESYGSRRTGDPYEGRSRRDDYSYDKYDKQDKYADYDYDRRSSRRSRYSASPARS
                     TAAPAPEVPRY"
     gene            657166..658705
                     /locus_tag="CNA02500"
                     /db_xref="GeneID:3253543"
     mRNA            join(657166..657632,657703..658226,658285..658705)
                     /locus_tag="CNA02500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566636.1"
                     /db_xref="GI:58258446"
                     /db_xref="GeneID:3253543"
     CDS             join(657212..657632,657703..658226,658285..658677)
                     /locus_tag="CNA02500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566636.1"
                     /db_xref="GI:58258447"
                     /db_xref="GeneID:3253543"
                     /translation="MPRRSAKYKATARARELYRMATILNHKQLKASLSIPYHALRTSR
                     YLNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLRVNHTEFRKLLCLIKDHPVFVSH
                     GPRKQANPLLQLTVALYRLGHCGCAASTFEIGEQFGVSEGTSAIWTTRVIKAILSLER
                     NNVYWPDENERKAIDRHFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVDFFSYKGRY
                     GFNILGICDHLKRIRYFQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVH
                     SEMISQGEYLLADSAFPAGDWCVPLFKRRRGQNDLDRPEAKFNKKCSSARVKIEHAYG
                     ILKNRWQSLRSLRVKIRNVRDEGVATCWIRACVVLHNLLIDTGDWYNRLDGDADEPDD
                     YIDIERMQERMERVLERHREEEEDEARDARDASNLTRKRVMERMQEIERRDLL"
     gene            complement(<658726..>660045)
                     /locus_tag="CNA02510"
                     /db_xref="GeneID:3253541"
     mRNA            complement(join(<658726..659441,659502..659595,
                     659650..>660045))
                     /locus_tag="CNA02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_566637.1"
                     /db_xref="GI:58258448"
                     /db_xref="GeneID:3253541"
     CDS             complement(join(658726..659441,659502..659595,
                     659650..660045))
                     /locus_tag="CNA02510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566637.1"
                     /db_xref="GI:58258449"
                     /db_xref="GeneID:3253541"
                     /translation="MISRRVTCFFLLEILHIPPLTYFYLRLRSSQQSPIMPPKRQNEN
                     ENQASEATQKKQRNSNKQWATDTNSDGVSAEEHVAVWLSTIPENGRLPNFHNWKTGHE
                     KKDFWSRKCLQYLTDNGCDSRRQFQSVALKINQIVESFTKASQIGTGTGAGAMEIDDE
                     SLLAQRKKVCPFYEILLPVLGDRASVTAHHASSTLHASLNRPDRDLAALDGLIERQRG
                     EMAADDSEDELSGEDGGLFGDGAGEASETESEADAPIIAAIRRESRSSSQPARSSSVL
                     GSVSTPIRAQTQSQRASIRSSKAKAVSADDKMDELVMRQEGNDDRRHQELLAVQERKI
                     SVQEKHHADMMNIAQENVTIARENAATEKMKMLAESWNRKMEMLMRSGKSWEEAKVMV
                     GPEPGAPSL"
     gene            660955..662014
                     /locus_tag="CNA02520"
                     /db_xref="GeneID:3253549"
     mRNA            join(660955..661174,661269..661448,661498..661564,
                     661625..662014)
                     /locus_tag="CNA02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_566638.1"
                     /db_xref="GI:58258450"
                     /db_xref="GeneID:3253549"
     CDS             join(661051..661174,661269..661448,661498..661564,
                     661625..661847)
                     /locus_tag="CNA02520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566638.1"
                     /db_xref="GI:58258451"
                     /db_xref="GeneID:3253549"
                     /translation="MFARAFILLTAVAGVLADLTVSSPATLIECQPALLSWSGGTAPY
                     YLAIIPGGEASAASLKDFGEQSGTSLTWTVDIASGNSVSLKVTDSTGTINYSSPVTIQ
                     AGSSSSCVSTSTAATGSTESTDSSSSASTADAAASSSSSDSTSASSAASAAASTTSAS
                     ASASTSASSDSGAKGFASVSLIATALFAVTAGAIALW"
     gene            complement(661634..662636)
                     /locus_tag="CNA02530"
                     /db_xref="GeneID:3253547"
     mRNA            complement(join(661634..662177,662239..662636))
                     /locus_tag="CNA02530"
                     /product="expressed protein"
                     /transcript_id="XM_566639.1"
                     /db_xref="GI:58258452"
                     /db_xref="GeneID:3253547"
     CDS             complement(join(662168..662177,662239..662465))
                     /locus_tag="CNA02530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566639.1"
                     /db_xref="GI:58258453"
                     /db_xref="GeneID:3253547"
                     /translation="MLQELDVMDPCTGNNWYLYSNKEVDENEVIELEVEGTRELEGFD
                     SAFSRKGRTSEASIPTAKLGMLTFGKQDRSKILK"
     gene            complement(665157..667419)
                     /locus_tag="CNA02540"
                     /db_xref="GeneID:3253557"
     mRNA            complement(join(665157..666336,666404..666481,
                     666534..666564,666625..666843,666894..667064,
                     667127..667419))
                     /locus_tag="CNA02540"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530533|gb|CF676374.1,gi|41530542|gb|CF676383.1,
                     gi|41539782|gb|CF685623.1,gi|41539789|gb|CF685630.1,
                     gi|41540453|gb|CF686294.1,gi|41540458|gb|CF686299.1,
                     gi|41540526|gb|CF686367.1,gi|41540532|gb|CF686373.1,
                     gi|41543067|gb|CF688908.1,gi|41543079|gb|CF688920.1,
                     gi|41547814|gb|CF693655.1,gi|41547822|gb|CF693663.1,
                     gi|41549931|gb|CF695772.1,gi|41549941|gb|CF695782.1,
                     gi|41550281|gb|CF696122.1,gi|41550288|gb|CF696129.1,
                     gi|41551084|gb|CF696925.1,gi|41551094|gb|CF696935.1,
                     gi|41553985|gb|CF699826.1,gi|41553992|gb|CF699833.1,
                     gi|41557797|gb|CF703638.1,gi|41557802|gb|CF703643.1,
                     gi|41558403|gb|CF704244.1,gi|41558408|gb|CF704249.1,
                     gi|41562507|gb|CF708348.1,gi|41562514|gb|CF708355.1,
                     gi|41564489|gb|CF710330.1,gi|41566384|gb|CF712225.1,
                     gi|41569035|gb|CF714876.1,gi|41569044|gb|CF714885.1,
                     gi|41569968|gb|CF715809.1,gi|41569973|gb|CF715814.1,
                     gi|41576567|gb|CF722408.1,gi|41576572|gb|CF722413.1"
                     /transcript_id="XM_566640.1"
                     /db_xref="GI:58258454"
                     /db_xref="GeneID:3253557"
     CDS             complement(join(665724..666336,666404..666481,
                     666534..666564,666625..666843,666894..667064,
                     667127..667196))
                     /locus_tag="CNA02540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566640.1"
                     /db_xref="GI:58258455"
                     /db_xref="GeneID:3253557"
                     /translation="MKLLPLAVVVASALPSALSWGAAGHEMVATIAQIHLFPSTRAKL
                     CSILPEEANCHLAPVAAWADIVRNRYRGTAPMHYINARNDHPQDHCEFGQHGWQNEDV
                     NVITAIQNFTRLIMDGKGGKDVDIPLRFLVHFIGDSHQPLHLAGRDKGGNGAKFLFEG
                     RERNLHSVWDSGIITKNIRELSNYTSPLPSKHIERCLPGAIFDPYVRWIVWEGIRLWW
                     RDEVDSWISCPATGDPYPHSSQNSIPPSASTIIKDHFRSAASFALSLLPGRLSELAEL
                     SFALPVIETANFEDQTLALTPKILAVKEVNMTFPSCPYHWISPIHQLNCDIVWPSKYT
                     GQPNEPLIELDTDEYLGEIGRQKILEKMMAMAGLRLAKVLNEALAEEGDSVHGVYFGY
                     S"
     gene            667719..668902
                     /locus_tag="CNA02550"
                     /db_xref="GeneID:3253563"
     mRNA            join(667719..667945,668007..668201,668249..668386,
                     668442..668555,668614..668902)
                     /locus_tag="CNA02550"
                     /product="isopentenyl-diphosphate delta-isomerase,
                     putative"
                     /transcript_id="XM_566641.1"
                     /db_xref="GI:58258456"
                     /db_xref="GeneID:3253563"
     CDS             join(667774..667945,668007..668201,668249..668386,
                     668442..668555,668614..668792)
                     /locus_tag="CNA02550"
                     /codon_start=1
                     /product="isopentenyl-diphosphate delta-isomerase"
                     /protein_id="XP_566641.1"
                     /db_xref="GI:58258457"
                     /db_xref="GeneID:3253563"
                     /translation="MSTTAVETVTTSPATLTTAVNDINLDSYDEEQVRLMEERCILVT
                     PEDKVYGEGSKKVCHLMSNINTGLLHRAFSVFLFRPADGRLLLQKRADEKITFPSMWT
                     NTCCSHPLSIKAELVEEHQAGVKAAAIRKLPQELGIPESQLKPEDFHFLTRIHYLAPS
                     SGVWGEHEIDYILFSTLNVDLDLNPNEVSDAKYVSKSELEAMFTDPSNSFTPWFKLIA
                     RDLLFPWWDEMLAKSRSAGWDEESGVGEVRADVLANGPKINELIRMI"
     gene            670209..672160
                     /locus_tag="CNA02560"
                     /db_xref="GeneID:3253571"
     mRNA            join(670209..670388,670443..670587,670640..670818,
                     670872..670973,671035..671232,671291..672160)
                     /locus_tag="CNA02560"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538218|gb|CF684059.1,gi|41538231|gb|CF684072.1,
                     gi|41544109|gb|CF689950.1,gi|41569809|gb|CF715650.1"
                     /transcript_id="XM_566642.1"
                     /db_xref="GI:58258458"
                     /db_xref="GeneID:3253571"
     CDS             join(670236..670388,670443..670587,670640..670818,
                     670872..670973,671035..671232,671291..672040)
                     /locus_tag="CNA02560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566642.1"
                     /db_xref="GI:58258459"
                     /db_xref="GeneID:3253571"
                     /translation="MYSLPTQSLSHINSPSHPSSPQPAAFPSSPSLLRDVGDEQMIWE
                     PIEPIVPDTSQMHYLALDTNILINYLNTVRTLHTLLSASVDRLRLLILIPIKVIQEID
                     GLKHSQKLPYPDSPVDIGRLARLANTWLLETNRIKREGGLSAVRCQSLKERYDRSMIG
                     GKGDDDILDCCMYFDQHGAKVVLWTNDKNLSLKAEANNIQTLGGHPSSLSALLKVSGA
                     DLPSDLWDQAAALDGDAQKSAESPETHKDNSDIHMNDADHLVESCHDFDSLSSPIFDQ
                     SNSGKPKYFADLPPIFSHGSREINQVHTPPQADTVQRRYPLLSNPGQDDDIEIDEEPL
                     SHCSAFSSRTTHSAASTSHASSIHAELSSHRRFARHPSSLMLSSLRISLLSPTLALIS
                     HPSYAPHVSSSPPPSTLPSVSILSTLLSSLTSLDSYLSSQSYPIEHPLRLSLMRGTIA
                     VKTIQKYIEYHENPQANGGTRRIKTNDMLVAVNNLRDTLKDLDVEMGMDVLDDFKGYD
                     "
     gene            complement(672173..674808)
                     /locus_tag="CNA02570"
                     /db_xref="GeneID:3253594"
     mRNA            complement(join(672173..672375,672426..672661,
                     672718..673017,673073..673375,673429..674348,
                     674397..674808))
                     /locus_tag="CNA02570"
                     /product="acetolactate synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538192|gb|CF684033.1,gi|41538196|gb|CF684037.1,
                     gi|41548415|gb|CF694256.1,gi|41548423|gb|CF694264.1,
                     gi|41551412|gb|CF697253.1,gi|41551430|gb|CF697271.1,
                     gi|41551557|gb|CF697398.1,gi|41551560|gb|CF697401.1,
                     gi|41576203|gb|CF722044.1"
                     /transcript_id="XM_566644.1"
                     /db_xref="GI:58258462"
                     /db_xref="GeneID:3253594"
     CDS             complement(join(672343..672375,672426..672661,
                     672718..673017,673073..673375,673429..674348,
                     674397..674761))
                     /locus_tag="CNA02570"
                     /codon_start=1
                     /product="acetolactate synthase"
                     /protein_id="XP_566644.1"
                     /db_xref="GI:58258463"
                     /db_xref="GeneID:3253594"
                     /translation="MLTRQSRLLRRIPPPNAVLQSGLQRRHRSTDRYSNNIHTSSTQN
                     APAPVYDAPIREKGMTIEAKERVRAHARKIQSSASTAAASPAVRPQPAQHFQAAPQPM
                     PANTPRFESDGQVKNGLDYSFIGLSGGQIFQEMMLRHDVKQVFGYPGGAILPVFDAIY
                     NSPHFDFVLPRHEQGAGHMAEGYARVSGKPGVVLVTSGPGATNVITPMQDALSDGVPM
                     VVFCGQVATNLIGSDAFQEADVVGISRSCTKWNVMVKDIAELPRRINEAFKIATTGRP
                     GPVLVDLPKDVTAAILRTPIPAKSAQPGHSPYLPSNPLNPSSQPSDPLPGDADLITEA
                     AQMINKAKRPIIFAGNGVLSSPEGPKLLKELSDKGRIPVTTTLQGLGAFDERDEKSLH
                     MIGMHGSAYANFAMQEADVLIALGVRFDDRVTGKVDTFAPAAKAAAAEGRGGIIHFEI
                     QPKNINKIVEAQIPVLGDVVASLAELVPQIEAVDRSAWIGRCKATKERYPFTYTPSQE
                     GQKLKPQEVVQELDRQAEALGKEKFIISTGVGQHQMWACQYYRWTEPRSWVSSGGLGT
                     MGFGLPSAIGAKVAAPEKYVIDIDGDASFSMTAMELATASQYDIGVKVLLFNNEFQGM
                     VEQWQDLFYENRYSHTRMTNPDFVKLSESMGTKGLRCTKLEDLPRMMKEFLEYDGKRP
                     IVLECLVSSEHVYPMIPAGKALHEQLLHPLLRNGSE"
     gene            675737..677601
                     /locus_tag="CNA02580"
                     /db_xref="GeneID:3253605"
     mRNA            join(675737..675857,675923..675976,676027..676051,
                     676119..676384,676440..676510,676564..676834,
                     676893..677062,677123..677218,677275..677601)
                     /locus_tag="CNA02580"
                     /product="sorbitol dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530155|gb|CF675996.1,gi|41532641|gb|CF678482.1,
                     gi|41532654|gb|CF678495.1,gi|41533295|gb|CF679136.1,
                     gi|41533740|gb|CF679581.1,gi|41533750|gb|CF679591.1,
                     gi|41537254|gb|CF683095.1,gi|41537259|gb|CF683100.1,
                     gi|41537627|gb|CF683468.1,gi|41537637|gb|CF683478.1,
                     gi|41537968|gb|CF683809.1,gi|41537969|gb|CF683810.1,
                     gi|41538690|gb|CF684531.1,gi|41538697|gb|CF684538.1,
                     gi|41540163|gb|CF686004.1,gi|41540174|gb|CF686015.1,
                     gi|41541743|gb|CF687584.1,gi|41541750|gb|CF687591.1,
                     gi|41544735|gb|CF690576.1,gi|41544739|gb|CF690580.1,
                     gi|41548469|gb|CF694310.1,gi|41548476|gb|CF694317.1,
                     gi|41550664|gb|CF696505.1,gi|41550667|gb|CF696508.1,
                     gi|41551164|gb|CF697005.1,gi|41551170|gb|CF697011.1,
                     gi|41555188|gb|CF701029.1,gi|41555200|gb|CF701041.1,
                     gi|41559973|gb|CF705814.1,gi|41559977|gb|CF705818.1,
                     gi|41562159|gb|CF708000.1,gi|41562165|gb|CF708006.1,
                     gi|41562700|gb|CF708541.1,gi|41562714|gb|CF708555.1,
                     gi|41565001|gb|CF710842.1,gi|41565010|gb|CF710851.1,
                     gi|41569538|gb|CF715379.1,gi|41569551|gb|CF715392.1,
                     gi|415"
                     /transcript_id="XM_566646.1"
                     /db_xref="GI:58258466"
                     /db_xref="GeneID:3253605"
     CDS             join(675744..675857,675923..675976,676027..676051,
                     676119..676384,676440..676510,676564..676834,
                     676893..677062,677123..677218,677275..677458)
                     /locus_tag="CNA02580"
                     /codon_start=1
                     /product="sorbitol dehydrogenase"
                     /protein_id="XP_566646.1"
                     /db_xref="GI:58258467"
                     /db_xref="GeneID:3253605"
                     /translation="MPTSLPLESKQPPKPEVFEAKSNLGFMLHSPLKTSFEEQSVPEI
                     GPDEVLVEIKKTGICGSDVHFYNTGKMGLAALTESMCLGHESSGIVVQLGSNIVQQAA
                     RSNVMATARGEAEESNKGTVSNRPLQVGDKVALEPGVTCRMCVDCKGGKYQICEHMIF
                     AAYPPSTGGTLQRYYALPADLVYPLPDNVDLSFGAMMEPLSVATHAVANIGGMRTGWN
                     VLITGAGPVGLLAMAVAKGLGAGKVIAVDINEERLHFAKQYAATDTYIPIPPNEGESR
                     GDHAVRAAEDLLRSTGTPARGPGSIDLVVDATGAETCVLMGLNAIKPGGIYVQIGFGP
                     PNVSVPMFRIVTNEITIRGAWRYGSGDYPLAIDMVARGLVNLKPLLTHTFKFEDALEA
                     FEITKNGRDKNGKGVIKCVIDGPE"
     gene            678048..679147
                     /locus_tag="CNA02590"
                     /db_xref="GeneID:3253517"
     mRNA            join(678048..678064,678121..678123,678222..678271,
                     678319..678338,678442..678542,678632..679147)
                     /locus_tag="CNA02590"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_566648.1"
                     /db_xref="GI:58258470"
                     /db_xref="GeneID:3253517"
     CDS             join(678060..678064,678121..678123,678222..678271,
                     678319..678338,678442..678542,678632..678845)
                     /locus_tag="CNA02590"
                     /codon_start=1
                     /product="mitochondrion protein"
                     /protein_id="XP_566648.1"
                     /db_xref="GI:58258471"
                     /db_xref="GeneID:3253517"
                     /translation="MASTFVNWAKSPAARQYFFSTHFWGPIANWGLPLAALADIANKD
                     EETISGVMSPTLAVYSLIFMRFAWRVQPRNYLLFACHATNAAAQLTQEARFLNYWYFG
                     GKEKKHPVGAKVDDVKEKVQEGVEKVKA"
     gene            complement(678902..680166)
                     /locus_tag="CNA02600"
                     /db_xref="GeneID:3253515"
     mRNA            complement(join(678902..679010,679057..679181,
                     679240..679714,679770..679851,679904..680026,
                     680088..680166))
                     /locus_tag="CNA02600"
                     /product="nucleus protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41569216|gb|CF715057.1,gi|41569221|gb|CF715062.1"
                     /transcript_id="XM_566650.1"
                     /db_xref="GI:58258474"
                     /db_xref="GeneID:3253515"
     CDS             complement(join(678951..679010,679057..679181,
                     679240..679714,679770..679851,679904..679905))
                     /locus_tag="CNA02600"
                     /codon_start=1
                     /product="nucleus protein"
                     /protein_id="XP_566650.1"
                     /db_xref="GI:58258475"
                     /db_xref="GeneID:3253515"
                     /translation="MPSKPQKNVPRKSNTGTPVASEDGVSIAAVIDRLSYADAPRPFK
                     SASFASHLPSRTATSSSTSVRKNAKQILALERERYLGGDGFLSAQHVAMRKRGEKIEL
                     GKKKKGVAKKGNIQNLLKGKMKRDVEEMSGTQEQTPAESRMTSEGTTPTLEEDEDMDV
                     SQKERPATQAPNDHPEDSRPKQEIVTSPPSLLPPKKYCDITGLHASYTDPRTKLRYKG
                     LDVWHVVRGLGPGGDQAYLSLRGAQTSLK"
     gene            680386..686795
                     /locus_tag="CNA02610"
                     /db_xref="GeneID:3253513"
     mRNA            join(680386..680621,680679..680711,680770..680906,
                     680957..681063,681128..681165,681219..681632,
                     681680..683321,683385..683650,683697..684094,
                     684157..684738,684791..685697,685757..685897,
                     685947..686000,686051..686145,686202..686287,
                     686340..686359,686413..686481,686546..686563,
                     686614..686795)
                     /locus_tag="CNA02610"
                     /product="conserved expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41553873|gb|CF699714.1"
                     /transcript_id="XM_566652.1"
                     /db_xref="GI:58258478"
                     /db_xref="GeneID:3253513"
     CDS             join(680540..680621,680679..680711,680770..680906,
                     680957..681063,681128..681165,681219..681632,
                     681680..683321,683385..683650,683697..684094,
                     684157..684738,684791..685697,685757..685897,
                     685947..686000,686051..686145,686202..686287,
                     686340..686359,686413..686481,686546..686563,
                     686614..686720)
                     /locus_tag="CNA02610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566652.1"
                     /db_xref="GI:58258479"
                     /db_xref="GeneID:3253513"
                     /translation="MPPLTKEELWSSGQDEDVEVNQRALIDKILARYSGEHTIFRELL
                     QNSDDAGAQHVQVKFYTKEGLEALKSDQKPSKLPDAKTALIHSYIVSNDGIPFRTEDW
                     QRLKKIAEGNPDEEKIGAFGVGFYSLFSVCDGPFVESGDKWMAFHWKDGKDKLLARSG
                     HLPKAMDNASSLSGNPWTTFSMTLREPSLLEGPLELARFFVTSITFMRTVKKIEMLVD
                     GISVLEVEKVVKRKERAERGGLHTMAAGGIMTVMNVDVTDMVITAKIMKWLEVAGFSP
                     PPLPSAISQFAKPARGLASMISSSFFGRYSSSPTPPPSSSVREPPSTAEDIMEITTFY
                     RDILIYQGNVKVNVSPAFARELERATKKAAPDRMPASIVYSRGTDDDEAKDLNGKPFK
                     KDVAGVFDGLCPKLDSDMSAKVFIGQPTGQTTGIGGHVASRFIPTVERESIDLVNKHV
                     SHWNRQLLWVAGYLCRLIYELEMQDIADEWIKTSKTDDLGLSRLTARALHVIRFFNFR
                     PTTPSTVVGQEMEASFYGCSKNNQLFPILSEQGVQPVKDVRMPQASISKFLPELPVIS
                     SAVLDQAIRLTGRLHAQRLLVDISYDDVVKQLGKRPLTQGEAVDCLKWWEDMASIEGF
                     NLSLRNRLLDAAIVLRDDGKILPLSMVQTFIRPHSGTISPDMPIPQHTIPYSITKNLR
                     ANSISRVFGWTELNLLQYISFLTNPPMSKPATDPSTDIRSSPEFSEKVLAMLSRSWPN
                     LPSNIQSAISIELKDVECIPTKMGMKKACETYFEGNLLFDDLPIIALSKGTALRGSME
                     KMLLAIGVRKTVDLQLVFSRLIGGGTWSCQDLMRYLVSVKDTLSDEEMKRLRQTAAFP
                     LFVEHPEDGKEPHPVRQKPWQLYEPTEAMKDLGLPVLDWANGKWRSNSDEAKLLFTLG
                     LNRYPPIDALLKIAAGRAPLNQKALEYLLSNHQNHYPTFKSDAYPDIAFIPAINTKGV
                     NILAKPGEVFTNPECAMLGFAVAQPYVASPENAAKLGVQKDPPLEQLVIALTNNLTTD
                     VGAARKIFEYIGTFIGHATPSSVDPLRHTAFIPVQKGAGPSSVVMFKPSQVYFVSGDS
                     EDNLYSSAFTFIDFGLKANMFLRYCGVKSEPSVKDITLLLMKDSQGMLRQAGSSERYL
                     EQLRLIAANWNRLDNQTRSAMKAAPFLLASQRIPMSKKSLSMATQPVIGGDDEYYREW
                     VLCRASEAVLVDRVAYAQYFGQYILSAPEERILEDFYLELGAKPLSSLVESKYISTPL
                     RNHSTSDKALALRQHVLERLAIFLSDRRKSAIYTVDELARENKFRVEEVQSLKVQHLY
                     RKGNKEQIHLQSLYAFASAGKGRSIILTISVTAEPDYYDVASALCEVLFKSQKADEAL
                     LLFSMLTTPLLALRKRGFNVDRILNQQREEKLRLEAEARRNKETVVPHEQGQTEVKTQ
                     NKENSARRASVSGESSGVKGLFSKLSRGSTGRGKEKEVEMPGGMPGGLPESTVQRVAK
                     QNQSSIGGASEGLMNGNKSSGVTGETRHGRSTKRPTDLLNIRATVKKAMDASRPETST
                     LIRDSRQAVNDVSESQDDYCDASVHVDLVMAFDASPQSGMPLQVWCPRDVSHPNDFLR
                     DKMEICVRFARDVLIPICQVFLLRPAVINIFWDHEGPTIAFNRGGTIFCNARYFGAWH
                     NDMCIRGQHKEPWISWYFSIAHELAHNLESAHNASHEFYFSSIAEQYLLSLAALVQER
                     TSFNR"
     gene            complement(685943..>687469)
                     /locus_tag="CNA02620"
                     /pseudo
                     /db_xref="GeneID:3253918"
     gene            complement(<690169..>691361)
                     /locus_tag="CNA02630"
                     /db_xref="GeneID:3253227"
     mRNA            complement(join(<690169..690380,690431..690532,
                     690592..690711,690769..690948,691037..>691361))
                     /locus_tag="CNA02630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566654.1"
                     /db_xref="GI:58258482"
                     /db_xref="GeneID:3253227"
     CDS             complement(join(690169..690380,690431..690532,
                     690592..690711,690769..690948,691037..691361))
                     /locus_tag="CNA02630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566654.1"
                     /db_xref="GI:58258483"
                     /db_xref="GeneID:3253227"
                     /translation="MSPRFGYIGLGNMGVPIVRNLAKYAAASGFPSISIWNRSSAKYA
                     LVKDAIPDAFYADDVEEVVMKSDIVLSSLIDDKAAEDVYEKMFKATEGRNVIFVDQSS
                     LKAVTSAKSIGATYIASPVFGRPPAAEASKLLIVLSGPANVKSEVKKHLIPAIGDRFV
                     DVGEDVKLASSLKSMGNMVLLGWIELLAEAFTLGDAVGLEPSVFNGFIQQFFPAPPLT
                     AYSNLISKGEFPSGSGFSVNGGLKDARNMMSLGADLGHPCPLPTIQRAHDNLERAKEL
                     GGPDQDWSALAAAVREQAGFSPYREGTNNGQGEKQI"
     gene            691711..693029
                     /locus_tag="CNA02640"
                     /db_xref="GeneID:3253534"
     mRNA            join(691711..691840,691922..692022,692162..692260,
                     692307..692364,692442..692552,692666..693029)
                     /locus_tag="CNA02640"
                     /product="expressed protein"
                     /transcript_id="XM_566656.1"
                     /db_xref="GI:58258486"
                     /db_xref="GeneID:3253534"
     CDS             join(691740..691840,691922..692022,692162..692260,
                     692307..692364,692442..692552,692666..692924)
                     /locus_tag="CNA02640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566656.1"
                     /db_xref="GI:58258487"
                     /db_xref="GeneID:3253534"
                     /translation="MIPSPRSFLAGWRPETQTSPDIPPLVAAEIAQEYASLRVPNGCP
                     KGMFLVPTEETLLRWHGVLFLHHGPYSGSILRFTVDFPSNYPQSGPTVRFNSDVFHPL
                     VDARTKIWHPRGNKMQWRPKVDHISRLLHELKSSFSRVTLDLIEEREAVNKHVWSLYQ
                     HSRQTFISLTAQRAVHSASQTVLFPAVYSQSPSSTTPPRRRQTSLNSLSSDDGLGPTE
                     PLINFKEVNLDEKEQLLARLRSAY"
     gene            complement(694347..695754)
                     /locus_tag="CNA02650"
                     /db_xref="GeneID:3254021"
     mRNA            complement(join(694347..694598,694653..694771,
                     694848..694945,695002..695208,695262..695277,
                     695333..695465,695521..695754))
                     /locus_tag="CNA02650"
                     /product="methionyl aminopeptidase, putative"
                     /transcript_id="XM_566657.1"
                     /db_xref="GI:58258488"
                     /db_xref="GeneID:3254021"
     CDS             complement(join(694524..694598,694653..694771,
                     694848..694945,695002..695208,695262..695277,
                     695333..695465,695521..695646))
                     /locus_tag="CNA02650"
                     /codon_start=1
                     /product="methionyl aminopeptidase"
                     /protein_id="XP_566657.1"
                     /db_xref="GI:58258489"
                     /db_xref="GeneID:3254021"
                     /translation="MGVDNETEGARIALGSKEEWGVRMACRVAADILKRAGHRIVKPG
                     ITTAQVDKAIHEMIIEHGAYPSPLGYSNYPKSCTTSINNVIVHGIPDNRPLHPQDIIN
                     IDLTIYLDGYHGDTSATFVLPEVDKLGRELVSATQEALDLGIRVCKPGVQISEIGKVI
                     GEFSKRHGFSVNSQISGHGIGKVFHQPPWIFHDVNSEPGKMMPGDCFTIEPCLVQGVN
                     SRGDIWDDGWTLATRTGARAAQFEHQVLITDDGVEILSI"
     gene            696118..697165
                     /locus_tag="CNA02660"
                     /db_xref="GeneID:3253991"
     mRNA            join(696118..696173,696223..696294,696344..696462,
                     696518..696600,696647..697165)
                     /locus_tag="CNA02660"
                     /product="expressed protein"
                     /transcript_id="XM_566659.1"
                     /db_xref="GI:58258492"
                     /db_xref="GeneID:3253991"
     CDS             join(696170..696173,696223..696294,696344..696462,
                     696518..696600,696647..697121)
                     /locus_tag="CNA02660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566659.1"
                     /db_xref="GI:58258493"
                     /db_xref="GeneID:3253991"
                     /translation="MGIFTHSAEDDVLVSASFPETNAFGNVVNGEDNNILIHLINSGS
                     KNYTLVSASASYHDPANHWALVKNATTLKYGVPLVSGANFSAPYHVYSEFRPQELGLT
                     VTVNLAETGTKDLHYITAMNRTVSIVEAPGSWLDFQLIFLYLILGTALTLGGWWAYDS
                     YFAPKSKVKGKKKSGPGPKKVQAVVPGKESVYPEVKPYEEEWIPEQLLKSKQNKLKKR
                     NVDGASSAGEITSGGETSGAEGKGKKRKGKKA"
     gene            698003..699225
                     /locus_tag="CNA02670"
                     /db_xref="GeneID:3253989"
     mRNA            join(698003..698207,698264..698441,698500..698780,
                     698836..698913,698968..699008,699065..699225)
                     /locus_tag="CNA02670"
                     /product="aerobic respiration-related protein, putative"
                     /transcript_id="XM_566661.1"
                     /db_xref="GI:58258496"
                     /db_xref="GeneID:3253989"
     CDS             join(698030..698207,698264..698441,698500..698780,
                     698836..698913,698968..699008,699065..699112)
                     /locus_tag="CNA02670"
                     /codon_start=1
                     /product="aerobic respiration-related protein"
                     /protein_id="XP_566661.1"
                     /db_xref="GI:58258497"
                     /db_xref="GeneID:3253989"
                     /translation="MSLPLRAARPLLRASTLTAARRISVASAIRPLSRADCGECGCVS
                     SRAFSTTPLRRGSGETDGTLISALAAEHKYELESAAAQPEVPAFIESFKAQGVWNIED
                     TAGSDDIVLTRKFGNETIKLTFQVSDLDATAFDPEYPAAEEDSEGPASGPASITCSLV
                     ITKSAAPGALMVDLETCDEGFEITNVAVYDKALADAKGAEGDWERRSRYMGPQFDHLD
                     ETVQEAFGSYLAERGVDESLADFVLSYCEHKEQKDYVSWIDQVRGFVEQ"
     gene            699381..701219
                     /locus_tag="CNA02680"
                     /db_xref="GeneID:3253999"
     mRNA            join(699381..699884,699933..700074,700121..701041,
                     701112..701219)
                     /locus_tag="CNA02680"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530646|gb|CF676487.1,gi|41530651|gb|CF676492.1,
                     gi|41537925|gb|CF683766.1,gi|41537930|gb|CF683771.1,
                     gi|41543604|gb|CF689445.1,gi|41543612|gb|CF689453.1,
                     gi|41548857|gb|CF694698.1"
                     /transcript_id="XM_566663.1"
                     /db_xref="GI:58258500"
                     /db_xref="GeneID:3253999"
     CDS             join(699396..699884,699933..700074,700121..700893)
                     /locus_tag="CNA02680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566663.1"
                     /db_xref="GI:58258501"
                     /db_xref="GeneID:3253999"
                     /translation="MSAAADNPHPHIDPSLVALAAQVQAHANAQAQRHVSISIPHRHI
                     PPAATDNHLGLGLPSEALGSALQIDPSLFEIEQVVNDVRRGKIRLGEDRRDEQEPERS
                     VQHPNDTAHHSQHQQQDDHPGEHGGMEGHGGLGDASDGLQMDDEIDPTLREIVNSLTN
                     AQQSSHLNAPGLSHAQAAAAIGAHLTDAEERERLQQSLQASLEDLTHASFGSLFPPNY
                     SNSPSQGFLTLNDHHNIHDTEVDLSNPSLDVNAEVGSSSTSLDASPMADPESSNSVKR
                     GRGRPKGSKNKPKPGPPPPKPPKPPKPPARPKGRPPKQRTPAEQAEYELRKHEKELGI
                     KRQKGRPRKFPGYLVREMRLKKNREEFNELMREYEEKRREEELANLEMAGVDTQIHLG
                     EGPSLASHDHHVHDPHLHGEHHGHHEQHDFSDWSVQDDQTLLDVVGVGHHEMSVGIGE
                     EEQDHHEGMDEVFGIRS"
     gene            complement(701076..702306)
                     /locus_tag="CNA02690"
                     /db_xref="GeneID:3254000"
     mRNA            complement(join(701076..701306,701354..701428,
                     701485..701540,701609..701668,701726..701773,
                     701833..701842,701900..701917,701992..702010,
                     702068..702144,702195..702216,702266..702306))
                     /locus_tag="CNA02690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566665.1"
                     /db_xref="GI:58258504"
                     /db_xref="GeneID:3254000"
     CDS             complement(join(701235..701306,701354..701428,
                     701485..701540,701609..701668,701726..701773,
                     701833..701842,701900..701917,701992..702010,
                     702068..702144,702195..702216,702266..702303))
                     /locus_tag="CNA02690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566665.1"
                     /db_xref="GI:58258505"
                     /db_xref="GeneID:3254000"
                     /translation="MSELCPPWAPFFGFAGVTSAIVFSTVGAAYGTSKAGIGIAGLGT
                     FRPDLIMKSLIPVVMSGIIAVYGLVVSVLIAGNISPSEPYSLFAGFVHLAAGLACGFT
                     GLAAGYAIGIVGDACVRAYLYESKVFVSMVLILIFAEVIGLYGLIVALILNTAVGEAV
                     CGAN"
     gene            702627..705189
                     /locus_tag="CNA02700"
                     /db_xref="GeneID:3253997"
     mRNA            join(702627..702674,702724..702748,702846..702992,
                     703052..703172,703222..703315,703368..703420,
                     703470..704265,704318..705189)
                     /locus_tag="CNA02700"
                     /product="t-complex protein 1, eta subunit (tcp-1-eta),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531808|gb|CF677649.1,gi|41534509|gb|CF680350.1,
                     gi|41534514|gb|CF680355.1,gi|41541974|gb|CF687815.1,
                     gi|41541981|gb|CF687822.1,gi|41545571|gb|CF691412.1,
                     gi|41545574|gb|CF691415.1,gi|41551780|gb|CF697621.1,
                     gi|41551786|gb|CF697627.1,gi|41558836|gb|CF704677.1,
                     gi|41558846|gb|CF704687.1,gi|41560489|gb|CF706330.1,
                     gi|41560498|gb|CF706339.1,gi|41562021|gb|CF707862.1,
                     gi|41562030|gb|CF707871.1,gi|41564963|gb|CF710804.1,
                     gi|41564970|gb|CF710811.1,gi|41566359|gb|CF712200.1,
                     gi|41566366|gb|CF712207.1,gi|41566462|gb|CF712303.1,
                     gi|41566467|gb|CF712308.1,gi|41568125|gb|CF713966.1,
                     gi|41568134|gb|CF713975.1,gi|41569800|gb|CF715641.1,
                     gi|41572337|gb|CF718178.1,gi|41572342|gb|CF718183.1,
                     gi|41575081|gb|CF720922.1,gi|41575086|gb|CF720927.1"
                     /transcript_id="XM_566667.1"
                     /db_xref="GI:58258508"
                     /db_xref="GeneID:3253997"
     CDS             join(702651..702674,702724..702748,702846..702992,
                     703052..703172,703222..703315,703368..703420,
                     703470..704265,704318..704740)
                     /locus_tag="CNA02700"
                     /codon_start=1
                     /product="t-complex protein 1, eta subunit (tcp-1-eta)"
                     /protein_id="XP_566667.1"
                     /db_xref="GI:58258509"
                     /db_xref="GeneID:3253997"
                     /translation="MQGRLPQMQPTVVLLREGTDTSQGTPQLLSNISACLAVAQTIAT
                     TLGPRGMDKLIVDDRGLATISNDGATILKLLDVVHPAARTLVDIARAQDAEVGDGTTS
                     VTLLAAEILKEVRPFIEEGVSPHVIIKGLREAKTLAIQKINEIAVTIDKSDPAEFRDL
                     LMQCAATSMSSKLIHSQTPFFSNMVVDAVLSLDQNDLDESLIGIKKVPGGGMQDSKLI
                     KGVAFKKTFSYAGFEQQPKSFKDPKVLCLNVELELKAEKDNAEVRVNEVSEYQAIVDA
                     EWSIIFRKLEAIVATGAKVVLSKLPIGDLATQYFADRDIFCAGRVADGDLKRVVQAVG
                     GSIQSTCSDIEPHHLGQCGSFEEKQIGGERFNLFEGCPQAKTCTLILRGGAEQFIAEV
                     ERSLHDSIMIVKRAIKNNSVVAGGGACEMETSKYLRAHSRTIMGKAQLIVGAVAKALE
                     IIPRQICDNAGLDATDILNKLRMRHAQGETWAGIDVDGEGVQDNMKSFVWEPALVKTN
                     ALSSAIDAACLILSVDETVRNPQSEQPQAGPPMPRGAAQQAMRGRGRGMPRR"
     gene            complement(704442..706667)
                     /locus_tag="CNA02710"
                     /db_xref="GeneID:3254015"
     mRNA            complement(join(704442..705646,705699..706004,
                     706116..706240,706300..706667))
                     /locus_tag="CNA02710"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41558427|gb|CF704268.1,gi|41558434|gb|CF704275.1,
                     gi|41560444|gb|CF706285.1,gi|41560454|gb|CF706295.1,
                     gi|41574881|gb|CF720722.1,gi|41574889|gb|CF720730.1"
                     /transcript_id="XM_566669.1"
                     /db_xref="GI:58258512"
                     /db_xref="GeneID:3254015"
     CDS             complement(join(705042..705646,705699..706004,
                     706116..706240,706300..706616))
                     /locus_tag="CNA02710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566669.1"
                     /db_xref="GI:58258513"
                     /db_xref="GeneID:3254015"
                     /translation="MSSPAPTYARIRSLSHWATFFNQPDGLFRLPSTQGAAIQHLEID
                     LRFVADHQVETVDPNLQADTPIHLPNVCILTFRGGEYVQEDDLRMDALAEVLLAINPV
                     EVRWLNATEDPSEQLSFATHLVHPAVIAAGEKWSAAGTLRKLVIQGGFPCPNLTAPTP
                     FALTPAATPCPSPGPARTTFGLQDASSKHHPAPFVSGLSALSTIKPKTVDEDRLKGRE
                     ERKRQAEYTLKPRFEYAFGKWSVQELKWRLDGRYTAACVISIITHFIKAISSSFPSAT
                     RHFLVDLPAAVSFTSIPAAVIPDLQSLPEKLELDIRVRDWLSDVGFGSLGDARHARLW
                     DLPAPDDENDHRNGLRTKAEMILLRDGATIVTLEELTQIVKDSSNEKGRGDRSAMSPA
                     DSIASLLSGVTESPTEDENEAVTPHSTGSPFANPTDKTDKKMAGDNDSVRPIETSVVL
                     "
     gene            706849..707770
                     /locus_tag="CNA02720"
                     /db_xref="GeneID:3253996"
     mRNA            join(706849..707373,707454..707602,707655..707770)
                     /locus_tag="CNA02720"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534537|gb|CF680378.1"
                     /transcript_id="XM_566671.1"
                     /db_xref="GI:58258516"
                     /db_xref="GeneID:3253996"
     CDS             join(707056..707373,707454..707602,707655..707745)
                     /locus_tag="CNA02720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566671.1"
                     /db_xref="GI:58258517"
                     /db_xref="GeneID:3253996"
                     /translation="MASVDPAEPSTLEIGSRQPSPPIMKESCDKVASLTSETSTKDKN
                     TLQLQDTRSGHILSDLSTFRKTVLLLTFALANFIDVCNVSGVAIAAAQISWDIGLETS
                     QVVWIITSYSLCFSAFLLFSGRLSDLFPAGLIFESGLFVLGVLSLATSFVTSNKYAFL
                     ILRGLGGIAGSMGECPYRRRTSPLQ"
     gene            complement(709386..714619)
                     /locus_tag="CNA02730"
                     /db_xref="GeneID:3254006"
     mRNA            complement(join(709386..709656,709711..710080,
                     710142..710257,710317..710381,710441..710499,
                     710647..711064,711110..711153,711204..711347,
                     711403..711422,711482..711555,711607..711744,
                     711804..711910,711965..712018,712081..712259,
                     712392..712778,712963..714351,714444..714619))
                     /locus_tag="CNA02730"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550329|gb|CF696170.1,gi|41550335|gb|CF696176.1"
                     /transcript_id="XM_566673.1"
                     /db_xref="GI:58258520"
                     /db_xref="GeneID:3254006"
     CDS             complement(join(709582..709656,709711..710080,
                     710142..710257,710317..710381,710441..710499,
                     710647..711064,711110..711153,711204..711347,
                     711403..711422,711482..711555,711607..711744,
                     711804..711910,711965..712018,712081..712259,
                     712392..712778,712963..714141))
                     /locus_tag="CNA02730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566673.1"
                     /db_xref="GI:58258521"
                     /db_xref="GeneID:3254006"
                     /translation="MNDQSYPTGSNLENHRRGFSSSSLDGRPTEEGVDGRNDRARGGN
                     EHPPALDPHSLPAQYKYHLHHYQGGPSPVATFFPQPVLQPSYNIHPMHLSGQPASYDS
                     SNASFPGNPQSIPYLQGRPNQSRNVLSESTPDATQFIQPVDGRSENMPSLHEASENFT
                     ISQEMIPRHAQASQSPGGPIGTRASIKNSGNESMSLNKAYGHVPHTRLPSSDRNAAGI
                     TFRGPSIAYPQNVPNLSDSGLITGSRATDENQPGSQPGKLDGASSAARGDNMAPVKQQ
                     SEEPLLSWDEMSQAASRPTSSSQKDLQGKGSPDFQSKLNPHMDGGDELIESIEKNKNP
                     DENIDHRKRKRNRTIRSCVPCHNHKRKVSIFLARRIQFIDTRNQCDRKRPCGRCIALG
                     LSERLRRRVAELEQVVRELRQKAPSRHANVSSASATTSLHPAPTTSTASGANAASPIS
                     DNGGIKRRVIVDRFARFKMDEAQAAENVAGMGYIASEVSSQNGAQHVQNEEGLDEDYR
                     GEPYSTHSLPDEEMLRELAASNEDEKLFSVPEDVAFTGVFPNLRKTFPFTTIWSHENF
                     CVEIIGLLPDQEQSETLWNAWTNGYQAYFSPFHLPTVRSEYAKFFAKSTEDKLNTPLS
                     SLAVFLMVCALGSLLRATAAEILGHPDPEVAMNARSKGEVPRDLKDLTSSRLQSELYL
                     SAAYHALRLCSFMANPTVPVLQCQLLIQVYLLASERAADAWAIGGNMIKQAIALGLHK
                     DPLSLDPNISMRDAEVRRRLWWSIAGFDTMLAIFFDRSDDNLSDAPGSARQLLPPSNV
                     LASETTDQTYHTAYYQLTIPSFELLEGIFHVDRQFSRSALYGWFSPPPHSSMDGGGPK
                     RHTYRHAIRLAEDIRQWYGHLPKGMRVDKEDTAESLSESRPKKQVVQTLGLCIKTWTL
                     IVSGYGRYPSFLDVLDDVLQTGAVCAFLALRQPGTALAAKCVDDLRGAIALFEDRLST
                     WCSTHPVQNDLRQGLIQLEKLVTTQRSDIPRHAPAPSYGTNNSPTFGNSQTFSRPASE
                     SNYQLASQAHDAPTLNNPIQATNSPLPLGVDGAGMFHGPGGIPYHSESLGMSKNGEAP
                     LYSQHPEQAGSLSTSLSGDFNGPSPLALSRFWASMFGIRMDDTKETSSPDMAWS"
     repeat_region   715290..715331
                     /rpt_type=tandem
                     /rpt_unit_seq="cgaa"
                     /satellite="microsatellite"
     gene            complement(715898..718031)
                     /locus_tag="CNA02740"
                     /db_xref="GeneID:3253566"
     mRNA            complement(join(715898..716164,716237..716855,
                     716906..717531,717590..717607,717669..717704,
                     717762..717810,717867..718031))
                     /locus_tag="CNA02740"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530573|gb|CF676414.1,gi|41530574|gb|CF676415.1,
                     gi|41533684|gb|CF679525.1,gi|41543961|gb|CF689802.1,
                     gi|41543978|gb|CF689819.1,gi|41568314|gb|CF714155.1,
                     gi|41568315|gb|CF714156.1,gi|41572761|gb|CF718602.1,
                     gi|41572766|gb|CF718607.1"
                     /transcript_id="XM_567152.1"
                     /db_xref="GI:58259478"
                     /db_xref="GeneID:3253566"
     CDS             complement(join(715929..716164,716237..716855,
                     716906..717531,717590..717607,717669..717704,
                     717762..717810,717867..717908))
                     /locus_tag="CNA02740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567152.1"
                     /db_xref="GI:58259479"
                     /db_xref="GeneID:3253566"
                     /translation="MAGQFTPEQSAQLQSEVQVELERREWAEPNDNVMAEYITVLLAN
                     GSSRERVQSEMDDLVGSDFDPAFLDWLFAKSESIVSAGSATQPATTPLEAAETATSAA
                     TPRGNSRLLSSALAPLTSQPEKRKLPDITHDGQNKRPAPEVPVGPRLGAVTPRSPNMP
                     AVSVRGRGMGIRGTSSGGRGTMVNQSPVNGSFIHQQPSQQTQPGFRPRQQMQPGRFNQ
                     QIGNPGMLGMPNQQEMMAQMMMMQANMAQMGQMMSMMVGERQHTPQRQQPSISQSGYQ
                     ASPPVPVKLPPGTKLGSHSISSITPKSSTGPIPDKPTSVALCKFGVGCSNARCPYSHP
                     SPVADEKTGMVLSEEACEKGKDCKDPECIKSHVSPSAVLGDSVGPSRLLCKYQNCNNP
                     SCPFRHEDADGNPVPPPALTKSNKPTVVKAPASSSDDGSVEVINSHRDLLDGQLADGP
                     KMIQCRFGDRCTRADCKFLHPASRSLAKAKKPLQSSHARPSNAAISIAGGLSKSKKFG
                     ADGKQGGLNPDAMEFKPTGHDEEKNGADLNVTL"
     gene            718429..719984
                     /locus_tag="CNA02750"
                     /db_xref="GeneID:3254002"
     mRNA            join(718429..718505,718568..718641,718696..719122,
                     719184..719489,719538..719678,719734..719984)
                     /locus_tag="CNA02750"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41567526|gb|CF713367.1,gi|41567531|gb|CF713372.1"
                     /transcript_id="XM_566675.1"
                     /db_xref="GI:58258524"
                     /db_xref="GeneID:3254002"
     CDS             join(718468..718505,718568..718641,718696..719122,
                     719184..719489,719538..719678,719734..719764)
                     /locus_tag="CNA02750"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_566675.1"
                     /db_xref="GI:58258525"
                     /db_xref="GeneID:3254002"
                     /translation="MADAKKKQLVYNIIDFLRTSSQDGTIKEDDKESLDVAVQCIAEA
                     FGVDPDSAEDDKAYSIKPASLVSILDVFLKTKAKSFASTSPQSEASLPQSSSDISQTD
                     KIKAESLKTKGNQLMGQKLYDSAIEQYTEAIKLDPNPVYYSNRAAAWGGAGQHEKAVE
                     DAEKALELDPKFTKAYSRLGHAHFSLGNYSDAVRAYENGLELDPDNANMKTALSTAKS
                     KLSELSSRPTAADREPPQNGINGSSGGMPDLASLAGALGGGGGSGSGGMPDLASMMNN
                     PQMMSMAQQMMANGGLERLMQNPALRNMAENMRNGGGMPDFSSLASDPSMRDLAQQFM
                     GGRQ"
     gene            720184..>721051
                     /locus_tag="CNA02760"
                     /db_xref="GeneID:3253616"
     mRNA            join(720184..720306,720356..720495,720562..720735,
                     720796..720851,720912..>721051)
                     /locus_tag="CNA02760"
                     /product="oligoribonuclease, putative"
                     /transcript_id="XM_566677.1"
                     /db_xref="GI:58258528"
                     /db_xref="GeneID:3253616"
     CDS             join(720262..720306,720356..720495,720562..720735,
                     720796..720851,720912..721051)
                     /locus_tag="CNA02760"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /product="oligoribonuclease"
                     /protein_id="XP_566677.1"
                     /db_xref="GI:58258529"
                     /db_xref="GeneID:3253616"
                     /translation="MASEPLLYDDGPLVWVDCEMTGLDFLNDRIIEIAVIITDGRLNP
                     VDGGISYIIKTPKEVLDNMGDWCREQHGKSGLIQACLDSPYSYDTVVEKVLDYIRRWI
                     PERGAGLLAGSSVHADMRFMLMGMPEVMKHLSYRILDVSSVKEICRRWYPKVRAQEQE
                     SRTTECSHRYVLLDLEAPGVALTI"
     gene            complement(<721266..>722248)
                     /locus_tag="CNA02770"
                     /db_xref="GeneID:3253689"
     mRNA            complement(join(<721266..721408,721479..721605,
                     721735..721765,721834..722023,722077..>722248))
                     /locus_tag="CNA02770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567153.1"
                     /db_xref="GI:58259480"
                     /db_xref="GeneID:3253689"
     CDS             complement(join(721266..721408,721479..721605,
                     721735..721765,721834..722023,722077..722248))
                     /locus_tag="CNA02770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567153.1"
                     /db_xref="GI:58259481"
                     /db_xref="GeneID:3253689"
                     /translation="MSAYGTIATSQPTSSLPVLSFPLPSAGLALVTYPVTGADAPEEL
                     LRYFYTIFSNELESGCTYPQEGPITYEEFLSYFFAATTIIGIIQPVGTNGKVDIPGDL
                     ETAKAERSWEECIGGCYYIKPNYPGRSSHNAGFLVPTNHRGKKLGIALGKSYLEYAPR
                     LGYRGSVFNLVYKNNIPSLSIWDQLGFQRVGVIPKAGRLKTGPNGSEEYVDAVIIYKS
                     FV"
     gene            722642..724574
                     /locus_tag="CNA02780"
                     /db_xref="GeneID:3253586"
     mRNA            join(722642..723499,723556..723867,723925..723992,
                     724043..724077,724150..724574)
                     /locus_tag="CNA02780"
                     /product="aminopeptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542058|gb|CF687899.1,gi|41542069|gb|CF687910.1,
                     gi|41546349|gb|CF692190.1,gi|41546355|gb|CF692196.1,
                     gi|41562170|gb|CF708011.1,gi|41562175|gb|CF708016.1,
                     gi|41572277|gb|CF718118.1,gi|41572281|gb|CF718122.1,
                     gi|41572425|gb|CF718266.1,gi|41572440|gb|CF718281.1"
                     /transcript_id="XM_566679.1"
                     /db_xref="GI:58258532"
                     /db_xref="GeneID:3253586"
     CDS             join(722659..723499,723556..723867,723925..723992,
                     724043..724077,724150..724444)
                     /locus_tag="CNA02780"
                     /codon_start=1
                     /product="aminopeptidase"
                     /protein_id="XP_566679.1"
                     /db_xref="GI:58258533"
                     /db_xref="GeneID:3253586"
                     /translation="MASLLLPLFFHLLSSLAETAAAGATPSSSPALFVSSDPPAHDTA
                     GCLKTSYYGTYGGAPKEQDHIYLPTAECLLTVSALDAVTSGSIVSVNDLMLGDGDRLV
                     WVGRSGVSHKDSQVVPLIEESWNLISSHSRDIVSESNSRGVGYGTQHVLQKANELHHI
                     RPITLVHQTEHSLLVNVPSSFLPIFDTLLPPHLVPVALPIAPLPISVSGWQSVPKKFA
                     KHLANITEHLSFSPELDRIVSEGIRLNQIRRDVRWLTGEAPSGIESRHSFTSGAVKAA
                     QWISSQVESTGADCSLQYFLSGFAPNVICHYPSTLNSTERVIFSAHYDSRGSFGSTRA
                     PGGDDDGSGTGHLLSLARAISNQGIVFEKAVTLAFFAGEEQGLLGSHAYAEYLNSQNA
                     TVLLQVQADMLGYHAPGEPLQLGLPETIHLPEASYLIGNLSQLYSPELVVGKTAACCS
                     DHQSFVTYGFPATQVFERNGPIVDPMYHNSGDVSQREGYDFEQIVSIAKVTLSALLTV
                     AGYKRVPV"
     gene            724845..727099
                     /locus_tag="CNA02790"
                     /db_xref="GeneID:3253601"
     mRNA            join(724845..724901,724962..725208,725266..725346,
                     725407..726079,726136..726315,726365..726440,
                     726503..726575,726628..727099)
                     /locus_tag="CNA02790"
                     /product="expressed protein"
                     /transcript_id="XM_566681.1"
                     /db_xref="GI:58258536"
                     /db_xref="GeneID:3253601"
     CDS             join(725179..725208,725266..725346,725407..726079,
                     726136..726315,726365..726440,726503..726575,
                     726628..726696)
                     /locus_tag="CNA02790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566681.1"
                     /db_xref="GI:58258537"
                     /db_xref="GeneID:3253601"
                     /translation="MSTILQDWIDLLNAEQHVQVDKLKEHARHGIAAPIRGEVWLYLL
                     GVLSEDKTSEITSLISLDLSYKALSNSIPSHLASLLLKTALVHHTKRFRNETYADLIT
                     SITAEQPIVRETSWTATRPSISGVPKSPGDITTSSLTSPQNSSERQISASQGPATLPP
                     DPTSEEVESFNTIRSQLSRILPKPPSTPPTRHGFLSMLEEVLGKFWNAENLEGRDDEW
                     RKDDAGGFEGSEKDWVYLCTPFVCCLSRPVGVFLGFKSLMERMRAFPPLPVRLASFLT
                     LFRQALPELHSYCEDEQVPYVQVALSWMTTLLAKEMWLGDVLRLWDTYLAAHDMFALH
                     CYVCVAIFSTCKETLEELDGSEAKLMLLDLPPMDVDRLLQDAANLRVTFPLARHADEE
                     E"
     STS             725394..726219
                     /locus_tag="CNA02790"
                     /standard_name="Xba9"
                     /db_xref="UniSTS:470887"
     gene            727175..729248
                     /locus_tag="CNA02800"
                     /db_xref="GeneID:3253585"
     mRNA            join(727175..727245,727300..727459,727520..727640,
                     727698..728431,728483..728626,728678..729248)
                     /locus_tag="CNA02800"
                     /product="zinc-finger protein zpr1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531970|gb|CF677811.1,gi|41538696|gb|CF684537.1,
                     gi|41549361|gb|CF695202.1,gi|41550047|gb|CF695888.1,
                     gi|41561494|gb|CF707335.1,gi|41562188|gb|CF708029.1,
                     gi|41567278|gb|CF713119.1"
                     /transcript_id="XM_566683.1"
                     /db_xref="GI:58258540"
                     /db_xref="GeneID:3253585"
     CDS             join(727319..727459,727520..727640,727698..728431,
                     728483..728626,728678..729106)
                     /locus_tag="CNA02800"
                     /codon_start=1
                     /product="zinc-finger protein zpr1"
                     /protein_id="XP_566683.1"
                     /db_xref="GI:58258541"
                     /db_xref="GeneID:3253585"
                     /translation="MSSDKTNLFPTLGEVADRTGKAESLEQEGDDRQMQEIESLCMRC
                     HENGTTRLLLTSIPYFKEIVVSSFRCDHCGHRDTEIQSAGEIQPKGVSYTVHLLTRAD
                     LDRQIVKSNWATITIPDIQLTIPPGRGQINTVEGIIRDTVRDLNISQPVRRVMDPETG
                     KKIDELLEKLRAAIDMEEDDEDDGGVGMDDDVKPVHHEPSNSSSKEEKPFVPFSMIVD
                     DPSGNSYFQFKGSQSDPQWNMRAYSRTFDQNVILGLVARPEDMSEEQPEGVPIVAADH
                     KLSSAEEFESKRNKNVINRDDGTVVPDEIYSFPATCSSCGHQLETLMQQVNIPYFQDI
                     IIMSSNCYACGYRDNEVKSGGSIAPKGKRITLKVEDEEDLSRDMLKSDTAGLSIPEID
                     LVLQPGTLGGRFTTLEGLLNEIYTELSTKVFRAGDSTTAGIGQTDSSAGEDEANFGDF
                     LKGLKECMSAQRQFTLILDDPVSNSYLQNLYAPDPDPNMQIEVYERTFEQNEELGLND
                     MVVEGYNKEAEGTA"
     gene            complement(729538..731298)
                     /locus_tag="CNA02810"
                     /db_xref="GeneID:3253597"
     mRNA            complement(join(729538..729874,729936..730054,
                     730112..730193,730250..730332,730386..730499,
                     730550..730566,730639..730649,730710..730753,
                     731024..731069,731122..731298))
                     /locus_tag="CNA02810"
                     /product="RAS small monomeric GTPase, putative"
                     /transcript_id="XM_566685.1"
                     /db_xref="GI:58258544"
                     /db_xref="GeneID:3253597"
     CDS             complement(join(729749..729874,729936..730054,
                     730112..730193,730250..730332,730386..730499,
                     730550..730566,730639..730649,730710..730753,
                     731024..731069,731122..731130))
                     /locus_tag="CNA02810"
                     /codon_start=1
                     /product="RAS small monomeric GTPase"
                     /protein_id="XP_566685.1"
                     /db_xref="GI:58258545"
                     /db_xref="GeneID:3253597"
                     /translation="MSKAQFLREYKLVVVGGGGVGKSALTIQFIQSHFVDEYDPTIED
                     SYRKQCIIDEEVALLDVLDTAGQEEYGAMREQYMRTGEGFLLVYSITSRSSFEEVSTF
                     HQQILRVKDKDYFPVVVVANKCDLEYERQVQPHEGRDLAKRFNAQCIETSAKQRVNVD
                     EAFIAVVRAIRRYQKESGPPQAVNAPAKSQMSAVGGRAAEKDDHVDKGCCRGCVVL"
     gene            731534..733767
                     /locus_tag="CNA02820"
                     /db_xref="GeneID:3253523"
     mRNA            join(731534..731984,732035..732257,732308..732908,
                     732962..732987,733049..733557,733609..733767)
                     /locus_tag="CNA02820"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533042|gb|CF678883.1,gi|41549349|gb|CF695190.1,
                     gi|41549363|gb|CF695204.1,gi|41552015|gb|CF697856.1,
                     gi|41556968|gb|CF702809.1,gi|41556973|gb|CF702814.1,
                     gi|41558279|gb|CF704120.1,gi|41558291|gb|CF704132.1,
                     gi|41564500|gb|CF710341.1,gi|41564508|gb|CF710349.1"
                     /transcript_id="XM_566687.1"
                     /db_xref="GI:58258548"
                     /db_xref="GeneID:3253523"
     CDS             join(731538..731984,732035..732257,732308..732908,
                     732962..732987,733049..733557,733609..733671)
                     /locus_tag="CNA02820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566687.1"
                     /db_xref="GI:58258549"
                     /db_xref="GeneID:3253523"
                     /translation="MSLYGGIKFSATNPEDEPEQRETPRPPDADAGSLPPAQSKQRQP
                     PAFSSALKFAPRINKKPLKPPVPTAHVSALPLNPSSADIVRSAEPVLHSRSPAAQDEG
                     DAQLVFGPDGLPLAKAPAMTIGTNKGGYKDRLGNDFSGEKKKKKKKKRKNPQPFFPTF
                     DPEEIYDPNRPNDLGEYQQYRKRAKEERRRKLMEAKRRRAEGLSSDESSYYTDSEEDI
                     APRRDAPKMFAPPKMYSPSASKSTVSEEPETAVNRLPESQPAFGRDQDDRRMDVSRLS
                     PSGDDAYARRVAMTQQAPLHLHHPSQSGDDAYARRAAISQNPPPTTSFIPSSTASSSA
                     APDAYPSSHLTQPPTTTPPPLPVIPNAQAELPQVQAAASASQDFQAMLEERKKAAEAI
                     AAKFKALAGAAQPPSSPAPASASSSAAQLQDVGGGTFAEKMMRKWGHVEGTGLGARGE
                     GIVHALTTEHVAPVANLSQPLSKRALAKQKAAAANAKSRKWVQAPSARGRIVNDNKDE
                     RAKEEKERKGEEGRVICLRGLVGSVEEIDEELVNEIGEECSNYGIVERVVLHLVEPPP
                     PEPEECLRVFVVFSGMAGAWRAIKELDGRFFGGRNIKATYFDETRFDKGDRDGPVL"
     repeat_region   731959..731983
                     /rpt_type=tandem
                     /rpt_unit_seq="gaa"
                     /satellite="microsatellite"
     gene            complement(735353..738534)
                     /locus_tag="CNA02830"
                     /db_xref="GeneID:3253263"
     mRNA            complement(join(735353..735701,735759..736714,
                     736768..737197,737253..737446,737502..737868,
                     737923..738360,738412..738534))
                     /locus_tag="CNA02830"
                     /product="heat shock protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532720|gb|CF678561.1,gi|41532721|gb|CF678562.1,
                     gi|41536913|gb|CF682754.1,gi|41539025|gb|CF684866.1,
                     gi|41539440|gb|CF685281.1,gi|41539446|gb|CF685287.1,
                     gi|41541103|gb|CF686944.1,gi|41541112|gb|CF686953.1,
                     gi|41541965|gb|CF687806.1,gi|41541969|gb|CF687810.1,
                     gi|41545356|gb|CF691197.1,gi|41545361|gb|CF691202.1,
                     gi|41547386|gb|CF693227.1,gi|41547391|gb|CF693232.1,
                     gi|41550775|gb|CF696616.1,gi|41550780|gb|CF696621.1,
                     gi|41562238|gb|CF708079.1,gi|41562248|gb|CF708089.1,
                     gi|41564585|gb|CF710426.1,gi|41564843|gb|CF710684.1,
                     gi|41575977|gb|CF721818.1,gi|41575984|gb|CF721825.1"
                     /transcript_id="XM_566689.1"
                     /db_xref="GI:58258552"
                     /db_xref="GeneID:3253263"
     CDS             complement(join(735469..735701,735759..736714,
                     736768..737197,737253..737446,737502..737868,
                     737923..738360,738412..738490))
                     /locus_tag="CNA02830"
                     /codon_start=1
                     /product="heat shock protein"
                     /protein_id="XP_566689.1"
                     /db_xref="GI:58258553"
                     /db_xref="GeneID:3253263"
                     /translation="MDNFTDKSSEVLKAALDKAAEMANAQVHPLHLISVLWEEPNQPS
                     SGPDQPTLLKAALEHVGGNPTLFNRALMHKINRLPVVDPPPSPPLPLANSFNAVIREA
                     QKLQKDQNDQFVAVDHLLLALLRTDASDMKELLRGTGAEPRALEAEIKRKRGGRKVDS
                     KGAEGQFDALNKYCVDLTALAEQGKLDPVIGRDNEIRRVIRILSRRTKGNPVLIGEPG
                     VGKTAIAEGLAQRIVDRDVPASLISRLLALDMGALMAGAKYKGEYEERVKAVLSEVEK
                     SGDEGTQIILFIDEIHLIMAGKDSSGGMDAANLLKPMLARGKLKVIGATTLNEYREYI
                     EKDSAFERRFAQVIVDEPSVPDTVAIMRGIREKYETHHGVRIMDSALVLAAQLAKQYL
                     TARRLPDSAIDLLDEAASAVKVARETRPEAIDELERKKLGLEVEIHALEREKDEASKE
                     RLEVAKKAIADLEDKLGPLKREYENDKHLGDQIHELRRKIDELRTKADEAERRYDLAT
                     AADIRYHSIPQREQKLQELEQKEAEKGSGQQVAPEMIAEVVARWTGVPVSRLVETEKA
                     KLLRLEKLISKKVIGQPEAVKSVANAIRLNRSGLGNQNRPIASFLLVGPSGTGKTLLA
                     KTLAGVMFNSEDAMVRIDASEYSEKHAISRLIGAGPGYVGHEAGGQLTEAVRRKPYSL
                     ILIDEIEKAAREFHQLFLQVLDDGRLTDGKGRVVDFRNTIVMMTSNVGSMYLNEHPSE
                     GAVDPAVRAKVNGAIAKTFPPEFINRIDDIILYRSLSRADIRKVVDVRLKEIQQRLLD
                     NNRKIKLDVDDPSCEWLAQAGYSPTYGARPMARLIQTEILNPLSRLLLQGRVRDGEVA
                     HITVDLRKNRLVVIPNHEPDVIQPDDSEDEDDSMDIEVEEMD"
     gene            <738807..>739696
                     /locus_tag="CNA02840"
                     /db_xref="GeneID:3253734"
     mRNA            join(<738807..738983,739063..739224,739288..739326,
                     739381..739477,739527..>739696)
                     /locus_tag="CNA02840"
                     /product="protein phosphatase inhibitor, putative"
                     /transcript_id="XM_566691.1"
                     /db_xref="GI:58258556"
                     /db_xref="GeneID:3253734"
     CDS             join(738807..738983,739063..739224,739288..739326,
                     739381..739477,739527..739696)
                     /locus_tag="CNA02840"
                     /codon_start=1
                     /product="protein phosphatase inhibitor"
                     /protein_id="XP_566691.1"
                     /db_xref="GI:58258557"
                     /db_xref="GeneID:3253734"
                     /translation="MQPTQTHAAPVRKKPSRPFVSSHHRPADEVDDGIFRVVLITSGS
                     VASIKAPDIVGALVKSPNIDVQVVATKASTYFYSQEDVDNSVRSALNLPDEQIGEHFG
                     VRVWTDEDEWSDWKHVGEPILHIELRRWADLVVIAPCSADLLAKIAGGICDSLAVCNF
                     SSPRTEPINAGNRVPRYEHAHVSASANYSAPRGRARGLGVPCLWTTGGWEACLR"
     gene            741618..746138
                     /locus_tag="CNA02850"
                     /db_xref="GeneID:3253723"
     mRNA            join(741618..742285,742336..742399,742460..742462,
                     742518..742577,742631..742843,742891..743146,
                     743197..743993,744047..744200,744250..744297,
                     744348..744489,744538..744683,744740..745027,
                     745081..745409,745459..745501,745556..745692,
                     745753..745896,745963..746138)
                     /locus_tag="CNA02850"
                     /product="DNA repair protein RAD5, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533855|gb|CF679696.1,gi|41533871|gb|CF679712.1,
                     gi|41543470|gb|CF689311.1,gi|41543479|gb|CF689320.1,
                     gi|41560481|gb|CF706322.1,gi|41560486|gb|CF706327.1,
                     gi|41564349|gb|CF710190.1,gi|41564356|gb|CF710197.1"
                     /transcript_id="XM_566693.1"
                     /db_xref="GI:58258560"
                     /db_xref="GeneID:3253723"
     CDS             join(741641..742285,742336..742399,742460..742462,
                     742518..742577,742631..742843,742891..743146,
                     743197..743993,744047..744200,744250..744297,
                     744348..744489,744538..744683,744740..745027,
                     745081..745409,745459..745501,745556..745692,
                     745753..745896,745963..746090)
                     /locus_tag="CNA02850"
                     /codon_start=1
                     /product="DNA repair protein RAD5"
                     /protein_id="XP_566693.1"
                     /db_xref="GI:58258561"
                     /db_xref="GeneID:3253723"
                     /translation="MSAEASPETGRFRTKSSPELFFPATDSEGEEQNDVPLTIVHPTQ
                     STSSKFSINIASSSRPQHGITTGDFEATSQTSAHDNVDDDFSIVGHNPASSHPQGTIV
                     APRRKRSLQQAHSHHSSSSSSPVPSAPVIRADFRKGFLGEFVCEGWSLSKGRGYCSPG
                     TKIVIERPKSKSTDVGAPKPGRKDSGPVRLVNGKVVGGVKSKQMTLGSMMAKKVEPAK
                     KVKATTDQIIRFRNERGFEIGRLSIHEAGFLAHLLDTGVIQLSGNVIDCPQNLTTGCT
                     ILLNIKVYLARKAFENFGKHKREEHFSFWKDQRETAMEEAMRLRKDSLRSLFERIGVK
                     PIQSSALSKVTPIQGVLNRQKGPDLEGSRLRSSPSTSTAEEKGKGRAAMPAVDDDGED
                     SGDEAEKLDEKQMNEIDSIYRKAQQGDTRLDEMDPPSTFLYTLRPYQKQALTWMNARE
                     KGDSSVRNESLHPLWEEYLFKKDQLPGEPIEISDDDEQPDSTRKFYWNPYSGELSLKF
                     PTSQNLSRGGILADAMGMGKTCMMASLIHTNREEKPAGNLESQTRDGVEGEIDEEPAS
                     KRIKFKQVTLSNQWRAVPTAPKVESFPRATLVVCPVSLAAQWHDELRKMSQQGSINSY
                     VWYGGDRVDIEALLAGDGKERVDVIVTSYGTLTSEYQKWLRTKDRPNYEGGSLYDHEF
                     LRIVLDEAHNIRNRLAMVSKACYELKGQRRWALTGTPIVNRLEDLYSLLHFLRITPWG
                     NYSFFRSFVTVPFLNQDHKALNVVQYILESCLLRREKTMRDKDGRLIVDLPPKTVEIK
                     VLQFSRAERQIYKFLEERAKKRFIDLDADGRAMSNYTSILAMLMKLRQCVDHPLLVLG
                     KSGEDGELGEKILESGAGNGEGNLRDMIAMYAGGIRAETPEDVDKAYAAKVLKELGEQ
                     EDTPICELCSNEMFDEVLLPCYHRSCQDCIVEWIGTCEDQNKIASCPSCGKGPIKLAD
                     LRSVQRRHKRVNPITDAYPGGRDPNLKSSNDTTVTLGKVDLVTSTKLRALLRQLEEIR
                     QEDPKAKALVFSQFTSFLDLIEATLTKQGIRWLRFDGTMSQAQRANTIEEFGRKTNEP
                     LILLISLKAGGVGLNLTMANYVFLMDTWWNEAIEQQAIDRVHRLGQNKPVYVTRYIIK
                     GTVEKRIMKIQRSKTALVNASLSNGAKTKETTLADIKKIFGMDEEDSEGEVY"
     gene            complement(<746168..749528)
                     /locus_tag="CNA02860"
                     /db_xref="GeneID:3253758"
     mRNA            complement(join(<746168..746263,746312..746485,
                     746536..746951,746997..747334,747385..747477,
                     747527..747786,747844..748389,748439..748502,
                     748553..748634,748686..748785,748839..749191,
                     749247..749346,749398..749528))
                     /locus_tag="CNA02860"
                     /product="gamma-tubulin complex component 2 (gcp-2),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533255|gb|CF679096.1,gi|41546274|gb|CF692115.1,
                     gi|41546279|gb|CF692120.1,gi|41558989|gb|CF704830.1,
                     gi|41563851|gb|CF709692.1,gi|41563855|gb|CF709696.1"
                     /transcript_id="XM_566695.1"
                     /db_xref="GI:58258564"
                     /db_xref="GeneID:3253758"
     CDS             complement(join(746168..746263,746312..746485,
                     746536..746951,746997..747334,747385..747477,
                     747527..747786,747844..748389,748439..748502,
                     748553..748634,748686..748785,748839..749191,
                     749247..749346,749398..749505))
                     /locus_tag="CNA02860"
                     /codon_start=1
                     /product="gamma-tubulin complex component 2 (gcp-2)"
                     /protein_id="XP_566695.1"
                     /db_xref="GI:58258565"
                     /db_xref="GeneID:3253758"
                     /translation="MPSSRPATSSTVPFTPKPRKRASSSKFTFTDKELNQFAGTLASV
                     RKVRPGAILEELEQSGEGSGILHRYESSLHRGNPEAQKRSASARAVENERDRSHFRTR
                     PSSSASITQREYNPSFLRAMSGSRDLLPESDHKGREKVNEPAKIEPVLERPTPMTELS
                     AERRLLDKVPLEVQEAWICEDLLFVLQGVEGVLIRYDEGYDPFDEEQRVKGAKWRVNP
                     LLDASLLSLVKRLLPLASFFTAVEASMELRTAPEYGMVSHALCSGIRAMLKEFRVLTA
                     QLESLFLTSPTFTLQTLYLHLHPTLHTMSLLASLCHALEADQAGQGTDDLSDDDDGLG
                     GMAEELGLGGAGLKGLMKNLKAREGLIGDGGDVLGGEVLGIICEREATMSGDPTASTL
                     HSSLLLHASQPYCKMLIQWIATGHLSDPFDEFMVKESGHITKGVLESDYTDEYWERRY
                     TLRDGAIPGSSKVSARNNTPSISAGVPPPRQGTNRLPGGACIPQFLQPWKHKILLAGK
                     YLNVIRECGIEVKKPGEVDEKEMVTMNDPNFYKRIEDAYIYANKTLLKLMVEEQELIP
                     HLRSMKHFFFLNQSDFLTNFLDLAASELRKPAKSASIIKLQSLLDLAVRNPSSSSSND
                     PFKDDLKVVMQSQGLYDWLLKIVSKTGSLTEEGELDFALGDIHEEEGSKREKERPLIA
                     IDALAFDYSVKFPLSLIISRKTIARYQLIFRFLLHLHHLESALSAMWLEHKSPSWRNN
                     SGNEDIERWKARIFSLRTRMLAFVRQVLAFATGEVLEPNWKALEEKLAKVQTVDQLLR
                     DHVDFLDTCLKQCMLTTSKLLNIYAKLMTTISVFVSYQSSLNSALNKFLVDPIAESDP
                     AKSKLRWTALSKFEINFNHHAKLHLDAVTYNAGSENVALLALVTRLHQITLRI"
     gene            <750192..751400
                     /locus_tag="CNA02870"
                     /db_xref="GeneID:3253793"
     mRNA            join(<750192..750247,750299..750392,750444..750673,
                     750730..750989,751043..751400)
                     /locus_tag="CNA02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_566697.1"
                     /db_xref="GI:58258568"
                     /db_xref="GeneID:3253793"
     CDS             join(750192..750247,750299..750392,750444..750673,
                     750730..750989,751043..751221)
                     /locus_tag="CNA02870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566697.1"
                     /db_xref="GI:58258569"
                     /db_xref="GeneID:3253793"
                     /translation="MRAASTFLALAASTSYAVALSTGCTTQLGALALGDLGSCLQLTS
                     LLPVLSSSGSVVDSVNTYLKSLCGSSTPTCSNDTLTSASSSINSGCSSDISDGGTNGA
                     EVTALLALINHYDQAYAAACSTNSSTGDYCVTDTLDTIQDASGSNLTLSSVASILSGT
                     SSDSSNITSMFSSGQLCTQCVSGMYYEALQANSSISDTTIGRALSSECGSDFGQTSPN
                     TTATSTSGDSSAAATSSASSSSGLVSVQYAGLAATAGIVGSVLGAVIIGSTIIL"
     gene            complement(753126..755873)
                     /locus_tag="CNA02880"
                     /db_xref="GeneID:3253828"
     mRNA            complement(join(753126..753383,753436..753595,
                     753651..753705,753760..753862,753921..754082,
                     754203..754307,754368..754415,754479..754553,
                     754610..754706,754760..754901,754953..755012,
                     755085..755111,755170..755184,755252..755277,
                     755347..755418,755498..755873))
                     /locus_tag="CNA02880"
                     /product="High-affinity nicotinic acid transporter,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41556676|gb|CF702517.1,gi|41556681|gb|CF702522.1"
                     /transcript_id="XM_566699.1"
                     /db_xref="GI:58258572"
                     /db_xref="GeneID:3253828"
     CDS             complement(join(753165..753383,753436..753595,
                     753651..753705,753760..753862,753921..754082,
                     754203..754307,754368..754415,754479..754553,
                     754610..754706,754760..754901,754953..755012,
                     755085..755111,755170..755184,755252..755277,
                     755347..755418,755498..755658))
                     /locus_tag="CNA02880"
                     /codon_start=1
                     /product="High-affinity nicotinic acid transporter"
                     /protein_id="XP_566699.1"
                     /db_xref="GI:58258573"
                     /db_xref="GeneID:3253828"
                     /translation="MGNMSTFATAATNKAEDCSSEVGISEKGVEAQDLKDVADIEVQV
                     AGIDRAIERRMLRKQDFGLLPVLATVYLFNALDKGNLSNAKTDGLDKDLGLVGNQYYL
                     MITVFYIPLCLCGTPLSIAAKRFSAARVIPLMMIGFGSCSLLSACVTNFGGLFALRFL
                     LGIFESPMLPSVVFYLSQFYTRGELARRVGVFYAASSISGAFSGLLAFGIFQIKSGRL
                     HGWQYLFLIEGAGTVAFAIFAFFWLPRSPATCWFFNEEEKQLSRMRMLRDGTSEIGEK
                     DAFMPFIKDWRYIVWAFLALGLGVPLASVGNFLPQIVGRLGYSTVKTNLYTVAPNIVG
                     TCFLVLFTQSSDYFRERAIHIVIPLIITMIGFIILGTIDVLNYKGVAYFACFLLCIGS
                     NTPSVLLSTWYSNNSISENKRVVLTGVMVGIANASGLISANIFRAQDEPKYIPALAAS
                     AAFGGFTALLACSFGLYMRIENRRRNFAQGLPKSYGSKDVPTEYLGRGPKDQAFRYMF
                     "
     gene            757688..759413
                     /locus_tag="CNA02890"
                     /db_xref="GeneID:3254008"
     mRNA            join(757688..757756,757804..757946,758005..758137,
                     758193..758697,758753..758806,758868..758946,
                     758997..759011,759255..759413)
                     /locus_tag="CNA02890"
                     /product="chaperone activator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41552949|gb|CF698790.1,gi|41572313|gb|CF718154.1,
                     gi|41572316|gb|CF718157.1,gi|41573314|gb|CF719155.1,
                     gi|41573327|gb|CF719168.1"
                     /transcript_id="XM_566701.1"
                     /db_xref="GI:58258576"
                     /db_xref="GeneID:3254008"
     CDS             join(757709..757756,757804..757946,758005..758137,
                     758193..758697,758753..758806,758868..758946,
                     758997..759011,759255..759273)
                     /locus_tag="CNA02890"
                     /codon_start=1
                     /product="chaperone activator"
                     /protein_id="XP_566701.1"
                     /db_xref="GI:58258577"
                     /db_xref="GeneID:3254008"
                     /translation="MEPKPLTAYQQTYHWRNKNCAPFAYDWIKQSLPGLKVDDGQQSA
                     EISSVTSVSGDCDLGQRKGKLLTIYDLEVQASWIGKTKDGNEVKGTLKIPEVSHEAID
                     GVSDYVYEFSITGGSSSASEELLFYIRKSFPPLLSDKFNSFRPALLAAHGSATADAAS
                     APDSGASTPAAYTPAPPTKGADEPINEEQKKEKKSVGATVTVEVKADLQASADDLWGL
                     LTDENKIPMWSRSAAKLSLKAGSPYELFGGNVRGKVITADPPKKLVQTWQVKSPSWPS
                     EHYGTMTLSLSQGSDTTAATFTLDGVPAGTQADVEKALNSFYIQGLKQMGLGTFL"
     gene            762164..763380
                     /locus_tag="CNA02900"
                     /db_xref="GeneID:3254025"
     mRNA            join(762164..762176,762239..762277,762334..762432,
                     762489..762521,762587..762679,762837..762918,
                     763033..763102,763245..763380)
                     /locus_tag="CNA02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_566702.1"
                     /db_xref="GI:58258578"
                     /db_xref="GeneID:3254025"
     CDS             join(762172..762176,762239..762277,762334..762432,
                     762489..762521,762587..762679,762837..762918,
                     763033..763102,763245..763258)
                     /locus_tag="CNA02900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566702.1"
                     /db_xref="GI:58258579"
                     /db_xref="GeneID:3254025"
                     /translation="MAFNSNPEKTTSCCSTSEAQDKCTCPEGKCECEACPKFTKAPGS
                     GPCDCGVKEKVSTCGCNGSGAACTCPPGQCACDSCPKKAKSVSTCGCGGSGAACSCPP
                     GKCACDNCPKQAQEKVNVPALVAPLKPRKVLSTKPPLAVAKV"
     repeat_region   764551..764628
                     /rpt_type=tandem
                     /rpt_unit_seq="tag"
                     /satellite="microsatellite"
     gene            complement(764968..767037)
                     /locus_tag="CNA02910"
                     /db_xref="GeneID:3253437"
     mRNA            complement(join(764968..765108,765164..765264,
                     765316..765597,765658..765942,765993..766215,
                     766259..767037))
                     /locus_tag="CNA02910"
                     /product="Gly-X carboxypeptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41550484|gb|CF696325.1,gi|41556402|gb|CF702243.1,
                     gi|41556411|gb|CF702252.1,gi|41558711|gb|CF704552.1,
                     gi|41558721|gb|CF704562.1,gi|41572452|gb|CF718293.1,
                     gi|41572467|gb|CF718308.1"
                     /transcript_id="XM_566704.1"
                     /db_xref="GI:58258582"
                     /db_xref="GeneID:3253437"
     CDS             complement(join(765025..765108,765164..765264,
                     765316..765597,765658..765942,765993..766215,
                     766259..767005))
                     /locus_tag="CNA02910"
                     /codon_start=1
                     /product="Gly-X carboxypeptidase"
                     /protein_id="XP_566704.1"
                     /db_xref="GI:58258583"
                     /db_xref="GeneID:3253437"
                     /translation="MSTHEKVYLPTASLGRPSPPRPYGPRLKFLLPLFGIVVFLLYQN
                     SSTVLSKLHACSHSSLDKISDSDKCPVQPNPLNVGEDWNPLTDQAYGELAAKRLSRAV
                     QIPTESFDNLPKDGSDPSFDKHYVFSNFIESEYPKLYQTLKHETVNSHAHLFTWEGSN
                     KSLKPILFMAHTDTVPVLPETLSQWSYPPFEGSITRNATPDTPGTWLWGRGVSDCKNS
                     LLGIYGAVERLVIEGYKPERTIIISNGYDEEIGGIRGSGVIAKILEERYGTEGISFLV
                     DEGFTGVSQDYGALVASLGMAEKGSVNVQIKVETLGGHSSVPPVHTGIGIMSLILAEL
                     EKNPFEPSLVPSTPYFKYLSCMSEHAPEVPKSIKSRIKNPKKWKKLAHDLASSDRILN
                     SFLATTQAIDLISGGVKVNALPEYVEATINYRIAFTSSVNETLEHISQLIVPLAQSLN
                     FTISAFEPPVKRASHFHITLDAPFGFESAPITSSDSKSFELMAGTCKHVFGKDTIVSP
                     SGMFANTDTKQMWNVTKNIYRFTPALLSENVNQHTVDERISLNAHLNTTRFFYKLLRN
                     AEGWDAE"
     gene            767259..771192
                     /locus_tag="CNA02920"
                     /db_xref="GeneID:3253435"
     mRNA            join(767259..767735,767786..767990,768050..768275,
                     768332..768400,768456..768568,768730..768824,
                     768880..769070,769118..769183,769240..769437,
                     769495..769559,769619..769806,769861..769900,
                     769952..770043,770095..770153,770213..770291,
                     770335..770755,770811..770876,770931..770949,
                     771007..771192)
                     /locus_tag="CNA02920"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530745|gb|CF676586.1,gi|41530751|gb|CF676592.1,
                     gi|41551663|gb|CF697504.1,gi|41551667|gb|CF697508.1"
                     /transcript_id="XM_566706.1"
                     /db_xref="GI:58258586"
                     /db_xref="GeneID:3253435"
     CDS             join(767287..767735,767786..767990,768050..768275,
                     768332..768400,768456..768568,768730..768824,
                     768880..769070,769118..769183,769240..769437,
                     769495..769559,769619..769806,769861..769900,
                     769952..770043,770095..770153,770213..770291,
                     770335..770755,770811..770876,770931..770949,
                     771007..771101)
                     /locus_tag="CNA02920"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein"
                     /protein_id="XP_566706.1"
                     /db_xref="GI:58258587"
                     /db_xref="GeneID:3253435"
                     /translation="MGKEDSQRSANHPVTVTPHISSTHDLIQLPLPNTISHNNARSGA
                     SFAVRVTIGTLILLWTLFNIDVVTSPFRQNPSIDSLDDSSAAGYLRGIATKSMKWALP
                     APNHQLHSTYGDLESTEIGEEGIKMSLIPPKLAEKIFLDVPSNDSVAAASKRYTGYAH
                     PAGSGYDYASALTLKNEWEKELGLRVSGPQEFIYDAGSPESQARVKNGMDKLGVWIDT
                     YYPVMNTPVYAAATLLTDPPFHAKLREDIVDGDSDSELRDEVPVFHGLSVSGDVRGNF
                     VYVGYGRKKDFDLLKQRGVDIDGKIVLAKYGGCFRGLKVKAAQEAGATGVIIFTDPGN
                     DGEITEENGYEVYPKGPARQLSKYPGDPSTPGEPAYKNASRLEGGNQPSIPSIPMSYE
                     DVIPFLKALEGKGIHASDLGPDWVGGLGYHGVDYYIGPSDVDLHLVNEVNTRVMPIWN
                     TMAVIPGHITDEVIILGNHRDAWVLGASDPNSGTASQFEVIRGLGTLLRKGWKPLRTI
                     MLASWDAEEYGLIGSTEWAEDFGDWLQTNAAAYLNMDSSASGSNFHASASPSLALLVR
                     SAAEEVESSSSPSKSVFDTRFDAGNWEQFNMEKLGNHVGLGVPLSEKKGSGIGALGSG
                     SDFTPFLQRYGIASSELGHKGGPKDAVYHYHSIYDSFTWQKKFGDVGFHRHTDAAKVI
                     GLLLLRLADGLILPLNTTQYTRDLEYYLEKVQDVSKIDLRTLEIDFEPLADAIEAAQT
                     ASGELDKQRHKALKKLHKLIGKPAHGKYGIFKTMLRGCGWRVEEGKEVDYSLQTWEEG
                     PKEGISSFPHPRLPFPLPTPGRIREIKKVLKEIRIINRKLQNFESGFLSQDGLKDREW
                     YKHKGTAPGLWLGYGATTFPALTEAITIDHSPKLAQKEVHELAKMINKIAKYLVA"
     gene            <771350..>773186
                     /locus_tag="CNA02930"
                     /db_xref="GeneID:3253739"
     mRNA            join(<771350..771871,771923..772040,772091..772176,
                     772261..772647,772697..772972,773019..773040,
                     773128..>773186)
                     /locus_tag="CNA02930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567236.1"
                     /db_xref="GI:58259646"
                     /db_xref="GeneID:3253739"
     CDS             join(771350..771871,771923..772040,772091..772176,
                     772261..772647,772697..772972,773019..773040,
                     773128..773186)
                     /locus_tag="CNA02930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567236.1"
                     /db_xref="GI:58259647"
                     /db_xref="GeneID:3253739"
                     /translation="MSTTNNRNSSRLTIPLYAHHFIFFPNTYSPLATMAECLKTLLSV
                     PSAPSFIYLHHPHHSSLSLPLPYSQKHLVKIDTIEHRTPRLLLNGILLRLIGGDTDVG
                     EARTWDEFSLRLKRWWSDKVYLAEGKSKGKQTETYAKDEAQERSLVLVITHAERLKTV
                     MGNNWPVIVRLAELTGVRSTVVLASSVPWDYVRPPRADAPEPLHVYLPSPSRDEIRTA
                     LLPASAHPLYPRFLDLLLSTILPLMTHLGLPYPDPAKPPPKLAVDVKLFTTLQHHITL
                     PLASAVESLLPRQIGHLEFVSALRPHPGKERALPKLPERPLPLAARLLLIAAYCASYN
                     PSKTDSRLFGRGYSANGKRKKGGGMRRTGYGKVRMGKVPQRLLGPKPFPVDRLLSLFF
                     AIYAEHAPRPAELEHLEESSSDDESVPLTWPPTIATDNGKRDRKRKREREQEQAWDDE
                     VEWLMGSTKFWGMLPELESQAKDSKLGFTLDDYLYEAIM"
     gene            complement(773179..775135)
                     /locus_tag="CNA02940"
                     /db_xref="GeneID:3253433"
     mRNA            complement(join(773179..774169,774220..774412,
                     774459..774584,774639..774720,774793..774906,
                     774978..775135))
                     /locus_tag="CNA02940"
                     /product="3-hydroxyisobutyryl-CoA hydrolase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529878|gb|CF675719.1,gi|41529886|gb|CF675727.1,
                     gi|41544988|gb|CF690829.1,gi|41544994|gb|CF690835.1,
                     gi|41545546|gb|CF691387.1,gi|41545554|gb|CF691395.1,
                     gi|41548873|gb|CF694714.1,gi|41548877|gb|CF694718.1,
                     gi|41560231|gb|CF706072.1,gi|41560245|gb|CF706086.1,
                     gi|41562927|gb|CF708768.1,gi|41562944|gb|CF708785.1,
                     gi|41569674|gb|CF715515.1,gi|41569687|gb|CF715528.1"
                     /transcript_id="XM_566708.1"
                     /db_xref="GI:58258590"
                     /db_xref="GeneID:3253433"
     CDS             complement(join(773254..774169,774220..774412,
                     774459..774584,774639..774720,774793..774906,
                     774978..775097))
                     /locus_tag="CNA02940"
                     /codon_start=1
                     /product="3-hydroxyisobutyryl-CoA hydrolase"
                     /protein_id="XP_566708.1"
                     /db_xref="GI:58258591"
                     /db_xref="GeneID:3253433"
                     /translation="MSSTARIQLLQRMSRPTATSRLAVLNRHLSSSAQMAAPREELVL
                     FESQQDTRIYKLNRSAKLNSLNLEMIDSLSSKIKAWRELDSCKVIIGTGDSRAFCAGG
                     DVKQLVLDLKEGKQTAVPFFKSEFQLNWLLARLGKPYVAVIDGVTMGGGGGLSLPAHI
                     RIATPRTIFAMPETKIGYSPDVGSNYYFAQLDGFIGAWLAVTGQEVYGRAAYELGIAT
                     HYVTENNISDIVYQITQHPSPTPANISSLISAYTAPASATSEASSKSSPDGHTPIKGE
                     IRKFLDKTFNKKSIQEIYAALDKSQSDDKLSSEVKEWAAHQKLQMEARSPTGMAVALQ
                     NYRKAREIRRLDRTLLNDISMATAYSGTNRATDDFITGVSAVLIDRSKGPVAWAPKDI
                     NEESLSPQNINSRFFSASSPHVADKPEIEFTPSSASKLDSGRDSTWGQFRKYGLPSEE
                     AVRAAVDGYAPGSGAFALLEEELIEQFVDAQGDVGGTRRDEVIKRVKEVVNACCKKGK
                     DGYLEWTA"
     gene            <775996..>776298
                     /locus_tag="CNA02950"
                     /db_xref="GeneID:3253431"
     mRNA            join(<775996..776092,776234..>776298)
                     /locus_tag="CNA02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_566710.1"
                     /db_xref="GI:58258594"
                     /db_xref="GeneID:3253431"
     CDS             join(775996..776092,776234..776298)
                     /locus_tag="CNA02950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566710.1"
                     /db_xref="GI:58258595"
                     /db_xref="GeneID:3253431"
                     /translation="MQSLNALGNRQIASLNADLSRMENGEGGPAIQDDYDSMARKEMV
                     TVARDKANT"
     gene            <776765..780684
                     /locus_tag="CNA02960"
                     /db_xref="GeneID:3253429"
     mRNA            join(<776765..776853,776906..776928,777563..778195,
                     778252..778619,778896..779344,779392..779562,
                     779612..779676,779732..780033,780080..780211,
                     780273..780287,780345..780579,780627..780684)
                     /locus_tag="CNA02960"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534519|gb|CF680360.1,gi|41534526|gb|CF680367.1,
                     gi|41549081|gb|CF694922.1,gi|41550732|gb|CF696573.1,
                     gi|41550741|gb|CF696582.1,gi|41567945|gb|CF713786.1,
                     gi|41567952|gb|CF713793.1"
                     /transcript_id="XM_566712.1"
                     /db_xref="GI:58258598"
                     /db_xref="GeneID:3253429"
     CDS             join(776765..776853,776906..776928,777563..778195,
                     778252..778619,778896..779344,779392..779562,
                     779612..779676,779732..780033,780080..780211,
                     780273..780287,780345..780579,780627..780658)
                     /locus_tag="CNA02960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566712.1"
                     /db_xref="GI:58258599"
                     /db_xref="GeneID:3253429"
                     /translation="MLKGTKRRLLDAANTLGMSRETIGWVERRTKQDAWIFVISEVRR
                     DTKSSPGNLSSQSSPRHATFIATNSGQDSDSESQSSRAASEADDDEPNNWDRDRGPDI
                     SDNSEGASNHSSNPSTSSFSTDQQFYRPEKATEVGSDSDSDTDHSSIPSQRSSDIEYE
                     DEAEKVPGRQYNSSPSLFIDPSPGVFAISSNESYSVVATETGSQQGSTTLVSSKEERY
                     TLAEDSRYLLAAHSKRDRTVQQVMARFSALYIFPILVAVPLTLLLSLNTILLTPLYNT
                     IPLSLHNVTLYALYTAPPTLLYWAMTLERSAREVVSANVCISLAALNGDLVAVLGRRL
                     GSLMGRLAGPEWGACFAKAILGFGAVGGGLIFALLCFILFITLYLTTIHLFVRPGPSL
                     ASSLNGLYGFISVGLGVAPSKRSEISKYTALLPKRAPSFILFLRLPLLVLALRQQIFL
                     RPPGQRTDPYVTAHGELRVLSSEQSFTGRVVVGDNLKDGYRFLRCDHSILGGRWFRER
                     ENNGEKTIELGDSIFAVFNLQEVMTLAHRSDEKESLITTLDLTTDLKVTSEGKEDEEP
                     SRGSRSNRALVIGLGAGITAQGFLRRGFNVDVVEIDPAVFTATEIYFNLSSSHLTSVN
                     LLDGSVFVSELATLSRVNITDPSLDSETLTALERLPKWDFVVQDCFTGGSVPGEMFTK
                     EFWEDLGEMVAEDGLIAMNFVGLKMSKASKAVLVTLTSVFPQCRAFGDGYEVNQGPND
                     ITNMVVFCTKTYSPILTFRRPRPSDVHRSPLRSHVFSTFLPNEIQLDSIISEEDYHDT
                     LMTLRRGDTKRLDYWQKETAIATWRAMQNILTPEMWMAY"
     gene            complement(780702..>782238)
                     /locus_tag="CNA02970"
                     /db_xref="GeneID:3254028"
     mRNA            complement(join(780702..780887,780943..781240,
                     781295..781380,781434..781605,781653..782012,
                     782060..782142,782187..>782238))
                     /locus_tag="CNA02970"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539866|gb|CF685707.1"
                     /transcript_id="XM_567154.1"
                     /db_xref="GI:58259482"
                     /db_xref="GeneID:3254028"
     CDS             complement(join(780784..780887,780943..781240,
                     781295..781380,781434..781605,781653..782012,
                     782060..782142,782187..782238))
                     /locus_tag="CNA02970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567154.1"
                     /db_xref="GI:58259483"
                     /db_xref="GeneID:3254028"
                     /translation="MAHYQISPGRAVGIFHLGDTLWHVLDLLRTRKNEYPKFSLSWDP
                     QHPHESAVVIHLPSLTLYFPHPSQTLTLISFPSLAFSNITLTFETQLLYAPEQPLTRA
                     KVGRIFGPTFADEGRGLVFPGIKFEMSSEGKGGREDLVRRLDVNGKEGERLSLPGQLI
                     SCNVQPNKGVVLSIAEEEPLEIILGQTTAQDLLLDLGHPLRKFWKEDDRLEKMWGGTS
                     EPGYCFWNYFQYGLDFLISPQFKVHKILCYSNIPGTPLFQRYARCPWTVSTSSGTLNL
                     TSSVAAFHSSLFPKPSQYEEEIDEQKRSTSDKTRKASKSGAGSTKKKRSGEPPVMVLD
                     RVVEGGLDGVMNVGESRLIGYEGLIIEEDQLSGGICSVLVWRNEGVQSLS"
     gene            783277..784267
                     /locus_tag="CNA02980"
                     /db_xref="GeneID:3253427"
     mRNA            join(783277..783676,783730..783966,784035..784267)
                     /locus_tag="CNA02980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566714.1"
                     /db_xref="GI:58258602"
                     /db_xref="GeneID:3253427"
     CDS             join(783332..783676,783730..783966,784035..784115)
                     /locus_tag="CNA02980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566714.1"
                     /db_xref="GI:58258603"
                     /db_xref="GeneID:3253427"
                     /translation="MLSSRAFSPRTIFNRAALSPLAISTRFFASPTTSSMAGNTSVAD
                     AVKHDHRELEEYYDQIIKATDADTKTRYQNLFTWELARHSVGEELVVYPALEKYVDGG
                     KALADRDREEHQKVKEMLYKFQQLSPSDSEFEPTIKKLMSDLAEHIKEEETEDLVKLE
                     QAVPSSESSSLAASFKRTKMFAPTRSHPSAPDKPPFETVAGLLAAPLDKLGDVFRKFP
                     NE"
     gene            784773..786376
                     /locus_tag="CNA02990"
                     /db_xref="GeneID:3253425"
     mRNA            join(784773..785135,785185..785206,785259..785919,
                     785970..786376)
                     /locus_tag="CNA02990"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543137|gb|CF688978.1,gi|41543972|gb|CF689813.1"
                     /transcript_id="XM_566716.1"
                     /db_xref="GI:58258606"
                     /db_xref="GeneID:3253425"
     CDS             join(784778..785135,785185..785206,785259..785919,
                     785970..786080)
                     /locus_tag="CNA02990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566716.1"
                     /db_xref="GI:58258607"
                     /db_xref="GeneID:3253425"
                     /translation="MTTPTAQSQPVTFSSAQDENSAIAQSLAARRRRSLASILRDFRI
                     RQSAHKTTGDRVVEEESEEEEEEEDEYDHPERINTLDLEAYKRAMGDMIKMEQSGEVI
                     DPDSIETEAAGLEFVWDVLFENQRGIYLLGTAYYSSNTLLPKDPSTFTRPDRTAPITS
                     SFALADPSQNPTVQPVKSSKKYLRKVKAKSSTPTQSNKTSYTLETYQPPSPEWEYLTP
                     WMVNMRTGTDELGWRYNAWFRKKGWSSHAGNLGWWGWVRRREWVRLRVRKPRRKEEDK
                     PSEKIYRTPSYKLEDLLNGEVSGNALRILKLMGELGVDRERLELWKSWLDGIQKGGQV
                     WNRLQELLADREASTLLHRQFIHLPSYQKFMDLLSDHSLSTSPAHSDTP"
     repeat_region   784961..784983
                     /rpt_type=tandem
                     /rpt_unit_seq="gaa"
                     /satellite="microsatellite"
     gene            complement(785983..786849)
                     /locus_tag="CNA03000"
                     /db_xref="GeneID:3253423"
     mRNA            complement(join(785983..786338,786392..786497,
                     786555..786619,786685..786780,786834..786849))
                     /locus_tag="CNA03000"
                     /product="DNA repair-related protein, putative"
                     /transcript_id="XM_566718.1"
                     /db_xref="GI:58258610"
                     /db_xref="GeneID:3253423"
     CDS             complement(join(786049..786338,786392..786497,
                     786555..786619,786685..786780,786834..786846))
                     /locus_tag="CNA03000"
                     /codon_start=1
                     /product="DNA repair-related protein"
                     /protein_id="XP_566718.1"
                     /db_xref="GI:58258611"
                     /db_xref="GeneID:3253423"
                     /translation="MTSFVFVTGNANKLREVKAILAAGDSGIEVTSQSVDVPELQGTT
                     QEIAIAKCKVAAEKLGTACVTEDTALCFEALNGLPGPYIKDFLANIGHEGLNTLLNGF
                     PTTRATALCTFAYSPGPGEEPILFEGRTEGNIVPARGSKVFGWDPIFQPLEGGGRTYA
                     EMDGEEKNKISHRYRALEKLRAYLSEQAK"
     gene            787098..788500
                     /locus_tag="CNA03010"
                     /db_xref="GeneID:3253421"
     mRNA            join(787098..787766,787817..788298,788352..788500)
                     /locus_tag="CNA03010"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543586|gb|CF689427.1,gi|41543595|gb|CF689436.1"
                     /transcript_id="XM_566720.1"
                     /db_xref="GI:58258614"
                     /db_xref="GeneID:3253421"
     CDS             join(787596..787766,787817..788298,788352..788394)
                     /locus_tag="CNA03010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566720.1"
                     /db_xref="GI:58258615"
                     /db_xref="GeneID:3253421"
                     /translation="MSTSSTPSRQRTIVNWMNTSLVAPLEGWERGCFGVGTRGRGGRR
                     RPHAKFEGLGGNQSSPAPQAAAEGPLTPHNLRILCVNKWISQPTSSTPTDLRLLRSTK
                     FSPYFDNCVGALDGTHIRTTVRGEEAKRSWRNRYSYISTNVLAACDFSLRFVYVRPGY
                     EGSANDQNVLNNALEDNFVIPKDRFYLADAGYGAHPGLRLPFRGVRYHLKEWGRANTR
                     PRSKEELYNLRHA"
     gene            complement(789327..792218)
                     /locus_tag="CNA03020"
                     /db_xref="GeneID:3253419"
     mRNA            complement(join(789327..789420,789471..790021,
                     790089..790234,790610..791476,791546..791833,
                     791905..791998,792047..792078,792134..792218))
                     /locus_tag="CNA03020"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538704|gb|CF684545.1,gi|41539064|gb|CF684905.1,
                     gi|41539075|gb|CF684916.1,gi|41539817|gb|CF685658.1,
                     gi|41543278|gb|CF689119.1"
                     /transcript_id="XM_566722.1"
                     /db_xref="GI:58258618"
                     /db_xref="GeneID:3253419"
     CDS             complement(join(789953..790021,790089..790234,
                     790610..791476,791546..791833,791905..791998,
                     792047..792078,792134..792170))
                     /locus_tag="CNA03020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566722.1"
                     /db_xref="GI:58258619"
                     /db_xref="GeneID:3253419"
                     /translation="MAKKSHNPAEAYRKQLKAKELKKNKEARQKARETQTVKKDTREL
                     ETEIRSLKAENNPANKKKIQELESELQYVSKLKEKYVSEHPEEHDRIYNIRRKTEQDQ
                     DGEGEGSGSGKQLYDERGRLRNPKRSVYYDPVYNPFGVPPPGMPYRERTAEEEESEED
                     ESDDDIVMPEGPPPDSDEEGDGDDSDDSDDIPLPEGPPPEPQAILPVPPLPSGPPLPP
                     SGSGFFPPSAGYRPPHHFAYGVPPPPPPSFRPPMPPRPHAPNVAHNRPPVPVQDPLSN
                     KPTIPYQAHKMAHALPTRPSGPSGTGVSTSASPKPIPVAASSDAKAPITQSAGVPGAS
                     GEISAAPVLRDLRKETTAFVPRGVRRRKAGPGGSSNGAGGMTVNAAPGAGEIDEDGDE
                     IKRPKLAEGEGLLGKLSGVLGGAHGVLGKNGSEEKRDVDDDYQKFLEAKIAVMMKKIA
                     TLKTDTFHAELLKKDSLSRLSSDDWTCDSSSEDDGPPSKKKTHRGSYPCPAKKSCEDK
                     WT"
     gene            792395..793238
                     /locus_tag="CNA03030"
                     /db_xref="GeneID:3253417"
     mRNA            join(792395..792573,792677..792749,792819..793004,
                     793092..793238)
                     /locus_tag="CNA03030"
                     /product="arp2/3 complex 16 kda subunit (p16-arc),
                     putative"
                     /transcript_id="XM_566724.1"
                     /db_xref="GI:58258622"
                     /db_xref="GeneID:3253417"
     CDS             join(792419..792573,792677..792749,792819..793004,
                     793092..793154)
                     /locus_tag="CNA03030"
                     /codon_start=1
                     /product="arp2/3 complex 16 kda subunit (p16-arc)"
                     /protein_id="XP_566724.1"
                     /db_xref="GI:58258623"
                     /db_xref="GeneID:3253417"
                     /translation="MSDYAFRKIDIDALDEDVLLPSDLYDPDPRGPDGVLEDAKRRSA
                     DVRGLVSRGDVAGALSTILTDPPYGDGVDEAKSLTTSSLLLILNSTRSADIPTMIKNL
                     DQVQQDRLMAYLYKGMAVLAQGGEVSGSVLLTWHEKLTEVAGVGCIVRVMTDRKTL"
     gene            complement(793270..794414)
                     /locus_tag="CNA03040"
                     /db_xref="GeneID:3253415"
     mRNA            complement(join(793270..793458,793518..793665,
                     793717..793957,794014..794349,794389..794414))
                     /locus_tag="CNA03040"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_566726.1"
                     /db_xref="GI:58258626"
                     /db_xref="GeneID:3253415"
     CDS             complement(join(793392..793458,793518..793665,
                     793717..793957,794014..794349,794389..794394))
                     /locus_tag="CNA03040"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein"
                     /protein_id="XP_566726.1"
                     /db_xref="GI:58258627"
                     /db_xref="GeneID:3253415"
                     /translation="MNPQTYPAVNPYPPTQAAPSAGPGSGFPPKSGLAGMTPHSMSST
                     PVPNMAPGAGVRGGLPEERNVAQLVRENTNVWARKWQGLLDRSTPHVLERWLVTLGLF
                     LLFALNVILRQGWYIVCYALAIYILNLFLAFLQPRFDPSLAEDLAADDVEEGAPGLPG
                     AGPAKTPGGLKGLLNGFSNGEEDEEFRPFIRRLPEFKFWYSATKANAIALLCTITRAT
                     DVPVYWPILLVYFFTLFGLTMRRQIQHMIKYRYVPFDLGKKARYGRK"
     misc_feature    794181..794209
                     /note="GC_rich"
     gene            <794578..797259
                     /locus_tag="CNA03050"
                     /db_xref="GeneID:3253413"
     mRNA            join(<794578..795059,795094..795477,795532..796168,
                     796228..796589,796641..796758,796820..797259)
                     /locus_tag="CNA03050"
                     /product="ubiquitin-protein ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530570|gb|CF676411.1,gi|41530578|gb|CF676419.1,
                     gi|41564697|gb|CF710538.1,gi|41564703|gb|CF710544.1"
                     /transcript_id="XM_566728.1"
                     /db_xref="GI:58258630"
                     /db_xref="GeneID:3253413"
     CDS             join(794578..795059,795094..795477,795532..796168,
                     796228..796589,796641..796758,796820..797158)
                     /locus_tag="CNA03050"
                     /codon_start=1
                     /product="ubiquitin-protein ligase"
                     /protein_id="XP_566728.1"
                     /db_xref="GI:58258631"
                     /db_xref="GeneID:3253413"
                     /translation="MNTHLAARLQHLASSYPPHTALFYARIWHTLAPTTDSNHDSLHA
                     LALAFLQAAEPYSAIHLVRDHTGLDNLDLDLEIRFERTDKVCGGCAMIVARCCEKLGR
                     YSEGQAVLARALKRGANISRFGCNVDEYPVLTLDRFSIACTLIECCNGISTPGQPVTQ
                     RKALDEDPWMWEAFTNLCDVGRLKSFDVSLFQPIRELTKHSQGAPPPIESLFPAGAGL
                     SLSRHASRSSRPPLSPNIHRQKSPIEPAPGVLRLHQAQAGAGNSGGLFTPDVEGIGGK
                     TGLGMMGNPSSWDSSSIIGDTTFAVPEQPTKRPFPSFMSTATSFLPSSLRGGTSTPAG
                     SDSPPKLPTMKRPRGKDPVKRPVETPQSQMSSGLPLAKELRPNGAKYEDSDAPRRSSR
                     LKTTTSKPAPKIPRDPHATRSRSVTSSNSNNEVPSPPSLTSQDAILQREADEYLKDIV
                     KKCARVYKSLSRYQCQQAIKEVDALPGELKTSPWAMEILGRAFYEIANYAMARRAFTF
                     LQQQEPYRIQSMEQLSTLLWHLTDLPALSHLSQSLISISRSSPQAWIAVGNCFSLQKD
                     HDEAMRCFRRATQVDEGCAYAWTLCGYEAVEMEEYERAMAFYRTAIRTDARHYNAWYG
                     MGLVYLKTDRPRYAEHHFRRAVEINPTNPVLLCCVGMALEKSDDVVQALHFYERASKY
                     APTSAMVQFKRIRALVALQRYDEAISALVPLTHSAPDEANVFFLLGKCLLKKERRQEA
                     TVAFTNARELEPKLEGVINAVLAANGEEGEDEE"
     gene            <797390..>802241
                     /locus_tag="CNA03060"
                     /db_xref="GeneID:3253411"
     mRNA            join(<797390..797645,797699..797970,798027..798217,
                     798275..798457,798864..799828,799940..800475,
                     800568..800656,800798..800961,801014..801240,
                     801303..801568,801638..>802241)
                     /locus_tag="CNA03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_566730.1"
                     /db_xref="GI:58258634"
                     /db_xref="GeneID:3253411"
     CDS             join(797390..797645,797699..797970,798027..798217,
                     798275..798457,798864..799828,799940..800475,
                     800568..800656,800798..800961,801014..801240,
                     801303..801568,801638..802241)
                     /locus_tag="CNA03060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566730.1"
                     /db_xref="GI:58258635"
                     /db_xref="GeneID:3253411"
                     /translation="MQNSVPPATFRRINSLPLSHSHSPTPTDNASSGWVTTTSSWTSS
                     TKDPPSTLDVLSKGGGPLAWTEVRHRLQEGEHVDVDGEGNNVGHCSQAVILSCLHLAH
                     EMALREVGMYAWTVPAVKDPTGSMMKIMKRTLTAVCQVYFQKEEQEERKADEGLEEYE
                     KQIKAMSRHADLRCRSVPDPSKLSIQHHLQKARQAAGLNSYVAVIYSGHGIQEPPTEA
                     GELWCYDKNFEECLQSGCGPSEYIPILLFDLLTWAGASTCYVWDCKNAGRFIRAAKTE
                     AEEIDSQLRTAAAQNPSVAETQPATLFRAFRLQFPTMPCGQHGILSLTICSNNCQNTS
                     MTLTPMSHGEKDLKLVSFMADQLESITTAGQSLLFTETPKSGMMPGLTRLPIICRASM
                     TEEFRVQACSALDACLNALDARGLARAVQGGALDVAVELLALQDERIKDQVISIWSSL
                     VKYDSCVLALAKEGLTADRLTDVPAVKFFLIVLQENLAHDKLSPDAGDSGPDTQEDCS
                     DFNLVPTVQIAAVLSTIANFVVGRSAPRFVSRSLNMANIMLHSSCDLIRQWGALLAAE
                     VLGSLSISDEERLSEELKGELLRMVDSGNVENRAAGIYALSRWLPVGDEWGASELEGF
                     TAMALWTQLLGYALDARRQDISVAEKAIINLGMNLKMAPKQKLLLNRIAAILSAVCVQ
                     RYDPDPMVAKIVHQPLCKALDMLRSQSQESKKDANVWSEIQSATFLSSKNKPEWTNEM
                     FETILAASERVKELYQGTSSGNDPCRFTAERPQHAKEAKSRKRVNHGLFERNKRALQA
                     HITFSNQINVFWRYLDYETSRSRGFARNSRTTGTVMSCNRDHDLLMWDWNSSRKIGHV
                     KLNLASHTSITSARFVNELHEQIVILAEICNGDIHILAGPQDASRIKPIASFQALNMH
                     SSRNMLVEDEDHRRLVTTWFRQSGKLCVGGASEVINVWDCPAERCVQVLETKANVPVT
                     TLITEPVSGNLVIGGQADGMVQLFDLRQCRRTSVLSWKADLPGLSIQQEDMRLFNTKK
                     DGVAKMGVILGESKHVTSACFNGLINVHDIRNLSQSAASVLAHPDGIASASFQPHSGL
                     MSTVSLLNKPPLNSSKGTIMSVTPAYSHSSTQSKLSTALSHFHLRSRSNSSPKIRPSY
                     TMNNNITLHPSAASIRSSANWSLHRTSLGSCNPVTVESISFDSQPADVMAQGFRPYTV
                     MHPLRPFLGIGFGETCYLRGCGVGKGDDTDSGSYTFLREQAKYGVL"
     gene            complement(805177..>808000)
                     /locus_tag="CNA03070"
                     /db_xref="GeneID:3253409"
     mRNA            complement(join(805177..805654,805708..807161,
                     807211..807828,807879..>808000))
                     /locus_tag="CNA03070"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41576539|gb|CF722380.1"
                     /transcript_id="XM_566732.1"
                     /db_xref="GI:58258638"
                     /db_xref="GeneID:3253409"
     CDS             complement(join(805236..805654,805708..807161,
                     807211..807828,807879..808000))
                     /locus_tag="CNA03070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566732.1"
                     /db_xref="GI:58258639"
                     /db_xref="GeneID:3253409"
                     /translation="MAQDPEAGISALSSRKMDSRTPKSPSDDAVAWVQLISKHKQLAD
                     LHDHFLTTLFDPLVPSSYHQLSIKYNIPSRLWQTAFFLILEQLRHAWVSHHPSALDLL
                     TDVVYDAYRFYSELLENQALSGLRGAWIEALGDLARYRMTIASHVADIDPRKETERIR
                     DQRQGADDDNDQDPEGKPPLSGASIGAEVAQNWDVEDKETWRVTARDWYTMGITEKPG
                     EGRLHHHLALLCRDMKGQEGRALHHFVKSLVVTHEFSTSRETILPLFDTALQSQRSLP
                     EATAMDLFIRLHGMLFTRISLDSFPDVMSRYVERLEEDARLDGVSRKATISQVDWMIM
                     GVVNIAGVLQYGSASGIIRKALAQEGAERRKAQAQNADDEEGEDVGENLEEVNGISKD
                     TELVSLPASVAESDLPITFTHALFLTFAVFGFSLAHPNRIQGFHQVLNPYIIIVLTFL
                     ATLFRQPHVGVHLLPYVPWQLLADFINSANLSLVEEKRLANGAPLPEDWLIRGSEWVG
                     RRVYERGFWKGKSPSGRGSSGLLQAQPRSGERFQSEMDVLLSNFDASVDIQEGVVDEA
                     EGTDLTDGPAAVNQRRWKRVAWAVGVLAKSVEGFEIRDGKVYVEGTLQEKVKERERRK
                     EEEERREREVLERKRQEREKEEKLLGLEMGEESDDQELVDLRRKLQDLKAQAGVQVSR
                     KSRKAASNILDVVAGYTMLIFDTNILLDSLELVNRIVESGQWSVVVPLPVVTELDGLS
                     KEHGALGAAARAAVALLEERIRTHALCLKIQTTKGNYLSDLLIRTEQIDSSTYASSEA
                     IARTMDDRIVHIASFAQEHFVDRTILLAMPRPEKGATKVLLISNDRNLRLKAKARGVE
                     VANEKELGVVLARV"
     misc_feature    805963..806061
                     /note="CT-rich"
     gene            complement(<808097..809458)
                     /locus_tag="CNA03080"
                     /db_xref="GeneID:3253407"
     mRNA            complement(join(<808097..808640,808690..808956,
                     809015..809458))
                     /locus_tag="CNA03080"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41576549|gb|CF722390.1"
                     /transcript_id="XM_566734.1"
                     /db_xref="GI:58258642"
                     /db_xref="GeneID:3253407"
     CDS             complement(join(808097..808640,808690..808956,
                     809015..809175))
                     /locus_tag="CNA03080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566734.1"
                     /db_xref="GI:58258643"
                     /db_xref="GeneID:3253407"
                     /translation="MGEIPLAGPSRPRRRNNTESDGISIRVAALQKQNATLVGVAANE
                     SGKTRPPPASPSRSRPHSSLPSRPDIDDDYYRGISGPMPSSLTSNLEFNDADGLGVAG
                     SSRPRRKDYAAVNGASSRAATLPKHGAAVKDEGETQQLPTSPSRPHSRPHPSLPTRPR
                     RDNEFSRGASGSSTNKVLFDPTKLHEVRRVEPGSTKKLFDPVAHDPRSFTSLATPPSL
                     PDTESAPSTSTTAKRLLRRAAPGTGSGSGQSGSSKHTWEIDADRERERRRRREGSERG
                     STLSGKKKDSDARSKGSKSSEGSESFKDRERGKGKKYVQRTERDKEG"
     gene            809760..811829
                     /locus_tag="CNA03090"
                     /db_xref="GeneID:3253405"
     mRNA            join(809760..809863,809939..809972,810023..810078,
                     810135..810265,810329..810345,810387..810986,
                     811040..811182,811233..811380,811435..811586,
                     811639..811829)
                     /locus_tag="CNA03090"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536598|gb|CF682439.1,gi|41536607|gb|CF682448.1,
                     gi|41541858|gb|CF687699.1,gi|41541864|gb|CF687705.1,
                     gi|41545044|gb|CF690885.1,gi|41545046|gb|CF690887.1,
                     gi|41552791|gb|CF698632.1,gi|41559177|gb|CF705018.1,
                     gi|41566819|gb|CF712660.1,gi|41566823|gb|CF712664.1,
                     gi|41569420|gb|CF715261.1,gi|41569432|gb|CF715273.1,
                     gi|41576167|gb|CF722008.1,gi|41576179|gb|CF722020.1"
                     /transcript_id="XM_566736.1"
                     /db_xref="GI:58258646"
                     /db_xref="GeneID:3253405"
     CDS             join(809802..809863,809939..809972,810023..810078,
                     810135..810265,810329..810345,810387..810986,
                     811040..811182,811233..811380,811435..811586,
                     811639..811768)
                     /locus_tag="CNA03090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566736.1"
                     /db_xref="GI:58258647"
                     /db_xref="GeneID:3253405"
                     /translation="MVKDTQLYDLLEVQPDATDIQLKKAYRKLAIKYHPDKNPAPEAA
                     EKFKDIGEAYQILSDPDSRAFYDKVGKDAMNRPEGGNIDPQEIFSQIFGGEAFFDYIG
                     EIALVKDFTTTMDVVMSPEEKAEMEAAAKADAEASAEATEPSSKTSAAASAAAASAAA
                     DPLGQSAAGAANEAAQAEVGVSGENQALALHSSASGTNTPTGKADGEADAVGAAKKPE
                     SSKKGKPKLTPEQKAQLEALEKKQDEEKQKRIETLQDRLVQRIRPFVDAKNPGDINDA
                     ETKAFENRIRIEAEDLKLESFGVEMLHTIGQVYITKAGNFLKSKKFFGGGFFGRLKEK
                     GGMMKEGWNLLGSAVGVQSAMAEMERLEAKGDASQEEIEALAQELSSKMLLTTWRATR
                     WEVINVLNVVVDRVLYEQGIHKDMALRRAKAIMTIGGIFKAVEADESDDERRELERLV
                     MNAGKKKKEEKEKKGWFSRSHAHKPEATTPDKEEGPKVTA"
     repeat_region   811658..811687
                     /rpt_type=tandem
                     /rpt_unit_seq="gaa"
                     /satellite="microsatellite"
     gene            <813738..818294
                     /locus_tag="CNA03100"
                     /db_xref="GeneID:3253403"
     mRNA            join(<813738..813982,814033..814090,814153..814210,
                     814274..814368,814425..814531,814585..815358,
                     815415..816933,817002..817484,817550..817632,
                     817699..818294)
                     /locus_tag="CNA03100"
                     /product="single-stranded DNA specific
                     endodeoxyribonuclease, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534792|gb|CF680633.1,gi|41535567|gb|CF681408.1,
                     gi|41555068|gb|CF700909.1,gi|41563089|gb|CF708930.1,
                     gi|41563096|gb|CF708937.1"
                     /transcript_id="XM_566738.1"
                     /db_xref="GI:58258650"
                     /db_xref="GeneID:3253403"
     CDS             join(813738..813982,814033..814090,814153..814210,
                     814274..814368,814425..814531,814585..815358,
                     815415..816933,817002..817484,817550..817632,
                     817699..818248)
                     /locus_tag="CNA03100"
                     /codon_start=1
                     /product="single-stranded DNA specific
                     endodeoxyribonuclease, putative"
                     /protein_id="XP_566738.1"
                     /db_xref="GI:58258651"
                     /db_xref="GeneID:3253403"
                     /translation="MTISDIYARRVITTGADTEMISVSAYSSSSSLSSSLVQSTVAYF
                     DESPACLFYHHVHRWKRIINMGVKGLWSLLNPVARPVQIESMEGKRLAIDSSIWLYQF
                     QATMRDKDGRVLVNAHVLGFLRRINKLLFHGIKPVFVFDGGAPALKRSTIAERKRKKT
                     GAAANHAKVAEKLFAAQMRREAVKAAQVAQEQKEAKASAEAAAEYARRYPDEAGEQIA
                     EGAVYLEDLEGRAGPSRPRSPGPAQTEGVDPSAVPTDPEKRRKYFKKHDPYRLPAAEM
                     PTVSTSDRPDARLATEEELKQFIDEVHPEDIDIESAEFRALPTEVQYEIIGDLRIRSR
                     QQSHRRLADMLRAAPTPLDFSKAQIKHLSQRNALTQQLLTVTDMVGKAHLTIPVRIAA
                     ERNREYVLVKKDETEGGGWALGIREGSKEKPIEVEPAEPKTESEHESDIEPLSPPPQA
                     AMDQDLREYRRQQVLEAIAARYAPKRQARAPLDVAVKPFGPSRTASSKPLFDVDGEEE
                     EGEEEVVPTANDEALALALQQEELGDDETEVDEDLAKALALSRREAERKSRSENEGFR
                     VVDVGKDELTEEEDGDMEEVELVPSGTVTPAQVDIEAEDSEDEDEFEEVDTPSTTLSS
                     SRVSLGASIAPGMETPEIVTIHPNSTRMIDPIVMDDDDDDDDDKGEPLVMSMFKEKRA
                     SVYLPPLASDLPERAAQSSGEQAPPAITSRSQISQSTAVPVRPKALQKLNSAVNVPSP
                     LRNVAQPKSSPKSSPISVDDVSVPAGAPDLPFTVEATDPTEIRGAPSPDMIPPRSPPS
                     PELYGSGSLERPHFLERPSPRSPVMYNEMDDEDGSEADEKDETRSTYSWSPSPTPPPR
                     PLRTTESDVSLNTVASPSPALIAAPRDDDEDDGDLAPADVAAESDDYARFVASIKNRD
                     LNEVRGEIDDEIRVLNSENRVAMRDSDEITQSMIAQIQTLLRHFGIPYITAPMEAEAQ
                     CAKLAQLGLVDGIITDDSDVFLFGGVQCFKNIFNDAKYAECFLLADVERELMLTRERL
                     ISLAYFLGSDYTLGLPGIGPVMGLEILANFPGERGLYDFKEWWGRVQKGNDTEEESGT
                     KWRKSFKKRFLKSIYLTADWPDPLVREAYLYPTVDESEEPFHWGFPRLSALRTFLHEE
                     LSWSISKVDDELTPIVQRISLRGKHGALNKQGTLDPFFDMSAGAGHYAPRKRGMNVSK
                     RLMGVIKQFKEAEIRMSKGEDLDVDAILADEEKEKKRKAKGKRKMDEKEAGDDEKEEG
                     RNSSSNKRKKTSARGRRRAGTASSVGDSVASSEGGSRSTSTSGRGRGGSRARGRARGK
                     GQE"
     repeat_region   816052..816078
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     misc_feature    817976..818116
                     /locus_tag="CNA03100"
                     /note="GA-rich"
     gene            complement(818339..>819144)
                     /locus_tag="CNA03110"
                     /db_xref="GeneID:3253401"
     mRNA            complement(join(818339..818524,818605..818682,
                     818769..818863,818943..>819144))
                     /locus_tag="CNA03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_566740.1"
                     /db_xref="GI:58258654"
                     /db_xref="GeneID:3253401"
     CDS             complement(join(818366..818524,818605..818682,
                     818769..818863,818943..819144))
                     /locus_tag="CNA03110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566740.1"
                     /db_xref="GI:58258655"
                     /db_xref="GeneID:3253401"
                     /translation="MLPFVVHSYTHTHTHTPTMFAPALLRTARPAASRIAPIASRLAS
                     SSTKLTIANENFPLPTGEEVDPQLNGYPQLPNVSLQNRYPFGWWDIQERKNFGEVVHE
                     SEDVLGMWGPDVHKTSWQSALLQLCTAFGLVGAVSYVLIKTRPERPVTARDYPYGGLE
                     KELGGINVARKEQVDEE"
     gene            <818914..>821465
                     /locus_tag="CNA03120"
                     /db_xref="GeneID:3253399"
     mRNA            join(<818914..819091,819376..820865,820935..821082,
                     821203..>821465)
                     /locus_tag="CNA03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_566742.1"
                     /db_xref="GI:58258658"
                     /db_xref="GeneID:3253399"
     CDS             join(818914..819091,819376..820865,820935..821082,
                     821203..821465)
                     /locus_tag="CNA03120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566742.1"
                     /db_xref="GI:58258659"
                     /db_xref="GeneID:3253399"
                     /translation="MPTVQEQRRTLRVDLLSGGQGKVLVCDGELCGGGRETGSDGSDA
                     RCCWAGCAEEGWGEHASQNKFKPVARPPQRKPPTAAPRQSLSLLDAAARPPTAAPRPP
                     SESPRPPTPPTAGFPPTLTTATQPADPSGLPPTLATALESSPPVVDPVLLAEEAVASI
                     SSSMPPPSGEIRRKAPRRRRIPAASTEASKKKRAGKIPGTAASTPQAASDDDSVSQAG
                     SKRAASVLDDDDETSLAGSVSSSRAGSLAPGRAKRAKTSRGPRVATIALTDVEPEEMV
                     GSPVTEEMTMGDLATVLVSEGRVSSRAIKIDEFRRAEMLKKKEVAQKRAEETWKRNQI
                     KRRKVRAAQNKDRAKRREEIRKQGGDEKDVSPDEMDSDEEFEVAPERLTPPRSSSEEA
                     GERAAAGFGQGDEEDGAVDSDVQDVAVDNGPLDEEDQAFENMFGDNARPNSLAPEDNA
                     VIANEEEEDAATAALRAAGFTVTDDPVSPRSNDDGWGGPGGAEEFDVADYRLALQEKR
                     LREFREREEEDGDVVEVDDETRFVNSATYGKNRKSQRWSKMETELFYEILGETGENYT
                     LMKAYFPGRDIRSLRLKGARENKVNPEKMTAAIMARKPLDKDYLAKSAGYDASRSWDK
                     EEALFEEAKADVERLRKLDSEQPLGKDVEDLDEQSGDMMEADDDDGLQRIEEMDVEEE
                     EGKSEDGNDE"
     gene            complement(821702..>824003)
                     /locus_tag="CNA03130"
                     /db_xref="GeneID:3253390"
     mRNA            complement(join(821702..822158,822232..822278,
                     822335..822643,822701..822945,822999..823173,
                     823242..823274,823379..823447,823507..>824003))
                     /locus_tag="CNA03130"
                     /product="anon-23da protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533478|gb|CF679319.1,gi|41533489|gb|CF679330.1,
                     gi|41539543|gb|CF685384.1,gi|41548223|gb|CF694064.1,
                     gi|41548227|gb|CF694068.1,gi|41549963|gb|CF695804.1,
                     gi|41562230|gb|CF708071.1,gi|41562235|gb|CF708076.1,
                     gi|41572395|gb|CF718236.1,gi|41572401|gb|CF718242.1,
                     gi|41573122|gb|CF718963.1,gi|41574204|gb|CF720045.1"
                     /transcript_id="XM_566754.1"
                     /db_xref="GI:58258682"
                     /db_xref="GeneID:3253390"
     CDS             complement(join(821812..822158,822232..822278,
                     822335..822643,822701..822945,822999..823173,
                     823242..823274,823379..823447,823507..824003))
                     /locus_tag="CNA03130"
                     /codon_start=1
                     /product="anon-23da protein"
                     /protein_id="XP_566754.1"
                     /db_xref="GI:58258683"
                     /db_xref="GeneID:3253390"
                     /translation="MHRRSLRPYLRYPFPVTQHLSFRSVHHFYSYREINEKNEKPIKY
                     SHTPTIHFSPYCNIHSPLPVHSHPHSSTDTNEHTVHRSMDPAFHPPFSLPNLYQTLPF
                     GTCCAIFILWAVHHILCQRYAPITITGPTRREEVGAHGETTEELVHKWCKSLKEGFTA
                     SWWLPNGHAQTIYSGLADFSMDDHVTYQRQLLRLPDGGTIGVDVYPPLTTELADDAPV
                     IVVNHGLTGGSHESYVRNLVVWLTKPIAEGGLGGRAAVVNFRGCASTPLTSPHLYCSG
                     NTIDNHTATTYLASLFPDAPLLGVGFSLGAAVMTRYLGEQGDKSRLRAAVVLYCPLEL
                     KAMSAKLDSAHLFPRLYSLTMARKILKSISPHLLPPSPLSSPSSPLHVNIPEILSLSS
                     SVKYKWTLRASKVTELVVTKVGGSAPCFPFEGMDQFLEWACPSGWIGRIKRPTLAISA
                     LDDPIVSGDCLPYSAVRASSHMILAGVAQGGHLGSFDSPSPFGPDRHRRWHVRPTIEF
                     LRGVIKDLPKSASEQKLGRVQVEEREDGWSWAGEVGWKLVGEEEECGWVGNGICESEM
                     DGAGASV"
     gene            complement(824584..829164)
                     /locus_tag="CNA03140"
                     /db_xref="GeneID:3253389"
     mRNA            complement(join(824584..824865,825009..825118,
                     825169..825328,825383..825531,825588..825691,
                     825760..826444,826501..827607,827680..827908,
                     827963..828084,828143..828248,828415..828471,
                     828571..828630,828982..829164))
                     /locus_tag="CNA03140"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540636|gb|CF686477.1,gi|41542671|gb|CF688512.1,
                     gi|41552057|gb|CF697898.1,gi|41561970|gb|CF707811.1,
                     gi|41561986|gb|CF707827.1,gi|41567733|gb|CF713574.1,
                     gi|41567744|gb|CF713585.1,gi|41576506|gb|CF722347.1,
                     gi|41576518|gb|CF722359.1"
                     /transcript_id="XM_566755.1"
                     /db_xref="GI:58258684"
                     /db_xref="GeneID:3253389"
     CDS             complement(join(824660..824865,825009..825118,
                     825169..825328,825383..825531,825588..825691,
                     825760..826444,826501..827607,827680..827903))
                     /locus_tag="CNA03140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566755.1"
                     /db_xref="GI:58258685"
                     /db_xref="GeneID:3253389"
                     /translation="MKNKVQRAKQSRKIQGRDEDPSQSTSLTKGIDLHQLASPPPKLL
                     PKPPTHDIPIAQDAQETRLHLITQRLPILSHSDSISSTLFNPESSKDMLLAQTRPLHV
                     PKATPSLSVQSLGPQPLQSIIDQAITPEIEHLALNTQSQLIPQSDPSPTEPSGQSLFN
                     LTQQQFQQKIPLRVTPLPTYDQSSFIPISAIPQDVATYNFFSAEANLSDTTKREPQAF
                     FAHTDLVNIGSAPSQSPFLPNHTSLCDSSSLESLFSPHITKSDINSCVKRPETNTGVE
                     TWDGQPSSRGTEIAGLLPVKDVAIADGSLTCDQLPYATAGGTTGFSSLALFNDGLVQP
                     SEGPYGLSQIRDTKDGISKTVPAWNGFPPGSLDQSYVPFTATGILTQGVHSQDLKRKA
                     EDPPPEESEYEIYTPPGNIQAAMDGWWNWILAHYDKDKHTAMQSVVRACNSFFANAHI
                     WLNFFNKSLFFSSLFSQASDSNTLEYKATSLRAAPHVLLSILSLVTLLQKGHTPEGQQ
                     LALLFQREAQSILNYCISAGSQDPSLVAAAIVIATFEMQPHVEHTTDRLVAAVLMLDG
                     IGLSVFSSRLDADDVRVSTSITGLPRLTHSNVLATTAREREVQLEPSITKWAQVPAWA
                     NHWSAGDIWKEEMRRMLWAASSISATLSLWLFMVGKSSYNLEISHPERFRLFFPGEMA
                     VIEAGDGEQGKTTPWALYHRLISLWHFIVNNQPLNGVCKLDVVRELQAVEDDIQIFID
                     AGVLKIYIWQSADWAMFIRRVLGVMDSQALRRWFRNEITFFKALAGDRPGVPGVRQRP
                     LYAWWYVMQVSSALELSRMRKEFWEDSDLIYNMTLAGLDQVIKYWNCQNVLGPYFVYL
                     QHKYRTVLEERQRLLHAEAQGRVQDLYLEQLKILRAEAEGQFAKIQNISEYRNSKLYY
                     "
     misc_feature    831477..831506
                     /note="AT_rich"
     gene            831600..832934
                     /locus_tag="CNA03150"
                     /db_xref="GeneID:3253388"
     mRNA            join(831600..831881,831935..832193,832246..832800,
                     832866..832934)
                     /locus_tag="CNA03150"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41576619|gb|CF722460.1,gi|41576622|gb|CF722463.1"
                     /transcript_id="XM_566756.1"
                     /db_xref="GI:58258686"
                     /db_xref="GeneID:3253388"
     CDS             join(831759..831881,831935..832193,832246..832800,
                     832866..832933)
                     /locus_tag="CNA03150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566756.1"
                     /db_xref="GI:58258687"
                     /db_xref="GeneID:3253388"
                     /translation="MRLPLDIYLDDTRSSATPSLYSPSDSEEERNSAVLTSRSQRLPT
                     SKQRRASNVSRKRRREKSSSEDVFAVEHILARSLSKWRNPESNKYEYRYLVRWENYQP
                     KDDTWEGRSGLMEGSKQLLEEFENRGYQPFTILASKSAASKPTMYLVRYGVVSDSILP
                     SPLYEKVWHSASQINRVGGVPKAVVKNAIDKYEETERLEEGKGLARGGSPRTLQLQKD
                     RCILDILERKEEGDEDPPTVIFHVRWRDKWKLKEEWMNYERIVFTFEEDGKQFLMKWE
                     EKRGYVKPTKVTTVRLVEKPDNMKRPATSSHAKERQQYELERLKNIEANKELMRQLGL
                     "
     gene            833732..836275
                     /locus_tag="CNA03160"
                     /db_xref="GeneID:3253387"
     mRNA            join(833732..833774,833825..833885,833946..833998,
                     834056..834068,834124..834189,834244..834347,
                     834402..834571,834621..835831,835881..836275)
                     /locus_tag="CNA03160"
                     /product="heat shock protein sks2 (heat shock cognate
                     protein hsc1), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529874|gb|CF675715.1,gi|41529882|gb|CF675723.1,
                     gi|41530221|gb|CF676062.1,gi|41530232|gb|CF676073.1,
                     gi|41531243|gb|CF677084.1,gi|41531252|gb|CF677093.1,
                     gi|41532008|gb|CF677849.1,gi|41532011|gb|CF677852.1,
                     gi|41532364|gb|CF678205.1,gi|41532374|gb|CF678215.1,
                     gi|41532625|gb|CF678466.1,gi|41532631|gb|CF678472.1,
                     gi|41532651|gb|CF678492.1,gi|41532661|gb|CF678502.1,
                     gi|41533476|gb|CF679317.1,gi|41533488|gb|CF679329.1,
                     gi|41533570|gb|CF679411.1,gi|41533578|gb|CF679419.1,
                     gi|41533723|gb|CF679564.1,gi|41534277|gb|CF680118.1,
                     gi|41535253|gb|CF681094.1,gi|41535387|gb|CF681228.1,
                     gi|41536070|gb|CF681911.1,gi|41536075|gb|CF681916.1,
                     gi|41536797|gb|CF682638.1,gi|41536804|gb|CF682645.1,
                     gi|41537869|gb|CF683710.1,gi|41537875|gb|CF683716.1,
                     gi|41540708|gb|CF686549.1,gi|41540714|gb|CF686555.1,
                     gi|41543393|gb|CF689234.1,gi|41543399|gb|CF689240.1,
                     gi|41544266|gb|CF690107.1,gi|41544272|gb|CF690113.1,
                     gi|41545071|gb|CF690912.1,gi|41545076|gb|CF690917.1,
                     gi|41546033|gb|CF691874.1,gi|41546042|gb|CF691883.1,
                     gi|415"
                     /transcript_id="XM_566757.1"
                     /db_xref="GI:58258688"
                     /db_xref="GeneID:3253387"
     CDS             join(833846..833885,833946..833998,834056..834068,
                     834124..834189,834244..834347,834402..834571,
                     834621..835831,835881..836068)
                     /locus_tag="CNA03160"
                     /codon_start=1
                     /product="heat shock protein sks2 (heat shock cognate
                     protein hsc1)"
                     /protein_id="XP_566757.1"
                     /db_xref="GI:58258689"
                     /db_xref="GeneID:3253387"
                     /translation="MSAEDVFEGAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPS
                     YVAFTEGERLIGDAAKNQSAMNPLNTIFDAKRLIGRRYDDADVKKDMKHWPFSVIDKD
                     GSPYVEVDYLNEKKTFSPQEISAMVLTKMKEIAEAKIGKTVKKAVVTVPAYFNDSQRL
                     ATKDAGAIAGLEVLRIINEPTAAAIAYGLDEKTEEERNVLIFDLGGGTFDVSLLTIQG
                     KVFSVKATAGDTHLGGEDFDNNLLEHFKAEFKRKTKLDISDDARALRRLRSACERAKR
                     TLSSVTQTTVEVDSLYQGNDFSSNITRARFEEINAVAFKSTVDPVEKVLKDSKIPAAK
                     VDDIVLVGGSTRIPKIQSLVSEYFGGRQLNKSINPDEAVAYGAAVQAAVLTGQTSDKT
                     ADLLLLDVAPLSLGVAMQGDVFGVVLPRNTPIPSNKSRVFTTVEDNQTTVMFPVYEGE
                     RTQCKDNRLLGEFELSGIPPMPRGQAELVCTFEVDANGLLKVSAQDRASGRKAQITIQ
                     NSVGRLSSEEIQAMIKDAEQFKNADKDFSARHEAKSDLEAYLHTCEQSISAPELSMKI
                     KRGARAAVESEIAKALEKLEQEDATADELKKAQLGVKRAMQKAMASAR"
     STS             836265..837044
                     /standard_name="Pst12"
                     /db_xref="UniSTS:470888"
     gene            complement(836319..838137)
                     /locus_tag="CNA03170"
                     /db_xref="GeneID:3253386"
     mRNA            complement(join(836319..836601,836663..837207,
                     837281..837454,837522..837899,837976..838137))
                     /locus_tag="CNA03170"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41552137|gb|CF697978.1,gi|41552145|gb|CF697986.1,
                     gi|41553700|gb|CF699541.1,gi|41553711|gb|CF699552.1,
                     gi|41558365|gb|CF704206.1,gi|41558371|gb|CF704212.1,
                     gi|41560716|gb|CF706557.1,gi|41560721|gb|CF706562.1,
                     gi|41566415|gb|CF712256.1"
                     /transcript_id="XM_566758.1"
                     /db_xref="GI:58258690"
                     /db_xref="GeneID:3253386"
     CDS             complement(join(836427..836601,836663..837207,
                     837281..837454,837522..837827))
                     /locus_tag="CNA03170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566758.1"
                     /db_xref="GI:58258691"
                     /db_xref="GeneID:3253386"
                     /translation="MSDLPLPQFYAHSLVPLAPIFDDTLSLSSPEAQSTLSIALDKLY
                     LIQRMLTSLGAFSENESVSEASNGQLLFMSIGWAIGSCEEKRNPGSMPERREALLKAE
                     YAFQAFVELLSSYGILSSQEASEYSVGNRAGLPNDPAKRREAKINQYKKEKELREKIN
                     AAISRRKQVSASTPVSFLISLLPEPPAEASTVQSTQARDVNEDDMAEESRETIINVLR
                     LLYSLALSSMASMKMELDILSSAPPVDPSQGIPHTDLRQGGRGENDDTWRLDQLPTSL
                     ARSSDLISSKGKVLRPFTILPSDTGVAQREKLKAGVFKQSWRLPTMTIDEYLDIERQR
                     GNVITGGGQASYDKPTDSELLELDSEMDGTLHAEQQAEHKREKDEKWAQYTDDNPKGY
                     GNTTNKG"
     STS             839311..840879
                     /standard_name="ha2998"
                     /db_xref="UniSTS:515619"
     gene            839365..842756
                     /locus_tag="CNA03180"
                     /db_xref="GeneID:3253385"
     mRNA            join(839365..839735,839935..840717,840781..841817,
                     841876..842083,842152..842756)
                     /locus_tag="CNA03180"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545741|gb|CF691582.1,gi|41546548|gb|CF692389.1,
                     gi|41549020|gb|CF694861.1,gi|41563699|gb|CF709540.1,
                     gi|41563704|gb|CF709545.1,gi|41566473|gb|CF712314.1,
                     gi|41566478|gb|CF712319.1,gi|41576015|gb|CF721856.1,
                     gi|41576023|gb|CF721864.1"
                     /transcript_id="XM_566759.1"
                     /db_xref="GI:58258692"
                     /db_xref="GeneID:3253385"
     CDS             join(839562..839735,839935..840717,840781..841817,
                     841876..842083,842152..842439)
                     /locus_tag="CNA03180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566759.1"
                     /db_xref="GI:58258693"
                     /db_xref="GeneID:3253385"
                     /translation="MTGNCSVPAYSDGPLPNVTDGNHEVLRSMSIGKRKLGLENGTEG
                     RMDPDEHGNRGLSEPPSSHTQSTNATMSPHPVLTASSALSMSRGSPYSSTTTTASETR
                     GQHPLAQPPLNANGSNSPSPLPLDFTPIPLAQITNLRKSLSRRRSSYPPATTPGALDS
                     LFSWSASGTPKADLSSLLDSLPGLGEGVDGNKGTGWTPGSNAWEQFIDPSSDIVESTD
                     VLTSMDSQTLRKLQLSASRVVNAPPAAPQSDEAKGNSAPAAPQLSNVLRPPPPTPGKR
                     NIQQSHESEWRSALASVIQIDGVGDVPVLKILQEVWKRGGGDSVTALCLWPSIIVALA
                     IPADSGPDFRVPNPSAQSAMSLQQLYNLTIRHWEPAIFSGLLGHFASGNMPSPAALPA
                     DRAFQSQHYGPSTPMRDTDLSQWINLTPGAWSAQHDPFIGSTGQSNLFKPQAPEDAGF
                     PFPLTSGLKAGEKAEDVGRKSLANGVAEEDQMGQSIAEILARMEEEQDGDGPVSVAED
                     EIQTHSQPSRMSFTELGSQRLNPVDQSFHLPTPETTSSESPNNHNAHNNKIAFSPPTS
                     MSSPFVSAGSTGSVVPTNNESGPGPTKCSAHVKTRPTQVPIPPVDFIPPPPMCMFFNP
                     SFENLQDGKSGVWRGDLEVRGRGGGKFSVLVIGESGMDHLWQSHLWPQSLSYPLKPNN
                     SDECYTSSMIPVSHLAREGLVPITMGMVLCNEPADRIDPYVKMVHGLHAEGVAFHLPC
                     ENPRLPVVFLPTKFHANDPLLRLGVAFMGKAGLPYPSAPLSAPRARRHTYDLGATSRE
                     EPKNKKRRQSASTGIKPKSGSRRNSKEKEGQ"
     gene            <842930..844003
                     /locus_tag="CNA03190"
                     /db_xref="GeneID:3253754"
     mRNA            join(<842930..842947,842993..843130,843181..843358,
                     843413..844003)
                     /locus_tag="CNA03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_567237.1"
                     /db_xref="GI:58259648"
                     /db_xref="GeneID:3253754"
     CDS             join(842930..842947,842993..843130,843181..843358,
                     843413..843963)
                     /locus_tag="CNA03190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567237.1"
                     /db_xref="GI:58259649"
                     /db_xref="GeneID:3253754"
                     /translation="MASPAARLLRAPRVPAAVLAASLAVSSADLAADDGAAPSSSVRP
                     GRSPSGEKLPIYPTPQHNPAITLVETHNPLVPYITQSRESVSSVLGDARNYVQSGVSK
                     WITFERSVEREVKSVLPPDEALNPGLIYVLVAGLSGSVLSRTRSLPVRFLAPPLFTLL
                     AFPYFLPKTSHNIRQYLSNLEDKHLPEFAAKHDHFVQTGIAHWGMLWGRIEDATGDAR
                     EWGHRAVEGVERTTGLRLGEAVSKVEKEKERLVEQERQRAVAVPAQKYETVGYVVEQK
                     PVAEIVAPMEPPKEKKLV"
     repeat_region   842993..843084
                     /rpt_type=tandem
                     /rpt_unit_seq="ccg"
                     /satellite="microsatellite"
     gene            complement(843942..>845039)
                     /locus_tag="CNA03200"
                     /db_xref="GeneID:3253766"
     mRNA            complement(join(843942..844133,844186..844287,
                     844341..844598,844664..844735,844881..>845039))
                     /locus_tag="CNA03200"
                     /product="ubiquitin-dependent protein catabolism-related
                     protein, putative"
                     /transcript_id="XM_567238.1"
                     /db_xref="GI:58259650"
                     /db_xref="GeneID:3253766"
     CDS             complement(join(844020..844133,844186..844287,
                     844341..844598,844664..844735,844881..845039))
                     /locus_tag="CNA03200"
                     /codon_start=1
                     /product="ubiquitin-dependent protein catabolism-related
                     protein"
                     /protein_id="XP_567238.1"
                     /db_xref="GI:58259651"
                     /db_xref="GeneID:3253766"
                     /translation="MLAVLYITLVYQDPCHRNSYSLLQRSPPSSPSPYPTQKLTQESP
                     ESMLSPLSSYQHGATASTSLLDNEGYPRGDLDIYAIRHARSSLVRLQNDRQTVTDLLA
                     TALHDAFAISSPASEQQPNGSVSLPSSQANGYSARTRETPWPARAIAKVNTVTVNSPA
                     SEAGLKAQDVIYSFAGINHTSPGGLQAIGTAVAQSEGIPLPLLIMRGQERLQLTLTPR
                     SGWGGRGSLGCHILPA"
     gene            <845217..846604
                     /locus_tag="CNA03210"
                     /db_xref="GeneID:3253937"
     mRNA            join(<845217..845296,845353..845616,845686..845753,
                     845869..846062,846131..846604)
                     /locus_tag="CNA03210"
                     /product="3'(2'),5'-bisphosphate nucleotidase, putative"
                     /transcript_id="XM_567155.1"
                     /db_xref="GI:58259484"
                     /db_xref="GeneID:3253937"
     CDS             join(845217..845296,845353..845616,845686..845753,
                     845869..846062,846131..846598)
                     /locus_tag="CNA03210"
                     /codon_start=1
                     /product="3'(2'),5'-bisphosphate nucleotidase"
                     /protein_id="XP_567155.1"
                     /db_xref="GI:58259485"
                     /db_xref="GeneID:3253937"
                     /translation="MASQLPFTRLVQETQIGILSVLRACYLTKNVQDTLVTKDTLLKS
                     DKSPVTVADLSAQSLISLHLLAHFQDPIIGEEDTSELRVNEPLRQRVVGLVNGGFEKE
                     EGWGKDKTFSEDEILSAIDAGSAKGGNKGRFWTIVFDGTSGFIRHQQYAVCLALIVDG
                     VVELGVIGCPNLGPEPAKIGEEIIPNGKGVLMVAVRGQGSWSRPLDSATYTKLNLPPT
                     PPASNPLTFLESVESGHSAHSIQARIGALLDVQRPSLRMDSQAKYTCLSRGEGGVYLR
                     IPTKYVGGKIYEERIWDHAPGALLIHESGGICTDMWGKELNFGVGRTLKENDGIVAAG
                     KDIHPKAVEAVKKAIEEAQVENK"
     gene            complement(<846664..848059)
                     /locus_tag="CNA03220"
                     /db_xref="GeneID:3253384"
     mRNA            complement(join(<846664..846867,847094..847647,
                     847702..847827,847885..847909,847976..848059))
                     /locus_tag="CNA03220"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543267|gb|CF689108.1"
                     /transcript_id="XM_566760.1"
                     /db_xref="GI:58258694"
                     /db_xref="GeneID:3253384"
     CDS             complement(join(846664..846867,847094..847647,
                     847702..847827,847885..847909,847976..848026))
                     /locus_tag="CNA03220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566760.1"
                     /db_xref="GI:58258695"
                     /db_xref="GeneID:3253384"
                     /translation="MDSDLRLDEIKCGSASEIMMAVRYSTSPPGPTFIPSLDDVLLEY
                     RPHDGHSSLRRGDLIELVGPSGSGKTTLLTFLLMITLLPAVLPPPLSTVVLGGKGGYA
                     QVFQPYTHRPIMLSLRRSIEAHIRSLAPEAQDDLIEDVIKESTSRLSVWRGRPRWKDL
                     ALGLKGIVVELSPYPARSERRPGALDLVAIDGFADGYYPHLWADEERGRKQHGDGANI
                     VGPDALGVRQVMEVIGQIRKDLGSVVAISVQGLRLPGDITLIDALRSKAREKKENGEV
                     GQNGKYEGLVRLVNMDGGILGKREGAKFHFHIGENGLQVWTDP"
     gene            848246..848341
                     /locus_tag="CNA03230"
                     /db_xref="GeneID:3253960"
     tRNA            848246..848341
                     /locus_tag="CNA03230"
                     /product="tRNA-Ala"
                     /codon_recognized="GCU"
                     /db_xref="GeneID:3253960"
     gene            complement(848640..851383)
                     /locus_tag="CNA03240"
                     /db_xref="GeneID:3253383"
     mRNA            complement(join(848640..849602,849662..850790,
                     850848..851258,851298..851383))
                     /locus_tag="CNA03240"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531470|gb|CF677311.1,gi|41531478|gb|CF677319.1,
                     gi|41539091|gb|CF684932.1,gi|41539097|gb|CF684938.1,
                     gi|41541465|gb|CF687306.1,gi|41541474|gb|CF687315.1,
                     gi|41559536|gb|CF705377.1,gi|41571619|gb|CF717460.1,
                     gi|41571631|gb|CF717472.1,gi|41572772|gb|CF718613.1,
                     gi|41572779|gb|CF718620.1"
                     /transcript_id="XM_566761.1"
                     /db_xref="GI:58258696"
                     /db_xref="GeneID:3253383"
     CDS             complement(join(848844..849602,849662..850790,
                     850848..851258,851298..851368))
                     /locus_tag="CNA03240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566761.1"
                     /db_xref="GI:58258697"
                     /db_xref="GeneID:3253383"
                     /translation="MPPNAPSPTLATPKPPPPAPMPDGRSTPTPDPPDSDAPDSEPAS
                     VALPAEVGLGPRQGEEQLKLALQSKDRIFLLVLAKELEAFLARAAAGALAPAPQPAHG
                     ATSSTMAALGPSAPISAVPTSKFQRMLVYKAAEWYGLKAVAGPEASMVVGVLGPLNEK
                     SATLRLSDLVPAAPSPTQKFRIMQRAPAPGERPDLAASSDAQSTADGRASKWKTLEER
                     EAAYAAAREKIYGKGGDVEESPSISKTEGEPPSRAAAALEDDIDPVPRRRYPAGGQFE
                     VVYPSLYHPPKGSHTPSPAPGMADQYQQNPYGYQQAMGYNYQMDMNGYPLAGQMPSGY
                     TQQQRQPQQGFAMQSYMDSQYNMSQQQAYTVPGWQPQAGGAYPQMTPNQQYSLMQAQQ
                     SGQWQYQQMVSQPMPMIPQGMPYPAGPAFGYPSQPLQPQLQPPQAVRPAMYPSLVQPS
                     PQRPLPQPYSSASSSISSHSYHDGSRPHSRGSTTSTKSAASSVRLGAMYPAAQGPGAG
                     YRQKGMKQQGLNGMTSLGTEDKRTRGHSPSQSSTTTTASSHSSRRTSSINVPPPSQHQ
                     LPQRPDWAANNVPYHPSPIIPNPSISDASAHQAIALGPNTAEFPPLLRSSTAAEPMQV
                     ERAKMRPMNGGGVWNGAAPSASMSNPLLPGQVVPSAEPRVSILPCPRAHSDTQIPQCQ
                     PPQSNNDDPDFPRRAPCKTAPTLYDPSAPRLAVSQPVSQGSRPSSPGVNQDDTAFAGE
                     ADRGQGLLSPEEVIEAKLAAVSLSAGVSIGPPPSKQPQTASYAKIVQRD"
     gene            complement(851529..853153)
                     /locus_tag="CNA03250"
                     /db_xref="GeneID:3253382"
     mRNA            complement(join(851529..851725,851776..852240,
                     852300..852747,852844..853153))
                     /locus_tag="CNA03250"
                     /product="hst3 protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536638|gb|CF682479.1,gi|41536647|gb|CF682488.1,
                     gi|41554766|gb|CF700607.1,gi|41571516|gb|CF717357.1,
                     gi|41571519|gb|CF717360.1"
                     /transcript_id="XM_566762.1"
                     /db_xref="GI:58258698"
                     /db_xref="GeneID:3253382"
     CDS             complement(join(851628..851725,851776..852240,
                     852300..852747,852844..853002))
                     /locus_tag="CNA03250"
                     /codon_start=1
                     /product="hst3 protein"
                     /protein_id="XP_566762.1"
                     /db_xref="GI:58258699"
                     /db_xref="GeneID:3253382"
                     /translation="MPPSLALDHLLCSTDHADFSARRQLSDVSIAVAKARRIVTVSGA
                     GISCSSGIPDFRSEGGLYSLVKEKYPDAFFTGKDLFSAGTFANPQSTSIFYTFIAELF
                     HCCASAQPTRTHHFIRKLEQKGKLLRSYTQNIDGFERRMGLESGGRGKGLKKKETRNV
                     ELHGDLGRVRCVLCFSDFEACDEWVEMFREGEAPDCPACWKRCESRINRSARATSVGR
                     LRPSIVLYDEPHPLGDDIGQLTAYDVSRRPDLLLIMGTSLKVHGLKRLVKDFAKAVHG
                     GKKRGLVVFVNATPPSKEWEGIIDVHIEGETDKWVEKVEEEWRRVKPGDWEVQTTLDS
                     EVVSVVKTGKPKGKTKAATPKGKALAKRDTNRLSPPPRLKASLRSQAIAASSETS"
     gene            853475..853569
                     /locus_tag="CNA03260"
                     /db_xref="GeneID:3253961"
     tRNA            853475..853569
                     /locus_tag="CNA03260"
                     /product="tRNA-Ala"
                     /codon_recognized="GCU"
                     /db_xref="GeneID:3253961"
     gene            855458..855550
                     /locus_tag="CNA03270"
                     /db_xref="GeneID:3253955"
     tRNA            855458..855550
                     /locus_tag="CNA03270"
                     /product="tRNA-Ala"
                     /codon_recognized="GCU"
                     /db_xref="GeneID:3253955"
     gene            855966..>858795
                     /locus_tag="CNA03280"
                     /db_xref="GeneID:3253516"
     mRNA            join(855966..856710,856759..857382,857435..857746,
                     857798..858058,858110..858324,858390..858538,
                     858599..>858795)
                     /locus_tag="CNA03280"
                     /product="transcriptional activator gcn5, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531826|gb|CF677667.1"
                     /transcript_id="XM_566649.1"
                     /db_xref="GI:58258472"
                     /db_xref="GeneID:3253516"
     CDS             join(856030..856710,856759..857382,857435..857746,
                     857798..858058,858110..858324,858390..858538,
                     858599..858795)
                     /locus_tag="CNA03280"
                     /codon_start=1
                     /product="transcriptional activator gcn5"
                     /protein_id="XP_566649.1"
                     /db_xref="GI:58258473"
                     /db_xref="GeneID:3253516"
                     /translation="MAPKQRRATNSKAKATPTSVTSPPDQSSPVRSRGGSSSLSPIRS
                     PQENSDLEDNNERHPGTNGSGLKAEDEGSTDLLDRDGDLEEVHACPDSITFRYPSSVP
                     DFTILSPREKAFKVARFLHCTAPSCACTGLEPPAGRTIRITKHDSSNEDEDDEDEDDD
                     VSMEDSENPLDFEDKKDEWRTKEGWWRICGKCGHGWESGGHVWADDVPPKERTRRGKV
                     VGRIEEILEDENKLVEFPTPQPESISSLLKQLHEFVPPPAGKTTISALPPPVDLSTPD
                     DDTQEDNSDGERPRKRRRQASESTHSDIEGEQHRGQGKKKQGKGPAKGAKPRVPRTVV
                     RGAHGFIPMATDPDGNQHVEGHLPISAGGTGADETFEEEEEEEEELSTAKRPELDETE
                     RRRRTEIKVKEKEREEELVSRLAAGVNPEDAGGAVEIWEGIELQKLPLRPAAIEQANR
                     EIMLPVVSSRNPTPVATILLVGLKNVFQRQLPKMPREYITRLVLDKNHISMAIVKRGY
                     RVVGGICYRPFEARGFAEIVFCAVDSSEQIKGYGSHLMNSLKDHVRKAHPTINVFLTY
                     ADNYAVGYFKKQGFTKEISYPRERWVGYIKDYEGGTIMQGRMLPKVKYMEVHQMLADQ
                     KAAIIAKIKTLTKSHIIHPGLQIFKERQPDEEIKLTKEQVPGLGKLYLYISLCTHQRA
                     DTAIAESGWNPDLDDIVRQPKRNPYHVLLQHVLNDLQNEPSAWPFVKPVDSSVVADYY
                     DVIKDPMDLSTMEYKLENNHYESIEGFVADVKLMCANCRQYNGEKSTYTKQANLLEKA
                     LDRILKKRKSVLAD"
     repeat_region   857188..857214
                     /rpt_type=tandem
                     /rpt_unit_seq="gga"
                     /satellite="microsatellite"
     gene            complement(859289..861362)
                     /locus_tag="CNA03290"
                     /db_xref="GeneID:3253514"
     mRNA            complement(join(859289..860175,860217..860442,
                     860494..861123,861176..861219,861256..861362))
                     /locus_tag="CNA03290"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533232|gb|CF679073.1,gi|41551768|gb|CF697609.1,
                     gi|41570684|gb|CF716525.1"
                     /transcript_id="XM_566651.1"
                     /db_xref="GI:58258476"
                     /db_xref="GeneID:3253514"
     CDS             complement(join(859417..860175,860217..860442,
                     860494..861123,861176..861219,861256..861354))
                     /locus_tag="CNA03290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566651.1"
                     /db_xref="GI:58258477"
                     /db_xref="GeneID:3253514"
                     /translation="MSVSPHKSGTFSPVSEGVEAYVLLTIDHANVKQVFEGEEMDLAK
                     GQLSVQCVSLPIPPEIGHQTANPFAPSPSDPPVPTQDFWLVLHVGATFELVATPGQMF
                     KPYVQGDKITYEMTSKDIPGASLLFSTPYPTSGSDLESLQSLESLLHQYGCLAPETTA
                     LSGISTARNTGQPSQTAPDELRGKLVLVNEDNGEIIGEMDQQLELQEDSKIAQESKLN
                     PVVLDFEQFREGQEALRVKVKTIPEKDLDDWLLRGANSLSHGILSFGEWTSRQMLSGA
                     DLYIKNTTPRTEPVQFGPQTKEGFLKVHSASVKTATVTKSTLNRLHGVSRRYLGSERK
                     TYTHGFQPAKDAYQRYNRSTPPLPPRPSQNSMDKPNIPPSRPIGDSKATDLTSSLPPD
                     APGALSEGKAIDYPSHSQSLIAEKETLNPPSYETSQQKEAQQQSTSMVAAGDQPKKKQ
                     GLLSRVVLASEVVLTSLEATAHDVLNSGTVAASSAAGHKFGKDAGELTALIGGSVKNV
                     AVVYIDVAGTGRKAILKSTAKGIIKTRLQSGETVELQAEGQGNGMKAGEAESKNGDIV
                     VGMAELGTQTSGTLTPSKK"
     gene            complement(862472..864877)
                     /locus_tag="CNA03300"
                     /db_xref="GeneID:3253512"
     mRNA            complement(join(862472..862916,862986..863234,
                     863283..863412,863462..863684,863747..864005,
                     864048..864217,864278..864877))
                     /locus_tag="CNA03300"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530284|gb|CF676125.1,gi|41530293|gb|CF676134.1,
                     gi|41555412|gb|CF701253.1,gi|41557681|gb|CF703522.1,
                     gi|41558834|gb|CF704675.1,gi|41558842|gb|CF704683.1,
                     gi|41560102|gb|CF705943.1,gi|41560106|gb|CF705947.1,
                     gi|41568744|gb|CF714585.1,gi|41568747|gb|CF714588.1,
                     gi|41573929|gb|CF719770.1,gi|41573940|gb|CF719781.1"
                     /transcript_id="XM_566653.1"
                     /db_xref="GI:58258480"
                     /db_xref="GeneID:3253512"
     CDS             complement(join(862592..862916,862986..863234,
                     863283..863412,863462..863684,863747..864005,
                     864048..864217,864278..864502))
                     /locus_tag="CNA03300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566653.1"
                     /db_xref="GI:58258481"
                     /db_xref="GeneID:3253512"
                     /translation="MWTNVLSVFIFATFFARSTRALSSWYTEPGGTPTGSVDGDKVRG
                     VNLGGWFILENWMMPSFFEESIVRDTYLNDEWSFCLVLGQDECLARLQQHWDTYITED
                     DFKRFANYSLNTVRIPMGYWAWTTPEDYEPYIQGQLPYLERALNWSSWYGLDVMMDLH
                     GLPGGANGQDNQGYKGPIEFQLNSTNMDRAMEALANMTQYVTAEKFDGVVKAIELTNE
                     PYILEYSSRGMDFYTLADFYVKGYQVVRANENIIDGANEVMVVIHDAFQPLLNWKYFW
                     GEESLGLNWTNYALDTHIYDAFGGADQKSYQEHLDTICALSASIAEAQQYFPVIVGEF
                     ALGVNTYCVDYQSCWGLTMDEVIANFTSTYEASLFLRQFWEVQSDVYELGAGWIFWSV
                     HHELAGPWSWTQSAAQNWIPMDPSEKIWPFDSDASSYCLDTFNPLEGDQNLPYFPLYA
                     NNYTNIDISSVKPVRLNVNPASNSTVASATSSSTTSSSQSSTASPSSSSSESGSFYTA
                     PLPSSLVLLLMVVAVSHL"
     gene            865159..867534
                     /locus_tag="CNA03310"
                     /db_xref="GeneID:3253259"
     mRNA            join(865159..865608,865657..865941,865988..866380,
                     866430..867166,867225..867534)
                     /locus_tag="CNA03310"
                     /product="protein-nucleus import-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41576437|gb|CF722278.1,gi|41576447|gb|CF722288.1"
                     /transcript_id="XM_566655.1"
                     /db_xref="GI:58258484"
                     /db_xref="GeneID:3253259"
     CDS             join(865170..865608,865657..865941,865988..866380,
                     866430..867166,867225..867500)
                     /locus_tag="CNA03310"
                     /codon_start=1
                     /product="protein-nucleus import-related protein"
                     /protein_id="XP_566655.1"
                     /db_xref="GI:58258485"
                     /db_xref="GeneID:3253259"
                     /translation="MSSRTRGKRAAVASPQASISAIEPTPRTRRVRRGQPDLEEYEEL
                     AHSNVEDDGGEEDAEGEDAEDAEEDDDEEFMTVPEPPKRSRGRPKGSTNKRKAPVEDG
                     DTDLDQGDEDDETRSKRRGRESVSYKEIPIDDKMDGDEDEASTPAAVTTPRRRGRPPK
                     RPVDDDDDDDKNDSSYKKEKIPGGSGRGGFSVKGAAAAAARARWEKVRRERAERGEDD
                     TPKSARRSTGTKKHAVGPPADYKMGATVSIKNEEYTVGDDELIIPDDPKGDTKIDAAG
                     RLLGDREYKLVTFTSVERRNPERIYALTIDAARACGYSDSLAFLRRYPTVLKLSCTAG
                     ERVKLIDLGRISGNLKHRQVTMVAMRNVFKVMGAKVIKNGRHVVDDYYEDEAAAKCAE
                     NGIEPGSIVQDEEYVPSANVNSERALRSAPGESSRSLAHLSTFYTVGGPTTHFAGNGV
                     DPWTDSGWGNKRSRLRTAGVTEEDWMLRTAEEARAVDEQLRKYREERLKLLEGVDAMR
                     GWVFAAENATEGMMGKSEPTGETADVFRAPVPMESKKSGLSHEVTMEDVEDGEQSTSA
                     EEALENEDADVHQAAVEDKEAVIIEEPGKLTSKYNWGLGKSWQPGAVRAAYEPHTNMP
                     HIPLFTQPTIAFLAQASPYPVLSSSTGTQHLHFVQSTITGSAARGLASVEYVLETDED
                     SQTQQRLTMVEEAEKWERRMRAKKHVA"
     gene            complement(<867564..>868691)
                     /locus_tag="CNA03320"
                     /db_xref="GeneID:3254018"
     mRNA            complement(join(<867564..867820,867886..868041,
                     868092..868299,868470..>868691))
                     /locus_tag="CNA03320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566658.1"
                     /db_xref="GI:58258490"
                     /db_xref="GeneID:3254018"
     CDS             complement(join(867564..867820,867886..868041,
                     868092..868299,868470..868691))
                     /locus_tag="CNA03320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566658.1"
                     /db_xref="GI:58258491"
                     /db_xref="GeneID:3254018"
                     /translation="MLLPLVRHVSKSLTKQRCFAAWGRTISTTPEPHAYLRPLLSTTA
                     DAKLPELDKVMTLMLNRPATKNALTVQMVSSSNPSLFCSGADLRERRTMSPMQVSNFL
                     DNLRQLLAELEALPIPTVAVIDGYALGGGAELALGCDLRVGGDNTKIALPETKLGIIP
                     GAGGTQRLTRIVGMAKSKELIFTGRHVQGPEAERIGLLNIYASSPSSPFEAALILARQ
                     ILTSAPLALAAAKRAISSAPELSLEAGLDLERAVYNGLLDTDDRQEGLKAFAEKRRAD
                     FRGR"
     gene            869035..869988
                     /locus_tag="CNA03330"
                     /db_xref="GeneID:3254022"
     mRNA            join(869035..869055,869124..869143,869221..869378,
                     869588..869679,869735..869794,869853..869988)
                     /locus_tag="CNA03330"
                     /product="ubiquitin-carboxy extension protein fusion,
                     putative"
                     /transcript_id="XM_566660.1"
                     /db_xref="GI:58258494"
                     /db_xref="GeneID:3254022"
     CDS             join(869124..869143,869221..869378,869588..869679,
                     869735..869794,869853..869912)
                     /locus_tag="CNA03330"
                     /codon_start=1
                     /product="ubiquitin-carboxy extension protein fusion"
                     /protein_id="XP_566660.1"
                     /db_xref="GI:58258495"
                     /db_xref="GeneID:3254022"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKQICRKCYAR
                     LPPRATNCRKRKCGHSSQIRPKKALKK"
     gene            871014..872531
                     /locus_tag="CNA03340"
                     /db_xref="GeneID:3254009"
     mRNA            join(871014..871174,871237..871258,871310..871347,
                     871399..871509,871565..871754,871813..872531)
                     /locus_tag="CNA03340"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539583|gb|CF685424.1,gi|41539587|gb|CF685428.1,
                     gi|41565058|gb|CF710899.1,gi|41565063|gb|CF710904.1"
                     /transcript_id="XM_566662.1"
                     /db_xref="GI:58258498"
                     /db_xref="GeneID:3254009"
     CDS             join(871125..871174,871237..871258,871310..871347,
                     871399..871509,871565..871754,871813..872475)
                     /locus_tag="CNA03340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566662.1"
                     /db_xref="GI:58258499"
                     /db_xref="GeneID:3254009"
                     /translation="MAQQVEEIEQDLSHIHWSWPEAIAANPARSLATPDLAMDYFAYS
                     PFWDAKSNNNVLRTQRRIENPAYGHAEEKVELNAFMSGFEYVVAHSQPPDLFVIHRRE
                     VESSGKRDRVTGAWFILHEKIYQCPTLFDVMSTRLKNATSLISKTLSTLSENRPPANP
                     RTTTLWRSIPSVTSNQPDGTQPSSLDQAEKPDEGKKDDSLNGSSPLDGSDGKASPAGP
                     DWHLFHALQATRASLVSLETLAKTPTQTTDPREELNNIEIAMDNQFGGQNQSLSGKGP
                     NVKGGAAAVKNISVPFVPKHSAGHATSTTGLTPSIWGGSASLGVSTAAVPAREAGGSP
                     LKWPGGDKSAPIAGATLAGQTGR"
     gene            complement(872535..875750)
                     /locus_tag="CNA03350"
                     /db_xref="GeneID:3254029"
     mRNA            complement(join(872535..872921,872979..873037,
                     873085..873167,873210..873286,873334..873403,
                     873457..873681,873732..873814,873974..874229,
                     874284..874387,874433..874763,874814..874900,
                     874949..875076,875126..875196,875245..875395,
                     875456..875601,875652..875750))
                     /locus_tag="CNA03350"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544057|gb|CF689898.1,gi|41558972|gb|CF704813.1,
                     gi|41558988|gb|CF704829.1,gi|41564117|gb|CF709958.1"
                     /transcript_id="XM_566664.1"
                     /db_xref="GI:58258502"
                     /db_xref="GeneID:3254029"
     CDS             complement(join(872577..872921,872979..873037,
                     873085..873167,873210..873286,873334..873403,
                     873457..873681,873732..873814,873974..874229,
                     874284..874387,874433..874763,874814..874900,
                     874949..875076,875126..875196,875245..875395,
                     875456..875601,875652..875745))
                     /locus_tag="CNA03350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566664.1"
                     /db_xref="GI:58258503"
                     /db_xref="GeneID:3254029"
                     /translation="MPSSSTQLSTGHASAAASTSAMDRLAKEFPDAESLGRHKQIQAK
                     LQLEAMEIREEIARLKAELKRDQDPGKMSVIQSEIGQLMLQINVIREKAAEAEAIVKG
                     ITSDIQRLDVAKSNLTTTIQTLERWAMLRQAHQQLSQLLPTRRYKEISQALAAVMELL
                     GPLKPLSTIPTVSHLFKSAENDRKTVQEKVAVEMDAFFKQDPNKPIDKRTISEVCLAV
                     DVLGGDFRNHIIERYLQLQLAEYRRIFRATDEAGQLDNVPRRYAWFRRVLKHHDEEDA
                     MLFPDTWQVTRLLVANFSECTRSDLANVLAKQTPAVNVLLDALQGTLDFEGGMSRKFG
                     MPFEEVISLSLRGGTSKWVISSVFDKYLSVYVDAQDRAISDMLSAYRGLKSRSSVEGA
                     IQEETDAPAPTILPSSTELFYFYGQQLEQCEKYSKGETMKKLSQVFAKWLRIYAGEIH
                     RAYPFRLEERLKDKIDSKFREEISFQDERQTFSSVMSTCITTILRELETACEPAFAAV
                     LKTPWMHLENVSGRSAYVVDLVGSIKQVAEAVRGRVESKKYIRNFADKAVGVVITKFT
                     QSVIKSRPLKKIGAEQILLDVQAVKACLLDLPEPHPENSTTIYTKYVTKNTGQLETML
                     KVILAPDDPPEGFVQNYCLLIGDRSFTNFQKILDLKGTPRTDQQRLLDIFLSVTSTNS
                     ELSDTSFLTHIDMDPPTSVDISRTVISPVGSSASLFSPTSGVAGLPGLLRSGSTDGAE
                     RSETPKAFGEFRRLVNFATRRDNINTTPH"
     gene            <875907..>876702
                     /locus_tag="CNA03360"
                     /db_xref="GeneID:3254013"
     mRNA            join(<875907..875970,876027..876225,876278..876392,
                     876457..876559,876611..>876702)
                     /locus_tag="CNA03360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566666.1"
                     /db_xref="GI:58258506"
                     /db_xref="GeneID:3254013"
     CDS             join(875907..875970,876027..876225,876278..876392,
                     876457..876559,876611..876702)
                     /locus_tag="CNA03360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566666.1"
                     /db_xref="GI:58258507"
                     /db_xref="GeneID:3254013"
                     /translation="MGAFDPAITYDRSTYIETDTGNKVSRKALIAGATNIVLGGKSII
                     QTSSILRGDLRRSAAGQHVVISVGRYCLIGEGAVIRPPGKMYKGTFTFYPLRIADFTH
                     IGPNCIVEAAQIGSCVEIGEGSIIGKFVVIKDLAVILPNTVLPEGTVVASMSVWGGNP
                     GRMIDTLPETYQETMEAKCKSYYQRFRPAH"
     gene            complement(876825..879362)
                     /locus_tag="CNA03370"
                     /db_xref="GeneID:3254012"
     mRNA            complement(join(876825..877578,877644..878053,
                     878126..878726,878798..878911,878983..879102,
                     879166..879362))
                     /locus_tag="CNA03370"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41560626|gb|CF706467.1,gi|41560634|gb|CF706475.1,
                     gi|41565319|gb|CF711160.1"
                     /transcript_id="XM_567156.1"
                     /db_xref="GI:58259486"
                     /db_xref="GeneID:3254012"
     CDS             complement(join(876964..877578,877644..878053,
                     878126..878726,878798..878911,878983..879102,
                     879166..879357))
                     /locus_tag="CNA03370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567156.1"
                     /db_xref="GI:58259487"
                     /db_xref="GeneID:3254012"
                     /translation="MALSRPLPPHRKRIPSITPRIAPNLTTEDNAWDSLRDKSDDQLR
                     AITRNDLVQALRGEWDLKDKMVGKIEMLENNRDKLERDIGELSRAMATLQSRFDESLN
                     EQGRMEADLVERNALLDRLRKRVSETERQIREAQKRYADQETAFEAERRAFQAQEAHL
                     RARINSLLSTPHKTAVAPAIAAQRREDGTISSLKDEIASLKLSCTTLRAKNSTLTQDI
                     QELKNLNNALQEDNEAWELFLRERTLNGDIREKDGLLNADQLQDRYERHEPEPLNEGL
                     LLESPLSRRGKIASDNGYSPLNGRNLASELGIFQEEREPGYLKKDINTEGMSAEVFCA
                     TIILKLITSIETLFTLHVQTLIKVAINKIIDRIIAQEGFEHILSVDYKTGPAGSRNVS
                     AIQTPLKHNAAPFAQAFNAEMTSQASASSQDSASSKDKRGRPLSMIMARTFSGAAEKT
                     PVVEEVLLPSPLTTSVEPSRATVAKQEKRARRGFSLDFRSFGFGGVTSPGSPRPALRP
                     LTLASRAISSTSPPLQQEKGATTGRKLEPTEEDEEDKRERHRMEATLKLMGISKSADT
                     SNVQDTMTKTPDNGKSPWSRLYSTICSTEHIYVVGNSNPAAAQAALKEYDRREAVRME
                     SLAQGKSEAVYTTPPGVGIPRRRSSSREKMMMSVGSVNTLWSMGSSSRPTSMDITRNG
                     K"
     gene            complement(879501..>881795)
                     /locus_tag="CNA03380"
                     /db_xref="GeneID:3254014"
     mRNA            complement(join(879501..880170,880209..880233,
                     880285..880383,880436..880588,880640..880985,
                     881039..881109,881150..881276,881314..881340,
                     881402..881628,881685..>881795))
                     /locus_tag="CNA03380"
                     /product="endoplasmic reticulum protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530054|gb|CF675895.1,gi|41530068|gb|CF675909.1,
                     gi|41542138|gb|CF687979.1,gi|41542147|gb|CF687988.1,
                     gi|41556465|gb|CF702306.1,gi|41556468|gb|CF702309.1,
                     gi|41567189|gb|CF713030.1,gi|41567202|gb|CF713043.1"
                     /transcript_id="XM_566668.1"
                     /db_xref="GI:58258510"
                     /db_xref="GeneID:3254014"
     CDS             complement(join(879578..880170,880209..880233,
                     880285..880383,880436..880588,880640..880985,
                     881039..881109,881150..881276,881314..881340,
                     881402..881628,881685..881795))
                     /locus_tag="CNA03380"
                     /codon_start=1
                     /product="endoplasmic reticulum protein"
                     /protein_id="XP_566668.1"
                     /db_xref="GI:58258511"
                     /db_xref="GeneID:3254014"
                     /translation="MTSSTFPSPLSTSYTMFWDSLFTELSDVVGAPTDQLKLIFSLLV
                     AFPLGSIFVRLPSAHPNVAHLFSIAISTVFLVPLLGLGGGMLHMLFSSLGTYAIVNGM
                     KDKNMPWVVFAFVMGHLLFNHIKRSVLGLPASTIEITGSQMVLVMKLSTFAWNVHDGK
                     VKEEELDANQLATRLIQIPSLVAFLGYCFFFPSVLVGPSFDYATYDALIHKRLYSSPP
                     AGSSPEQAKATKRRIPYGRKRVAYLHLVIGLFFLGVYALYGDKYSYENVLSPIWTGWG
                     WTRKFGFVQLAGLLARTKYYAVWSLSEGACILTGIGFNGYDPKTGRTLWNRVRNINIK
                     GIETAESFKILFDSWNCRTNVWLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISP
                     GYYLAFFMGGLVTSLGRQFRRYVRPYFLPPSETAQPGPPKRVYDLIGWISVQSTLNYL
                     VAPFLLLNFKDSIGAWNRMYWYGHVAVIISICFMSFGGRKALKRGLDKRKPRITPSVK
                     VSPPSPPVDSTPPPPPEDEMDSTDLRWVKHDLDNPEYQDSGEGVAMGVAIRDHGFLDK
                     WIQGEETPGDTPGGTPKNEKDDPLRK"
     gene            <881843..>883350
                     /locus_tag="CNA03390"
                     /db_xref="GeneID:3254010"
     mRNA            join(<881843..881966,882005..882274,882326..882427,
                     882478..882697,882764..883029,883086..883161,
                     883212..>883350)
                     /locus_tag="CNA03390"
                     /product="O-sialoglycoprotein endopeptidase, putative"
                     /transcript_id="XM_566670.1"
                     /db_xref="GI:58258514"
                     /db_xref="GeneID:3254010"
     CDS             join(881843..881966,882005..882274,882326..882427,
                     882478..882697,882764..883029,883086..883161,
                     883212..883350)
                     /locus_tag="CNA03390"
                     /codon_start=1
                     /product="O-sialoglycoprotein endopeptidase"
                     /protein_id="XP_566670.1"
                     /db_xref="GI:58258515"
                     /db_xref="GeneID:3254010"
                     /translation="MLVLLIVFFNSYYTHCSHHSLYSFHCTPPDPAMKQSPLHRPSRP
                     LLALGIEGSANKLGCGIISHSPSPTGGPTLVMVLSNVRHTYITPPGEGFLPSDTARHH
                     REWVVKVIEEAVRKAGVRMGDLDCIAFTKGPGMGTPLQVGALVARTLSLLHNIPLVGV
                     NHCVGHIEMGRQITSSHNPIVLYVSGGNTQVIAYSQQRYRIFGETLDIAIGNCLDRFA
                     RVIGLRNDPSPGYNIEKEAKKGKRLVQLPYGTKGMDVSLAGILHSVEAYTKDKRYRSW
                     DQVNDVEEDIITPYDLCFSLQETTFAMLVEITERAMAHVGAKDVLIVGGVGCNLRLQE
                     MMGIMASERGGRVFATDESFCIDNGIMIAQAGLLAFRMGNTMPLEKTGVTQRYRTDAV
                     HVAWRA"
     gene            complement(883359..>888873)
                     /locus_tag="CNA03400"
                     /db_xref="GeneID:3253993"
     mRNA            complement(join(883359..883588,883656..883702,
                     883756..883998,884049..884125,884175..885371,
                     885423..885503,885555..886652,886700..886949,
                     886997..888220,888251..>888873))
                     /locus_tag="CNA03400"
                     /product="two-component sensor molecule, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41573667|gb|CF719508.1"
                     /transcript_id="XM_566672.1"
                     /db_xref="GI:58258518"
                     /db_xref="GeneID:3253993"
     CDS             complement(join(883575..883588,883656..883702,
                     883756..883998,884049..884125,884175..885371,
                     885423..885503,885555..886652,886700..886949,
                     886997..888220,888251..888873))
                     /locus_tag="CNA03400"
                     /codon_start=1
                     /product="two-component sensor molecule"
                     /protein_id="XP_566672.1"
                     /db_xref="GI:58258519"
                     /db_xref="GeneID:3253993"
                     /translation="MSRTPISPRPNSNPRVPPSSAAFLQHLHSDPSSHHITLSGHRVS
                     GLSLSPQSLTGEGDLLDINGTSEPSISPSLHSHLSPVSSGTSSGPSPLGSVGRAPSKR
                     ARPKTAPSRNDEWPLGRSYETSPDLPPLIPPQADEHLRSSPVGDLCTNAMTMDEGLVD
                     AMEALSTSGEPKSYLIGRSESLAGTAESHTGPSKPSPASMNWSTFAQAVPNPPTPNET
                     PTEFQSARSSPGQKYSSLPLNHKYSMPTVPHNRSGSSSENYSSKSSKDSVSTNASSAP
                     STSSASASGKQMSMAASLAARKKAYELENIRSKPSGLALNTDKLSLPSYSLAAATVRM
                     ASTSILNDLAPLSMPSPERELTDPLASVVSFDSSSTKKDSARSDPGSSRFPLHHSVSS
                     AANPYTSSLRLPTIQASPVTTPLEGPHRPKGKDRSPPRARHGIVNSRIPSASAPLEKT
                     AEAESSTDYFGAVAVAAVSPQETDSSSTATDPTPTGPSLELRKTTPLRSNSVVPEPSP
                     RQQKDPLPPLVTPSDLNRIYDQYGWLPAPLPPDEAARRRALYRFSILHSAPDINFNRI
                     AHMTKLVFNPKAVLITLIDSDTQWFKSQSGFTVEQGGRISSFCAHTILPRTDEPFVVL
                     DTSSDWRFENNPNVVGPNSIRFYAGAPLRTADGFNVGALCILDDKPRTEFPPRSRLIL
                     KEFAAVTMREMELWRDKLQLRVRDKIQTSMEKFTRECLEMDSASPTSDAETVNKMEHV
                     YSRAAQLVCSTIGLDGCFILDISQIEMVQTNTPTGKKSTYRANPYGAAENTSPVLERS
                     ESFGPVNPFPVLAAVPTAKSTRALTPYEHEKLSDFMQNHHDGRIFEGAAPQWIRYMFP
                     QSFRYGMAVPIYGVDQQPFAMICAYTANPEKQFLEGYELQFLRAIGVIILSAVLRRRM
                     ALADKTKSILISSVSHELRTPLHGILAAAELLSDTQLDSNQLSFLKTVQTCGNSLIET
                     VNHVLDFTKLSGTQSCKGSPSDLGKVNLAALVEQTVEGCWIGQRARFFMGDSDIGSFY
                     APPAPTSIVPKSKRALVGEELSHVETVVDIDMREKGWMVRCEKGGLRRVLMNLVGNSF
                     KFTKNGYIQVSLREMPHEPGSKTIPVEMTVVDTGKGIGKDFLKDQLFHPFSQENPLQT
                     GTGLGLAIVNTIVRSDSVNGKVDVWSAEGVGTEIKVTFDVEVVDDDDGQPSISSSSSV
                     VSATSTFGHGLSVSFVGFNPKHQGHMLSCEVFTRYVNYWYFSIEDQQRADILIVNELE
                     ELVNHPMAAQKPILLLSVQRGFESTALAEKINRGGGFCQVVYKPVGPSALQKALNAAV
                     HWIEERDSSDKSDILGGNVTGINLEGNSYRPSISRGSSGESHESHSTISELSNARFNQ
                     QSSINSRLPLQRRRSEENEQAPRRPSMAPRGMTYHSSRKMQRSSNDSAGSTPSQVPPS
                     PTSSIPTIPLADGGVMLKAATVSAEAPRKEKMGRVMVVEDNVINRRVLGAFLKKRGFE
                     YAEAVDGQAGVELFENAPPNYWDVILMDISMPIMNGHQATRAIRRIEATRRNSLSDIP
                     IVPPPGKPVTISSQKAVQARVKIFALTGLATPDDKREAFWSGVDGYLVKPVSLSSLDI
                     IFKKIGF"
     misc_feature    889905..889933
                     /note="AT_rich"
     gene            890317..892537
                     /locus_tag="CNA03410"
                     /db_xref="GeneID:3253641"
     mRNA            join(890317..890437,890492..890522,890595..890695,
                     890744..890870,890920..891120,891174..891252,
                     891307..891466,891528..891635,891694..891873,
                     891930..892537)
                     /locus_tag="CNA03410"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531358|gb|CF677199.1,gi|41531369|gb|CF677210.1,
                     gi|41531620|gb|CF677461.1,gi|41531631|gb|CF677472.1,
                     gi|41565451|gb|CF711292.1,gi|41565455|gb|CF711296.1,
                     gi|41576515|gb|CF722356.1"
                     /transcript_id="XM_567253.1"
                     /db_xref="GI:58259680"
                     /db_xref="GeneID:3253641"
     CDS             join(890408..890437,890492..890522,890595..890695,
                     890744..890870,890920..891120,891174..891252,
                     891307..891466,891528..891635,891694..891873,
                     891930..892487)
                     /locus_tag="CNA03410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567253.1"
                     /db_xref="GI:58259681"
                     /db_xref="GeneID:3253641"
                     /translation="MEDRLHSLSKGVFVIPFEPAALNEEDREDTHSSTRDTLDRLYET
                     TLQIYEDAGAEYEQEKTNEQLDDIADWLERYKATAFLQLPQRTNRLPVAILQNASSSL
                     PDRITSLDATSYTLLGRDAPDVAAALRSIAIGFTGDTLGSGRKSSQASIDEVENWWQA
                     NGKGLPLMLYIQDAQTIPASVLSEITYILALHAGLPIRLLLSVPSAAVFLSSWGHIEP
                     SSVDVSILRSGRSRRGAGGIDAIIRSSSEAPFKISDDLAEELRSNETLLGGGIAAAMK
                     TLKWLLLHHSLSSPLALLVEKTKNSEQERVMQSLLNAVKSSPVNPSIPRRDLFELNPH
                     PDMFSVLNPAPRTSILHSLSDPQDILPFFAASAPEKPSPNHHKSAKRKAVSASMDNEK
                     RRKTGELEKLKINEEDQVLELKRLQTLFELWKSAGKTVNLWDWLDSFQGEDERGSEEN
                     KEANSAQVGSEQTDKDENIDKESRNEAPKRAAQEENRLHATFIRFVEEARMLGLIRAR
                     GKGRKADEVIKSVGLV"
     gene            892796..894669
                     /locus_tag="CNA03420"
                     /db_xref="GeneID:3254027"
     mRNA            join(892796..892897,892981..893021,893092..893119,
                     893189..893268,893328..893817,893864..894024,
                     894077..894669)
                     /locus_tag="CNA03420"
                     /product="Hob1p, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530186|gb|CF676027.1,gi|41531173|gb|CF677014.1,
                     gi|41531176|gb|CF677017.1,gi|41536375|gb|CF682216.1,
                     gi|41536388|gb|CF682229.1,gi|41536421|gb|CF682262.1,
                     gi|41536422|gb|CF682263.1,gi|41539618|gb|CF685459.1,
                     gi|41546915|gb|CF692756.1,gi|41546922|gb|CF692763.1,
                     gi|41549794|gb|CF695635.1,gi|41549798|gb|CF695639.1,
                     gi|41550331|gb|CF696172.1,gi|41550336|gb|CF696177.1,
                     gi|41550870|gb|CF696711.1,gi|41552630|gb|CF698471.1,
                     gi|41559836|gb|CF705677.1,gi|41560008|gb|CF705849.1,
                     gi|41560015|gb|CF705856.1,gi|41565935|gb|CF711776.1,
                     gi|41565940|gb|CF711781.1,gi|41566207|gb|CF712048.1,
                     gi|41566216|gb|CF712057.1,gi|41567750|gb|CF713591.1,
                     gi|41567758|gb|CF713599.1,gi|41568449|gb|CF714290.1,
                     gi|41568455|gb|CF714296.1,gi|41568751|gb|CF714592.1,
                     gi|41568762|gb|CF714603.1"
                     /transcript_id="XM_566674.1"
                     /db_xref="GI:58258522"
                     /db_xref="GeneID:3254027"
     CDS             join(892869..892897,892981..893021,893092..893119,
                     893189..893268,893328..893817,893864..894024,
                     894077..894549)
                     /locus_tag="CNA03420"
                     /codon_start=1
                     /product="Hob1p"
                     /protein_id="XP_566674.1"
                     /db_xref="GI:58258523"
                     /db_xref="GeneID:3254027"
                     /translation="MKGFTKALQRTPHNLTTRIGLAKKSTDPEFNDYERKFAAVEAAC
                     QKMHKDSVVFRDSVSNLLASGSSFSGSLATLFSPMGAEYNLAAKHPQAETTVQNITIY
                     QTLMEEVRETLLPELELIESRIVGPCKELVEICKKIRKTISKREHKLIDYDRHNNSLN
                     KLREKKEKSLSDEKNLFKVEQDFELASGEYEHYNNLLKSELPHFLGMATRFIDPLFHS
                     FYYMQLNVYYIMMEKLQSFADGKYDLTRKDIEDIYLEQRGDAAERIEELQITKRIIST
                     AKLLQQRRSASGSSTPGRANSFASRTTSHTLGRKTSTDSYGSYSAAEKKTFSPPPPQS
                     HAVSAPPPYTAPAAGVATTGTVGKKAPPPPPPMKPKASYNNVKYATAIFDYEAQAEGD
                     LSFRAGDRIEIVEQTESAEDWWTGRLNGVTGVFPGNYTQVE"
     gene            895256..897073
                     /locus_tag="CNA03430"
                     /db_xref="GeneID:3254005"
     mRNA            join(895256..895723,895780..895827,895878..895988,
                     896036..896235,896283..896519,896572..896814,
                     896865..897073)
                     /locus_tag="CNA03430"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535442|gb|CF681283.1,gi|41535456|gb|CF681297.1,
                     gi|41547216|gb|CF693057.1,gi|41547217|gb|CF693058.1,
                     gi|41561659|gb|CF707500.1,gi|41561661|gb|CF707502.1,
                     gi|41564973|gb|CF710814.1,gi|41564978|gb|CF710819.1"
                     /transcript_id="XM_566676.1"
                     /db_xref="GI:58258526"
                     /db_xref="GeneID:3254005"
     CDS             join(895393..895723,895780..895827,895878..895988,
                     896036..896235,896283..896519,896572..896814,
                     896865..897011)
                     /locus_tag="CNA03430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566676.1"
                     /db_xref="GI:58258527"
                     /db_xref="GeneID:3254005"
                     /translation="MSSTSPTASFRPNQRSSQSYHPQISTSTASSTASQAFSDRAPVS
                     IARRPSRATHPPMAPPRPLTHDEALEALRAFLKERSSYDVFPVSFRLIVLDTQLKVKK
                     ALDVMLLYGVVSAPLWNTSSAQFAGMFTVQDVIHLIQYYYHTSSWEGATADVEQFRLQ
                     SIRDIEKVLHVPPPPLLYVHPLRPLYDACRYLIRTHARRLPLIDKDPQTNGEVVISVL
                     TQYRVLKFIAMNCRDITQYLTASVQELGIGTYVSPNPDPSNTNKFWPIAAATMKTTVF
                     DVVHMFSEQGISAVPIVDDQGKVLNLYETVDVITLVRNGAYTSLDLTIAQALKQRAVD
                     FAGVVTCSPKDSLSAIFSLIKIRRVHRLVVVAGQDDEQPGRLVGVISLSDIMRALIGN
                     DIPLGGAGVGAMGVDRALREEGEEGVFARSEGSKSAGTSTEGQSTE"
     gene            complement(<897476..>898258)
                     /locus_tag="CNA03440"
                     /pseudo
                     /db_xref="GeneID:3253931"
     gene            898799..900212
                     /locus_tag="CNA03450"
                     /db_xref="GeneID:3253580"
     mRNA            join(898799..899799,899847..900212)
                     /locus_tag="CNA03450"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41548832|gb|CF694673.1,gi|41548836|gb|CF694677.1"
                     /transcript_id="XM_566678.1"
                     /db_xref="GI:58258530"
                     /db_xref="GeneID:3253580"
     CDS             join(899033..899799,899847..900135)
                     /locus_tag="CNA03450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566678.1"
                     /db_xref="GI:58258531"
                     /db_xref="GeneID:3253580"
                     /translation="MRFTWLLVVAVGIVLSLADSAYCHAHGSGHFPKASRQRHHLQPR
                     PLLSPEQRHDHATLLLPRSNSTAISSNATNAVEASAEPSLPTRPSTVLTAPPSPVPTP
                     LDLSISTSLSSSCMLYLASLVSSETFLYCLPFSLLLTTSTAYSSIVAKALASGNYTTL
                     NDLVAYTSSPQPSIDQCVTFMSGVMTALTSKSNCASDISKNVPVAIKTKWGVGNYQVM
                     REAESLVNEDTGVFCYIEAVASERPDDLYLWGLPGGISLPSSSRPSCTDCSASLLNTY
                     ESYLSNTTTLNSTVINAAVKRINEACGSSFVNFGKDTQASGDSSCVAVKFIAGLKGAV
                     AFASIVAWMLIVYIDLN"
     gene            900479..902408
                     /locus_tag="CNA03460"
                     /db_xref="GeneID:3253569"
     mRNA            join(900479..900844,900892..901479,901532..901634,
                     901690..902041,902089..902202,902247..902408)
                     /locus_tag="CNA03460"
                     /product="tRNA isopentenyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531710|gb|CF677551.1,gi|41531719|gb|CF677560.1,
                     gi|41546146|gb|CF691987.1,gi|41546153|gb|CF691994.1"
                     /transcript_id="XM_566680.1"
                     /db_xref="GI:58258534"
                     /db_xref="GeneID:3253569"
     CDS             join(900482..900844,900892..901479,901532..901634,
                     901690..902041,902089..902202,902247..902382)
                     /locus_tag="CNA03460"
                     /codon_start=1
                     /product="tRNA isopentenyltransferase"
                     /protein_id="XP_566680.1"
                     /db_xref="GI:58258535"
                     /db_xref="GeneID:3253569"
                     /translation="MLNFIRSLQLFIRSQMTSQRPIVAVIGTTGVGKSQLAVSLAQSF
                     SLSRAPRLGMNNNENKTHPAVVLSADSMQLYTGLDVITNKVTVEEMGGIEHWGLNMVT
                     PGEDTSWEVGKWCNEANAKITTLPVDVLPIICGGTHYFIQHFLFPPPELSFVRDGEIK
                     SQAKDPMSVRWTPPGPRPPIPENLSPELLALLDTFWLTEPTWPSTSGSSVTERNPGPS
                     KSSRPTTREDEHLLALHRLLETIDPKESQRWHWRDGRKVRRSLERWWERGGTVDSVPS
                     SNGLEEPKGREARFRTLIFWVYEPMETLRPRLDRRVDKMLENGLLDEISELREIAQRI
                     YGSTDATDHTEGIFQAIGYKEFASLPLPSPNPQSHPLFPTMVDRTKVSTQQYAKSQLK
                     WIKKQFLPAVREARSLGGEVEVYVVPGGETGVPLATEILHKFLKREKVPSNLEVGHVN
                     AKELLHSLEENGIVPNTADRQSINARKICEVCSTPNNPCSVLLREWDQHTKTRAHKHN
                     ANPIKMDKAEWIARQKAMGEERKTERQRLKQESMAVGLDQKAD"
     gene            complement(902240..904105)
                     /locus_tag="CNA03470"
                     /db_xref="GeneID:3253551"
     mRNA            complement(join(902240..902591,902656..902775,
                     902835..903019,903080..903161,903222..903279,
                     903325..903681,903741..903839,903887..904105))
                     /locus_tag="CNA03470"
                     /product="ribonuclease H, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535144|gb|CF680985.1,gi|41538055|gb|CF683896.1,
                     gi|41538063|gb|CF683904.1,gi|41542439|gb|CF688280.1,
                     gi|41542451|gb|CF688292.1,gi|41564107|gb|CF709948.1,
                     gi|41566935|gb|CF712776.1,gi|41566940|gb|CF712781.1"
                     /transcript_id="XM_566682.1"
                     /db_xref="GI:58258538"
                     /db_xref="GeneID:3253551"
     CDS             complement(join(902529..902591,902656..902775,
                     902835..903019,903080..903161,903222..903279,
                     903325..903681,903741..903839,903887..903888))
                     /locus_tag="CNA03470"
                     /codon_start=1
                     /product="ribonuclease H"
                     /protein_id="XP_566682.1"
                     /db_xref="GI:58258539"
                     /db_xref="GeneID:3253551"
                     /translation="MAPKPGFYAVATGRHPGVYKTWPAAEEQVKGFPSAKYKKFATEQ
                     EAKDFVTAAGDALPSQPPPIGKRKRAEMEDSKAPPVDTHFQATSPATVASPASLPPKL
                     QKIAQQGFSFTKSVPHYLVVYTDGSAKGNGQVGSRAGAGVWWGSRGEASKQNWAERVP
                     GEPQTNNRGELLAVIRAIERCPFPDIPLEIRCDSQYTISCMTIWLPKWMNNNFRNSYK
                     QEVINTDLIKHLLVLLRRRGAAGRVKFKYVPAHSGVEGNEAADRLARTGGALPFVSDE
                     SNWLDPEDEVVPCDSETNPTEVELEIDEDWLMTAEELAALEQQLV"
     gene            complement(904431..906322)
                     /locus_tag="CNA03480"
                     /db_xref="GeneID:3253909"
     mRNA            complement(join(904431..904743,904793..905203,
                     905267..905677,905743..905875,905955..906061,
                     906117..906219,906267..906322))
                     /locus_tag="CNA03480"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530121|gb|CF675962.1,gi|41530131|gb|CF675972.1,
                     gi|41530805|gb|CF676646.1,gi|41530810|gb|CF676651.1,
                     gi|41533129|gb|CF678970.1,gi|41533137|gb|CF678978.1,
                     gi|41542698|gb|CF688539.1,gi|41542704|gb|CF688545.1,
                     gi|41544948|gb|CF690789.1,gi|41544958|gb|CF690799.1,
                     gi|41545225|gb|CF691066.1,gi|41545236|gb|CF691077.1,
                     gi|41546470|gb|CF692311.1,gi|41548644|gb|CF694485.1,
                     gi|41548655|gb|CF694496.1,gi|41548682|gb|CF694523.1,
                     gi|41548691|gb|CF694532.1,gi|41550506|gb|CF696347.1,
                     gi|41550515|gb|CF696356.1,gi|41551156|gb|CF696997.1,
                     gi|41551376|gb|CF697217.1,gi|41551383|gb|CF697224.1,
                     gi|41552531|gb|CF698372.1,gi|41552538|gb|CF698379.1,
                     gi|41555283|gb|CF701124.1,gi|41555294|gb|CF701135.1,
                     gi|41555407|gb|CF701248.1,gi|41555413|gb|CF701254.1,
                     gi|41556537|gb|CF702378.1,gi|41556543|gb|CF702384.1,
                     gi|41557207|gb|CF703048.1,gi|41561112|gb|CF706953.1,
                     gi|41561121|gb|CF706962.1,gi|41563468|gb|CF709309.1,
                     gi|41563480|gb|CF709321.1,gi|41565779|gb|CF711620.1,
                     gi|41565792|gb|CF711633.1,gi|41570952|gb|CF716793.1,
                     gi|415"
                     /transcript_id="XM_567157.1"
                     /db_xref="GI:58259488"
                     /db_xref="GeneID:3253909"
     CDS             complement(join(904648..904743,904793..905203,
                     905267..905677,905743..905875,905955..906061,
                     906117..906219,906267..906280))
                     /locus_tag="CNA03480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567157.1"
                     /db_xref="GI:58259489"
                     /db_xref="GeneID:3253909"
                     /translation="MSWFGSNKSSSNSPAGVTNFWPATSYNSGFGELTESDTAWLNAS
                     NQGFQTETNVWYSVLEDGSLLMVQVIWSYLGIFLIPATTQMTFKHYNPTTKKAVWKSV
                     HASNAKFDKQSCKSDLFEIRHSGSPTEGETYNITASLEKDVQITVEYTRPADTPGFKL
                     GSGPDGGISAFGKDRAKREGYVVHRFHPFIHSSGTLVINGQAVDAKGEGIFIHAIQGM
                     RPNLVASRWNFCFFSTAPGQDEEKLGSVRAFQMEFETTDDFGPKGAKSGRTKVNIGAI
                     YCSKTAPVPFLITGQTHAPPSDSTYPAPSQDISSATHLNPVHDSETGYSVPSGLEFKW
                     QGDRRDGQGKAGATLVIEKAGKVPGEGGLIEKVDVLAEIPYVIKKGLTAVTGTNAYIY
                     QYHNPATLEVNLDEEVIPVKGFVFNEATFISP"
     gene            complement(906524..>907593)
                     /locus_tag="CNA03490"
                     /db_xref="GeneID:3253621"
     mRNA            complement(join(906524..907052,907110..907521,
                     907569..>907593))
                     /locus_tag="CNA03490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566684.1"
                     /db_xref="GI:58258542"
                     /db_xref="GeneID:3253621"
     CDS             complement(join(906527..907052,907110..907521,
                     907569..907593))
                     /locus_tag="CNA03490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566684.1"
                     /db_xref="GI:58258543"
                     /db_xref="GeneID:3253621"
                     /translation="MYDGPTRGGTRGGQGDFRWSAVANDKHRGMPSSNTPVAITHLSV
                     ENYLGHSINAPVGRWSKNKDIHWYNRDISEDDTAKAARERAEEVRRIKQQEDDALAAA
                     LGYAVPKRDTDGEGTGANDIPVKKSEKDDEIARLEKEERKREKALRREQRALKRAEKE
                     IKREEKERHRHRRSESRRHHHDDEDSPRHYEREQERIRARRHHDRYDEGDKDDWRSQD
                     RENRERDYTSDRHARDHRLRQREDERRQGELPYSNDRGKERDRYRDRREERPRYHLED
                     DMPRRKYERSRTRSKSPRRDHRSSERHVGEVLDANPMREGLERR"
     gene            <907725..910387
                     /locus_tag="CNA03500"
                     /db_xref="GeneID:3253261"
     mRNA            join(<907725..907926,907989..908225,908281..908403,
                     908455..908577,908633..908755,908803..908931,
                     908980..909354,909401..909523,909573..909691,
                     909747..910387)
                     /locus_tag="CNA03500"
                     /product="beta-catenin, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530447|gb|CF676288.1,gi|41530458|gb|CF676299.1,
                     gi|41531558|gb|CF677399.1,gi|41531567|gb|CF677408.1,
                     gi|41532595|gb|CF678436.1,gi|41532606|gb|CF678447.1,
                     gi|41534396|gb|CF680237.1,gi|41534404|gb|CF680245.1,
                     gi|41535964|gb|CF681805.1,gi|41535973|gb|CF681814.1,
                     gi|41540681|gb|CF686522.1,gi|41540694|gb|CF686535.1,
                     gi|41541252|gb|CF687093.1,gi|41541949|gb|CF687790.1,
                     gi|41541957|gb|CF687798.1,gi|41545938|gb|CF691779.1,
                     gi|41545949|gb|CF691790.1,gi|41546085|gb|CF691926.1,
                     gi|41546097|gb|CF691938.1,gi|41546114|gb|CF691955.1,
                     gi|41546128|gb|CF691969.1,gi|41552772|gb|CF698613.1,
                     gi|41552779|gb|CF698620.1,gi|41553553|gb|CF699394.1,
                     gi|41553561|gb|CF699402.1,gi|41556690|gb|CF702531.1,
                     gi|41556695|gb|CF702536.1,gi|41557240|gb|CF703081.1,
                     gi|41557248|gb|CF703089.1,gi|41558329|gb|CF704170.1,
                     gi|41558335|gb|CF704176.1,gi|41558565|gb|CF704406.1,
                     gi|41558569|gb|CF704410.1,gi|41562433|gb|CF708274.1,
                     gi|41562437|gb|CF708278.1,gi|41564435|gb|CF710276.1,
                     gi|41564449|gb|CF710290.1,gi|41566513|gb|CF712354.1,
                     gi|415"
                     /transcript_id="XM_566686.1"
                     /db_xref="GI:58258546"
                     /db_xref="GeneID:3253261"
     CDS             join(907725..907926,907989..908225,908281..908403,
                     908455..908577,908633..908755,908803..908931,
                     908980..909354,909401..909523,909573..909691,
                     909747..910175)
                     /locus_tag="CNA03500"
                     /codon_start=1
                     /product="beta-catenin"
                     /protein_id="XP_566686.1"
                     /db_xref="GI:58258547"
                     /db_xref="GeneID:3253261"
                     /translation="MSCTAQDTHTDQDTASLPPLPTSTPTPQTTMGSALSSCCSPRRK
                     NAYEPLLLETEREAVADLLQYLENRSTTNFFAGSPLAALTTLSFSENVDLQRSAALAF
                     AEITEKEVREVGRDTLDPVLYLLSSHDPEVQRAASAALGNLAVNAENKLLVVSLGGLE
                     PLIRQMLSPNVEVQCNAVGCITNLATHDENKTQIAKSGALVPLTRLAKSKDMRVQRNA
                     TGALLNMTHSDENRQQLVAAGAIPVLVSLLNSPDTDVQYYCTTALSNIAVDAANRKKL
                     AQSEPKLVQSLVQLMDSQSLKVQCQAALALRNLASDSKYQLEIVKFGGLKPLLRLLHS
                     SYLPLILSAAACVRNVSIHPANESPIIESGFLQPLIELLSFDENEEVQCHAISTLRNL
                     AASSEKNKGAIVEAGAVEKIKSLVLTVPLAVQSEMTACVAVLALSDDLKPQLLEMGIC
                     EVLIPLTNSPSVEVQGNSAAALGNLSSKAAEDYAPFNAVWNKPDGGLHAYLVRFLSSA
                     DITFQHIAVWTIVQLLEAEDEQLTNNIRSSPILISSIRQLAKSPPPSRAGGAPRHDPN
                     DPSAGSSEDEFEDGLTDQEGEGEIVSLARRILDLTEVGEEGDEFGERAGRNVPVGSHG
                     QAPGQGQTSQVGSMGSEHAALRASVHRALSGGGRDR"
     gene            <910787..911855
                     /locus_tag="CNA03510"
                     /db_xref="GeneID:3253230"
     mRNA            join(<910787..910811,910875..910946,911001..911116,
                     911176..911267,911317..911442,911497..911855)
                     /locus_tag="CNA03510"
                     /product="prostatic steroid 5-alpha-reductase type I,
                     putative"
                     /transcript_id="XM_566688.1"
                     /db_xref="GI:58258550"
                     /db_xref="GeneID:3253230"
     CDS             join(910787..910811,910875..910946,911001..911116,
                     911176..911267,911317..911442,911497..911785)
                     /locus_tag="CNA03510"
                     /codon_start=1
                     /product="prostatic steroid 5-alpha-reductase type I"
                     /protein_id="XP_566688.1"
                     /db_xref="GI:58258551"
                     /db_xref="GeneID:3253230"
                     /translation="MGHHGARFSYNLFDDNRKQLSSFFESSLENTLWAVSRALCPSGY
                     YITPDTFTKKVAPPYHCCSCGHVVQSFEWISFSRWLGFLPPKRDRLAIRSRCCWMGNR
                     PPTKRIVMSHLPEDDASKLERYKVPRGGLFEWVSFPNYLCEWLEWTCWSFAANPYPFI
                     SVPALPYLLRAPEYRNSHTVLSIISNFYWPSWLLAPSWAFVLAEVTSMLPRAMRGHAW
                     YKEKFGNKYPKSRKAAIPGIL"
     gene            complement(911817..913282)
                     /locus_tag="CNA03520"
                     /db_xref="GeneID:3253525"
     mRNA            complement(join(911817..912381,912440..913029,
                     913084..913282))
                     /locus_tag="CNA03520"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542017|gb|CF687858.1,gi|41554049|gb|CF699890.1,
                     gi|41554057|gb|CF699898.1"
                     /transcript_id="XM_566690.1"
                     /db_xref="GI:58258554"
                     /db_xref="GeneID:3253525"
     CDS             complement(join(911855..912381,912440..913029,
                     913084..913187))
                     /locus_tag="CNA03520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566690.1"
                     /db_xref="GI:58258555"
                     /db_xref="GeneID:3253525"
                     /translation="MDQLSAEQAQALWEAGGFLIITDLPEGSEFGIDGTFHTVRKFSG
                     IKFLPPGFHFIAWSPPPSSTTAGPSVIPIRQAFVRNFSAKERYAVHYDKDTENISLPE
                     NGTVISDDNLKTLDKELAPYPFERFEAWKSLTSHITPTILQSVIGPDGKVDGLMPVID
                     QEEDTLTRDMREKLEEIKRRSQNFGFTKSLMFVRFSLKKSWRDGAVGEEVTVYSKDKS
                     WLLGNVIDEQLDRNPTALLGHLQLSFIFFLQISSYSSLLAYQRILALLCQSSSFLISP
                     STFLSPPKRNPNAHVGEGMKIIYKELLKTLRVEIEALPDGVFDTELPEMDVFYLDQLE
                     SLRKNLASAIWGEVEEGTTWTELERQSFKSLWNALRDSAWKKWKWDIDELSHRVDEED
                     EDEEGEYAPVVIEI"
     gene            complement(915591..>916677)
                     /locus_tag="CNA03530"
                     /db_xref="GeneID:3253728"
     mRNA            complement(join(915591..915820,915933..916176,
                     916234..916339,916398..916443,916497..>916677))
                     /locus_tag="CNA03530"
                     /product="succinate dehydrogenase (ubiquinone), putative"
                     /transcript_id="XM_566692.1"
                     /db_xref="GI:58258558"
                     /db_xref="GeneID:3253728"
     CDS             complement(join(915732..915820,915933..916176,
                     916234..916339,916398..916443,916497..916677))
                     /locus_tag="CNA03530"
                     /codon_start=1
                     /product="succinate dehydrogenase (ubiquinone)"
                     /protein_id="XP_566692.1"
                     /db_xref="GI:58258559"
                     /db_xref="GeneID:3253728"
                     /translation="MSLIIGAGYWTNGIRWIIFDSLHLRLPLNVNSSVLLSIFAYSPP
                     MSTSILRNSLARAVHKPSILRTTPGLMLAQRRLASTESVTAAESIALLNSQRQHRPTS
                     PHLAIYQPQLTWYLSSLHRITGVAFGGALYLSAMAYLLHPLVPVIDSAHLIQLVHDLP
                     GWFKGSAKFIIALPFTFHCYNGLRHLNWDIGKALTIKGVYRTGYAVLGATVLSSLYLA
                     FFI"
     gene            complement(916772..918221)
                     /locus_tag="CNA03540"
                     /db_xref="GeneID:3253642"
     mRNA            complement(join(916772..916997,917058..918018,
                     918089..918221))
                     /locus_tag="CNA03540"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41529870|gb|CF675711.1,gi|41529877|gb|CF675718.1,
                     gi|41534014|gb|CF679855.1,gi|41534015|gb|CF679856.1,
                     gi|41557964|gb|CF703805.1,gi|41557972|gb|CF703813.1,
                     gi|41565793|gb|CF711634.1,gi|41565797|gb|CF711638.1,
                     gi|41573789|gb|CF719630.1,gi|41573798|gb|CF719639.1"
                     /transcript_id="XM_567254.1"
                     /db_xref="GI:58259682"
                     /db_xref="GeneID:3253642"
     CDS             complement(join(916790..916997,917058..917926))
                     /locus_tag="CNA03540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567254.1"
                     /db_xref="GI:58259683"
                     /db_xref="GeneID:3253642"
                     /translation="MTSSSRPATSIARLPPEIQLQIIHMLKQISSIPELINLLCTCRF
                     ILAECESGLYERVELSSSAAASFFKGFDLEENKERCFFVRSIEDQDQSNHTTVSQPRK
                     TMLQKLELFGNVKAMRFDDAESIIATSEAVMELKRYQKSISTSEIATQDPCGPYNILF
                     PQLRRISFGPSSLPKVCRDGLSWGAILDTLGSAWPDNPSLCFHLSPNSLDTYGRIAGY
                     LETRVKSLVLHQGYPSDLILLDKPSGIHAEQVTMYLKPHQIKGTYTCWEDHHWSIVNF
                     CKKYFGERRARHFVDPNSVHSPIFTFVNISGNLDDIREDIGRQLREMELEDGLVEAVQ
                     NKMRLVGVGDVREGGCEVCGTWDT"
     repeat_region   918493..918523
                     /rpt_type=tandem
                     /rpt_unit_seq="cgg"
                     /satellite="microsatellite"
     gene            complement(918722..920484)
                     /locus_tag="CNA03550"
                     /db_xref="GeneID:3253716"
     mRNA            complement(join(918722..919744,919798..919889,
                     919941..920110,920162..920484))
                     /locus_tag="CNA03550"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534679|gb|CF680520.1,gi|41553909|gb|CF699750.1,
                     gi|41563298|gb|CF709139.1,gi|41563312|gb|CF709153.1"
                     /transcript_id="XM_566694.1"
                     /db_xref="GI:58258562"
                     /db_xref="GeneID:3253716"
     CDS             complement(join(918739..919744,919798..919889,
                     919941..920110,920162..920483))
                     /locus_tag="CNA03550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566694.1"
                     /db_xref="GI:58258563"
                     /db_xref="GeneID:3253716"
                     /translation="MPKRKSNPSDHLPNPPPPLSSLDAALDLLVCDTFTRLNSVAAKF
                     EACAGVKLNDGVVKARWEEAVSRYWVIKSMDELTCGAKKMEVKEGTAEADRDGMEQNG
                     VDGNQVGERADSNGRPLPASYPGAVVTHSLTPEEEHEWRKWTPKAGDVVLVDTFEDGL
                     WPAKIIDKKIFFQGRTVPRGNHFFPVRIYNEDMPPSITVKSRLIPFHLRANPPLMAST
                     ALLSAYHHAANPTTFDMLASARETLAAHNRLHPCVIDEESKARFKAEKEAWNKQVNWV
                     MGERRVEKLRSTAEEREKRLREVARSTSTPVYESQGCADPCEEEMGSLFGCPKKRRTV
                     PRNENSVNASSDPCLTIFGPTTPTFPRTPPRSAASSVASYIRPSLSNTIRPSSPRRTP
                     TREKRRVHAFVSDLSPASRRTYTPPKILPSGDETAPPSFGSATLLSEVKAGKFDFVSP
                     LGPVKRGKLSSNPETIASSTSSTTSKPHSGRSGSLEIVREEEEEDGWTVVQRRGRRAG
                     SEPVRQTMEAEEKTSVDDMEL"
     gene            920683..925951
                     /locus_tag="CNA03560"
                     /db_xref="GeneID:3253755"
     mRNA            join(920683..920736,920773..920999,921052..921166,
                     921220..921404,921451..921511,921564..921965,
                     922015..923964,924014..924028,924087..924150,
                     924218..924350,924397..924790,924852..924961,
                     925023..925063,925120..925179,925239..925419,
                     925473..925634,925690..925951)
                     /locus_tag="CNA03560"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41562963|gb|CF708804.1,gi|41562969|gb|CF708810.1,
                     gi|41563501|gb|CF709342.1,gi|41563510|gb|CF709351.1"
                     /transcript_id="XM_566696.1"
                     /db_xref="GI:58258566"
                     /db_xref="GeneID:3253755"
     CDS             join(920709..920736,920773..920999,921052..921166,
                     921220..921404,921451..921511,921564..921965,
                     922015..923964,924014..924028,924087..924150,
                     924218..924350,924397..924790,924852..924961,
                     925023..925063,925120..925179,925239..925419,
                     925473..925634,925690..925914)
                     /locus_tag="CNA03560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566696.1"
                     /db_xref="GI:58258567"
                     /db_xref="GeneID:3253755"
                     /translation="MAKKKLSLKPQNRGFATTSLPKKAAPPPAPPPADSPPAPPPQAP
                     PSSSPPPADWEHEEGAEEAALQSLVDRLQDKAEKEVARIVKAIEYDSRLAASFPKLDI
                     NQAIRDTALELALEEEKAACQDTDHPPVVTFPSTTVSDSDKGLLRYFVAYHVLQNLGF
                     RQERIEQCLLQGIKEGEGWEEALEWMWLHLSEDECLQRGEYERTTEPSITENQESLVP
                     AIEPDVEPIAQPAQSSRPTRTALQATDASTEARTTAHKSLFQSQDTSDTESDSGTEDE
                     YHINEQWAKLQLELDTLRMASGEGKKGKKGKGNQVILETPEIRRLKDKIGKVEKEYMF
                     TRKNADAILKVLRNQRDVAAIAAKFKGASIQDADQTETDSPSGNTQGDSIVEEKTNLM
                     DGSSDEEGDLFGGMLDEPTTLPGTPAETSTSTHITVRSMPIPKQMSFAGTIPKNVLKA
                     ALAKQTKQVVISYVNLSGASRAARAGLEIGWQGGGRKVWKMDDIACDDMVEAENYVST
                     LALSDLEAEKTVAGVNWRTMPPSYRELWEELKVKRQEREDESRRGIWKMIKGIWDKKA
                     VEATAEKNDTSKPSTSNTPIDPPARPAKEKEDVIIQKLQDDFAKRKESSAYQTMLTQR
                     NTLPIASFRDQIISTLDTNQILVFSGETGCGKSTQLPSFILEDQLARGKPCKIVVTEP
                     RRISAISLAQRVSQELGDAPGAVGTSSSLVGYSIRLESKTSANTRLSFVTNGIALRML
                     ESGSSGSSRGTAFDEVTHIIVDEVHERSIESDFLLIVLKNLCEARKDLKVVLMSATVD
                     AEKISAFFGGCPFMSVPGRTFPVTVQYLEDAVELAGWHIDGSSPYAIRGKKFKPASQM
                     VEWNEEGAKSDSDPDDEDEETAFNPAKLSSNKYSAQTVDTINILDSRLIPYDLIVLLL
                     EKICFEAADYVPFSQATLVFMPGLAEIRKLNDMLLAHPKFGSTDFVVWPLHSSISSEG
                     QSAVFKRPPEGVRKIVISTNIAETGVTIPDITCVIDTGKQREMRDSFRDLSNRMLQEA
                     TLNNVADEPVVFRKALRSICSPRPDMIRRQLPDHPIPEMLRLSLQDLALRIKILKVPL
                     GKTVESVLLQALDPPSSINIQRAIASLVEVKALTPNEEITPLGRLLSKLPMDVHLGKF
                     LLVAAMLGCLDPALTIAATLNSKSPFVTPFGFESQARAAKRSFAIGNNDFFTIANVFA
                     SWRRASDNPHFVRTFCKKNFVSHQNLQQIEELRQQLLAYLIDTSFVDATPAQRQAISQ
                     GRFSRGVRTKFVPVPPELNINGEDLKVVGAALVSGLYPKLLALDASGGMKTITNQQPV
                     AIHPSSVNFKVHKGEFGSNYLAYFTIMHSKRLYAWETGPVDDAALALLCGDIADFKVS
                     ASSFILDRKIKYSLSPKTSIAIKLIREQFYQVMSLRFRGKKLSDNQQRWFELGLKCLA
                     AGLQDEEAAKICVV"
     gene            complement(<925856..>926781)
                     /locus_tag="CNA03570"
                     /db_xref="GeneID:3253787"
     mRNA            complement(join(<925856..926493,926592..>926781))
                     /locus_tag="CNA03570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567239.1"
                     /db_xref="GI:58259652"
                     /db_xref="GeneID:3253787"
     CDS             complement(join(925856..926493,926592..926781))
                     /locus_tag="CNA03570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567239.1"
                     /db_xref="GI:58259653"
                     /db_xref="GeneID:3253787"
                     /translation="MSTAQRSPPSRTSTLTLTQTHTTPTDTPPQTVLHLRAGASTERR
                     VVWTEETVDNEGLGKKKSKICCIYHKPRAFDESSSDESSSDGSSSETDRRPSRGSNSH
                     RHRLKDDPNVEEEESSESDGGAGDGRARLAHLLRVSKRFADAPLSETDHCGSHVDITI
                     LISVTIRTMPISPTSTTYNRMELAKARRNHSLSELFVDLAVHRRIDQNTVKTNYCNDL
                     CSCRTSIVHVNISWNETHPNVMLQCIVVLRNCEKRATYSIPHKFSPPPRLAVQLRDT"
     gene            <926937..928344
                     /locus_tag="CNA03580"
                     /db_xref="GeneID:3253799"
     mRNA            join(<926937..926986,927039..927288,927357..927745,
                     927804..927891,927941..928157,928216..928344)
                     /locus_tag="CNA03580"
                     /product="porphobilinogen synthase, putative"
                     /transcript_id="XM_566698.1"
                     /db_xref="GI:58258570"
                     /db_xref="GeneID:3253799"
     CDS             join(926937..926986,927039..927288,927357..927745,
                     927804..927891,927941..928157,928216..928274)
                     /locus_tag="CNA03580"
                     /codon_start=1
                     /product="porphobilinogen synthase"
                     /protein_id="XP_566698.1"
                     /db_xref="GI:58258571"
                     /db_xref="GeneID:3253799"
                     /translation="MSHQRTAHFQVPPLQISSVLHGGIHHPTLRTWQANGRNLTKSML
                     IYPIFISDDPDAEQEVATLPGQKRWGINKLEAFLKPLVEKGLKSVILFGVPVTMEKDP
                     RGSAADDESTPVIQALKLLTNVFPQLMLCVDVCLCEYTSHGHCGILSSLPNPAHSNAP
                     TLDAEASAQRIAEVAVAYAKAGAHCVAPSDMMDGRIRAIKYGLMQVGLANRCALMSYS
                     AKFASGLYGPFRDAAGSAPSFGNRKCYQLPPNARSLARRAIQRDASEGADILMVKPAL
                     PYLDIISDCAQYAPDHPTACYQVSGEYAMVVAGAEKGIYDLREMAFETTESMVRAGAS
                     IILTYFTPQFLDWLDE"
     gene            complement(<928453..>932095)
                     /locus_tag="CNA03590"
                     /db_xref="GeneID:3253885"
     mRNA            complement(join(<928453..928611,928669..928749,
                     928810..928830,928841..928871,929048..929330,
                     929384..929582,929643..929816,929874..929930,
                     929989..930159,930210..930321,930370..931506,
                     931902..>932095))
                     /locus_tag="CNA03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_567228.1"
                     /db_xref="GI:58259630"
                     /db_xref="GeneID:3253885"
     CDS             complement(join(928453..928611,928669..928749,
                     928810..928830,928841..928871,929048..929330,
                     929384..929582,929643..929816,929874..929930,
                     929989..930159,930210..930321,930370..931506,
                     931902..932095))
                     /locus_tag="CNA03590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567228.1"
                     /db_xref="GI:58259631"
                     /db_xref="GeneID:3253885"
                     /translation="MYIVDWETVLSSPPSDVLVSYVKKTNHSVFPPYIKSMDKWLHFR
                     FIFFSLYGVGVLRLTSDASLASKRRNVEIGSPGNKERSRNLSNDTQPQNQANDSAVHI
                     TSSLSPTPPSRSPTPPSRSTSPSPQVKGTAVFEPERLKSGWTRPRLMARARTQQYNHG
                     SGASSESPILSSESSAPASNRYTTRNCGRPLSPSLVNRREISELFSGFSSGASSHASV
                     KSGDLQPVPPSSGGFHATSSARAGGLRRMLTKTQSLGVSEPSTPSKQDRRDDHEAGPA
                     SSRIVTAPSTPPRSALRRTQSMPSSPAEPSPQGVDIDSAFAVHPQIMQHPGSGGRAKK
                     TYGKVRTILVELSRGPEDGDQSSYDTMSQGDESQLQASYVELRQRYEVDNTIQHTSRS
                     ASLLQDMLQARAPETVSDMRSRGENRRFIDELGYLFDGISDPAANKSFQRSSAMDILQ
                     NMLDEYWLSKMKICGQVDKAWDCFTGAGEDEVMESACLVFLCILFVSGSGLEYVVHND
                     SQKSVSLLLKLIKAREGPLDLSYKPKITNSISKLRTICEKLKDNWKISRSSTRYWASC
                     VLNAICQSTMWAATGIDFEKEKALTNMLEVLKEEIKGVSDHFDLYEKGLDLQPDERSL
                     DLGYLDHCLRAILSLTEHSSTLREELLNSPQEVAQVLVDITLATTHLALTHDSNRSEA
                     SWCSLHAVQILAQLGTASGQWAIAVMECEAGPICLARVILKRVDLVRNAKDAHEKYLT
                     GQRTVLEKEEGAKVTRPSINEPEISEEELLCYALALSSIRAALRTFYSNSNDDPLASI
                     LKGNLALLLSKIIGVSAEIEGESLRELGELQSMMQNTFRRLMPGGLSMEGGDEGDGSE
                     NTDVVLETIRGVKSLL"
     gene            complement(932406..937505)
                     /locus_tag="CNA03600"
                     /db_xref="GeneID:3253862"
     mRNA            complement(join(932406..932608,932665..932781,
                     932835..933119,933169..933405,933454..933627,
                     933682..933794,933847..934378,934434..934817,
                     934867..935182,935233..935326,935390..935580,
                     935627..935853,935908..936102,936153..936235,
                     936287..936384,936438..936583,936636..936705,
                     936756..936868,936919..937137,937193..937505))
                     /locus_tag="CNA03600"
                     /product="DNA topoisomerase II, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532274|gb|CF678115.1,gi|41532288|gb|CF678129.1,
                     gi|41533167|gb|CF679008.1,gi|41536114|gb|CF681955.1,
                     gi|41536122|gb|CF681963.1,gi|41548864|gb|CF694705.1,
                     gi|41548869|gb|CF694710.1,gi|41550878|gb|CF696719.1,
                     gi|41559608|gb|CF705449.1"
                     /transcript_id="XM_566700.1"
                     /db_xref="GI:58258574"
                     /db_xref="GeneID:3253862"
     CDS             complement(join(932507..932608,932665..932781,
                     932835..933119,933169..933405,933454..933627,
                     933682..933794,933847..934378,934434..934817,
                     934867..935182,935233..935326,935390..935580,
                     935627..935853,935908..936102,936153..936235,
                     936287..936384,936438..936583,936636..936705,
                     936756..936868,936919..937137,937193..937315))
                     /locus_tag="CNA03600"
                     /codon_start=1
                     /product="DNA topoisomerase II"
                     /protein_id="XP_566700.1"
                     /db_xref="GI:58258575"
                     /db_xref="GeneID:3253862"
                     /translation="MSDSEFDDFRIDDDGSESDYYVAPSKGKKAAVPKKKAPAAKAPA
                     AKKAAPKKINKAPLASKKHPNESLSDAGSDTVCSPPKKKTKADDDDGDFGTESSAKAP
                     TSNKNASEVYQKLSQREHVLKRPDTYIGSVEAITQPMWILNPETKTMVHRPITFVPGF
                     LKIFDEILVNASDNKINDPTMDSIKVVIDREKNAISVYNNGRGIPVEMHTKEGVMIPE
                     LIFGHLLAGSNFDDDQKKLTGGRNGYGAKLANIYSHEFIVETADKVNSKKYKQIFSNN
                     MSKKGTPKITDNKKGEEWTKITFKPDLERFGMNGIDDDTNALLMKRVYDMAGTVKDVK
                     VFLNDERIKVKNFKQYVEMYLNASTTATSEAAGGAAVTKPPIIYEVANKRWEVAFALS
                     DGEFKQVSFTNSIATTKGGTHVDMIATQLANKLMDQIKKKNKAAPVKPFQIKNHMWIF
                     VNALIENPAFDSQTKENLTLKSSAFGSKCELSEEFIKKVAKTGIIDNVLNWARFKQDQ
                     ILKKTDGTKRSRISGIVKLEDANNAGGRNSKNCTLILTEGDSAKALAVSGLAVVGRDE
                     YGVFPLRGKLLNVREAGHDQIVKNVEIQHIKQILGLKHNQDYATADSLRYGHLMIMTD
                     QDHDGSHIKGLIINFLDHFYPSLLRIPNFLVEFITPIVKVWKGKKEISFYTMPQYEEW
                     KAQNNNGRGWESKYYKGLGTSTSADAKKYFSDLDKHRLAFETMQPEDRQLIDMAFNKK
                     KADDRKEWLRQFKPGTYLDHDVQSLPISDFVNKELILFSMADNIRSIPSVADGLKPGQ
                     RKVLFGCFKRNLTKEIKVAQLAGYVSEKTAYHHGEASLTSTIVGLAQNFVGSNNINLL
                     DPNGQFGTRLAGGKDAASARYIFTNLPRMTRAIFHPADDGLLNYLVEDGMSIEPDYFM
                     PTVPMVLINGADGIGTGWSTAIPNYNPVDIVENLRRMMRGEEPEKMTPWFRGFKGFIE
                     RIDQDKYKVSGIIEKINDTTLEITELPIRRWTQDFKEMLEEMTTGTDKVPQTIKDYEE
                     HHTDTTVHFRVHMTEKNLADAEKEGFDKRFKLTTSLGTGNMVCFDLNGKIKKYASPEE
                     ILEEFFHKRLEFYGHRKQHLADELNRQFERLSNQARFVHMIITKELVVSGKRRPDIVA
                     ELRSLKFKPFPKKERAKEEGENEAAEEEEDGDEGQASDYDYLLGMAIWSLTSEKVEKL
                     LAERDAKEQELIELLKLSPNNIWDRDLDNFLAEWQLALEADIADAKGSKPKAKAAAIK
                     ATQKPKKRAM"
     misc_feature    932891..932947
                     /note="CT-rich"
     gene            <938878..>942381
                     /locus_tag="CNA03610"
                     /pseudo
                     /db_xref="GeneID:3254026"
     gene            <947935..>949689
                     /locus_tag="CNA03620"
                     /pseudo
                     /db_xref="GeneID:3253963"
     repeat_region   949461..949505
                     /rpt_type=tandem
                     /rpt_unit_seq="cata"
                     /satellite="microsatellite"
     gene            <950292..>952208
                     /locus_tag="CNA03630"
                     /pseudo
                     /db_xref="GeneID:3253958"
     gene            complement(<952224..>958559)
                     /locus_tag="CNA03640"
                     /pseudo
                     /db_xref="GeneID:3253938"
     repeat_region   952495..952613
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     misc_feature    952989..953104
                     /note="A-rich"
     repeat_region   958408..958526
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     gene            <958687..>963360
                     /locus_tag="CNA03650"
                     /pseudo
                     /db_xref="GeneID:3253965"
     repeat_region   962149..962313
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     gene            complement(<963349..>968886)
                     /locus_tag="CNA03660"
                     /pseudo
                     /db_xref="GeneID:3253939"
     repeat_region   969965..970007
                     /rpt_type=tandem
                     /rpt_unit_seq="cata"
                     /satellite="microsatellite"
     gene            complement(<970224..>972053)
                     /locus_tag="CNA03670"
                     /pseudo
                     /db_xref="GeneID:3253941"
     gene            <972606..>978104
                     /locus_tag="CNA03680"
                     /pseudo
                     /db_xref="GeneID:3253969"
     repeat_region   972640..972804
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     misc_feature    978061..978176
                     /note="T-rich"
     repeat_region   978554..978718
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     gene            complement(<978965..>986773)
                     /locus_tag="CNA03690"
                     /pseudo
                     /db_xref="GeneID:3253972"
     misc_feature    982967..983058
                     /note="G-rich"
     gene            <988630..>991902
                     /locus_tag="CNA03700"
                     /pseudo
                     /db_xref="GeneID:3253967"
     gene            <992764..>993699
                     /locus_tag="CNA03710"
                     /pseudo
                     /db_xref="GeneID:3253973"
     gene            998062..1003420
                     /locus_tag="CNA03720"
                     /db_xref="GeneID:3253992"
     mRNA            join(998062..998396,998461..998990,999043..999084,
                     999134..999243,999291..999496,999552..999842,
                     999887..1000062,1000109..1000172,1000224..1000550,
                     1000600..1000729,1000784..1001005,1001061..1001309,
                     1001357..1001440,1001501..1001615,1001663..1001736,
                     1001789..1001801,1001856..1002001,1002052..1002166,
                     1002217..1002260,1002315..1002548,1002601..1002743,
                     1002796..1002821,1002869..1003052,1003102..1003191,
                     1003235..1003420)
                     /locus_tag="CNA03720"
                     /product="calcium transporting ATPase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533919|gb|CF679760.1,gi|41533927|gb|CF679768.1,
                     gi|41547888|gb|CF693729.1,gi|41547902|gb|CF693743.1,
                     gi|41556145|gb|CF701986.1,gi|41556156|gb|CF701997.1,
                     gi|41558021|gb|CF703862.1,gi|41558030|gb|CF703871.1,
                     gi|41560271|gb|CF706112.1,gi|41564803|gb|CF710644.1,
                     gi|41572193|gb|CF718034.1,gi|41572203|gb|CF718044.1,
                     gi|41576488|gb|CF722329.1,gi|41576492|gb|CF722333.1"
                     /transcript_id="XM_566703.1"
                     /db_xref="GI:58258580"
                     /db_xref="GeneID:3253992"
     CDS             join(998182..998396,998461..998990,999043..999084,
                     999134..999243,999291..999496,999552..999842,
                     999887..1000062,1000109..1000172,1000224..1000550,
                     1000600..1000729,1000784..1001005,1001061..1001309,
                     1001357..1001440,1001501..1001615,1001663..1001736,
                     1001789..1001801,1001856..1002001,1002052..1002166,
                     1002217..1002260,1002315..1002548,1002601..1002743,
                     1002796..1002821,1002869..1003052,1003102..1003191,
                     1003235..1003385)
                     /locus_tag="CNA03720"
                     /codon_start=1
                     /product="calcium transporting ATPase"
                     /protein_id="XP_566703.1"
                     /db_xref="GI:58258581"
                     /db_xref="GeneID:3253992"
                     /translation="MPAQQQDPFDDLLGSDSPPAPPRNDIFHEGRHIDFFHQGSSTAR
                     APAAISQRGSSPDSVNQATYALDPFFDDDDEYGPAVSNSYSGYLAPHPSSALHSSQPL
                     GRSDPSLLESSMPLANAGAMPAGFSGPMDDNDVKGYQASSSTAYAAEDPFRDDEGPSA
                     YAFTAPGASSGWTQPRRSRWQMFRDDYLTDVDWSFGVNQLLRRRSKFDGVPREIALNE
                     PEENRLKGFERNSVTTGKYGPITFLPKFLLSEFSRSANLFFLFTACIQQVPNVSPTGH
                     WTTIVPLGVVIIASAFKEIKEDFKRHASDRSLNNNLAQVLVDQQFQLRPWRRLRVGDI
                     VRLEANSFIPADIVLISSSEPEGLCYVETANLDGETNLKIKQAHPSTASLTNPHSVSL
                     LRGHILSEPPNSSLYTYDGTFHLSSAHPGSAPTKIPVGPNQMLLRGAQLRNTGWVYGV
                     IVNAGHETKLMRNATEAPVKRTAVERQVNRQILYLFLLLIVLSLVSTIGSSIRTWLFD
                     KNAWYLRLGDESKNKARQFIEDILTFIILYNNLIPISLIMTMEVVKFQQASLINSDLD
                     MYYAPTDTPALCRTSSLVEELGQIAYIFSDKTGTLTRNEMEFRECTIFGTMYAQTVDD
                     NKRDQGQKTFDSLRHRAQEDSQEGHVIREFLSLLSICHTVIPEEHDGKMVYQASSPDE
                     AALVAGAEMLGYRFQTRKPKSVFIDVNGETQEWEILNVCEFNSSRKRMSTVVRGPDGT
                     IKLYTKGADTVIFERLAPKQEFSEPTLVHLEDYATEGLRTLCLAYRDISEEEYSSWSA
                     LYNNAASQMSGRAEALDKAAEVIEQNLQLLGATAVEDKLQDGVPDAIHTLQQAGIKIW
                     VLTGDRQETAINIGLSCRLISESMNLVIVNTETAVETSELLNKRLFAIKNQRLGGDTE
                     ELALIIDGKSLTYALEKDCSDVFLELAIMCKAVICCRVSPLQKALVVKLVKRSTDAPL
                     LAIGDGANDVSMIQAAHVGVGISGVEGLQAARSADIAISQFRFLRKLLLVHGSWSYQR
                     LTKLILYSFYKNITFALTLFWYSWFNDYSGQIAFEGWSMSYYNVVFTILPPLVIGIFD
                     QFVSARMLDRYPQLYHLGQQNYFFTPIRFFYWVGNAFYHSVLLFAFSVLVFYNDLLAT
                     DGKNSGLWVWGTTLYLAVLLTVLGKAALISDVWTKYTLAAIPGSFIFTMIALPLYAII
                     APLLNFSLEYTGIVPRLWADPVFYFVLLLFPIICLLRDYVWKYYRRTYHPASYHIVQE
                     IQKFSLSDYRPRQEQFQKAIKKVRATQRMRRQRGFAFSQTETNNQDQARLIRAYDTSV
                     ARPSGY"
     gene            <1005391..1006415
                     /locus_tag="CNA03730"
                     /db_xref="GeneID:3253436"
     mRNA            join(<1005391..1005393,1005438..1005622,1005676..1005783,
                     1005843..1005938,1005991..1006087,1006147..1006241,
                     1006297..1006415)
                     /locus_tag="CNA03730"
                     /product="proteasome subunit beta type 3, putative"
                     /transcript_id="XM_566705.1"
                     /db_xref="GI:58258584"
                     /db_xref="GeneID:3253436"
     CDS             join(1005391..1005393,1005438..1005622,1005676..1005783,
                     1005843..1005938,1005991..1006087,1006147..1006241,
                     1006297..1006345)
                     /locus_tag="CNA03730"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="proteasome subunit beta type 3"
                     /protein_id="XP_566705.1"
                     /db_xref="GI:58258585"
                     /db_xref="GeneID:3253436"
                     /translation="MSVMELNGGSVVAMIGKDCVAIASDLRLGNQQVGIAANFDKVFP
                     INDKLYCGLPGLATDVYTLREHLRFRVNMYRMKEEREITPKTFTHLLSSTLYEKRFGP
                     FFLEPVVAGLPTPTSLEPHPRPYISTMDTIGCITTPKDFAVAGTAADKLYGIAEGLWE
                     PDLEPEDLFETISQTLLSAVDRDALSGWGAVVNIITHDKVITRTLRARMD"
     gene            <1006580..1010546
                     /locus_tag="CNA03740"
                     /db_xref="GeneID:3253434"
     mRNA            join(<1006580..1006658,1006753..1006934,1006996..1007700,
                     1007760..1009367,1009421..1010250,1010303..1010546)
                     /locus_tag="CNA03740"
                     /product="eukaryotic initiation factor 4F subunit P130,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531280|gb|CF677121.1,gi|41531448|gb|CF677289.1,
                     gi|41536041|gb|CF681882.1,gi|41551310|gb|CF697151.1,
                     gi|41551315|gb|CF697156.1"
                     /transcript_id="XM_566707.1"
                     /db_xref="GI:58258588"
                     /db_xref="GeneID:3253434"
     CDS             join(1006580..1006658,1006753..1006934,1006996..1007700,
                     1007760..1009367,1009421..1010250,1010303..1010510)
                     /locus_tag="CNA03740"
                     /codon_start=1
                     /product="eukaryotic initiation factor 4F subunit P130"
                     /protein_id="XP_566707.1"
                     /db_xref="GI:58258589"
                     /db_xref="GeneID:3253434"
                     /translation="MRRKWRRKKSGKGRCEDYNLKDGFCYLTHPQQTMPPQPAPARQN
                     GVPQQPIPRPPVPQQGIPAHFPVPNQPPAQYPIMAYPPQSGFYAGYNPYEQQQNFGMP
                     PQWAPQHHPQNQFPGGYSARPVSPPSGTAPFQPAQQSFIHNSPFPGGSGPNGPQTPLR
                     PSGPALNGHQQTSSNASQTSAPSTPNFSLSGASATFTPRRSAAIKISRPDGTEFDLKK
                     EALKVSSTTVSPAPTSPASTPHTPATPNSELKNVKVDTPKKPVFGLPVTVKIERPEEK
                     AARLLEEAKREKIRAQEEKEENERKERLEKKAKEEEEKKAKDAAEKAEQANSAGEPTN
                     TEVNGSVEEVISGAPSSVSSPALGAGLPPKPVSVVNGANALPATLNLASASPPVVSEP
                     SSASVSALSSARPIEDIHAISYPGSLKSPNPQLNVSAEPRKFRYDREFLMQFMNICKD
                     KPESLPPLEEIGLEADGGSGFGSRGSRGGRSSQGPSSRTGSTGLGIGGVNRATMGSFS
                     MGQFGSGSGSGSLRNSTSEQRYRASLPGRSSSQGGPGGLPSLSGLPSMGLSSSRGGES
                     RGSQRGSKRVPQSSQPSTPAAAPIPISENAWTRKRLGGDSEGTPAYIERKVKALLNKL
                     TEEMFDPISKQILEWANKSANETDGLTLKLVIKLIFEKATDEAHWSSMYAKLCRLLHD
                     EISNDVSDTIDGQVISGRSLFRRYLLGRCQVDFEAGWKAREDTAVAAAAKKDEDEAKQ
                     EKAKAEDGGEEKEADLMSDEYYAAQKAKRRGLGLIQLIGELFKREIVANRVISQCLLK
                     LLSNVNDPDEEDIESACKLLATVGAAYDRAARENLNKAFDVLNQMMKIESLPSRIKFM
                     IMDLNDLRREGWKSRKNQSGVMTIAEIHEQNAKEKTAAAAAARESLSRGGSRSGNRRD
                     GTQPGEWQSVSSNPRSISRPTDFSNIGRNISSSSVTPSFGPSSVFANRKGKAATASNA
                     PSPTSRPSSANMFSALHEAQESESPAERRTSTDEGEAPQRKKLNLAPRTKPLASEDDA
                     REEGEEARSEEEAAGPELSEGDIKSKIDLDMKELWGDKDQGGSRNPADVAEYFSSLPE
                     SRRPLLAARLLDDLFRISKLKDAEVVAKGWKVSLEQQAVSSEVLKQALEARMPTLDDE
                     AIDFPNAYDAVALLTRSLSLSDDDVSALGDKIEVDGTPRVTPKQKLEKALAKLNEQA"
     misc_feature    1007581..1007687
                     /locus_tag="CNA03740"
                     /note="GA-rich"
     gene            1010727..1013272
                     /locus_tag="CNA03750"
                     /db_xref="GeneID:3253896"
     mRNA            join(1010727..1010813,1010878..1010969,1011008..1011126,
                     1011164..1011205,1011260..1013272)
                     /locus_tag="CNA03750"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537179|gb|CF683020.1,gi|41537191|gb|CF683032.1,
                     gi|41572119|gb|CF717960.1"
                     /transcript_id="XM_567158.1"
                     /db_xref="GI:58259490"
                     /db_xref="GeneID:3253896"
     CDS             join(1010773..1010813,1010878..1010969,1011008..1011126,
                     1011164..1011205,1011260..1013194)
                     /locus_tag="CNA03750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567158.1"
                     /db_xref="GI:58259491"
                     /db_xref="GeneID:3253896"
                     /translation="MFASNNDPSSPDTRMIAFQTLLDGSETALEKSVDIELLRKLCAT
                     GIPSHPPHLRPLAYSLLLELLPLDKHQWKGTMRAQRRRYYNLMQTFMRELEAQPNSSS
                     SGTDNILNGISGDIKNLKSPFWHRPVSYRPSSPLRPVNSKVIRRSEGSNKEQEIEESF
                     SDSEEEFEEPILNRRAVFERLEVLSAARHATSVQKGPLNNITVQSPVSSVESTVLSPQ
                     ITLSFDPTPMPSPSGITRSPKLIQSAPQPMIDEQAPSSITLLSPRPLQSTIDSPAAPV
                     KGALLHPDSNREALIRLLYVFCQSNPQWRYRSSFVDIGAALYLIYAGGTKSDLDYVEE
                     QTFWALSALAGDTSELLSDEGMDSALDRFERRLHWVNPALSKILRDRNVEPVLYAQRW
                     LSSFFTLDVPPTRIPLLFDIIVSARLSSPEEQPKVDLIMDIGVAMVSLLKDEIVYPNH
                     LKVSHGMWDNAVEEDEDSSDAMVRVLTLLRSYPLERAGDLPAVLEEASDLQETRLLSL
                     QRGIDPDQIPLPPRKPVSVKNLRDQAATNSSWGKAVGSLWSSISATSISAVKSAPAPL
                     SSTLDSSSGRSPVTDRRRSDSVTSSVSAIQERFASLSKHFSPTSSPKQSEDEPVNLPR
                     PLLLSGSTRSVSRSYRGDSTPSSSPRASPSMDKSLSPSNEFRSPPNRSLPSRQSPGGL
                     YKIGNNYRNRHPLRTAPTLAQRIHAGADHLWRSESAIDEKEMRKVDDNAHDDESSGWR
                     SV"
     gene            complement(<1013414..>1016158)
                     /locus_tag="CNA03760"
                     /db_xref="GeneID:3253432"
     mRNA            complement(join(<1013414..1013665,1013706..1014011,
                     1014057..1014741,1014795..1014874,1014914..1015986,
                     1016026..>1016158))
                     /locus_tag="CNA03760"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41556718|gb|CF702559.1,gi|41573335|gb|CF719176.1,
                     gi|41573344|gb|CF719185.1"
                     /transcript_id="XM_566709.1"
                     /db_xref="GI:58258592"
                     /db_xref="GeneID:3253432"
     CDS             complement(join(1013414..1013665,1013706..1014011,
                     1014057..1014741,1014795..1014874,1014914..1015986,
                     1016026..1016158))
                     /locus_tag="CNA03760"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_566709.1"
                     /db_xref="GI:58258593"
                     /db_xref="GeneID:3253432"
                     /translation="MSTASLPDTQRSLPHPPPDPAAPQLTAHWTRHDEGDGEVDVLRI
                     KSSSPRINPFHLLSHPDSLSSLPPLPPSLQTIAAGPGNSDTRQPPVHITKVSANEVEL
                     KSHSPEPSNYRNIIGKVSGVFKRNSHNSDADFAPSPVIMQGPPPSPPLSEGGLDESVI
                     MSDNTDETPVYHSAAAPVSENGPTIATGFTSEPSEMSPTVLAPPIPFSTRRVSSSSTS
                     SRAGSLTLVRSGRLAPQRDGESPGKGKDLPLLPHESDPNLERRDSAGSLLAPTPQLYR
                     RSTVGSSNFPSAPRSPLTNAHTAFTSPSSTPPPSGPPSAKGDLLDSAILAQEEHIRRE
                     RIERLERRQKKASTTSDSDPEPKIEEKPKEKPREKEKEETKVLVGNLIGEDHVNYVLM
                     YNMLTGIRIGVSRCQAKIKRPISDDDYTARHKFSFDIVGNELTPSAKYDFKFKDYAPW
                     VFRELRDEHFHLDPADYLLSLTAKYILSELGSPGKSGSFFYFSRDYRFIIKTIAHSEH
                     KFLRSILKDYHQHVKENPHTLLSRFYGLHRVKLPRGPKIHFVIMNNLFPPHRDIHETY
                     DLKGSSFGREYPEERAAQNPRATLKDKNWVNRGRTLEFGPEKRALLTEQLRRDMEFLK
                     RIKVMDYSLLVGIHNMERGNRDNLRKNQLSVFHPEVTTTKRKPSTKQGPSEASNVRKV
                     VRRSDPKSLDVTSQLPSEDSADRRHFIFYQDEGGFRATNEANQPLDTIYYLGVIDICT
                     PYSSLKKIEHFWKSMTEDRHTISCVDPVFYGQRFYNFLRSVMRGGDKSLRPVGLEQVE
                     PSEKPEVGQDMDNSEMPIGGASDTQDTTVQDGPQPSIVGHLKTD"
     gene            <1016379..1017616
                     /locus_tag="CNA03770"
                     /db_xref="GeneID:3253430"
     mRNA            join(<1016379..1016895,1016963..1017106,1017146..1017616)
                     /locus_tag="CNA03770"
                     /product="mitochondrion protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41558632|gb|CF704473.1"
                     /transcript_id="XM_566711.1"
                     /db_xref="GI:58258596"
                     /db_xref="GeneID:3253430"
     CDS             join(1016379..1016895,1016963..1017106,1017146..1017612)
                     /locus_tag="CNA03770"
                     /codon_start=1
                     /product="mitochondrion protein"
                     /protein_id="XP_566711.1"
                     /db_xref="GI:58258597"
                     /db_xref="GeneID:3253430"
                     /translation="MAAPRIAHLAHKSVLELSGPDAQKFLKGLSCKDVEYLAGGYSGF
                     LNASGRVLHTAFVFPRSKNSYLITHESPEDHPAPLTSLLPPFKLRSKVRIKDVTSQWD
                     AWSAWGSDLQGGPSPIRTWKMGSGGASESHWDWEGGVRDLGLRDDEVGCWDLRAGWPH
                     MGRQLLIPKGEKPSLATSHDLGNMDDYELHRMLLGVPEGPTEILPGHALPLESCMDIH
                     GGVDFRKGCFLGQELTVRTYHTGATRKRILPVRLIPLDQTSSSSISDLLSSSPQQSLD
                     EVSTPLDITYHPPSSSATRKPRSAGKILSLHNAVGLALVRLEMAERCWWSGDILRSSV
                     SQWLDSGAGRLTTQVNGKEWGVYVGQGEAYAAALEHMSSSS"
     gene            complement(<1017607..>1019056)
                     /locus_tag="CNA03780"
                     /db_xref="GeneID:3253428"
     mRNA            complement(join(<1017607..1017878,1017937..1018062,
                     1018116..1018297,1018368..1018474,1018548..1018620,
                     1018662..1018715,1018746..>1019056))
                     /locus_tag="CNA03780"
                     /product="protein monoubiquitination-related protein,
                     putative"
                     /transcript_id="XM_566713.1"
                     /db_xref="GI:58258600"
                     /db_xref="GeneID:3253428"
     CDS             complement(join(1017607..1017878,1017937..1018062,
                     1018116..1018297,1018368..1018474,1018548..1018620,
                     1018662..1018715,1018746..1019056))
                     /locus_tag="CNA03780"
                     /codon_start=1
                     /product="protein monoubiquitination-related protein"
                     /protein_id="XP_566713.1"
                     /db_xref="GI:58258601"
                     /db_xref="GeneID:3253428"
                     /translation="MPDIKLKNQASLCASTRLFLAYTSIKPFDVAFHPKEPVVFSSLL
                     TGQVCAWSYDDATGETSSSWSVRPSKRTARALSIEENGDEIWMGGKSGSLLCALTPPK
                     VIQLSTRDGSMTRERDSAHECPINRVYCVNRNLVATGDDDGVIKLWDPRQADSIRTYS
                     QHFDYISDFTYFDDKRQLVATSGDGHLSVIDIRSNKSTPLTVSEDQEDELLSIVPIKG
                     GQKAIVGSGLGILSVWNRQMGWADSVDRIPGHPASIDAIVALTPDIIATGSEDGMIRV
                     IQVLPHKFLGVVATHEEFPVERIRLDRNNKWLGSVSHDECLKLTDVEDLFEDSDEDDE
                     MEEDEPDSDEEKSKKKKKDNGMKDMSRGQAENDGSFFADL"
     repeat_region   1019141..1019177
                     /rpt_type=tandem
                     /rpt_unit_seq="taaaaa"
                     /satellite="microsatellite"
     gene            1019289..1021817
                     /locus_tag="CNA03790"
                     /db_xref="GeneID:3253426"
     mRNA            join(1019289..1019659,1019697..1019977,1020017..1021817)
                     /locus_tag="CNA03790"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41563629|gb|CF709470.1,gi|41563645|gb|CF709486.1,
                     gi|41567046|gb|CF712887.1,gi|41571820|gb|CF717661.1,
                     gi|41571829|gb|CF717670.1"
                     /transcript_id="XM_566715.1"
                     /db_xref="GI:58258604"
                     /db_xref="GeneID:3253426"
     CDS             join(1019314..1019659,1019697..1019977,1020017..1021747)
                     /locus_tag="CNA03790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566715.1"
                     /db_xref="GI:58258605"
                     /db_xref="GeneID:3253426"
                     /translation="MDALRVARVDNVTIQYFLPPTAPDQKPTPCTQIGQLHLTPHHLI
                     FSHTPSTAYEPEIWIPYPLITRLTRLPQTINGLYPLQVETKTFESYVLHFTKDRDGGA
                     EEVWQSVKDCSVKSSVEQLYAFFYVPPSPGTGWTVFNHRTEFARQGLGTRTKAWRFTD
                     INKDYSFSPTYPSKLVVPSRISDSTLMYAGKYRSKARIPALTYLHWANNASITRSSQP
                     MVGIKNSRSSQDERLVECIFSSHLFLDNAYSSAPVFGATSTNLIIDARPTTNAMANVA
                     MGAGTENMENYKLGKKAYLGIDNIHVMRNSLKMVVEAIREANLKPSVPLNRALLRKSN
                     WLRHISTILDGALIIVRNIHLNASHVLIHCSDGWDRTGQLSAVAQICLDPYYRTFDGF
                     KVLVEKDWLAFGHKFLDRSGHLSSEKYFMVTENDDETEEEGVSAQRAAQAFFASVQKQ
                     FTSTSHLKEISPVFHQFLDCVRQIQRQFPERFEFNEQYLLDIYRHLYTCQFGTFLFNN
                     ERERQGNTSPSRKSFVEQTSSVWDYLDSPSEREKHINSLYDASLDSNQSRDAGADQGV
                     LFYDPKDVRFWFRLFGRGDEEMNGSALTLNQPQGVDIIGPIGGDQVEDMAAGEILRGA
                     SPVSAPSTHAAPSQSRPWNWSQLSGNALNAVHSAAREIKSISQDALSQIRAEANELDK
                     ESWQQEGKGKNSEPTPLTESVSLPEANPWSAEARPSPFTPPPRPNSQVSRTTQNPWAA
                     MPDTVTSLSHLTLDSKAPDSPANDAGAKERAEEKQQKAWDPLGAL"
     gene            1023097..1024846
                     /locus_tag="CNA03800"
                     /db_xref="GeneID:3253424"
     mRNA            join(1023097..1023786,1023824..1024138,1024192..1024335,
                     1024416..1024591,1024661..1024846)
                     /locus_tag="CNA03800"
                     /product="conjugation with cellular fusion-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41563776|gb|CF709617.1,gi|41563780|gb|CF709621.1"
                     /transcript_id="XM_566717.1"
                     /db_xref="GI:58258608"
                     /db_xref="GeneID:3253424"
     CDS             join(1023102..1023786,1023824..1024138,1024192..1024335,
                     1024416..1024591,1024661..1024738)
                     /locus_tag="CNA03800"
                     /codon_start=1
                     /product="conjugation with cellular fusion-related
                     protein, putative"
                     /protein_id="XP_566717.1"
                     /db_xref="GI:58258609"
                     /db_xref="GeneID:3253424"
                     /translation="MAHPGALSRNTPEASLPRSYPESSDNARKSAAVPSANADAATAR
                     RLPALPNGPHSFRTDTSTPAGELDSAYEQTATRRRRAGTRSERPSTQPNTDSKGQRTS
                     SRTAHPRKPHEPRLPSAKDVRRAPASSMYFYPAPCYGSPPNQALRAHTGTLVGERIWV
                     IGGVDKQTCFRDVACFDTESFMWSTLETQGERFPPLRAHTTTLVGDKLFIFGGGDGPS
                     YSNDVWILDTTTHRFSRPSFSPDLPLPPPRRAHSTVLYQHYLIVFGGGNGQTALNDVW
                     ALDVSDPNALTWTEWKTKGDIPQKKGYHTANLIGDKMVVFGGSDGHASFADVHVLNLK
                     TCVWTLINTDIKHNRLSHTSTQVGSYLFVIGGHNGQAYAQDVLLFNLVTLQWEMKLPR
                     GVFPPGRGYHVALLHDARIFLSGGYNGETVFDDFWILDLSASAYLPQVTTFQVDENLY
                     KRSITESSSLWQTHL"
     gene            complement(1025170..1028240)
                     /locus_tag="CNA03810"
                     /db_xref="GeneID:3253422"
     mRNA            complement(join(1025170..1025477,1025525..1025600,
                     1025663..1025825,1025880..1025948,1026005..1026077,
                     1026140..1026452,1026506..1026567,1026632..1026858,
                     1026913..1027018,1027076..1027123,1027179..1027210,
                     1027263..1027362,1027415..1027723,1027798..1028000,
                     1028059..1028086,1028154..1028240))
                     /locus_tag="CNA03810"
                     /product="1,4-alpha-glucan branching enzyme, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533221|gb|CF679062.1,gi|41533229|gb|CF679070.1,
                     gi|41534395|gb|CF680236.1,gi|41534402|gb|CF680243.1,
                     gi|41536999|gb|CF682840.1,gi|41537008|gb|CF682849.1,
                     gi|41539722|gb|CF685563.1,gi|41539730|gb|CF685571.1,
                     gi|41546597|gb|CF692438.1,gi|41546606|gb|CF692447.1,
                     gi|41556959|gb|CF702800.1,gi|41558287|gb|CF704128.1,
                     gi|41558293|gb|CF704134.1,gi|41558968|gb|CF704809.1,
                     gi|41558981|gb|CF704822.1,gi|41564397|gb|CF710238.1,
                     gi|41564409|gb|CF710250.1,gi|41564413|gb|CF710254.1,
                     gi|41568160|gb|CF714001.1,gi|41568169|gb|CF714010.1,
                     gi|41570137|gb|CF715978.1,gi|41570150|gb|CF715991.1"
                     /transcript_id="XM_566719.1"
                     /db_xref="GI:58258612"
                     /db_xref="GeneID:3253422"
     CDS             complement(join(1025263..1025477,1025525..1025600,
                     1025663..1025825,1025880..1025948,1026005..1026077,
                     1026140..1026452,1026506..1026567,1026632..1026858,
                     1026913..1027018,1027076..1027123,1027179..1027210,
                     1027263..1027362,1027415..1027723,1027798..1028000,
                     1028059..1028086,1028154..1028178))
                     /locus_tag="CNA03810"
                     /codon_start=1
                     /product="1,4-alpha-glucan branching enzyme"
                     /protein_id="XP_566719.1"
                     /db_xref="GI:58258613"
                     /db_xref="GeneID:3253422"
                     /translation="MTAVSLSDGTAVLKTDPWLEPFSGALRERYAAYQKQRTIIEEHE
                     GGLAEFSKGYKSMGFQIDKNGGVRYREWASNATEARLIGEFNNWSHTANPMTKSPFGV
                     WECYVPPVSPGVCAIPHDSMVKISMTLPGGESIDRIPTWITRVTQDLNISPIYDGRFW
                     NPPKEQQYQFKHGHSTRPVEGLKIYEAHVGISSPNMRVTTYKEFEVDVLPKIKQLGYN
                     CIQMMAIMEHAYYASFGYQVTNFFAASSRFGTPEELKSLVDKAHELGLTVLLDVVHSH
                     ASKNILDGINMYDGSDHLYFHEGGRGRHDQWDSRLFNYGQHEVLRFLLSNLRFWMDIY
                     MFDGFRFDGVTSMMYKHHGIGSGFSGGYHEYFGDSVDLEAMVYLMLANAMLHETYPHV
                     VTIAEDVSGMPTLCRPVAEGGVGFDYRLSMAIPDMWIKLLKEYTDDQWEMGQIVHNLT
                     NRRHLEKSVAYAESHDQALVGDKTLAFWLMDKEMYDFMSDLSPLTPIIDRGLALHKMI
                     RFIVHTLGGEAYLNFEGNEFGHPEWMDFPREGNGNSFAHARRQFNLVDDKLLRYKYLY
                     EFDVAMNWLEDKYKWLNSPQAYVSLKHEGDKMIVFERAGLLFIFNFHPTQSFTDYRVG
                     VDTAGEYKVILTSDETRFGGHNRIDMGGRYFTTPMEWNGRKNWLQVYSPSRTVLVLGL
                     "
     gene            <1028733..1029335
                     /locus_tag="CNA03820"
                     /db_xref="GeneID:3253420"
     mRNA            join(<1028733..1028915,1028970..1029335)
                     /locus_tag="CNA03820"
                     /product="G1 phase of mitotic cell cycle-related protein,
                     putative"
                     /transcript_id="XM_566721.1"
                     /db_xref="GI:58258616"
                     /db_xref="GeneID:3253420"
     CDS             join(1028733..1028915,1028970..1029248)
                     /locus_tag="CNA03820"
                     /codon_start=1
                     /product="G1 phase of mitotic cell cycle-related protein,
                     putative"
                     /protein_id="XP_566721.1"
                     /db_xref="GI:58258617"
                     /db_xref="GeneID:3253420"
                     /translation="MPNYYDELEIEDFAWDPVARVFHYPCPCGDRFEISKGQLRDGEE
                     IAICPSCSLIVRVIYDYLDWEDYVTTDDEDDGGSVDTPLSNTSPDPAYPVVVGSAEVE
                     SQSKTASSAVSSQKEECTSLSDRLAGLQVESGKEDDPVQEHKREDSSDVLH"
     gene            complement(1029306..1031258)
                     /locus_tag="CNA03830"
                     /db_xref="GeneID:3253877"
     mRNA            complement(join(1029306..1029973,1030023..1030434,
                     1030485..1030606,1030667..1030694,1030762..1030784,
                     1030841..1030933,1031015..1031258))
                     /locus_tag="CNA03830"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544942|gb|CF690783.1,gi|41562100|gb|CF707941.1,
                     gi|41562116|gb|CF707957.1,gi|41563954|gb|CF709795.1,
                     gi|41563961|gb|CF709802.1,gi|41564050|gb|CF709891.1,
                     gi|41564057|gb|CF709898.1"
                     /transcript_id="XM_567159.1"
                     /db_xref="GI:58259492"
                     /db_xref="GeneID:3253877"
     CDS             complement(join(1029326..1029973,1030023..1030434,
                     1030485..1030606,1030667..1030694,1030762..1030784,
                     1030841..1030933,1031015..1031152))
                     /locus_tag="CNA03830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567159.1"
                     /db_xref="GI:58259493"
                     /db_xref="GeneID:3253877"
                     /translation="MSDDAEVTNNKKTTKSTLLDGNHIFPPFYACYLLRSKATANSNR
                     TYVGSTPDPPRRIRQHNGELKQGAWSTSRHRPWEMQMIVYGFPSKLAALQFEWAWQKP
                     ELSRHLRIRGEDQEYYHIFTKDARRNWVERKVCVAYALISLTPFNRLPLHVRFFNHET
                     HGIWQSIHEQAGVNTIQRGKSRAKPVNPLHLLSQSVAPAVTIILDLGGVSGTSGKRRE
                     CTKGVMSHEGPIDVKDVEFRQGFGVRGKWLEIRKRILSGQDLCCHLCQERIAFNDHLT
                     FSICPLAESQDCFCITHLICLAKHFQDEAPVEDRRAPSQPKILPYQGLCPNCKRTVQW
                     GQHIRACYARKEQVEKAEKAEKAEKAEKAEKAEKAEKAEKAEKAEKAGRKVRQREMKT
                     KKGDQSNGTVAQPESIYSATPVHTTFGLSNASATLIDPSMPARSMKSKDVGGEGIRHS
                     THTDDSDGIISVYSETEDESESEPEWEIFEAEMMALS"
     repeat_region   1029594..1029742
                     /rpt_type=tandem
                     /rpt_unit_seq="ctttg"
                     /satellite="microsatellite"
     gene            complement(1031578..1033945)
                     /locus_tag="CNA03840"
                     /db_xref="GeneID:3253859"
     mRNA            complement(join(1031578..1031851,1031917..1032146,
                     1032197..1032253,1032309..1032391,1032443..1032647,
                     1032698..1032962,1033009..1033220,1033261..1033501,
                     1033555..1033633,1033716..1033945))
                     /locus_tag="CNA03840"
                     /product="protein serine/threonine kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530312|gb|CF676153.1,gi|41531492|gb|CF677333.1,
                     gi|41531501|gb|CF677342.1,gi|41532243|gb|CF678084.1,
                     gi|41544467|gb|CF690308.1,gi|41549586|gb|CF695427.1,
                     gi|41559415|gb|CF705256.1,gi|41559425|gb|CF705266.1,
                     gi|41566132|gb|CF711973.1,gi|41569431|gb|CF715272.1"
                     /transcript_id="XM_567160.1"
                     /db_xref="GI:58259494"
                     /db_xref="GeneID:3253859"
     CDS             complement(join(1031767..1031851,1031917..1032146,
                     1032197..1032253,1032309..1032391,1032443..1032647,
                     1032698..1032962,1033009..1033220,1033261..1033501,
                     1033555..1033571))
                     /locus_tag="CNA03840"
                     /codon_start=1
                     /product="protein serine/threonine kinase"
                     /protein_id="XP_567160.1"
                     /db_xref="GI:58259495"
                     /db_xref="GeneID:3253859"
                     /translation="MEGIQRDSPPIQQPMATEKAPIVGSSASTSLPTLSVQDGTLPLT
                     PGAQGMQTGTIDGHRQLQSPVSRSSSAGEDKMREKARDAQEQAAQSQANLHHATQQAR
                     VAAINAAATQAALETAAQLPATARVPVSGGGVEQGQARRKTAGRYALSDFLIERTLGT
                     GSFGRVHLVRSRHNGRFYAVKVLNKEKVIKMKQVEHTNSEREMLVRVRHPFLVNLWGT
                     FQDVNNLYMVMDFVAGGELFSLLRKSQRFPNSVAKFYAAEVALALDYLHSLDIIYRDL
                     KPENLLLGADGHVKVTNFGFAKYVPDITWTLCGTPDYLAPEVVQSKGYNKSVDWYALG
                     VLIFEMLAGYPPFFTEDGNPMKLYEKIIAGKVRYPTYFDALAKELLKNLLIGDLTKRY
                     GNLRAGSSDIFAHGWFAEVDWDKLYRREIPAPYVPKIDGEGDASQFDRYQEADVSAYG
                     KVGNGPYDHFFTEF"
     gene            1034461..1036463
                     /locus_tag="CNA03850"
                     /db_xref="GeneID:3253418"
     mRNA            join(1034461..1034891,1034952..1035067,1035118..1035212,
                     1035272..1035384,1035421..1035698,1035747..1035760,
                     1035819..1035929,1035982..1036267,1036321..1036463)
                     /locus_tag="CNA03850"
                     /product="pyruvate dehydrogenase (acetyl-transferring),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534555|gb|CF680396.1,gi|41534563|gb|CF680404.1,
                     gi|41546093|gb|CF691934.1,gi|41546104|gb|CF691945.1,
                     gi|41551552|gb|CF697393.1,gi|41553048|gb|CF698889.1,
                     gi|41553060|gb|CF698901.1,gi|41555647|gb|CF701488.1,
                     gi|41564793|gb|CF710634.1,gi|41564804|gb|CF710645.1"
                     /transcript_id="XM_566723.1"
                     /db_xref="GI:58258620"
                     /db_xref="GeneID:3253418"
     CDS             join(1034649..1034891,1034952..1035067,1035118..1035212,
                     1035272..1035384,1035421..1035698,1035747..1035760,
                     1035819..1035929,1035982..1036267,1036321..1036408)
                     /locus_tag="CNA03850"
                     /codon_start=1
                     /product="pyruvate dehydrogenase (acetyl-transferring)"
                     /protein_id="XP_566723.1"
                     /db_xref="GI:58258621"
                     /db_xref="GeneID:3253418"
                     /translation="MTLLTGSRITQSFLLTVKTRKPQCLCLLQSEQGKRMSTNHAAVH
                     KGKPPPSRSAPAIIDMQSTTEEPPLGESELFLRTRDEALNTPGMKFADGHGLKGPTGK
                     GRQTRKMNLYQAIRDALGTALAKNPKSFVFGEDVETGVFRCTTGLVDEFGKRRVFNTP
                     LTEQGIAGFGIGLASVGGCAIAEIQFGDYIFPAFDQLVNEAAKQRYASGGSYPPVGGS
                     LTIRAPIGSVGHGGLYHSQSPEGFFLGAAGLKIVIPRSPIQAKGLLLAAIRDPSPTLF
                     FEPKILYRAAVEEVPIDDYTIPLGQAEVIRKGADLTVVSYGTPLHICLRAINMLQQPP
                     SSILGSLPPGLRPPQPAPSIELIDLRTINPLPLEDLVSAVRKTGRLVIVHEAGRSGSV
                     GNNIAGEVGRRAFEYLEAPVGVVSGWDTPVPLSFERFYQPDVIRVFDKLVETLSY"
     gene            complement(1036458..1037806)
                     /locus_tag="CNA03860"
                     /db_xref="GeneID:3253416"
     mRNA            complement(join(1036458..1036667,1036725..1036947,
                     1037008..1037104,1037175..1037229,1037296..1037806))
                     /locus_tag="CNA03860"
                     /product="actin filament organization-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41561960|gb|CF707801.1,gi|41561977|gb|CF707818.1"
                     /transcript_id="XM_566725.1"
                     /db_xref="GI:58258624"
                     /db_xref="GeneID:3253416"
     CDS             complement(join(1036587..1036667,1036725..1036947,
                     1037008..1037104,1037175..1037229,1037296..1037670))
                     /locus_tag="CNA03860"
                     /codon_start=1
                     /product="actin filament organization-related protein"
                     /protein_id="XP_566725.1"
                     /db_xref="GI:58258625"
                     /db_xref="GeneID:3253416"
                     /translation="MATQQPAQAFASHLINQTLSSIALLESLSLINSADASLIRQKLP
                     SPTGPFPSLSPPSPSNSFANLTIAQSSPTSSWTVQHARDDNSSNSPSNSMQPSASAPA
                     LPPRQRSEPAERRAKALWDFSGTEADDLQFRSGDTIIIDEEVNEQWSRGRVIPNGHSA
                     PLPRSGLFPSNYVEQLPPVQNNAPPPPQIPYYQPPPPGPQSMVPYQPPQQGYYGQKPP
                     MHAMPPQQQVQGGVMVQQDTQHKPRFGKLGSQLGTAAVTGVGFGAGSAVGSGIINSIF
                     "
     gene            complement(<1038580..>1040241)
                     /locus_tag="CNA03870"
                     /db_xref="GeneID:3253414"
     mRNA            complement(join(<1038580..1038665,1039008..1039088,
                     1039152..1039335,1039399..1039630,1039757..1039810,
                     1039937..1040130,1040239..>1040241))
                     /locus_tag="CNA03870"
                     /product="transformer-2-beta isoform 3, putative"
                     /transcript_id="XM_566727.1"
                     /db_xref="GI:58258628"
                     /db_xref="GeneID:3253414"
     CDS             complement(join(1038580..1038665,1039008..1039088,
                     1039152..1039335,1039399..1039630,1039757..1039810,
                     1039937..1040130,1040239..1040241))
                     /locus_tag="CNA03870"
                     /codon_start=1
                     /product="transformer-2-beta isoform 3"
                     /protein_id="XP_566727.1"
                     /db_xref="GI:58258629"
                     /db_xref="GeneID:3253414"
                     /translation="MAFSAAYVPSSPGPGEYNPPYPGYIIYSSTVRPPFSQGSPTTIS
                     WERNFEKFICENDAKSHKWDEFVWDHPLRLLMRRVNPYPLMTFNSYAVRSPSPSDSRS
                     SDAIPSKSPPRSSHVFSKVKSTNILGVFGLSVRTTERDLQDEFSRHGEIEKVVIVYDQ
                     RTGRSRGFGFITMRSIEDATQCINKLNGFTIHGRNIRVDYSATPKPHDPTPGQYLGPK
                     TTTISDERLLSRCGRYDDFLEMDGSLHGASHLAVAEMLLTNRGVVIPVDINKFASWNY
                     Q"
     gene            <1041990..1043345
                     /locus_tag="CNA03880"
                     /db_xref="GeneID:3253412"
     mRNA            join(<1041990..1042028,1042133..1042231,1042305..1042324,
                     1042396..1042409,1042475..1042544,1042609..1042782,
                     1042829..1043345)
                     /locus_tag="CNA03880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566729.1"
                     /db_xref="GI:58258632"
                     /db_xref="GeneID:3253412"
     CDS             join(1041990..1042028,1042133..1042231,1042305..1042324,
                     1042396..1042409,1042475..1042544,1042609..1042782,
                     1042829..1042835)
                     /locus_tag="CNA03880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566729.1"
                     /db_xref="GI:58258633"
                     /db_xref="GeneID:3253412"
                     /translation="MSPTSQALNMLIFVTNEVIQQCREGLKNVDIGIFTLHCLHTSAG
                     LTLNENCDRTVRTDMDMALDTIVPESLPWEHTDEGPDDSVSHLKTSLIGNSITVPISK
                     GKLVLGTWQGIYLAEFRHNGAGWGGQGQGRKVVATILP"
     gene            complement(1042800..1044686)
                     /locus_tag="CNA03890"
                     /db_xref="GeneID:3253410"
     mRNA            complement(join(1042800..1043210,1043264..1043432,
                     1043496..1043595,1043649..1043880,1043950..1044050,
                     1044104..1044270,1044328..1044392,1044446..1044686))
                     /locus_tag="CNA03890"
                     /product="cell division cycle protein 91, putative"
                     /transcript_id="XM_566731.1"
                     /db_xref="GI:58258636"
                     /db_xref="GeneID:3253410"
     CDS             complement(join(1042894..1043210,1043264..1043432,
                     1043496..1043595,1043649..1043880,1043950..1044050,
                     1044104..1044270,1044328..1044392,1044446..1044605))
                     /locus_tag="CNA03890"
                     /codon_start=1
                     /product="cell division cycle protein 91"
                     /protein_id="XP_566731.1"
                     /db_xref="GI:58258637"
                     /db_xref="GeneID:3253410"
                     /translation="MSYLERLCSHKISHSEVYIVGAVLRMALFSLPEVVIALQRRPEL
                     STPLTSFRSIQEGVFIYEHGTSPYSGGTFYHSPIYLVLFSHVIPISSICLTAAFWTLA
                     DLWGAWSLVKISQARNQKRCARDALVAAVYLLNPYSLLTCIARSTTTLDNAVLLGALS
                     AAAAGKTTFSLISLAVAVHTSFYPIILLPPIVILLGKINTEQPKKSLVLQSLLLFAAL
                     TIAIGVFNFVILGDNWIWKSLGTSLEVTNLTPNVGMWWYFFTEMFDHFRTFFLGVFQL
                     HTVIYIAPICIRMVDRPLDAILLLLAIFVTWKSFPALGDMGLCAGLIGCFPDILANLR
                     HPLFSLTVHLYTSILLPLLHSLWLLTGTGNANFFYAATMVYGLNASLIIVDMLGASMR
                     VEVKKRVALEGADDQSGTQDKKECTDDVCENWEARKWHVVQFTK"
     gene            complement(1045041..1050278)
                     /locus_tag="CNA03900"
                     /db_xref="GeneID:3253408"
     mRNA            complement(join(1045041..1045352,1045403..1046250,
                     1046303..1048066,1048122..1048817,1048871..1049559,
                     1049614..1049911,1050047..1050278))
                     /locus_tag="CNA03900"
                     /product="eukaryotic initiation factor 4F subunit P130,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534037|gb|CF679878.1,gi|41534045|gb|CF679886.1,
                     gi|41535417|gb|CF681258.1,gi|41535426|gb|CF681267.1,
                     gi|41539095|gb|CF684936.1,gi|41539908|gb|CF685749.1,
                     gi|41543400|gb|CF689241.1,gi|41543408|gb|CF689249.1,
                     gi|41554759|gb|CF700600.1,gi|41554761|gb|CF700602.1,
                     gi|41558603|gb|CF704444.1,gi|41558607|gb|CF704448.1,
                     gi|41561907|gb|CF707748.1,gi|41561916|gb|CF707757.1,
                     gi|41576601|gb|CF722442.1"
                     /transcript_id="XM_566733.1"
                     /db_xref="GI:58258640"
                     /db_xref="GeneID:3253408"
     CDS             complement(join(1045136..1045352,1045403..1046250,
                     1046303..1048066,1048122..1048817,1048871..1049559,
                     1049614..1049884))
                     /locus_tag="CNA03900"
                     /codon_start=1
                     /product="eukaryotic initiation factor 4F subunit P130"
                     /protein_id="XP_566733.1"
                     /db_xref="GI:58258641"
                     /db_xref="GeneID:3253408"
                     /translation="MSQNTSPTVNGDNKTSAPGSIASVWARGPPSAVSSTSASKNQSG
                     VNTPSQEGAGLPNITSVSSSAAISIRNAHSRQNSLLVGPGGVDIKKGNIAFGTVDSPN
                     TALSSSPAAPSTTGGHLADAVKSFGSIDADGNSDPDVVKTRRTSSLSNPIGPVQEKKL
                     SVHSLFTSKAPAQAPLGSSPSRPAMSPPQPHQQPIPHIRRQSMGQGGPGFQSQVPVGS
                     PSFTSGPPMRPPMVMPNQPRSPVANPNVPHGQYAPMPPLHVQQGFRPPQQGMGTQQPP
                     VRPNGMGTQGMARPMMGPGQYGMHPGPQGPQYPVMGYPPQGGFYPGYGPYDQQPHYGS
                     PQWAQQQQNQSFNANFGPGPMSPRSGPSQISSAPSQSPLPPQGVPLGSGGPSPIPTPP
                     NRPPNLMAGHQHSASIPATPIPSTPSRPMQANVPPPFLSGAASVFTPRGASKAVKIAR
                     EDGTAVNMKEVAEAASKAVSSGAHTPESAAQPSKDDAPRRKPGLPVIVRLESEEQKKK
                     RVAEEEREAKLKFMEEKEEQERRERLEKKIKEDEERQAKEAAEKAEAEKKAKEEEEKK
                     KLDEAYAAEALAAKKLAEEKEATAKAAKEQTEAAEREKLAAHAATQEARDKAEEQRRE
                     LLSTPVTPAAVSPVESPALGAGLPAKPVAAISGAMKTLPTAPELASTSVATINETPSA
                     SASALSSARPINDLSSITYPATLKSPDPRLNVDAEPGKFRYDREFLMQFMAVCREKPD
                     TLPPLEDIGLEVDGGSGFGGRSSRGGSRASMGPSSRSAPGGAGLGISGSNRSAFPGQG
                     MGQFGSMGQFGSGAGPIRSTSEQRYRASLSNRTPSSLSGLPSLGISGSRTGANRGSQR
                     GSKRAPQSSQVPTSATAPIPISENAWTRTRLGGDAQGTPAYIERKVKALLNKLTEEKF
                     DPISLQILEWANKSANETDGLTLKLVIKLIFEKATDEAHWSAMYAKLCKLLHDEISPE
                     VSDTIDGKPVAGRALFRRYLLGRCQVDFEAGWKAREDTAVAAAAKKEEDGAKQEEAKD
                     DKDKEAVLMSDEYYAAQKAKRRGLGLVQLIGELFKREMISNRVIKECLLKLLSNTTDP
                     DEEDIESACKLLTTIGAAYDRVAPENLSKAFDMLSKMMQVESLSSRIKFMIMDVFDLR
                     RNGWKSKKNQTSVMTIAQIHEQNAKEKSAASTAVSKESISRGGSRSGRDRHEGSQPGE
                     WQSVSAGPRSLNRPTDFSNMGRNISSGGTAPSFGPTSIFNTRKGKAGTPTNVTPPMSR
                     QPSSANMFSALNDTQENELVSAERRTSTDNGESAPQRKRLNLAPRTKPVEGEGENKDE
                     GAEEEPHGDRVDEHDLSEEEARAKIDLDMKELWGEKDQGGSRNPEDIADYFSALPVSR
                     RPLLAERLLNDIFRISRLKDAEIVAKGWKTALLQQSVSADVLRQSLEHRMPTLDDESI
                     DFPSAYEAIALLVRNVSLSQEDINAMVGRIEVEGTPRITPPQKMEKALRKVDEAGSLA
                     "
     STS             1046582..1047437
                     /standard_name="Xho10"
                     /db_xref="UniSTS:470889"
     misc_feature    1048121..1048264
                     /note="CT-rich"
     gene            1050504..>1052323
                     /locus_tag="CNA03910"
                     /db_xref="GeneID:3253406"
     mRNA            join(1050504..1051581,1051636..>1052323)
                     /locus_tag="CNA03910"
                     /product="mitochondrion protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41554559|gb|CF700400.1,gi|41563093|gb|CF708934.1"
                     /transcript_id="XM_566735.1"
                     /db_xref="GI:58258644"
                     /db_xref="GeneID:3253406"
     CDS             join(1050542..1051581,1051636..1052323)
                     /locus_tag="CNA03910"
                     /codon_start=1
                     /product="mitochondrion protein"
                     /protein_id="XP_566735.1"
                     /db_xref="GI:58258645"
                     /db_xref="GeneID:3253406"
                     /translation="MSLRLFLSRVPPSQQLPSKLLPQLSLRRAQSSSSDSRPPHPAVQ
                     QSFEALASDLLATPSTLSSSGLKRSAPEAPRTFIKSPSLPPVQLSRNPYAGQYAISED
                     DLDDPFETEIAVEEPKGLAVPPRRRRLAGRQSSATARPQRIINLSPHDTVSVYPDFIS
                     LTSHGRTGVITNARLLDACHCKKCRDPSTRQMNTTTGEAVRESKIARITRGNSVRKGG
                     IRKDGLVVSWGEGVKHMSFFPLHRLRSMLERDMGTVYRSPSFVHQTWDGESLSLTNLR
                     FQYSDLSESLLKVLEQLQVYGIVVIEGVPTDPTDDKECMLRKVTDMIGKIRNTFYGET
                     WDVKSVKQSKNIAYTNLNLGLHMDLLYFSSPPRFQALHCLRNKVEGGSSYFVDSFRTV
                     SDLPRDQFEFLQKINITYQYDNDNHYFRYRHPIISSDFVRGRNNRHAAVNWSPPFRAA
                     AEALDFPQHDFVAAAKHEQKVLQAIADFEERLSDPRYRYEFTMQEGDLVLFDNRRVLH
                     ARTAFRDKKDMEVEEEERVEQKSEMESDKEPTRWLKGCYLDGEAVWDKLATLRKQSLE
                     RRAASVGVQ"
     gene            1052585..1052656
                     /locus_tag="CNA03920"
                     /db_xref="GeneID:3253962"
     tRNA            1052585..1052656
                     /locus_tag="CNA03920"
                     /product="tRNA-Gly"
                     /codon_recognized="GGA"
                     /db_xref="GeneID:3253962"
     gene            complement(1052956..1055334)
                     /locus_tag="CNA03930"
                     /db_xref="GeneID:3253404"
     mRNA            complement(join(1052956..1053375,1053449..1053514,
                     1053610..1055334))
                     /locus_tag="CNA03930"
                     /product="RING zinc finger protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539530|gb|CF685371.1,gi|41539538|gb|CF685379.1,
                     gi|41560979|gb|CF706820.1,gi|41560988|gb|CF706829.1,
                     gi|41564038|gb|CF709879.1,gi|41564047|gb|CF709888.1,
                     gi|41566611|gb|CF712452.1,gi|41566617|gb|CF712458.1"
                     /transcript_id="XM_566737.1"
                     /db_xref="GI:58258648"
                     /db_xref="GeneID:3253404"
     CDS             complement(join(1053244..1053375,1053449..1053514,
                     1053610..1055325))
                     /locus_tag="CNA03930"
                     /codon_start=1
                     /product="RING zinc finger protein"
                     /protein_id="XP_566737.1"
                     /db_xref="GI:58258649"
                     /db_xref="GeneID:3253404"
                     /translation="MQAASPAPGPRATPPVLSPPPAALPLPLSIPHTLCQLPSPGSPL
                     GPAPAPPADAFTPSSASSPGRRSVYDDLQHYNPVPPFVDHTEDEMLREDYNRLRARRT
                     SSNLSSSPAATNSPSSLSMQRRSLGDSGQRLPPDFVPSPVPPHLNPVPPYLDYIEDEM
                     LRDDHVRVRSSARGSSIGPFPSEHVPPAFPTNNIGPSHASSPSPSSASIISPSSRHQL
                     AGSEEPNDRWSRDRLADLRRAMLASQSHDNRPSPWVQAWGRAPDEPLNAEVNDRYWDA
                     EYPAEYIERPSQRSSSSSLRPSPATTHMGGRGRQALNRDINETVGRRLGSLRPIQMAN
                     PSFPLETSTNTLRRREVPHGPQEGRAAAPPPAEGNLWGELERDSRSSSSFSESAPPSA
                     DGDSGTTTPTQESVFRAYGSSNHGEDEDGDFDENDEDDDEDYDDENENGDSEMLNPDI
                     MREVYNLLTARPVPPMAMFSGPGMAEPIELIHAHVHSHVSSFGRVFRQRPPRQSLEEL
                     RLSPQMDDNTVQKTLMSAVKGLKYLSDGKKRRMAMGMLENITWAEFGEREGMVRDEYC
                     SVCHDEYEDTTEISITPCKHMYHKDCLSTWLNTPKISSCPMCRRDLALLAAFANMTSS
                     KTVNEAIPYWYRV"
     repeat_region   1053995..1054087
                     /rpt_type=tandem
                     /rpt_unit_seq="tcg"
                     /satellite="microsatellite"
     repeat_region   1055173..1055360
                     /rpt_type=tandem
                     /rpt_unit_seq="cgggg"
                     /satellite="microsatellite"
     gene            <1055485..>1058658
                     /locus_tag="CNA03940"
                     /db_xref="GeneID:3253402"
     mRNA            join(<1055485..1055562,1055600..1055881,1055931..1056039,
                     1056098..1056669,1056938..1058071,1058185..>1058658)
                     /locus_tag="CNA03940"
                     /product="kinase, putative"
                     /transcript_id="XM_566739.1"
                     /db_xref="GI:58258652"
                     /db_xref="GeneID:3253402"
     CDS             join(1055485..1055562,1055600..1055881,1055931..1056039,
                     1056098..1056669,1056938..1058071,1058185..1058658)
                     /locus_tag="CNA03940"
                     /codon_start=1
                     /product="kinase"
                     /protein_id="XP_566739.1"
                     /db_xref="GI:58258653"
                     /db_xref="GeneID:3253402"
                     /translation="MPPSEGRYLAALPAQHKDAAPDTLYQKLEIVGKGAYGAVYRGKH
                     IATGHIVALKIINLDTEDDDVADIQKEISLLQQLMLGGSNSGGPPPNVIKYYGSLMQG
                     PRVWIIMEYAEGGSIRTLSRAQPLKELHICLVIREVLLALAFLHKNGVIHRDIKAANI
                     LLTTQPHRILLCDFGVAALLQSSTSKRSTFVGTPYWMAPEVVTEGRMYDAKADIWSLG
                     ITLLEMAYGEPPMSGQPAARAVMLLGDKRMRAPRLEGDHWSKEMRDFVVGCLNEEPAD
                     RLSAEELSKSKWIKQQSKTPLTAMNDLIARYQAWKESGGQRQSLAAGVGANVDDDDDD
                     FDRHPADGDWAFDSFAHQQPPTPQTTEGSDTIKQTGRFPSPEQEDLPPLVDTDSPPAT
                     PGKNELDGQTIRQARLGRDGRSPTPLMITTGYSPSPSSNTLSAASTATYYPIETPQEH
                     TPIARTDAGVPSPRRIRNKISLDNLSLTPTSKTQPAAEERSKSSGGMRRPSASDAREG
                     LRGFQFPLMTKSGPGPTPITTASMSTSTNTPTSTQPPAAGKLFPPPLNRNHSAAPAYP
                     FADPTTTSTTTTTSPTGTSSPGFGGLAFGPRPPMMRQASVAVMEGRAASQSQSQAQAQ
                     ALALALAHTQTHQQQQQQQQQQQQQQGSTSPPTPKKAVALGAPNSIGLGRPGVSAAAA
                     AAAAAAASATAAGGGGGQGMMIRSRSGSKAEDGHPVGLRDLLKLSPAVPDMPDLLPPS
                     PSVANTPHKFFPSPSPLAQTTHAHAEPSAASAASASATASAAFSFPTLASAPMSAAPS
                     QRSLLPAGTIPASAPPGLATQPNAFAPVHATMGPPIRPLDLSMLESDDVFDELGRMVD
                     DMQSWFGCVESGLEELLATGVDVQNA"
     repeat_region   1057805..1057845
                     /rpt_type=tandem
                     /rpt_unit_seq="cag"
                     /satellite="microsatellite"
     STS             1057871..1058159
                     /locus_tag="CNA03940"
                     /standard_name="CTG17"
                     /db_xref="UniSTS:470890"
     repeat_region   1057929..1057977
                     /rpt_type=tandem
                     /rpt_unit_seq="cag"
                     /satellite="microsatellite"
     gene            complement(<1058812..>1061603)
                     /locus_tag="CNA03950"
                     /db_xref="GeneID:3253400"
     mRNA            complement(join(<1058812..1060216,1060263..1061513,
                     1061563..>1061603))
                     /locus_tag="CNA03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_566741.1"
                     /db_xref="GI:58258656"
                     /db_xref="GeneID:3253400"
     CDS             complement(join(1058812..1060216,1060263..1061513,
                     1061563..1061603))
                     /locus_tag="CNA03950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566741.1"
                     /db_xref="GI:58258657"
                     /db_xref="GeneID:3253400"
                     /translation="MSPSTTYQKARLSLAMLGLNGLPLDEYLSQLPRLPDTPKDSKRI
                     DDIPEGIVSHSISQYSTPDLPTSESQVEVDKGSRDSLRVPGSRVKVDSPLEKHPIILN
                     SSIEEVGDSSISPDALHVGPHYEKVTCDQSTSQSPFASTLIEQSVNPQAAPAPRLSAS
                     FRLPNMGDISLIGECSLFGGASSVGDDSLEYELSDIRPKRDTINRSTSDPFMMKRQRD
                     INPASQHLGQSTLLPTSPAKQAHLLASTNSLHRVEPPWCGNDSTMTTSSNGSNDTVTE
                     SRSASPTRSSTVKAQSLPRSNALRGFPTSKTRRTFPASSSGNSLAAVGEEESELLINL
                     DKSTLLPISPQKTAYLLRDEEMIARETLDEGPSYMLTIPPATISRAAAGCIGHDGDRT
                     MDVRDLMAKVGKPKRASGTEESFVDLLHAEDDMFAKMDMTMLGADETMVMPATLRPRQ
                     ASPSKIVAQAQATTKATLPTSRTSHTLSILDDNQAQEQKPITLSRSKSLSKVAEIIQR
                     VKADKLAAASASRLGSPPKTASVARTYKTSSTSTATPAAPRVRGKVAPHTTGSRRISL
                     SAGGVPISCSASQKSIDLPRPRPTHARPISTHSTLSSANQNVSARQTITAAPTETCAA
                     RIVNRNPQATLTARVPRASIVPSSRTEVKNRSGSVSSSVSTAATVSRAPNSRPSIAAP
                     RTITRSHTTEGLSAAGARVPRASVAASSRPAGLPLPGTGPTARSATANTPASTATRAR
                     LSRAFGSDATSATNRLSRPATSTLASATSKTLKLSSGPSVISARSSATSTDRLKSRAL
                     STPASAGTRQSTLPISRALPTPRSATDAARNSSKPPATTIDLPKARVGSTLRRPSTSR
                     VPAGGPGKNSAPPGSGSNLAALRSRLDELQAKQKERSAARCL"
     gene            complement(1062299..1065175)
                     /locus_tag="CNA03960"
                     /db_xref="GeneID:3253802"
     mRNA            complement(join(1062299..1062815,1062868..1063384,
                     1063434..1063526,1063583..1063958,1064010..1064146,
                     1064192..1064600,1064653..1064682,1064743..1065175))
                     /locus_tag="CNA03960"
                     /product="glyoxal oxidase precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529947|gb|CF675788.1,gi|41529951|gb|CF675792.1,
                     gi|41532568|gb|CF678409.1,gi|41532582|gb|CF678423.1,
                     gi|41533313|gb|CF679154.1,gi|41535892|gb|CF681733.1,
                     gi|41535899|gb|CF681740.1,gi|41536223|gb|CF682064.1,
                     gi|41536533|gb|CF682374.1,gi|41536539|gb|CF682380.1,
                     gi|41537322|gb|CF683163.1,gi|41537331|gb|CF683172.1,
                     gi|41537557|gb|CF683398.1,gi|41537562|gb|CF683403.1,
                     gi|41537784|gb|CF683625.1,gi|41537792|gb|CF683633.1,
                     gi|41541715|gb|CF687556.1,gi|41541721|gb|CF687562.1,
                     gi|41544394|gb|CF690235.1,gi|41544405|gb|CF690246.1,
                     gi|41544981|gb|CF690822.1,gi|41544985|gb|CF690826.1,
                     gi|41545636|gb|CF691477.1,gi|41545640|gb|CF691481.1,
                     gi|41553598|gb|CF699439.1,gi|41553606|gb|CF699447.1,
                     gi|41553864|gb|CF699705.1,gi|41553872|gb|CF699713.1,
                     gi|41554105|gb|CF699946.1,gi|41554115|gb|CF699956.1,
                     gi|41555190|gb|CF701031.1,gi|41555199|gb|CF701040.1,
                     gi|41556469|gb|CF702310.1,gi|41557942|gb|CF703783.1,
                     gi|41557952|gb|CF703793.1,gi|41559837|gb|CF705678.1,
                     gi|41559842|gb|CF705683.1,gi|41562283|gb|CF708124.1,
                     gi|415"
                     /transcript_id="XM_567162.1"
                     /db_xref="GI:58259498"
                     /db_xref="GeneID:3253802"
     CDS             complement(join(1062558..1062815,1062868..1063384,
                     1063434..1063526,1063583..1063958,1064010..1064146,
                     1064192..1064600,1064653..1064682,1064743..1064917))
                     /locus_tag="CNA03960"
                     /codon_start=1
                     /product="glyoxal oxidase precursor"
                     /protein_id="XP_567162.1"
                     /db_xref="GI:58259499"
                     /db_xref="GeneID:3253802"
                     /translation="MYSAILLSLLPLLAAAHGGPSRNLPNRAFSQQQVRDGVTPGGYQ
                     IVGDSGVSAQMLFLGTETTAYILDKAENNSLQVTNDDGLTHPAWGTSYDLTTNKATAM
                     QVSSNTFCAAGLSMATGEWAVFGGNQPVTYGGVATKDNPSIPNDFMDTDGGAAIRLLT
                     PCDDGSCKWQEGGDELTMTSKRWYPTVELLGDGSLIVLGGDGNGGYVSTFAQNNPTYE
                     FYPKTDNQSHYMDFLNYTVPVNLFPLTWLMPGGKLFMQAAYKTILYDLDAQQETPLPD
                     MPYAVRVYPASAATALLPLTPANNYSATVLFCGGSAANFNLSSDGGAQFNVTAVPADN
                     TCVRISPEDEKPTYEDDDYMLEGRSMGQFIFMPDGKMWMGNGVAMGTAGYGDEGYSIG
                     QSYGQEPLYQPAIYDPSAPAGSRWSREGLGMSTQERMYHSSAILLADSSILVSGSNPN
                     KDATSEKWPTSYSVEQWYPLWYNEQRPEPSSSWPSSLSYGGEYFNVSYTPSNSSSNSD
                     NTKVVVIRTGFSTHAMNMGQRYLELNSTYTKDEASGEVTLYVSQMPPNANIFQPGPAM
                     IFLVVDGIPSQGKIIMVGSGKIETQPISEVAVLPATSVIPAQTNSSSSDNAAGTSTTS
                     SGSSQGTSASQNVDSGATAGLRARFATVFGSAVVGLALLL"
     gene            complement(1065436..1067792)
                     /locus_tag="CNA03970"
                     /db_xref="GeneID:3253817"
     mRNA            complement(join(1065436..1066334,1066385..1066440,
                     1066487..1066555,1066604..1066671,1066729..1066804,
                     1066854..1067140,1067188..1067278,1067327..1067450,
                     1067612..1067792))
                     /locus_tag="CNA03970"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41575329|gb|CF721170.1,gi|41575345|gb|CF721186.1"
                     /transcript_id="XM_567161.1"
                     /db_xref="GI:58259496"
                     /db_xref="GeneID:3253817"
     CDS             complement(join(1066202..1066334,1066385..1066440,
                     1066487..1066555,1066604..1066671,1066729..1066804,
                     1066854..1067140,1067188..1067278,1067327..1067450,
                     1067612..1067637))
                     /locus_tag="CNA03970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567161.1"
                     /db_xref="GI:58259497"
                     /db_xref="GeneID:3253817"
                     /translation="MSLSSDLDKQIEQLKRCETIPESAVKELCTKAKEILMEEGNVQY
                     VDSPVTICGDIHGQFFDLMELFKIGGFCPETNYIFMGDFVDRGFYSVETFLLLLLLKV
                     RYPDRITLIRGNHESRQITQVYGFYDECQRKYGSSNVWRYCCDVFDYLSLGCVVDGRV
                     FCVHGGLSPAVHRLDQIRVIDRRQEVPHEGPMCDLLWSDPDEEIQGWGMSPRGAGFLF
                     GRDVVEQFNHANDIELVARAHQLVMEGYKLMFDRRIVTVWSAPNYCYRCGNTASVLEL
                     DENLRQEYKTFDAAPPDARSIPQKRPMTHEYFL"
     gene            <1067534..>1067899
                     /locus_tag="CNA03980"
                     /db_xref="GeneID:3253398"
     mRNA            join(<1067534..1067650,1067807..>1067899)
                     /locus_tag="CNA03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_566743.1"
                     /db_xref="GI:58258660"
                     /db_xref="GeneID:3253398"
     CDS             join(1067534..1067650,1067807..1067899)
                     /locus_tag="CNA03980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566743.1"
                     /db_xref="GI:58258661"
                     /db_xref="GeneID:3253398"
                     /translation="MKMWEMKGTYQLYAYVKSYLESLRTHLSRSDDRDIIVNKIYSMD
                     GEYRFVMLWVMLVVGGEPSLRGTLE"
     gene            1068187..1069848
                     /locus_tag="CNA03990"
                     /db_xref="GeneID:3253397"
     mRNA            join(1068187..1068526,1068580..1069002,1069061..1069429,
                     1069478..1069848)
                     /locus_tag="CNA03990"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534264|gb|CF680105.1,gi|41543739|gb|CF689580.1,
                     gi|41543743|gb|CF689584.1,gi|41547172|gb|CF693013.1,
                     gi|41547180|gb|CF693021.1,gi|41550608|gb|CF696449.1,
                     gi|41550614|gb|CF696455.1"
                     /transcript_id="XM_566744.1"
                     /db_xref="GI:58258662"
                     /db_xref="GeneID:3253397"
     CDS             join(1068284..1068526,1068580..1069002,1069061..1069429,
                     1069478..1069537)
                     /locus_tag="CNA03990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566744.1"
                     /db_xref="GI:58258663"
                     /db_xref="GeneID:3253397"
                     /translation="MLLRSSHRHLLRTAFTISRSKPLHKPILPSSTMSQGVGYSSLTE
                     QVTSAAAAASRTVSDLVNKYTVHDIAKTGFGEGTNDFYNAARPSYPAGALQVIHSSLP
                     SHPLKIVEPGSGTGIFSRLLLAPPNPTYPSFSIDTLVAVEPSEGMRNSWWKALEKAGL
                     GKREENEGGKGEKKVGTVDGGFDSFGGAREYGVTEVQNGQGGVDGVVIAQAWHWCPDY
                     DKALREIAAYLRPNAPLILIWNLEANNPQWQADLREAYQGYDLGSPQYYKGLWRKMFE
                     TPAYKELFDSSEEHTIPWSVGITEDGMLDRLFSKSYLTEQHLNGERREEFIRKIRDIV
                     RQAPHEWIDKEKGTFKYDYNTDIVICRRKA"
     gene            complement(1069598..>1072800)
                     /locus_tag="CNA04000"
                     /db_xref="GeneID:3253396"
     mRNA            complement(join(1069598..1070028,1070082..1070147,
                     1070197..1071044,1071094..1071170,1071210..1071311,
                     1071364..1071499,1071549..1071669,1071726..1071814,
                     1071860..1071868,1071918..1072279,1072364..1072469,
                     1072530..>1072800))
                     /locus_tag="CNA04000"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550573|gb|CF696414.1,gi|41550580|gb|CF696421.1,
                     gi|41557191|gb|CF703032.1,gi|41567626|gb|CF713467.1,
                     gi|41567637|gb|CF713478.1"
                     /transcript_id="XM_566746.1"
                     /db_xref="GI:58258666"
                     /db_xref="GeneID:3253396"
     mRNA            complement(join(1069598..1070028,1070082..1070147,
                     1070197..1071044,1071094..1071170,1071210..1071311,
                     1071364..1071499,1071549..1071669,1071726..1071868,
                     1071918..1072279,1072364..1072469,1072530..>1072800))
                     /locus_tag="CNA04000"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545818|gb|CF691659.1"
                     /transcript_id="XM_566745.1"
                     /db_xref="GI:58258664"
                     /db_xref="GeneID:3253396"
     CDS             complement(join(1069816..1070028,1070082..1070147,
                     1070197..1071044,1071094..1071170,1071210..1071311,
                     1071364..1071499,1071549..1071669,1071726..1071814,
                     1071860..1071868,1071918..1072279,1072364..1072469,
                     1072530..1072800))
                     /locus_tag="CNA04000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566746.1"
                     /db_xref="GI:58258667"
                     /db_xref="GeneID:3253396"
                     /translation="MNLQGVNVLGYFLTRGASSISSIYTSRHIPLPSPYPSSMSTPAM
                     ATHAPQTNPTPAIVSEKVPLNTQALPKIVFAGRTGRILCVADIRGDYHELNRLIREHD
                     ATAVIHTGDFGFMTAESVDRMNDKILRHLIQYSPLLPPAARTQLLAIPLSAGRSALIN
                     QLNNSSVHFPLSQFPHLLSGAINFPVPVFTTWGLVEDVNVIEKFRTGEYGVQNLAILD
                     EATSRLVEVGGVKLRLLGLGGTVADHKLFDYGEGHGSIAGAQGTMWTTALQIGELIDT
                     AQRTFNPDETRLFVSTTPTSRNGLMTLVSNAIKADLTISCGLHFRYPVSYNEYSIHPD
                     FESYRRKMQRAKDDFKGLFDQVRDRVFGSLDDKQTALLHKTLSAIENVPIADDGMWAN
                     TWHWSLSIRDAGFGNMLLSITDSRVSAETKSSGVNFAHRTGKGPAPPTGSTISSAPSG
                     LNSVKSLSSRPGPGPIGARPLPAQGVPSASGPHGAHGAPGAFLSQGRAPVRPGMGPGF
                     SARPPPGPRNTRQFGSNPASSMGGLSQSQMFAQAQAQAAVSGKTAAAASLTNGKKDEK
                     NEKPEGEKGMNVEEKKEKLAANGNAAPDKIKDTDEKEEKDAKPIEKNEDKEKSQDENP
                     WGEDKEEKKGSNPWADDISDEGEKKDEDKTEFTEDAKPKRYSLYIKGLPTPTTEEELK
                     AVVGESGQKAIQVKIIFDQFTKQQKDFGYLDFDSEEVMNEALKASTGTIRDTPVNVSI
                     SKPTVPRYNNRQFGGPGGRGRGGFRGRGRGFGSAGPRRERGEREGSGSGNATAGGEKK
                     A"
     CDS             complement(join(1069816..1070028,1070082..1070147,
                     1070197..1071044,1071094..1071170,1071210..1071311,
                     1071364..1071499,1071549..1071669,1071726..1071868,
                     1071918..1072279,1072364..1072469,1072530..1072800))
                     /locus_tag="CNA04000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566745.1"
                     /db_xref="GI:58258665"
                     /db_xref="GeneID:3253396"
                     /translation="MNLQGVNVLGYFLTRGASSISSIYTSRHIPLPSPYPSSMSTPAM
                     ATHAPQTNPTPAIVSEKVPLNTQALPKIVFAGRTGRILCVADIRGDYHELNRLIREHD
                     ATAVIHTGDFGFMTAESVDRMNDKILRHLIQYSPLLPPAARTQLLAIPLSAGRSALIN
                     QLNNSSVHFPLSQFPHLLSGAINFPVPVFTTWGLVEDVNVIEKFRTGEYGVQNLAILD
                     EATSRLVEVGGVKLRLLGLGGTVADHKLFDYGAFYSKISKTTEQLPGEGHGSIAGAQG
                     TMWTTALQIGELIDTAQRTFNPDETRLFVSTTPTSRNGLMTLVSNAIKADLTISCGLH
                     FRYPVSYNEYSIHPDFESYRRKMQRAKDDFKGLFDQVRDRVFGSLDDKQTALLHKTLS
                     AIENVPIADDGMWANTWHWSLSIRDAGFGNMLLSITDSRVSAETKSSGVNFAHRTGKG
                     PAPPTGSTISSAPSGLNSVKSLSSRPGPGPIGARPLPAQGVPSASGPHGAHGAPGAFL
                     SQGRAPVRPGMGPGFSARPPPGPRNTRQFGSNPASSMGGLSQSQMFAQAQAQAAVSGK
                     TAAAASLTNGKKDEKNEKPEGEKGMNVEEKKEKLAANGNAAPDKIKDTDEKEEKDAKP
                     IEKNEDKEKSQDENPWGEDKEEKKGSNPWADDISDEGEKKDEDKTEFTEDAKPKRYSL
                     YIKGLPTPTTEEELKAVVGESGQKAIQVKIIFDQFTKQQKDFGYLDFDSEEVMNEALK
                     ASTGTIRDTPVNVSISKPTVPRYNNRQFGGPGGRGRGGFRGRGRGFGSAGPRRERGER
                     EGSGSGNATAGGEKKA"
     gene            1072904..1074700
                     /locus_tag="CNA04010"
                     /db_xref="GeneID:3253395"
     mRNA            join(1072904..1072937,1072998..1073828,1073876..1073978,
                     1074032..1074213,1074260..1074323,1074378..1074538,
                     1074586..1074700)
                     /locus_tag="CNA04010"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541650|gb|CF687491.1,gi|41541663|gb|CF687504.1,
                     gi|41550083|gb|CF695924.1,gi|41550093|gb|CF695934.1,
                     gi|41566808|gb|CF712649.1,gi|41566812|gb|CF712653.1,
                     gi|41567921|gb|CF713762.1,gi|41567929|gb|CF713770.1,
                     gi|41573807|gb|CF719648.1,gi|41573811|gb|CF719652.1"
                     /transcript_id="XM_566747.1"
                     /db_xref="GI:58258668"
                     /db_xref="GeneID:3253395"
     CDS             join(1072924..1072937,1072998..1073828,1073876..1073978,
                     1074032..1074213,1074260..1074323,1074378..1074538,
                     1074586..1074664)
                     /locus_tag="CNA04010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566747.1"
                     /db_xref="GI:58258669"
                     /db_xref="GeneID:3253395"
                     /translation="MSFGGFKFGNSSTTAPATGSAPTTSSPFSFGNTSTSNAQPAAGA
                     SNTGGGMFGGFGQNQQQQPQQPAGGGSSLFGSFGAKPAAPAAGTTGTGGGLFGGASGQ
                     QQQPPSGGGGLFGSTTQPQQQAQQSGSGLFGSTTQPQQQQQQTGGLFGSTMQPAQQSS
                     GLFGSTVQKPAGSGLFGSTTQPTQQSTGIGLFGSTAQTAQQPASTGLFGSTTQQQQPS
                     TSLFGQSTAQLGGSSLFGQTTQPPQNQQQELKTSANPGANTGADKTTKFSDLPEAAQK
                     YIEQLDTAIKNQKSIASTLQTEPLGRAIWQTSLDVKSATEEYSSISHTLKSLKNSISQ
                     LRDKMIDQSRDVERIKEIWDIYTSGEGRMGQIRLGAYKEFPHEFFSKVANSMEERVTR
                     YKKTITQLNRVVASLSSDSQTSSPQVIAQTINNHQQAILALAAQLDQLQVRMNGLKAE
                     FTADWRDKTGSVRDPFEMAREERNVKV"
     gene            complement(1076587..1078981)
                     /locus_tag="CNA04020"
                     /db_xref="GeneID:3253394"
     mRNA            complement(join(1076587..1077780,1077831..1077998,
                     1078047..1078314,1078372..1078670,1078738..1078981))
                     /locus_tag="CNA04020"
                     /product="nucleus protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532810|gb|CF678651.1,gi|41532819|gb|CF678660.1,
                     gi|41534870|gb|CF680711.1,gi|41534884|gb|CF680725.1,
                     gi|41535026|gb|CF680867.1,gi|41543688|gb|CF689529.1,
                     gi|41543697|gb|CF689538.1,gi|41545802|gb|CF691643.1,
                     gi|41545811|gb|CF691652.1,gi|41547931|gb|CF693772.1,
                     gi|41547938|gb|CF693779.1,gi|41549664|gb|CF695505.1,
                     gi|41551226|gb|CF697067.1,gi|41551236|gb|CF697077.1,
                     gi|41553334|gb|CF699175.1,gi|41553348|gb|CF699189.1,
                     gi|41558448|gb|CF704289.1,gi|41558450|gb|CF704291.1,
                     gi|41559363|gb|CF705204.1,gi|41559369|gb|CF705210.1,
                     gi|41562368|gb|CF708209.1,gi|41562374|gb|CF708215.1,
                     gi|41566553|gb|CF712394.1,gi|41566565|gb|CF712406.1,
                     gi|41566774|gb|CF712615.1,gi|41566781|gb|CF712622.1,
                     gi|41567611|gb|CF713452.1,gi|41567926|gb|CF713767.1,
                     gi|41567932|gb|CF713773.1,gi|41569354|gb|CF715195.1,
                     gi|41569360|gb|CF715201.1"
                     /transcript_id="XM_566748.1"
                     /db_xref="GI:58258670"
                     /db_xref="GeneID:3253394"
     CDS             complement(join(1076680..1077780,1077831..1077998,
                     1078047..1078314,1078372..1078670,1078738..1078938))
                     /locus_tag="CNA04020"
                     /codon_start=1
                     /product="nucleus protein"
                     /protein_id="XP_566748.1"
                     /db_xref="GI:58258671"
                     /db_xref="GeneID:3253394"
                     /translation="MPAAVRERSPSSPSGRAAKKSRNNTEHAVLSSINHPSAEQVAAY
                     REKYVNAAPFKHAVLSDLLSDDLLEGVVEESKKFGMRGEEGSLPGWGWEQKETDIYKI
                     HQTPDLSSLSPEHLPDETLEALPLLTRLKDALYSQEFRNLVRQVTGCGPLSGTKTDLS
                     AALYTKGSHLLLHDDSISTRLISYILYLPYSIEEAPESQNVALQRSTNGKFLKGWDPA
                     WGGSLELFSVETGEEVGPPSVKRFAKVSATWGQIVFFEVQPGRSYHSVEEVVIDEGRR
                     RFSVSGWFHRPVEGEEGYAPIDKEKEQKQLSSLAQITAAPSMPFTPYNTTPPPGLKPS
                     DIAFLSNYLSPSYLTVATLERLSGQFVEASEIVLHNFLQPELAAKLKAETEGVDKKDQ
                     ASYEGLLPPQELGEGDGWIIQGPSSKHRYLNLTSLTTSTPIVQSIHNVLFPSEAFRAW
                     LSVVSSLAPTGHRNEARRFRNGLDYTLANGEGKDGDARLDVSLGMTWWADVPAGSDEE
                     DALVENGGWEAYLAAPDEDEDPTVYQSSVAKKAVKEHSQEPKEPNGKKVEEKSKPQAN
                     GSSEKKDGPSISIGGQELEFDPDQFSPSDFDSDSEAGDEDDGPLLTQPVAFNKLLLVL
                     RDPGVMKFVKYLGANAPGSRWDVSGEFEVGVLEEEPAEDGAPEAEGSGEGKADA"
     gene            1081086..1083008
                     /locus_tag="CNA04030"
                     /db_xref="GeneID:3253393"
     mRNA            join(1081086..1081118,1081185..1081830,1081889..1082030,
                     1082082..1082218,1082274..1082409,1082465..1082556,
                     1082621..1082749,1082805..1083008)
                     /locus_tag="CNA04030"
                     /product="cell division cycle 2, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41552665|gb|CF698506.1,gi|41552670|gb|CF698511.1,
                     gi|41572790|gb|CF718631.1,gi|41572794|gb|CF718635.1"
                     /transcript_id="XM_566749.1"
                     /db_xref="GI:58258672"
                     /db_xref="GeneID:3253393"
     CDS             join(1081388..1081830,1081889..1082030,1082082..1082218,
                     1082274..1082409,1082465..1082556,1082621..1082749,
                     1082805..1082961)
                     /locus_tag="CNA04030"
                     /codon_start=1
                     /product="cell division cycle 2"
                     /protein_id="XP_566749.1"
                     /db_xref="GI:58258673"
                     /db_xref="GeneID:3253393"
                     /translation="MRQETLAFAEPEPLKPARSPSLRQSSKSPSRHPSPAASTPSFAD
                     APLPPPPRSRFAPPRSSHPPLVSCRSVYNYTRLNHIEEGTYGVVFRARCNDTGEIYAL
                     KKLKLDEEKQGFPITSLREVMALMISGGHENVVGIREIVVGDTLNQVFIVMPFIEHDL
                     KTLLADMPHPFLQSEVKTIMLQLLSAVAHCHANWILHRDLKTSNLLMNNRGQIKVADF
                     GLARKFGDPLGEMTQLVVTLWYRSPELLLGGKEYTTAVDIWSIGCIFAELMQGEPLFP
                     GRGEIDQINRIFQLLGRPNDESWPGYSTLPLVQKINPIGPMFSTLRQKFKHLTYEGHN
                     LLSSLLCYDPERRITAEEALKHPYFSEHPLPKHPDLFSSFPSQAAGERKHKSLISPSA
                     PVREDRMAKDSLADLDSFV"
     gene            complement(1082999..1085813)
                     /locus_tag="CNA04040"
                     /db_xref="GeneID:3253392"
     mRNA            complement(join(1082999..1083213,1083264..1083789,
                     1083847..1083962,1084030..1085201,1085252..1085360,
                     1085414..1085469,1085533..1085571,1085661..1085813))
                     /locus_tag="CNA04040"
                     /product="f-box/wd-repeat protein lin-23, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540819|gb|CF686660.1,gi|41540824|gb|CF686665.1,
                     gi|41563623|gb|CF709464.1,gi|41563635|gb|CF709476.1"
                     /transcript_id="XM_566750.1"
                     /db_xref="GI:58258674"
                     /db_xref="GeneID:3253392"
     CDS             complement(join(1083046..1083213,1083264..1083789,
                     1083847..1083962,1084030..1085201,1085252..1085360,
                     1085414..1085469,1085533..1085571,1085661..1085751))
                     /locus_tag="CNA04040"
                     /codon_start=1
                     /product="f-box/wd-repeat protein lin-23"
                     /protein_id="XP_566750.1"
                     /db_xref="GI:58258675"
                     /db_xref="GeneID:3253392"
                     /translation="MPGSPPLQRHVSTKAELLQKALTLPLELRRELATSLLWSMPRNE
                     VLALNERLNMMLQKDIVGLLPPELAFLILSRLDLGDILKCSSVSRTWRNLCNKQALWA
                     LLCATNSPPIRPLPISWAELTTQYSLPPPTDDIEDPTFDISLSDDRLSNHYDVIDGQG
                     GMGGGGGIDPLGMSGGLRWNVWERGGAGSGEGLPVHLQRSAVNVQEFKKKEEPPITSH
                     LAVPSANPQANFKHLYIVHHILEQRMKTPRPIGMANYMPSPPEEVKVNMPSLPPVPRP
                     RTIDAISSIKYGGLPGHSEAVYSLSLISHSMRINMLQACPDCHVQLAPPSNLSGITEG
                     QFRLSVMETLSGAGTSPRRKLPNLSQAGGTRDLVTGRDWLLSGSRDKTLRLWQLSPAP
                     RVVKIFHGGHTGSVLTHAIVKVPCLPFISSPQSRFSKLEIGSSAKEAKERVKVMAVSG
                     GSDGKICLWDVEGGNGEPEKCVKAHEDSVLCVRADDERITIRLFSIHTLEPLLVIGGT
                     ADLYLHRGAVNAVGLSKDYIISASGDKTLRVWSIKTGALLACIEGHHRGIASIDFSPL
                     PPSPINLPDGQIFRGLIVTGSSDASIRTFHLIEDRIPDLQNLKMGHSMVTSATDGSED
                     GYSQANTYGIPTELTGEGHKVILVPQGSFFSPCICPPGLSRMEGGVCRRCFNRGHLDL
                     VRTVHFGKGVILSGSYDATVKVWSPTGEIIADLHGAHTGRVFSVVGDRMRIVSSGLDC
                     RINIWDFSEGLDTSFVAP"
     gene            complement(1086022..1087860)
                     /locus_tag="CNA04050"
                     /db_xref="GeneID:3253391"
     mRNA            complement(join(1086022..1086366,1086423..1086825,
                     1086880..1087234,1087520..1087714,1087800..1087860))
                     /locus_tag="CNA04050"
                     /product="elongation factor 1-gamma (ef-1-gamma),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530824|gb|CF676665.1,gi|41530832|gb|CF676673.1,
                     gi|41533610|gb|CF679451.1,gi|41533615|gb|CF679456.1,
                     gi|41533944|gb|CF679785.1,gi|41534684|gb|CF680525.1,
                     gi|41534829|gb|CF680670.1,gi|41534842|gb|CF680683.1,
                     gi|41536609|gb|CF682450.1,gi|41536614|gb|CF682455.1,
                     gi|41539112|gb|CF684953.1,gi|41539619|gb|CF685460.1,
                     gi|41539622|gb|CF685463.1,gi|41539765|gb|CF685606.1,
                     gi|41539774|gb|CF685615.1,gi|41540294|gb|CF686135.1,
                     gi|41540303|gb|CF686144.1,gi|41541804|gb|CF687645.1,
                     gi|41541805|gb|CF687646.1,gi|41542044|gb|CF687885.1,
                     gi|41542051|gb|CF687892.1,gi|41543576|gb|CF689417.1,
                     gi|41543584|gb|CF689425.1,gi|41546926|gb|CF692767.1,
                     gi|41547899|gb|CF693740.1,gi|41547906|gb|CF693747.1,
                     gi|41550225|gb|CF696066.1,gi|41550234|gb|CF696075.1,
                     gi|41552664|gb|CF698505.1,gi|41552673|gb|CF698514.1,
                     gi|41552843|gb|CF698684.1,gi|41552856|gb|CF698697.1,
                     gi|41558744|gb|CF704585.1,gi|41558758|gb|CF704599.1,
                     gi|41558823|gb|CF704664.1,gi|41558835|gb|CF704676.1,
                     gi|41558966|gb|CF704807.1,gi|41560076|gb|CF705917.1,
                     gi|415"
                     /transcript_id="XM_566751.1"
                     /db_xref="GI:58258676"
                     /db_xref="GeneID:3253391"
     CDS             complement(join(1086088..1086366,1086423..1086825,
                     1086880..1087234,1087520..1087714,1087800..1087827))
                     /locus_tag="CNA04050"
                     /codon_start=1
                     /product="elongation factor 1-gamma (ef-1-gamma)"
                     /protein_id="XP_566751.1"
                     /db_xref="GI:58258677"
                     /db_xref="GeneID:3253391"
                     /translation="MAPKLTGFPGNSRVRRVLSVAALAGVELEHDKSFTFASEWKTPE
                     FLEKNPFGFLPVLELEDGTTLRECAAIAEYIAEIGSNKNLIPSDPKLKAIVHSYQATA
                     DQEIFIPGGLANAMLYGKAPYHKAVFQTLVERVTGRLNVIDSILAKRTFLVGERVTLA
                     DIFVVTAVTNIFTTWFDAPARAKVPNLLRFVETIINHPKLKEIFTPIEFSEKAPAPQP
                     PVNKDQKKKEEPKPKAEKAPKAPKAKEEDEEEEPAVPAEPKAKNPLDDLPKSAFNLEE
                     WKRQYSNLDTRGANGSLAWFYEKFDKEGFSIWRVDFKYNEELTQVFMSSNQVGGFFNR
                     LEASRKYLFGSVGVLGKANDSVITGVLVLRGQDAEPVVNVAPDWESYSFKKLNLDNAD
                     DKAFFEGAMAWDLVENGREWADGKNFK"
     gene            complement(1088160..1090149)
                     /locus_tag="CNA04060"
                     /db_xref="GeneID:3253248"
     mRNA            complement(join(1088160..1088657,1088712..1089382,
                     1089436..1089686,1089747..1089855,1090030..1090149))
                     /locus_tag="CNA04060"
                     /product="methionine adenosyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530729|gb|CF676570.1,gi|41530740|gb|CF676581.1,
                     gi|41531503|gb|CF677344.1,gi|41531770|gb|CF677611.1,
                     gi|41531775|gb|CF677616.1,gi|41532041|gb|CF677882.1,
                     gi|41532047|gb|CF677888.1,gi|41536918|gb|CF682759.1,
                     gi|41536928|gb|CF682769.1,gi|41537330|gb|CF683171.1,
                     gi|41537338|gb|CF683179.1,gi|41539661|gb|CF685502.1,
                     gi|41539675|gb|CF685516.1,gi|41541868|gb|CF687709.1,
                     gi|41541879|gb|CF687720.1,gi|41543238|gb|CF689079.1,
                     gi|41543246|gb|CF689087.1,gi|41544257|gb|CF690098.1,
                     gi|41544264|gb|CF690105.1,gi|41545966|gb|CF691807.1,
                     gi|41545973|gb|CF691814.1,gi|41546011|gb|CF691852.1,
                     gi|41548775|gb|CF694616.1,gi|41548779|gb|CF694620.1,
                     gi|41558009|gb|CF703850.1,gi|41558018|gb|CF703859.1,
                     gi|41561305|gb|CF707146.1,gi|41562666|gb|CF708507.1,
                     gi|41562674|gb|CF708515.1,gi|41564723|gb|CF710564.1,
                     gi|41564728|gb|CF710569.1,gi|41566264|gb|CF712105.1,
                     gi|41566273|gb|CF712114.1,gi|41569214|gb|CF715055.1,
                     gi|41569220|gb|CF715061.1,gi|41573710|gb|CF719551.1,
                     gi|41573723|gb|CF719564.1"
                     /transcript_id="XM_566752.1"
                     /db_xref="GI:58258678"
                     /db_xref="GeneID:3253248"
     CDS             complement(join(1088551..1088657,1088712..1089382,
                     1089436..1089686,1089747..1089855,1090030..1090085))
                     /locus_tag="CNA04060"
                     /codon_start=1
                     /product="methionine adenosyltransferase"
                     /protein_id="XP_566752.1"
                     /db_xref="GI:58258679"
                     /db_xref="GeneID:3253248"
                     /translation="MTAVNVNGNAPATELAPGHFLFTSESVGEGHPDKICDQVSDAIL
                     DACLAEDPFSKVACETAAKTGMIMVFGEITTRAQIDYQKVIRDTIKKIGYDSSEKGFD
                     YKTCNVLVAIEQQSPDIAQGLDHGALEKIGAGDQGIMFGYATDETPEMMPLTIMLAHK
                     LNAAMAIARRDGSMGWLRPDSKTQVTVEYKKGEDGAMVPLRVDTVVISTQHAEEITTE
                     QLREEILEKIIKKVIPKNLLDDRVIYHIQPSGRFVIGGPQGDAGLTGRKIIVDTYGGW
                     GAHGGGAFSGKDWSKVDRSAAYTARWIAKSLVAAGLARRALVQLSYAIGVAEPLSIFV
                     DTYGTGKKSDAELVEVIRQNFDLRPGLIVQALNLQQPQYLKTAAYGHFGNPAYSWEQP
                     KQLNF"
     gene            complement(<1093077..>1094432)
                     /locus_tag="CNA04070"
                     /db_xref="GeneID:3253247"
     mRNA            complement(join(<1093077..1093820,1093886..1094007,
                     1094062..1094239,1094322..>1094432))
                     /locus_tag="CNA04070"
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /transcript_id="XM_566753.1"
                     /db_xref="GI:58258680"
                     /db_xref="GeneID:3253247"
     CDS             complement(join(1093077..1093820,1093886..1094007,
                     1094062..1094239,1094322..1094432))
                     /locus_tag="CNA04070"
                     /codon_start=1
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /protein_id="XP_566753.1"
                     /db_xref="GI:58258681"
                     /db_xref="GeneID:3253247"
                     /translation="MKSVNRWLYGPTPEEKVRSWQTKLRQQERQLDKEIRNLETATQR
                     SRIELKQLAKKNDVKSAKILAREVVRANKQRDRLESSKARIKSVNMQLQHQLSMVKVT
                     GAFQKSTEIMKTTNALVKLPQLSATMREMSMEMMKSGIMEEMMEETLDSVDDEEIEEE
                     ADAEVDKVLYELTDGKLGQAGAVGAALPVSRVRSIHKRTADNGVGCSGRGGRGERGGD
                     AAHEKRNAGAVEFMMIAVDVGDVYMKKRTSCYAHNIQCPLDIPCITRDNIATDSFHGS
                     AGHILDTLFTLASLCSQHLINQQQLRHFEVRSVLGKSHLRETRTLPDSRGISQALAPR
                     KLGSMPQRKQEATKGAFMQKPKEKAADQLLTSTSPVKCGLPQAVYRQLVL"
     gene            <1094623..>1098680
                     /locus_tag="CNA04080"
                     /db_xref="GeneID:3253381"
     mRNA            join(<1094623..1094764,1094812..1094948,1095004..1095221,
                     1095276..1095358,1095406..1095746,1095792..1096012,
                     1096064..1096176,1096227..1096606,1096663..1097796,
                     1097849..1097930,1097989..>1098680)
                     /locus_tag="CNA04080"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41567002|gb|CF712843.1"
                     /transcript_id="XM_566763.1"
                     /db_xref="GI:58258700"
                     /db_xref="GeneID:3253381"
     CDS             join(1094623..1094764,1094812..1094948,1095004..1095221,
                     1095276..1095358,1095406..1095746,1095792..1096012,
                     1096064..1096176,1096227..1096606,1096663..1097796,
                     1097849..1097930,1097989..1098680)
                     /locus_tag="CNA04080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566763.1"
                     /db_xref="GI:58258701"
                     /db_xref="GeneID:3253381"
                     /translation="MQRSRAVWTDDDPYAADLFFLSLLFRSAARTVIMWLLTVVGEIL
                     GQKHYTFALQQQKSYTFGRNKDCDIAFPNNLRVKPEEGTLEILEWDYTNRHSRPDIKW
                     RPKPKKNGDYGTIVAVGKRPETPNGSLNKGDYDILPINNEKGSGVFVDELNVTGISFA
                     DDIWFFLEWRDLCLLYGKMMDEPDPIRNTLKSYCISWTTTFDTSDPPQYVLLDTYRNN
                     WEARYAVCCGIPILLPSFLALLQSRLTINWRKTADAFCSFKFPLPGEDEAEYRPKNHQ
                     SIRFSSSIWLPDRRRRTLYRGWHVLLLREQIQPREAFMYKALGADLQEVIVEGNPPKT
                     SSDVEEYLADWLSYVDTHGGRKKGLVAYSGKVKDMTDAKIIEDTCERLKVNCASVASA
                     FGAVLNGGVHQFLEGVDNKHNRHAARGSITAITPAASSSVPSPAADPFRRLTETPTPA
                     LTPTPPSEPTVTSVVAESSNAPGVPSTFSDETTPPVPFEPPRLSRRRTAYTKPIIADA
                     TPVPVASSEPQHVAVNADGTEEAVDEWRPPPVAVLRRPQRRTVGKGARNTPTSAPAPA
                     QPLATPQFNGTDTHVTSLDPHPSFAPNSMPSQEEDSPGVAPGPSRAGLSDFPSSTQQN
                     TMPPIQTLPRPSRRYGTTSSIARPQAAPSRVAFEETVEEEEDDRLKKLYEKTRKQGFG
                     PASLAKKVRTADRGGDVEMEDTQISSAASMTDRERYKAPSEILHIDEEPEEEEEEQDL
                     FAQTMRRSKRPASAAGLSATQGTAPEVRSKDIGGRDSQDLMPPPAQRRRIQSPSPSPE
                     PGPSEDQAPRRAAPSQNRFDFQDAIPQPMTRDEQFLRVVAERKKAKAAIDNLDKSFDS
                     MLRIPKAQTESEADKPDYSVLDEVPPPKAGNYIAVMRTNSLFRKDLGQTKERENVEDG
                     RPNFKKFKRKNVPRRAPLKMVLTTSVVDPSKYEEPEPYWPTQKKTQKKSQAQSGSLSD
                     PEEDDRPLLPRHKPRLLVEDDNEGDGDVKFMATGQAAAGRRGTQRNQIRDNRVTLGTS
                     AQRTKGGESVASDTYDDQAARSDVSKTTHSKAATKATAARGRNKLLVEDNDTTIDWAS
                     SPSTAKGGKSSFESSGTATLDENPSSTARKGTQKRKALAVDVDDDEGVSLNRCYCGRS
                     GAYSINRDLETLGRGEDVDAQCVLMLEQYRTTVG"
     gene            complement(1098716..1100470)
                     /locus_tag="CNA04090"
                     /db_xref="GeneID:3253379"
     mRNA            complement(join(1098716..1099032,1099085..1099646,
                     1099699..1099781,1099833..1100076,1100129..1100265,
                     1100315..1100470))
                     /locus_tag="CNA04090"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41565142|gb|CF710983.1,gi|41565150|gb|CF710991.1,
                     gi|41574368|gb|CF720209.1,gi|41574376|gb|CF720217.1"
                     /transcript_id="XM_566765.1"
                     /db_xref="GI:58258704"
                     /db_xref="GeneID:3253379"
     CDS             complement(join(1099549..1099646,1099699..1099781,
                     1099833..1100076,1100129..1100265,1100315..1100424))
                     /locus_tag="CNA04090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566765.1"
                     /db_xref="GI:58258705"
                     /db_xref="GeneID:3253379"
                     /translation="MEQQQPNHDMREDQQDYSFSEQNVSQEMSEEGWRALAKIVRDVN
                     PNLSPDEELGDLAAAEAAVNAKDAERTEIVDKLRDELRQLSRQHSQAAAAAQRPPSHP
                     SPAEHEANVRSLEQQQFSIAKQLNEEQAAVAKKEVELGKWKTAKEDIEKVEIGEGDWA
                     DGKVIRLKLFSEAGFSLVSAKDGSNVTKVLIRNDAKEDVHSVVVDNSRPKVYTANLIW
                     SLASD"
     gene            1100719..1102605
                     /locus_tag="CNA04100"
                     /db_xref="GeneID:3253377"
     mRNA            join(1100719..1100856,1101017..1101257,1101389..1101898,
                     1101955..1102247,1102318..1102605)
                     /locus_tag="CNA04100"
                     /product="choline-phosphate cytidylyltransferase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537075|gb|CF682916.1,gi|41537081|gb|CF682922.1,
                     gi|41546935|gb|CF692776.1,gi|41546947|gb|CF692788.1,
                     gi|41553826|gb|CF699667.1,gi|41553828|gb|CF699669.1,
                     gi|41569447|gb|CF715288.1,gi|41569458|gb|CF715299.1"
                     /transcript_id="XM_566767.1"
                     /db_xref="GI:58258708"
                     /db_xref="GeneID:3253377"
     CDS             join(1100754..1100856,1101017..1101257,1101389..1101898,
                     1101955..1102247,1102318..1102532)
                     /locus_tag="CNA04100"
                     /codon_start=1
                     /product="choline-phosphate cytidylyltransferase"
                     /protein_id="XP_566767.1"
                     /db_xref="GI:58258709"
                     /db_xref="GeneID:3253377"
                     /translation="MSANPPAQKRHNRNRLGERRVNRDPSSSRDASEEDNDNVENSFS
                     DVGSMNSYHAEALSTTSTIDSPTRMPPPALPPHSSSGSPSTTQAGRRSYQQRRVEELN
                     GEGSQSEGLDSPTYDGDVESSSTIGGAPAHHQHTHFRRPSFPAPVPTSETPHPAAHIV
                     QRQPTPKASQIGFSAADYPAVPTPKATYVRPSDVPVAPSVALEECARSPPTTSWIQSP
                     NSAGGPPKMYARAVERTEEDIKGFVERAIHGRGQEDGVERWWKTNPPPEGKVVRVYAD
                     GVYDLFHFGHALQLRQAKLSFPQVHLMVGVCSDVLCAQHKSAPAMTHAERCEAVRHCR
                     WADEVIPDAPWVVDQAFLDKHQIDYIAHDEEVYPSKDHEDVYAFAKKEGRFVPTRRTP
                     AISTSDLLERIVRGYRDGFFDSKLEKNGHPELLAADVDWDSSASMEKREKRKAAHHHK
                     VKK"
     STS             1102175..1102976
                     /standard_name="Pst9"
                     /db_xref="UniSTS:470891"
     misc_feature    1102823..1102929
                     /note="CT-rich"
     misc_feature    1102980..1103070
                     /note="CT-rich"
     misc_feature    1103894..1103958
                     /note="GA-rich"
     gene            complement(1104273..>1107017)
                     /locus_tag="CNA04110"
                     /db_xref="GeneID:3253375"
     mRNA            complement(join(1104273..1104338,1104412..1104482,
                     1104539..1106236,1106298..>1107017))
                     /locus_tag="CNA04110"
                     /product="ER organization and biogenesis-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546179|gb|CF692020.1,gi|41546183|gb|CF692024.1,
                     gi|41549851|gb|CF695692.1,gi|41562723|gb|CF708564.1,
                     gi|41564052|gb|CF709893.1,gi|41564056|gb|CF709897.1"
                     /transcript_id="XM_566769.1"
                     /db_xref="GI:58258712"
                     /db_xref="GeneID:3253375"
     CDS             complement(join(1104317..1104338,1104412..1104482,
                     1104539..1106236,1106298..1107017))
                     /locus_tag="CNA04110"
                     /codon_start=1
                     /product="ER organization and biogenesis-related protein,
                     putative"
                     /protein_id="XP_566769.1"
                     /db_xref="GI:58258713"
                     /db_xref="GeneID:3253375"
                     /translation="MDDLLDLSWSAKPPPPARSPQPAFELLARPPPQPAAKPPTPAPP
                     PARPPATAPPPAPATAHSDAFSSLLAIPAARPAEPAKDMTMAQKQAAIAEERRRRDEA
                     QRKQFEADGAFWENLGSRSSAATSASSRSNHGTFWDQYGDDGDLLSAGSNPVSQPRSH
                     AHSPAPLPPAHTDPFDFDAFENTLNGSAKAALASEASNSGETSAIRTPVSNVDLWDGD
                     GNDDDLLGELGRPAASKPAQTKSTLPRTPQEPPPASPPPHIVGQIVEMGFAPTQARQA
                     LAKTSTGTDVQEALELLLGSGQGQGHAPGNAGPSGSWDDHLPEADDDRIEYERRKRQE
                     AEKERRRRRRAGPSRDSVKARTTEEQERDAAAAAANAQEQAERILAQASEIGQSMFNK
                     ATSFWNTSKERAIKVYEEQRKALEAAERGEDQKKKDTRPKWMQENEGWKDERSRQVRG
                     GFKDSDDEQEIGPSIPAPRREQRPARQEGIADLLSGNDHHPAHRPTSRPTSRPASRAA
                     PSPKPAAPPLPRRPLISATPLQLESSAAHKTKGNDHFKLGRFTEAESCYSSAIAALPK
                     DNLFLIPLLNNRATTRLKLGDAVNAATDCTAVIDLVGISYHPGKEAPLPAEYADIKLG
                     DGLSKALVKRAQAWEMGEKWKAALEDWERVMGLDPVLLGGTNAAASTRNMAAQGARRA
                     KKMMQSGGNVAAAAPAVVSSPAPSTPAADVNRSAAVADLRKAAQALEAEEEARLFHKD
                     NVDAKIANWKSGKETNLRALIASLDTVLWDDIVKEGGLKVGMHELVTDKQVKIKYMKV
                     IARLHPDKLNTQNTTVEQRMLANGAFGVLSDAWQAFNQ"
     misc_feature    1106910..1106937
                     /note="GC_rich"
     gene            complement(1107112..>1109169)
                     /locus_tag="CNA04120"
                     /db_xref="GeneID:3253373"
     mRNA            complement(join(1107112..1107218,1107275..1107605,
                     1107655..1107815,1107871..1107999,1108058..1108351,
                     1108415..>1109169))
                     /locus_tag="CNA04120"
                     /product="Type 2C Protein Phosphatase, putative"
                     /transcript_id="XM_566771.1"
                     /db_xref="GI:58258716"
                     /db_xref="GeneID:3253373"
     CDS             complement(join(1107194..1107218,1107275..1107605,
                     1107655..1107815,1107871..1107999,1108058..1108351,
                     1108415..1109169))
                     /locus_tag="CNA04120"
                     /codon_start=1
                     /product="Type 2C Protein Phosphatase"
                     /protein_id="XP_566771.1"
                     /db_xref="GI:58258717"
                     /db_xref="GeneID:3253373"
                     /translation="MLSPHHARPYSTPSARPPSVKTTAFVSIALLTSAYLLYRHESES
                     APGKHAVSPSSLLSGGKPTFQLSIRSGRGGVQTYEFERKPDDQVERELRAHEVSRRID
                     RKGNPVVRWDNNWLGSNEPCEDRWATDLVRRDGAAGGAVGKAVNFWTRWYRGDSIPSE
                     SAPAEEDEAARGKHDLMLFSIMDGHAGDATSRLLQKSLHPTISMALAGLQRGNVPPRH
                     NVWERWAGYLNPWYWLGTDTVWTPENVSKTIQNAFVQLDDNICQTPLKLLPTLSSPST
                     SSPTPRETLVALAQPAAAGACAISTLVDSENDDLYVAVTGDCRAVAGWEGEDGKWRCD
                     VLSEDQMGDNPKEIERMRSEHPASERDTVIRNGRVQGGLQPTRAFGDAVYKWTNAQAA
                     QIADAFRAQGERPRPGRPWNYTPPYVTARPEVTYRKLNAHTGEKLRFIVLATDGLWDR
                     ITSEESTLLLASYLSHPSHAPLPKSALPRRFPLAPPPPREKRPYPAQDLPAPTGEAAS
                     DTWVYEGDANAATHLIRNSLAGGDVKTRAELVSLGGKVSRWMRDDITVTVVFFGDS"
     gene            1108955..1110661
                     /locus_tag="CNA04130"
                     /db_xref="GeneID:3253371"
     mRNA            join(1108955..1110263,1110333..1110405,1110468..1110661)
                     /locus_tag="CNA04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_566773.1"
                     /db_xref="GI:58258720"
                     /db_xref="GeneID:3253371"
     CDS             join(1109247..1110263,1110333..1110405,1110468..1110601)
                     /locus_tag="CNA04130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566773.1"
                     /db_xref="GI:58258721"
                     /db_xref="GeneID:3253371"
                     /translation="MGLLAVLAFTQGLATFSQVLLGLPAALALLGPASFLLLSLLYTA
                     HHLLYATLRLALKNTPLAPLVSVAAVLSPAISAALALLTLYFYLAPPAPGATLAHCLV
                     NILPFAYAQLLRWVSPLFTLLEGISTLLVIQVAGRVGKGWADEEDRDEGLEWRTVVAL
                     VAAALVYCAGLAGVVKTFPSLPFPAFLLGAALTAVLFLSLIGFSLKRTNVLETSLVFV
                     YVVYSAWLSGVEAEMPSGTFGSSSSSFPPPSPLRQSHPLPSTVGPSVNSLLSYALHAA
                     VPSFITVSETLPPHLVLSLIYRVTVLHLAAKIVPVLRRASMGWDDRDEREGFWDGRTL
                     GDEPANMRITTVFLSYRRAILIAVYTHLLLLDGGSQTWWRWVNIALLLSVWSLELLLD
                     AEGDDTDSVTRWKVD"
     misc_feature    1109422..1109577
                     /locus_tag="CNA04130"
                     /note="C-rich"
     gene            complement(1110685..1112818)
                     /locus_tag="CNA04140"
                     /db_xref="GeneID:3253369"
     mRNA            complement(join(1110685..1111913,1111967..1112046,
                     1112106..1112455,1112523..1112818))
                     /locus_tag="CNA04140"
                     /product="tRNA dihydrouridine synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530677|gb|CF676518.1,gi|41530686|gb|CF676527.1"
                     /transcript_id="XM_566775.1"
                     /db_xref="GI:58258724"
                     /db_xref="GeneID:3253369"
     CDS             complement(join(1110706..1111913,1111967..1112046,
                     1112106..1112455,1112523..1112717))
                     /locus_tag="CNA04140"
                     /codon_start=1
                     /product="tRNA dihydrouridine synthase"
                     /protein_id="XP_566775.1"
                     /db_xref="GI:58258725"
                     /db_xref="GeneID:3253369"
                     /translation="MSVAAQVVSSEGPQSVGDELQTKKQFPTFPAPGKPTHEKLGGYD
                     FYRSIGSPKFVVAPMVDQSELAWRLLSRSPLPPALAGPSETVTTPQGKAYIRHPGGAH
                     VCYTPMIHAKVFVDAKGEGGRNGDGQFCLSLDEEGGEGTIGGVEGGDRPLIVQFCAND
                     PDILLAAAKKVEHRCDAVDINFGCPQGIAKRGHYGSFLQDEWELIHKLISTLHENLSV
                     PVTAKFRIFPDLDKTIAYARMMEAAGAQILTCHGRTREMKGQNTGLADWEYIREVKKA
                     VKVPVFANGNILYREDVDRCMEVTGCDGVMTAEGNLSNPAIFMPPEHPHAHPPITVLA
                     HRYLDIVEALDTPTAGSAIKAHLFRLLKPVLDTDEELRVQIATCRWSDGMDGFREIIR
                     DIERRCAPVREALGADWRPPTVDPKTGYRSLPMFAAQPQIRAKPVSTEIGGHEDMVSR
                     PVSPGKEGEGRMFDTPNITTAPASSVPGTVLFSRSHRHTSLGQTERCVHSDCTGVAAT
                     RCPTRACITHCRILRAVEAGYTREEAEAEGAKGGLVGMGCDAHEEKVRARKEREARKR
                     KGREMAKEKAKERKKEEKAKEEREKSKEKVGMTEEEVSFAAGLA"
     misc_feature    1110734..1110884
                     /note="CT-rich"
     gene            complement(1113787..1117855)
                     /locus_tag="CNA04150"
                     /db_xref="GeneID:3253552"
     mRNA            complement(join(1113787..1113925,1113976..1114041,
                     1114090..1114815,1114964..1115278,1115396..1115671,
                     1115734..1116665,1116711..1117855))
                     /locus_tag="CNA04150"
                     /product="mitochondrion protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41555763|gb|CF701604.1,gi|41573724|gb|CF719565.1"
                     /transcript_id="XM_567167.1"
                     /db_xref="GI:58259508"
                     /db_xref="GeneID:3253552"
     CDS             complement(join(1113899..1113925,1113976..1114041,
                     1114090..1114815,1114964..1115278,1115396..1115671,
                     1115734..1116665,1116711..1117818))
                     /locus_tag="CNA04150"
                     /codon_start=1
                     /product="mitochondrion protein"
                     /protein_id="XP_567167.1"
                     /db_xref="GI:58259509"
                     /db_xref="GeneID:3253552"
                     /translation="MILIRHKSCSLASLVGLTLPRATCRAPQQYRSSSSAAIPPADQE
                     EHQSKPLTGSARLFADAEAEEKVTSNASNRDHLRMTQGPVWTGDESPADAVLRMLVDA
                     HKPLRNEGGVKHNAADEKIKGWMKGLQLEPILGPGPSLPPEEAQEIALESVEKENAHR
                     TKIPPHLHRPWHSTYTGEYQTAETPKVKYGAFTNKRTDGDSLTNLLELQLPPNADSKT
                     RAKVKAARKSTMFMGRLDKAREGALDYKLGLGVDDAHVVETGEEGEVSEEGQTFKGNR
                     QIKGSSVLGAQRGSASGMKAWAGLVEDRILVRSLSASWIAKLTFAIFREQEVRIVTMY
                     LTDGLMVVIEAGFFNNASGKGKPIVADPEARNPHIERGELFMNRIIKRQGALPPWIEL
                     QNLLDSNLRSFRATLLTTYKTQLVRNIISTNALHPLPPLHAIPDRDEAWEAREFKFHQ
                     ENVKQINDLVRRMNAQAPSPARRHLITLEGELNRIRGNMLKNEVWEEIKRRAEESINM
                     PYQRERSGLAAFIFEGENWTKLKNATNRSFGTVAVSGTAPLANANVSGLEGSSKGYSG
                     DPTGDHSSGPSSYSGRDPRPLRLVVMAGVGVGVIIYLRRRPVKNDSAHLNPFHHHLQP
                     TPTPQPDIVASSPSEPPLTFIRIIEIYILEPIGTFFRFLHLACLFVPVILLSPMLLSW
                     GAIWWYGFLVKQMERAGPSFIKLGQWAASRADLFPAELCEKMSKLHSNGRPHSLGYTK
                     KVMEAAFGMGFDDIFEEFDEEPIGCGAIAQVESDTASVAIKVIHPRVRKIIRRDIAVM
                     SIFAKFVNAFPGMQWFSLPEEVQVFGEMMNSQLDLRVEASNLDKFLHNFGKRGRRVTF
                     PTPIKLGDGKEELEEEMKDILEMLLIDNWTHGDLHPGNIMVRFYKPTTTDYLSPLLHA
                     FGKNPTPSTDASVASHDNLVHTLAAVSRDREKWLNKLDELHQDGYEPQLIFIDAGLVT
                     SLDSKNRANFLDLFQAVAEFDGYKAGKLMIERCRTPDFAIDEETFALKMQHIVLSVKS
                     KTFSLAKIKISDILTDVLKAVRQHHVKMEGDFVNTVISILLLEGIGRQLDPDMDLFKS
                     ALPILRQLGKQMGTREAIQATPTGNILAMIKLWVWVEARQVAGEVSTLDEWMKYDRLT
                     PSI"
     gene            complement(1119185..>1121107)
                     /locus_tag="CNA04160"
                     /db_xref="GeneID:3253367"
     mRNA            complement(join(1119185..1119375,1119436..1119584,
                     1119641..1119907,1119960..1120031,1120104..1120229,
                     1120334..1120521,1120575..1120664,1120713..1120769,
                     1120830..1120849,1121035..>1121107))
                     /locus_tag="CNA04160"
                     /product="transporter, putative"
                     /transcript_id="XM_566777.1"
                     /db_xref="GI:58258728"
                     /db_xref="GeneID:3253367"
     CDS             complement(join(1119335..1119375,1119436..1119584,
                     1119641..1119907,1119960..1120031,1120104..1120229,
                     1120334..1120521,1120575..1120664,1120713..1120769,
                     1120830..1120849,1121035..1121107))
                     /locus_tag="CNA04160"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_566777.1"
                     /db_xref="GI:58258729"
                     /db_xref="GeneID:3253367"
                     /translation="MSTLMEVTVGLYSVLVVVWQDVRWAGTLCAFMMNATAFISGRYG
                     DRYGFKRVLYCSAVITWLGLFLAGWSTKLWQTILTQGILTGFGQGLSLPLFMSLPSQW
                     FYRRRGLASGLAIGGAGLGGGTTTLICRELLTRVGYRKTLWTRPSSPEGKATGKGPWI
                     DWAVVKTSSFWSLVIGLVVSTTGYAMPFNFTAQWTRLHFPNLNPILLALPVTLLGYTV
                     CVGRALIGLIADLLGPMNTFILCFFLSGVVQLCLWLTASSFASVLVFAIMFGLVAPGY
                     MGIIPQIIVQLFGPTNLATNVGILLLFNGPGNLMGGPIGGALYDASGRTSFKYMIITG
                     GCLQIAGGLIICWARFKTSRKWLKKI"
     gene            complement(<1122849..>1124313)
                     /locus_tag="CNA04170"
                     /db_xref="GeneID:3253365"
     mRNA            complement(join(<1122849..1123036,1123094..1123180,
                     1123234..1123480,1123530..1123639,1123681..1123709,
                     1123759..1123864,1123989..>1124313))
                     /locus_tag="CNA04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_566779.1"
                     /db_xref="GI:58258732"
                     /db_xref="GeneID:3253365"
     CDS             complement(join(1122849..1123036,1123094..1123180,
                     1123234..1123480,1123530..1123639,1123681..1123709,
                     1123759..1123864,1123989..1124313))
                     /locus_tag="CNA04170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566779.1"
                     /db_xref="GI:58258733"
                     /db_xref="GeneID:3253365"
                     /translation="MDMDSAHLDSSLLTLAFRLIKAAQTAAPSVLADLLAEGAPAWFQ
                     DDDLGWSCLHYAAERKEPECLEVLLQGGAVWNAVDKWGRTAGEICLSLGDEEGWSIIR
                     NEGIRSEDKTSAGDNLVFLKSKLTWDVGKDGKERVLDADGNGVMMGWEEPLSYCIVVE
                     HVKRLTEEHPKAELGAEGMSILNVGFGLGIVDRLFQECDPKPSHHTIIEAHPQVLEYI
                     HKKGVHLLPNVRILQGRWQDWLLDGEKVGDVLSGTPDGMGFDAIFVDTFAEGYEDLKA
                     FFEVIPDILNADNGRFSFWNGLGATNPTIYAVSSSLAELHLEDVGLQVEWHDVLIPES
                     MREEVWKGVRRRYWDLPGYRLPIAKMSLI"
     gene            <1124752..1125633
                     /locus_tag="CNA04180"
                     /db_xref="GeneID:3253363"
     mRNA            join(<1124752..1124905,1124949..1125281,1125393..1125633)
                     /locus_tag="CNA04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_566781.1"
                     /db_xref="GI:58258736"
                     /db_xref="GeneID:3253363"
     CDS             join(1124752..1124905,1124949..1125281,1125393..1125496)
                     /locus_tag="CNA04180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566781.1"
                     /db_xref="GI:58258737"
                     /db_xref="GeneID:3253363"
                     /translation="MIQRMRWKKAISSRTIKEDHLQEVNKHGRCVKPGELNVFVRLRN
                     IFIFHQVLPPPSNPTSDLLQAIHHHASHFYTSTSLLIPPKKRQRAAPWASKKRVEVLK
                     DSLLSKGHAQGIESLVNERGEFVSVAREEKVDGGDIRGPRGKYKVRDMYRAIEGEGLM
                     AIGYQPGEGSQAGIESKGDNEAQGGNEEEENGGPER"
     gene            complement(1125636..1128695)
                     /locus_tag="CNA04190"
                     /db_xref="GeneID:3253361"
     mRNA            complement(join(1125636..1125812,1125867..1126477,
                     1126531..1126617,1126669..1126694,1126742..1126806,
                     1126859..1126921,1126973..1127236,1127287..1127415,
                     1127463..1127816,1127872..1128001,1128054..1128283,
                     1128363..1128695))
                     /locus_tag="CNA04190"
                     /product="palmitoyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530062|gb|CF675903.1,gi|41545305|gb|CF691146.1,
                     gi|41548815|gb|CF694656.1,gi|41548825|gb|CF694666.1,
                     gi|41560756|gb|CF706597.1,gi|41560759|gb|CF706600.1,
                     gi|41561126|gb|CF706967.1,gi|41568704|gb|CF714545.1,
                     gi|41571940|gb|CF717781.1,gi|41576064|gb|CF721905.1"
                     /transcript_id="XM_566783.1"
                     /db_xref="GI:58258740"
                     /db_xref="GeneID:3253361"
     CDS             complement(join(1125651..1125812,1125867..1126477,
                     1126531..1126617,1126669..1126694,1126742..1126806,
                     1126859..1126921,1126973..1127236,1127287..1127415,
                     1127463..1127816,1127872..1128001,1128054..1128283,
                     1128363..1128572))
                     /locus_tag="CNA04190"
                     /codon_start=1
                     /product="palmitoyltransferase"
                     /protein_id="XP_566783.1"
                     /db_xref="GI:58258741"
                     /db_xref="GeneID:3253361"
                     /translation="MDQEMTTVASPDIRVKATSPDSNRAVLEQSIVLSDSGRLDEGSS
                     IRGGELERDSQEVGRETVREPLMCHDLDIHALAQRGDTAAIAAMLQENPSLNLSARDA
                     QDVTPLHWAAINAHMGTCRLLIDSGADIDAIGGELKATPLQWAARNGHLYVVHLLISR
                     GADPNIHDSQGFNTLHLITHSSAVMPLLYMLHQPVAIDEKDTDGHTALMWAAYQGDAL
                     SVDLLIRHGASVNSTDNAGMTPLHWAAVKGNKVSIMHLVEAGASLDAKEEAGKTPRDM
                     AEELRGLVPFQKGLEEAGWSIDGVKMEGKLGPRNTILAIFLLPIAVLWLIFSTFKWLP
                     VYVGVPFAIAEFMGMQYTVVLVLLGHIKAQDKVSTSNYFASIITASLIWVGYCWISRF
                     AVNTPGYAFSNLGFIIMFVGCCWTFWTAIVTDPGFVPKGQQDAEIKEVLEDLVDAGRL
                     NGTNFCIVCMARKPLRSKHCRTCNRCVARFDHHCPWIWNCVGAKNHRSFLLFVLFLIG
                     GIILFIRLTIAYIQQNAPEYIPTPNPGLTTCDISTTLCQAGDFDPFLLCMALWSTLQL
                     TWTSVLAISHLWQVSRQMTTFEVSNLGRYGFMGGRGGQSLRDQSGAMLKQAAAVGAGI
                     GMSGAGEEAAGPPGAEAGPEGNALLPPPGGHVHGPQCRHGDHARGHSHGVLHICGALW
                     KTLTGPLMTILGLDRFTKGKALGGMKRAGRDQNPFDMGMVKNCIDFWLPDNDVDYMTV
                     YEIPPGGWRAYRRKLAMDKRVPGGKGRYEVVSEQEV"
     gene            complement(<1129244..>1129642)
                     /locus_tag="CNA04200"
                     /db_xref="GeneID:3253668"
     mRNA            complement(join(<1129244..1129383,1129438..>1129642))
                     /locus_tag="CNA04200"
                     /product="ubiquitin-protein ligase, putative"
                     /transcript_id="XM_567169.1"
                     /db_xref="GI:58259512"
                     /db_xref="GeneID:3253668"
     CDS             complement(join(1129244..1129383,1129438..1129642))
                     /locus_tag="CNA04200"
                     /codon_start=1
                     /product="ubiquitin-protein ligase"
                     /protein_id="XP_567169.1"
                     /db_xref="GI:58259513"
                     /db_xref="GeneID:3253668"
                     /translation="MKVEINSYRAVAYWIWDVSDEPHKLYHYAPPDEVGLDDDDDQDV
                     CGICQAAFESTCPDCKIPGDDCPLIWGECTHVFHMHCLLKWIGQKEDESQQQCPMDRR
                     PWGKSSIKSLCS"
     gene            1129896..1131045
                     /locus_tag="CNA04210"
                     /db_xref="GeneID:3253693"
     mRNA            join(1129896..1129913,1129973..1130060,1130118..1130549,
                     1130614..1131045)
                     /locus_tag="CNA04210"
                     /product="expressed protein"
                     /transcript_id="XM_567163.1"
                     /db_xref="GI:58259500"
                     /db_xref="GeneID:3253693"
     CDS             join(1129900..1129913,1129973..1130060,1130118..1130549,
                     1130614..1130997)
                     /locus_tag="CNA04210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567163.1"
                     /db_xref="GI:58259501"
                     /db_xref="GeneID:3253693"
                     /translation="MGFTLLLQWSCTPPAGRAVSLADVVCARVLESYGHNPPSRLGLQ
                     VRTYRAQFPLSPTTDDNNQDNNNQVSRYLTIISNLMPPAQPGEAKTNAPIIKDDTAYL
                     FLDDRSSTATGGESEHVNRATETSTAAHSSDPIPLQMDEEGKRFRCVAVRPSTAVIPM
                     LQSLLSPFVMGLTKAARTTASQTSSTPVPTSLPGSTLLMTVLTFNALLSPQPPVILRL
                     YILPNQSASSIFLEGEYAGSVDGKSEEEIEGEVKKYLESCLITDLLGERRWIDCSRGQ
                     ENWRAWDDAERNKCAMLTLAKTLRQGNFI"
     gene            complement(1131031..1135280)
                     /locus_tag="CNA04220"
                     /db_xref="GeneID:3253380"
     mRNA            complement(join(1131031..1131226,1131279..1131343,
                     1131400..1131621,1131675..1131803,1131845..1131886,
                     1131938..1132255,1132310..1132603,1132656..1132739,
                     1132794..1132999,1133047..1133218,1133269..1133350,
                     1133399..1133655,1133714..1133823,1133948..1134135,
                     1134186..1134350,1134404..1134802,1134857..1134915,
                     1134975..1135106,1135172..1135280))
                     /locus_tag="CNA04220"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538286|gb|CF684127.1,gi|41549655|gb|CF695496.1,
                     gi|41549668|gb|CF695509.1"
                     /transcript_id="XM_566764.1"
                     /db_xref="GI:58258702"
                     /db_xref="GeneID:3253380"
     CDS             complement(join(1131127..1131226,1131279..1131343,
                     1131400..1131621,1131675..1131803,1131845..1131886,
                     1131938..1132255,1132310..1132603,1132656..1132739,
                     1132794..1132999,1133047..1133218,1133269..1133350,
                     1133399..1133655,1133714..1133823,1133948..1134135,
                     1134186..1134350,1134404..1134802,1134857..1134915,
                     1134975..1135106,1135172..1135264))
                     /locus_tag="CNA04220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566764.1"
                     /db_xref="GI:58258703"
                     /db_xref="GeneID:3253380"
                     /translation="MESLTMDEESPTPSLVSFPVLPQSDLTQVAQTILQLFDPATSSN
                     PAQAKYLQSELQKIQGTPEAWGLIAGLANHEDTNVRFFGAHTAQVKISRDWDTLPQEL
                     HQGLLALLLETLSGAINPKNPHSYQPGNAVVVRKIFGSVSVVRIFIPATALILTMRKL
                     ASLLLRLEFTIFSHPIHTVIQSMQYAFSQADTQSIGVNLALRLRLLELEWCAICVEEM
                     GRAGLAEQRRAAIRRHVESDLKVVVRTVIRSMNGDNASSTDERLREAEAACKCVESWI
                     DWGLGADELNEVLPVLYNLLPLPAACSAVVEVLSESIFKYGKGTKILTEPLISWATGP
                     SGQSILGLTEEEWLVAHIQESQVQTFLGMVLRITGWKGIAGVEENISELTLPIYSLLQ
                     EALMDSDLFQAPHQTHPAWLIAKQFFAELVSVTRRKVRWPGEGEVPHGDTLGGLEKDD
                     REAFSRWRRDAGEVVVGAYYVLREEMMQNLTQTAAQQIQDGASWQDVEATLHCIRYSS
                     EAVPLGEDQSLPVLFGEQALGLLTQRPIGGLGEDRLRLTVVCLIQSYEEWFKFHPTHL
                     APCLSYLVPSLTSRNHSISRSAADALKALCDMCRKKLVEHIGAFSELHGKIGDMGSEE
                     QSKVIQGISSVIQALPPKEAIGPVEAIVNPIIDRMQAAVSTSRTNALEAQPLLIQTIN
                     SLTACLKGLSPSDDEIFDAVDGEDQKEEEVKRVRGDERMARLREKTFVAIEGVVGVWN
                     GDSEIADAISSLLKHVSPNPPTLISLPPLPLLSLVTLACSRAPSALWFTLASTVILSI
                     SAPPSFLIKKKDLAAREDEAMRAREEQEKWETVGQCGGRLVEIAQGLFQGEGMKENPD
                     IVEGWFKFCHSFAERYPGVLLRLQPHQVESYIQLGLAGLRLHERFSLKSASDFFVALL
                     SKTRFPSPLEAIFDPLLVAFGPSLLHALILSAGSEGPRSVIPNLAELLAGLVTRVSGD
                     VMSAWLEGVLSIDGFPDPRATLESKKKLKTAVLKSRTARRMREALHEFALVSRGLEGT
                     TYGNATAI"
     gene            1135541..1137029
                     /locus_tag="CNA04230"
                     /db_xref="GeneID:3253378"
     mRNA            join(1135541..1135910,1135974..1136370,1136423..1137029)
                     /locus_tag="CNA04230"
                     /product="general RNA polymerase II transcription factor,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41563509|gb|CF709350.1,gi|41564023|gb|CF709864.1"
                     /transcript_id="XM_566766.1"
                     /db_xref="GI:58258706"
                     /db_xref="GeneID:3253378"
     CDS             join(1135562..1135910,1135974..1136370,1136423..1136996)
                     /locus_tag="CNA04230"
                     /codon_start=1
                     /product="general RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_566766.1"
                     /db_xref="GI:58258707"
                     /db_xref="GeneID:3253378"
                     /translation="MSSNFYTSSHNRYWLLTRPSLLESRQTDLKYCTSRQLYCLFIFF
                     SQLIQKLGKRLLLRQIPIATACVFFKRFYFKNSLCETNPYLVLAACIYVAAKVEETPV
                     HIKSVVSEAKLVFHEHNIKMFPAETNKLGEMEFYLLEDLDFHLVVFHPYRALLHLTGR
                     ESADMGKFEKSRVQEDMEIRKKEGDAKKMREEEAKKASSKGQQPTVGQALEKEGERLE
                     EAEETRIRRLMSRGTGEGMMEVDEGVLQISWFILNDSYRTDAPLLYPPYIIALSAIYI
                     AFCLTSMSNSSARTRASSTQRPELLQSASINEGLNLLPPPKNAAEFLAGFQVSLPMLF
                     GCVQEIIGLYPVWEAFEPTVMRNSQAQAKTGNAAAPVPAATGTKTGQNNDLVQDKKDK
                     FGLEEAESLVRKMIEERMIDLGHPDNAGVEKASGTGPSNVAGKKRAR"
     gene            complement(1137059..1139158)
                     /locus_tag="CNA04240"
                     /db_xref="GeneID:3253376"
     mRNA            complement(join(1137059..1137324,1137382..1137783,
                     1137836..1138504,1138555..1138710,1138760..1138828,
                     1138888..1139158))
                     /locus_tag="CNA04240"
                     /product="IMP dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529933|gb|CF675774.1,gi|41529942|gb|CF675783.1,
                     gi|41531940|gb|CF677781.1,gi|41531946|gb|CF677787.1,
                     gi|41536136|gb|CF681977.1,gi|41536147|gb|CF681988.1,
                     gi|41536414|gb|CF682255.1,gi|41537187|gb|CF683028.1,
                     gi|41537198|gb|CF683039.1,gi|41543080|gb|CF688921.1,
                     gi|41543087|gb|CF688928.1,gi|41548702|gb|CF694543.1,
                     gi|41553551|gb|CF699392.1,gi|41554366|gb|CF700207.1,
                     gi|41554378|gb|CF700219.1,gi|41555793|gb|CF701634.1,
                     gi|41555800|gb|CF701641.1,gi|41559678|gb|CF705519.1,
                     gi|41559682|gb|CF705523.1,gi|41564929|gb|CF710770.1,
                     gi|41564936|gb|CF710777.1,gi|41565141|gb|CF710982.1,
                     gi|41565149|gb|CF710990.1,gi|41565429|gb|CF711270.1,
                     gi|41565433|gb|CF711274.1,gi|41566577|gb|CF712418.1,
                     gi|41566585|gb|CF712426.1,gi|41569164|gb|CF715005.1,
                     gi|41569171|gb|CF715012.1,gi|41570828|gb|CF716669.1,
                     gi|41570834|gb|CF716675.1,gi|41572600|gb|CF718441.1,
                     gi|41572611|gb|CF718452.1,gi|41573457|gb|CF719298.1,
                     gi|41573463|gb|CF719304.1,gi|41575883|gb|CF721724.1"
                     /transcript_id="XM_566768.1"
                     /db_xref="GI:58258710"
                     /db_xref="GeneID:3253376"
     CDS             complement(join(1137201..1137324,1137382..1137783,
                     1137836..1138504,1138555..1138710,1138760..1138828,
                     1138888..1139102))
                     /locus_tag="CNA04240"
                     /codon_start=1
                     /product="IMP dehydrogenase"
                     /protein_id="XP_566768.1"
                     /db_xref="GI:58258711"
                     /db_xref="GeneID:3253376"
                     /translation="MADTNPNAPPRSDSLLNPADALKYLEEYPRGDGLSLQELMDSRK
                     NGGLTYNDFLVLPGHISFPASDVSLQSRATKNIVLNTPFLSSPMDTVTEDRMAIALAL
                     HGGLGIIHHNCSAEEQAAMVRRVKKYENGFITDPLCLGPDATVGDVLEIKAKFGFCGV
                     PITETGAPNSKLLGIVTGRDVQFQDAETPIKSVMTTEVVTGSSPITLEKANSLLRETK
                     KGKLPIVDSNGHLVSLVARSDLLKNQNYPYASKVPESKQLYCGAAIGTRPGDKDRLKL
                     LAEAGLDVVVLDSSQGDSVYQIEFIKWIKQTYPKIEIIAGNVVTREQAAQLIAAGADG
                     LRIGMGSGSICITQEVMAVGRPQGTAVYAVAEFASRFGIPCIADGGIGNIGHIAKALA
                     LGASAVMMGGLLAGTTESPGEYFYHEGKRVKVYRGMGSIEAMEHTQRGSASGKRSILN
                     LDNAATARYFSEADAVKVAQGVSGDVADKGSINKFVPYLFTGLQHSFQDAGVKSVSEL
                     HSCARSGSLRFELRTASAQLEGGVHGLNSYTKRLFA"
     gene            1140361..1142303
                     /locus_tag="CNA04250"
                     /db_xref="GeneID:3253374"
     mRNA            join(1140361..1140828,1140882..1141187,1141238..1142303)
                     /locus_tag="CNA04250"
                     /product="cyclin, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532684|gb|CF678525.1,gi|41532696|gb|CF678537.1,
                     gi|41533540|gb|CF679381.1,gi|41533546|gb|CF679387.1,
                     gi|41538558|gb|CF684399.1,gi|41538567|gb|CF684408.1,
                     gi|41539476|gb|CF685317.1,gi|41539477|gb|CF685318.1,
                     gi|41540549|gb|CF686390.1,gi|41540559|gb|CF686400.1,
                     gi|41543156|gb|CF688997.1,gi|41543159|gb|CF689000.1,
                     gi|41544361|gb|CF690202.1,gi|41544990|gb|CF690831.1,
                     gi|41545003|gb|CF690844.1,gi|41545341|gb|CF691182.1,
                     gi|41545348|gb|CF691189.1,gi|41546358|gb|CF692199.1,
                     gi|41546364|gb|CF692205.1,gi|41550843|gb|CF696684.1,
                     gi|41550851|gb|CF696692.1,gi|41551447|gb|CF697288.1,
                     gi|41551458|gb|CF697299.1,gi|41551615|gb|CF697456.1,
                     gi|41551622|gb|CF697463.1,gi|41552660|gb|CF698501.1,
                     gi|41552667|gb|CF698508.1,gi|41554317|gb|CF700158.1,
                     gi|41554326|gb|CF700167.1,gi|41555397|gb|CF701238.1,
                     gi|41555399|gb|CF701240.1,gi|41557831|gb|CF703672.1,
                     gi|41557838|gb|CF703679.1,gi|41558857|gb|CF704698.1,
                     gi|41558872|gb|CF704713.1,gi|41561626|gb|CF707467.1,
                     gi|41561631|gb|CF707472.1,gi|41564689|gb|CF710530.1,
                     gi|415"
                     /transcript_id="XM_566770.1"
                     /db_xref="GI:58258714"
                     /db_xref="GeneID:3253374"
     CDS             join(1140723..1140828,1140882..1141187,1141238..1142106)
                     /locus_tag="CNA04250"
                     /codon_start=1
                     /product="cyclin"
                     /protein_id="XP_566770.1"
                     /db_xref="GI:58258715"
                     /db_xref="GeneID:3253374"
                     /translation="MPSRNPIHPASLCRLSTHNKPLVECLRTRVRSEFLAHVAEQTCS
                     VIRISPSAPSTPSTSYLPTPPASPSGEHYDEDGKPSEWWQAPNGTEDDLDVDLPELQE
                     FIRGLVVQSNVQMPTLSVTLVYLERLREKLPAVATGMKCTRHRVFLAVLICAAKYLND
                     SSPKNMHWQKYGKFFSLAEVNLMEKQLLYLLDYNLRVEEDELVRHLEGFGPSVLAPAT
                     SSAPSSVSVQAAPDQLRVPAVIPRTKTSPSASSRLRTGPNKSRSTNFERPFNPTADIA
                     SHHSRPVDLQRSHTNEHIGSSCQPRSYRPAPIHIPRAITCSSSPGSASSSASSVLYGD
                     IPTPGLGRDSSDAGDSPQAARTPDEGRWGRYGYGGVPVPVSVPGRLYKMSCEPTIVGL
                     SSASPVACVKSPIGTEKQREGLLKRAGRTFKRII"
     gene            complement(1142556..>1144207)
                     /locus_tag="CNA04260"
                     /db_xref="GeneID:3253372"
     mRNA            complement(join(1142556..1143711,1143784..1143908,
                     1143966..1144058,1144121..>1144207))
                     /locus_tag="CNA04260"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41570314|gb|CF716155.1,gi|41570321|gb|CF716162.1"
                     /transcript_id="XM_566772.1"
                     /db_xref="GI:58258718"
                     /db_xref="GeneID:3253372"
     CDS             complement(join(1142577..1143711,1143784..1143908,
                     1143966..1144058,1144121..1144207))
                     /locus_tag="CNA04260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566772.1"
                     /db_xref="GI:58258719"
                     /db_xref="GeneID:3253372"
                     /translation="MACFPYINQMLLDTGVVDDPRKTGFYAGLIESMFAVAELLTVFQ
                     WGTASDRWGRKPVLLIGCAGAALSSILFGFATTFPMMVLTRVINGLANGNVAVLKSVI
                     GELCDETNQSVAFSFFPLSMAIGTILASAIGGYFPRITDRYPKLGQTIPILDRYPYLL
                     PCLVAAIFPLISGLVAWIWMEETLPPKTKGMQVEDQSQSRSQVHHAHSHTTVHYSSTD
                     EGDTRVEGATDHHNTWAPPGHIDDHEDDAPVSFRDLLTPDINALMTSFGLLQLQGISF
                     LGLLPLFCFTPVPSGGLSFPSGKIGLAMSIRGVSTIAVQLFAFPWLSKRIGTVKLYKM
                     LVILFIPAFVLLPFCNVMARSGRDAWVWIGLSGSMVLYAIGNMAFGTHDRLIGLFCLL
                     LTLSSACNLIMVNDAAPNRRSLGAINGWSQAVSSLMRAIGPGTSSALFALSVDKHVME
                     GQLIWVVLSVLSVVSAMAALMLKNHHRKV"
     gene            1147503..1151144
                     /locus_tag="CNA04270"
                     /db_xref="GeneID:3253370"
     mRNA            join(1147503..1147757,1147853..1147933,1148081..1148301,
                     1148358..1148695,1148789..1149969,1150022..1151144)
                     /locus_tag="CNA04270"
                     /product="HMG1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41547704|gb|CF693545.1,gi|41547716|gb|CF693557.1,
                     gi|41550798|gb|CF696639.1,gi|41555815|gb|CF701656.1"
                     /transcript_id="XM_566774.1"
                     /db_xref="GI:58258722"
                     /db_xref="GeneID:3253370"
     CDS             join(1147883..1147933,1148081..1148301,1148358..1148695,
                     1148789..1149969,1150022..1150918)
                     /locus_tag="CNA04270"
                     /codon_start=1
                     /product="HMG1"
                     /protein_id="XP_566774.1"
                     /db_xref="GI:58258723"
                     /db_xref="GeneID:3253370"
                     /translation="MQSTNAPVNGGVSQQWQSAMQGMYSGAQQRPTSNSKPYNAPDAN
                     GMPAKKDDANQSMYSVNTENGYPAYQQQGYGTLGGLGQYGYNSAGLGGLSAAYGGATS
                     STAGATNGRRTSGQRMMTPPPHPSSVATNTSPSARYYTGQEGEAGRHASPYQPASAPP
                     QILSHQFNAMTNSPQTAQGYPQYQYNQQSHQQNPTQWAGYPTYARQQPTSMYDYTTHA
                     LQQWPASDLSKVPSAHQNSWQNAQSLSRLTQAQSPALGQTQPSSASQPTSSTSSTQNA
                     SPAVPQSGWQGYPSIPSIPPHTLGGGHLMSGQPYGWGHTQQWGGYYGAQQPSQAPQGT
                     PAHRPPLNNFPTGSTSSAPAESLPTGRKRMSKDKGKTAKEKEENRSHFEDYHGLGKRS
                     AEAVVEEIPGEDKKESKKKKGKEEKEKPVPKAKSHLHPPKQAPSSWQLFFADELAKAK
                     AAEPESRSPGGTSHPQKLNVAQIAKEAGVAYANLSEERKKYYAERVKEHREIYAKELA
                     AWQATLTPEDIRAENAFRAQQRKEGKSRKGNIKDPNAPKKPLSAYFLFLKAIRENSDI
                     RAQVWGTEAETTKQSVMAAEKWRSLTDDEKRPYLEQAEHDKQTYETARKQYEEDSAAR
                     ARGEDVPIRAVEAPASPPKPPASILRSIHGGQAPVTKSSPSVTDSAPHPAPHSDLEPG
                     ITSLGKSPSPNPPSEPSLAQFHTSPRSVPHYDPSLEVDDFQGFSDPLNMDLSGLDGID
                     VGSMEVGAGGDSEQPWDELQKLIGTEDVYSSAKLQPAAHIVPDASTAARVAPASGFES
                     TDISVAPSYAEAKNETQQETSLNGTPEGNGNESKVRHIAEAAEGELAVLPALGENTAQ
                     KNQGGLEVMVGAGEARRHNKNLSTESGQAAADAPVVDGV"
     misc_feature    1149391..1149435
                     /locus_tag="CNA04270"
                     /note="GA-rich"
     gene            complement(1151724..1153626)
                     /locus_tag="CNA04280"
                     /db_xref="GeneID:3253368"
     mRNA            complement(join(1151724..1151800,1151856..1152586,
                     1152644..1152732,1152780..1153349,1153398..1153509,
                     1153564..1153626))
                     /locus_tag="CNA04280"
                     /product="t-complex protein 1, beta subunit (tcp-1-beta),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533674|gb|CF679515.1,gi|41533682|gb|CF679523.1,
                     gi|41534158|gb|CF679999.1,gi|41534164|gb|CF680005.1,
                     gi|41536632|gb|CF682473.1,gi|41536641|gb|CF682482.1,
                     gi|41540475|gb|CF686316.1,gi|41540479|gb|CF686320.1,
                     gi|41541892|gb|CF687733.1,gi|41543167|gb|CF689008.1,
                     gi|41543173|gb|CF689014.1,gi|41550208|gb|CF696049.1,
                     gi|41550210|gb|CF696051.1,gi|41556220|gb|CF702061.1,
                     gi|41556223|gb|CF702064.1,gi|41557913|gb|CF703754.1,
                     gi|41557921|gb|CF703762.1,gi|41561015|gb|CF706856.1,
                     gi|41561019|gb|CF706860.1,gi|41561329|gb|CF707170.1,
                     gi|41561334|gb|CF707175.1,gi|41565240|gb|CF711081.1,
                     gi|41565249|gb|CF711090.1,gi|41569508|gb|CF715349.1,
                     gi|41569516|gb|CF715357.1,gi|41574748|gb|CF720589.1,
                     gi|41574753|gb|CF720594.1"
                     /transcript_id="XM_566776.1"
                     /db_xref="GI:58258726"
                     /db_xref="GeneID:3253368"
     CDS             complement(join(1151752..1151800,1151856..1152586,
                     1152644..1152732,1152780..1153349,1153398..1153509,
                     1153564..1153584))
                     /locus_tag="CNA04280"
                     /codon_start=1
                     /product="t-complex protein 1, beta subunit (tcp-1-beta),
                     putative"
                     /protein_id="XP_566776.1"
                     /db_xref="GI:58258727"
                     /db_xref="GeneID:3253368"
                     /translation="MNVFADEATEERGENARLSSFVGAMALGDLVKSTLGPKGMNKIL
                     QSASNSTITVTNDGATILKSIHLDNPAAKILVNISKVQDDEVGDGTTSVCVLASELLR
                     EAEKLVTVQKIHPQTVAEGYRIASRAALQALEASAVDNKNDNAKFREDLFNIARTTLS
                     SKVLAQDKDYFANLAVDAVLRLKGSTDLEHIQIIKKVGGKLTDSYLDEGFILDKTIAT
                     NSPKRIENAKILIANTSMDTDKIKIFGARVRVDGTGKLAELERAEKEKMKAKVQAIAS
                     HGITCFVNRQLIYNYPESLLAEAGIMSIEHADFEGVERLALVTGGDIASTFDAPEKVK
                     IGRCDVIEEIMIGEDKLIKFSGVAAGEACTVVLRGATSQMVEEAERSLHDALSVLSQT
                     VKETRVTLGGGCAEMLMSCQVEEAARTVKGKKALAVEGFARALRQMPTIIADNGGYDS
                     SDLVTKLRAAHYEGQSDAGLDMDKGEIGSMRQLGITESFKLKKQVVVSASEAAEMILR
                     VDNILRSAPRRREAH"
     gene            1153779..1155229
                     /locus_tag="CNA04290"
                     /db_xref="GeneID:3253366"
     mRNA            join(1153779..1153986,1154041..1154140,1154187..1154537,
                     1154587..1155229)
                     /locus_tag="CNA04290"
                     /product="vacuolar ATP synthase subunit d, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41550156|gb|CF695997.1,gi|41550157|gb|CF695998.1"
                     /transcript_id="XM_566778.1"
                     /db_xref="GI:58258730"
                     /db_xref="GeneID:3253366"
     CDS             join(1153966..1153986,1154041..1154140,1154187..1154537,
                     1154587..1155185)
                     /locus_tag="CNA04290"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="vacuolar ATP synthase subunit d"
                     /protein_id="XP_566778.1"
                     /db_xref="GI:58258731"
                     /db_xref="GeneID:3253366"
                     /translation="MEALGFNMSSGYLEGVVRGYKGALLTQSNYHNLTQCENLEDFRL
                     QLSSTDYGSFLANEPLPLSTSTIADKATEKLVAEFHYLRTNAVEPLATFMDYITYAYM
                     IDNVILLTLGTLHERDTHELLERCHPLGVFDTMPALCVATNVEELYHSVLVETPLAPY
                     FQDCLSAQDLDDLNIEIIRNSLYKSYLEDFHKFCQTLPAPTSEIMSRILAFEADRRTL
                     NITINSFGTELSKEQRARLFPSIGRLFPEGNNALARADDIDAVVAAVDHIAEYKAFFD
                     KAGVTSGGGAGTDEASSSLEDEFFKHDVDLNKQSFLQQFQYAVFYSFVKLKEQEVRNL
                     TWIAECIAQDAKDRVNDYIPVF"
     gene            complement(1156733..1158671)
                     /locus_tag="CNA04300"
                     /db_xref="GeneID:3253364"
     mRNA            complement(join(1156733..1156906,1156958..1157136,
                     1157189..1157513,1157563..1158193,1158246..1158671))
                     /locus_tag="CNA04300"
                     /product="art-4 protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41543966|gb|CF689807.1,gi|41543971|gb|CF689812.1,
                     gi|41576430|gb|CF722271.1,gi|41576439|gb|CF722280.1"
                     /transcript_id="XM_566780.1"
                     /db_xref="GI:58258734"
                     /db_xref="GeneID:3253364"
     CDS             complement(join(1157020..1157136,1157189..1157513,
                     1157563..1158193,1158246..1158657))
                     /locus_tag="CNA04300"
                     /codon_start=1
                     /product="art-4 protein"
                     /protein_id="XP_566780.1"
                     /db_xref="GI:58258735"
                     /db_xref="GeneID:3253364"
                     /translation="MVLSYSAIAKPTADTPKVISMTASKQVFPEAFEALPAPAAEESQ
                     ELESQPEALAQASSSTIEAPISSEDRKVIQHLILDAGPLLSLTPLRHLATSFHTTPMV
                     LAELRDPKAREHWERLALTGVNVKVESPTAEAMAQVTAFAKKTGDFAVLSQTDLSVAA
                     LTYQYEVMVNGVKRIRTEPPQAKKPSAKGKEKEKDTKQAEKKDEEVQENKNEKEGKPE
                     EEDVEVEEAIQSLSQIIIEPSTKSELSVNDVSTTNRSHTQTSVPASAHAEDPESEGEW
                     INPTNLSTHRSRDLGLITPSGSTAKPPAVACMTGDYAVQNILLGMRLGLVGEGGKKIG
                     KVKSWVLRCHACFKVCKDPSKRFCPSCGNATLLRTSVSTSAKTGEQRVHLKQNFQYRT
                     RGTIYSIPDPKMGRAKGQQKGGSGLILREDQREWQDAMRGDRIKKEKEERKAAKGALE
                     GWNDPDWLPEMITVGMSGKGRSGGHNMPSIGHGRKNPNQAKRRR"
     repeat_region   1158022..1158044
                     /rpt_type=tandem
                     /rpt_unit_seq="ttctcc"
                     /satellite="microsatellite"
     gene            1158946..1160458
                     /locus_tag="CNA04310"
                     /db_xref="GeneID:3253362"
     mRNA            join(1158946..1158985,1159033..1159067,1159127..1159300,
                     1159352..1159555,1159611..1159935,1159983..1160090,
                     1160140..1160458)
                     /locus_tag="CNA04310"
                     /product="3-isopropylmalate dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544644|gb|CF690485.1,gi|41544652|gb|CF690493.1,
                     gi|41561154|gb|CF706995.1,gi|41561679|gb|CF707520.1,
                     gi|41571800|gb|CF717641.1,gi|41571811|gb|CF717652.1"
                     /transcript_id="XM_566782.1"
                     /db_xref="GI:58258738"
                     /db_xref="GeneID:3253362"
     CDS             join(1158972..1158985,1159033..1159067,1159127..1159300,
                     1159352..1159555,1159611..1159935,1159983..1160090,
                     1160140..1160401)
                     /locus_tag="CNA04310"
                     /codon_start=1
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="XP_566782.1"
                     /db_xref="GI:58258739"
                     /db_xref="GeneID:3253362"
                     /translation="MADKTFKITVLPGDGIGPEVVAEAVRVLETIVNHSDLKLDLKSY
                     DFGGAAIDNHGVPLPDETLKACKEADAVLMGSVGGPKWGVGPVRPEQGILKLRKELGL
                     YANIRPANFASESLLKRSPLKEDTARGTDIIVLRELIGGIYFGERQETNDEGVAWDQC
                     IYSKPEIERITRVAAQIALAAEPPLPITSVDKANVLATSRLWRKTVSELMAKEYPQLK
                     LEHQLVDSAAMIMIANPRKLNGVLLTENMFGDILSDESSVIPGSLGLLPSASLAGAPD
                     AKSTTMGLYEPIHGSAPDIAGQGIANPIGTILSAAMMLRYSLGKGREAALIEQAVQKV
                     LDSAESGGFDYRTKDLGGQRSTKEVGDKVVEVLKGLLGA"
     gene            <1160722..>1162530
                     /locus_tag="CNA04320"
                     /db_xref="GeneID:3253360"
     mRNA            join(<1160722..1160842,1160902..1161102,1161161..1161363,
                     1161422..1161724,1161787..>1162530)
                     /locus_tag="CNA04320"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_566784.1"
                     /db_xref="GI:58258742"
                     /db_xref="GeneID:3253360"
     CDS             join(1160722..1160842,1160902..1161102,1161161..1161363,
                     1161422..1161724,1161787..1162530)
                     /locus_tag="CNA04320"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_566784.1"
                     /db_xref="GI:58258743"
                     /db_xref="GeneID:3253360"
                     /translation="MTCTIHPSLPETDTHKDYARFYFDTTNVPDKRIVGLLACQRDPL
                     LRILRTKVHAAREADITSPPPPKGKAKQKKGAAFTSEQNVALKEESKGKLWEVELLDT
                     IIFPEGGGQPSDTGVMRLLDPNGGVSHTFPIEMCLRRKLDSVHLIRIPSGIEIDLREG
                     REVEVEADWDRRIDQMSIHTSQHLLSAILETHLSLPTLSWSMQPYPSIEPAYVELPRA
                     LTPEEAMGIERLCGEAIKQCKKIWVDFTIQGDDVGKENIGAGSVGTREMRGLPKDYDG
                     GVIRHINIQDTDRNACCGTQSPNTSLLSLLHVIPPTLSNSSKPSPTKLYFLSGPRAIL
                     ALQQASRTLSAAAKAVGYGRADLVERLERAEVARKDTADSLKGLRTELAKLVGEQAVK
                     AGKEGKSVTLVEREEKGTHDFDWLGLVGATYLESFSASGQNTDGKTPPSPLIILTSSI
                     TPASTTSQTLLLIQSPDNDLAKYVNEKIKTALAGRVKGGGARGRYMSKIDGKWGKIEK
                     DALAKVIDDLRADRV"
     gene            1162805..1165523
                     /locus_tag="CNA04330"
                     /db_xref="GeneID:3253750"
     mRNA            join(1162805..1162866,1162928..1162993,1163062..1163145,
                     1163193..1163298,1163351..1163391,1163444..1163486,
                     1163540..1163705,1163769..1163913,1163965..1164019,
                     1164068..1164158,1164217..1164320,1164379..1164461,
                     1164766..1164837,1164917..1164938,1165138..1165523)
                     /locus_tag="CNA04330"
                     /product="Isovaleryl-CoA dehydrogenase 2, mitochondrial
                     precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537473|gb|CF683314.1,gi|41537476|gb|CF683317.1,
                     gi|41541491|gb|CF687332.1,gi|41559980|gb|CF705821.1,
                     gi|41559990|gb|CF705831.1,gi|41563562|gb|CF709403.1,
                     gi|41563568|gb|CF709409.1,gi|41569553|gb|CF715394.1,
                     gi|41569559|gb|CF715400.1,gi|41572396|gb|CF718237.1,
                     gi|41572403|gb|CF718244.1"
                     /transcript_id="XM_567164.1"
                     /db_xref="GI:58259502"
                     /db_xref="GeneID:3253750"
     CDS             join(1162810..1162866,1162928..1162993,1163062..1163145,
                     1163193..1163298,1163351..1163391,1163444..1163486,
                     1163540..1163705,1163769..1163913,1163965..1164019,
                     1164068..1164158,1164217..1164320,1164379..1164461,
                     1164766..1164837,1164917..1164938,1165138..1165256)
                     /locus_tag="CNA04330"
                     /codon_start=1
                     /product="Isovaleryl-CoA dehydrogenase 2, mitochondrial
                     precursor"
                     /protein_id="XP_567164.1"
                     /db_xref="GI:58259503"
                     /db_xref="GeneID:3253750"
                     /translation="MMLPKAHACSRLLCSSSRLGTRRRYSSYNTAVAGLTEAQEEFRS
                     VVQHFAQKEIAPRAAEIDRTNKLPQDIFPKLGEMGLLGVTVPERWGGLGLGYLEHTIA
                     MEEISRASASVALSYGAHSNLLVNQLVRWGTEKQLSKYLPPLLTGKHIGSLAMSEPNA
                     GSDVVSMRTSATRSDEGEGWIMNGSKCWITNAPVSSTFLIYAKSDTNVAPSKGMTAFL
                     VEKGWKGFEVGEGLDKFGMRGSPTAELFFDNVKIPEENVLGKVGNGALVLMSGLDLER
                     LVLSGGPLGIMQAALDMALEYTHERKQFGKQIGTFQLMQGKLADMYTKLSASRAYVYA
                     VARACDAGMISRRDCAGAILYSSDRAVEVAIEAQQCLGGNGYINDYPAGRLVRDSRLY
                     TVGAGTQEIRRMLIGREFNEALSGL"
     gene            1165692..1167642
                     /locus_tag="CNA04340"
                     /db_xref="GeneID:3253656"
     mRNA            join(1165692..1165800,1165868..1166232,1166287..1166384,
                     1166441..1166548,1166611..1166811,1166913..1166969,
                     1167124..1167642)
                     /locus_tag="CNA04340"
                     /product="mitochondrion protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41565255|gb|CF711096.1,gi|41565263|gb|CF711104.1"
                     /transcript_id="XM_567165.1"
                     /db_xref="GI:58259504"
                     /db_xref="GeneID:3253656"
     mRNA            join(1165692..1165800,1165868..1166232,1166287..1166384,
                     1166441..1166548,1166611..1166868)
                     /locus_tag="CNA04340"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_567166.1"
                     /db_xref="GI:58259506"
                     /db_xref="GeneID:3253656"
     CDS             join(1165795..1165800,1165868..1166232,1166287..1166384,
                     1166441..1166548,1166611..1166732)
                     /locus_tag="CNA04340"
                     /codon_start=1
                     /product="mitochondrion protein"
                     /protein_id="XP_567165.1"
                     /db_xref="GI:58259505"
                     /db_xref="GeneID:3253656"
                     /translation="MKIVSQDDVRGYNDATIVGGIKGAFLAAAICIPGHMFLMKRSPY
                     IRALPLPLKALGHVTITVPCISIAAEKGGEAYNRAQYSGVGQREIDWELQIRNEKWEK
                     MSKLEKAGDWAARHKYGIIGGGWAASMALAFGIVARNPYQSTSQKVVQARMWAQGLTV
                     ALLVGSAMATGLGASNSSTPVESADHSWRRMLEHDEHLTPEERAQLRDTRDPTTAKEI
                     QKAVSQRKAAAAQA"
     gene            complement(<1167772..>1169904)
                     /locus_tag="CNA04350"
                     /db_xref="GeneID:3253356"
     mRNA            complement(join(<1167772..1168705,1168755..1169136,
                     1169186..1169302,1169358..1169528,1169778..>1169904))
                     /locus_tag="CNA04350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566789.1"
                     /db_xref="GI:58258752"
                     /db_xref="GeneID:3253356"
     CDS             complement(join(1167772..1168705,1168755..1169136,
                     1169186..1169302,1169358..1169528,1169778..1169904))
                     /locus_tag="CNA04350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566789.1"
                     /db_xref="GI:58258753"
                     /db_xref="GeneID:3253356"
                     /translation="MTTASPFLFQSSLHDTGLIHEMLSNPLKFGAPVNKKSLGFEAGL
                     FPSTFDLSWPEAIATAKRAAGLHNPSMACYANATLQVLLHTPPVLRIALTHDEGSCSQ
                     IKKKNFCMLCSLKHMAEGSHWSGRKAYAPGIHRSLSQIKKGFSKNRQEDTHEFFRFVT
                     DALQNTALAKLPKCVLPYNHRKFAHTTSRDTPEKIKHTSWVYRIWGGRVRSRVVCSRC
                     NNPSDTFDSFLDLSLDVNKQGKKSVLGMLAGFTKEDRLEGDNKYHCERCKRKANATKS
                     FKIDQAPPILTLHLKRFSVNYNPYSGRARAEKFNQPIKFEQTLDIAPYMVDPASPGTK
                     YRLFGVTCHRGTELRFGHYTSYVRGPSGQWFHADDDEVSPVQLEQVLNDKTAYLLSYI
                     RVDNGNEGLCESPAVRDRVKGLVNGSAKGMRDDESESQSEAESSSHKSSSPIKRKSTY
                     DPEDPPRMKIGAFVNNKAYAPSTNKSESPFSDGENKMPPELPKFGYKPKPTIRAPAPV
                     EASSFYTSPVARPSNSLAGMSKKEKKKFKHKEKGKPRHSATPMPFAQGRVGNGRNRQP
                     GVLSRMKGRA"
     gene            1171618..1173960
                     /locus_tag="CNA04360"
                     /db_xref="GeneID:3253354"
     mRNA            join(1171618..1172196,1172259..1172537,1172588..1172859,
                     1172911..1173960)
                     /locus_tag="CNA04360"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530029|gb|CF675870.1,gi|41530038|gb|CF675879.1,
                     gi|41530926|gb|CF676767.1,gi|41530944|gb|CF676785.1,
                     gi|41530953|gb|CF676794.1,gi|41530961|gb|CF676802.1,
                     gi|41531804|gb|CF677645.1,gi|41531810|gb|CF677651.1,
                     gi|41532260|gb|CF678101.1,gi|41532267|gb|CF678108.1,
                     gi|41532968|gb|CF678809.1,gi|41532985|gb|CF678826.1,
                     gi|41534157|gb|CF679998.1,gi|41534162|gb|CF680003.1,
                     gi|41534306|gb|CF680147.1,gi|41534311|gb|CF680152.1,
                     gi|41534644|gb|CF680485.1,gi|41534650|gb|CF680491.1,
                     gi|41534848|gb|CF680689.1,gi|41534859|gb|CF680700.1,
                     gi|41535213|gb|CF681054.1,gi|41535220|gb|CF681061.1,
                     gi|41535498|gb|CF681339.1,gi|41535509|gb|CF681350.1,
                     gi|41535655|gb|CF681496.1,gi|41535801|gb|CF681642.1,
                     gi|41535807|gb|CF681648.1,gi|41536015|gb|CF681856.1,
                     gi|41536024|gb|CF681865.1,gi|41536088|gb|CF681929.1,
                     gi|41536097|gb|CF681938.1,gi|41536248|gb|CF682089.1,
                     gi|41536263|gb|CF682104.1,gi|41536816|gb|CF682657.1,
                     gi|41536823|gb|CF682664.1,gi|41536880|gb|CF682721.1,
                     gi|41536884|gb|CF682725.1,gi|41537048|gb|CF682889.1,
                     gi|415"
                     /transcript_id="XM_566791.1"
                     /db_xref="GI:58258756"
                     /db_xref="GeneID:3253354"
     CDS             join(1171777..1172196,1172259..1172537,1172588..1172859,
                     1172911..1173760)
                     /locus_tag="CNA04360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566791.1"
                     /db_xref="GI:58258757"
                     /db_xref="GeneID:3253354"
                     /translation="MSTLPIYHPVPTDEKHPISATLVDGEFDPRYIHPAAIGSQYLYI
                     GGPRSAYQAAKDKYAGLSKVKKGLLALAVVWFGLVVGHQAARLAGGKCHQDAHHAPAE
                     FGVKQWRDHSSHRFGGPIFLEDGPLDCHGGRKDRAPEELSSVATVYESINVVGSNDAT
                     DILSANASFPLKLGRGKHFDLTFQGEGNVIISRAEEESEDSTVNVFVESTWSGEEAEG
                     VKMLSGKHSHALSVASSQSSSHIVHLVLPANKKRLPSISIFSTKDLTLDIHPSVQDIH
                     VGKLSLKSESGDIKLPTLAVNKLVAETVTGDVGGNFNVSNSFVVKTVTGNINAIVNVV
                     PHSPPKDKLNLHNVDAKHEHKKFDSRHGEHNHEKKHFGGRFHSEEERPSKWSLNIFKS
                     KKEDEPEHPPPPPVFIGAFSTSGNILLKVFGSPNVSTDTNVFSHTGDVDVTHDKSFHG
                     LYEVGSLKGTYDVVVRDGKVHRVLEEYVTEEGGKQKGLAFVPKNRKTEGSHEKRHFRN
                     AESVDGELPPPPPGKGHGPDGPDGPDGPGGPSGPGGPGGPDGPGGPGGPGGPGGPGGP
                     GGPGGPGPDHPRGPPPWVVFPPGHSEVFVHTEVGNAKIVL"
     gene            1175342..1177454
                     /locus_tag="CNA04370"
                     /db_xref="GeneID:3253352"
     mRNA            join(1175342..1175452,1175782..1175893,1176075..1176220,
                     1176297..1176599,1176650..1176814,1176864..1177205,
                     1177259..1177454)
                     /locus_tag="CNA04370"
                     /product="glutamate-ammonia ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530688|gb|CF676529.1,gi|41530700|gb|CF676541.1,
                     gi|41533128|gb|CF678969.1,gi|41534156|gb|CF679997.1,
                     gi|41534161|gb|CF680002.1,gi|41536056|gb|CF681897.1,
                     gi|41536066|gb|CF681907.1,gi|41536153|gb|CF681994.1,
                     gi|41536161|gb|CF682002.1,gi|41537153|gb|CF682994.1,
                     gi|41537163|gb|CF683004.1,gi|41537226|gb|CF683067.1,
                     gi|41537236|gb|CF683077.1,gi|41538058|gb|CF683899.1,
                     gi|41538613|gb|CF684454.1,gi|41538628|gb|CF684469.1,
                     gi|41539960|gb|CF685801.1,gi|41539967|gb|CF685808.1,
                     gi|41540859|gb|CF686700.1,gi|41540872|gb|CF686713.1,
                     gi|41541911|gb|CF687752.1,gi|41541922|gb|CF687763.1,
                     gi|41542298|gb|CF688139.1,gi|41542448|gb|CF688289.1,
                     gi|41542454|gb|CF688295.1,gi|41543633|gb|CF689474.1,
                     gi|41543645|gb|CF689486.1,gi|41543747|gb|CF689588.1,
                     gi|41543754|gb|CF689595.1,gi|41544362|gb|CF690203.1,
                     gi|41544368|gb|CF690209.1,gi|41545351|gb|CF691192.1,
                     gi|41547609|gb|CF693450.1,gi|41547616|gb|CF693457.1,
                     gi|41547958|gb|CF693799.1,gi|41547970|gb|CF693811.1,
                     gi|41548427|gb|CF694268.1,gi|41548431|gb|CF694272.1,
                     gi|415"
                     /transcript_id="XM_566793.1"
                     /db_xref="GI:58258760"
                     /db_xref="GeneID:3253352"
     mRNA            join(1175594..1175893,1176075..1176220,1176297..1176599,
                     1176650..1176814,1176864..1177205,1177259..1177454)
                     /locus_tag="CNA04370"
                     /product="glutamate-ammonia ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530688|gb|CF676529.1,gi|41533128|gb|CF678969.1,
                     gi|41533134|gb|CF678975.1,gi|41534156|gb|CF679997.1,
                     gi|41536056|gb|CF681897.1,gi|41536153|gb|CF681994.1,
                     gi|41537153|gb|CF682994.1,gi|41537226|gb|CF683067.1,
                     gi|41538058|gb|CF683899.1,gi|41538064|gb|CF683905.1,
                     gi|41538613|gb|CF684454.1,gi|41539960|gb|CF685801.1,
                     gi|41540859|gb|CF686700.1,gi|41541911|gb|CF687752.1,
                     gi|41542298|gb|CF688139.1,gi|41542448|gb|CF688289.1,
                     gi|41543633|gb|CF689474.1,gi|41543747|gb|CF689588.1,
                     gi|41544362|gb|CF690203.1,gi|41545351|gb|CF691192.1,
                     gi|41547609|gb|CF693450.1,gi|41547958|gb|CF693799.1,
                     gi|41547970|gb|CF693811.1,gi|41548427|gb|CF694268.1,
                     gi|41548822|gb|CF694663.1,gi|41549804|gb|CF695645.1,
                     gi|41550450|gb|CF696291.1,gi|41552744|gb|CF698585.1,
                     gi|41555551|gb|CF701392.1,gi|41555985|gb|CF701826.1,
                     gi|41556031|gb|CF701872.1,gi|41556045|gb|CF701886.1,
                     gi|41556846|gb|CF702687.1,gi|41558819|gb|CF704660.1,
                     gi|41559082|gb|CF704923.1,gi|41559146|gb|CF704987.1,
                     gi|41559161|gb|CF705002.1,gi|41559230|gb|CF705071.1,
                     gi|415"
                     /transcript_id="XM_566794.1"
                     /db_xref="GI:58258762"
                     /db_xref="GeneID:3253352"
     CDS             join(1175809..1175893,1176075..1176220,1176297..1176599,
                     1176650..1176814,1176864..1177205,1177259..1177294)
                     /locus_tag="CNA04370"
                     /codon_start=1
                     /product="glutamate-ammonia ligase"
                     /protein_id="XP_566793.1"
                     /db_xref="GI:58258761"
                     /db_xref="GeneID:3253352"
                     /translation="MSQLIATKRVDLLAPYLALDQGSRVQAEYIWIDAEGGIRSKTMT
                     LDKAPSSVADLKEWNFDGSSTNQAPADNSDVFLRPVAIFKDPFRGGANILVLCECYDN
                     DGTPNKSNYRAHCKKVMDAAKDTEPWFGLEQEYTLFDADGQVFGWPKNGFPGPQGPYY
                     CGVGAGKVFARDFIEAHYRACLYAGIKISGINAEVMPSQWEFQVGPCTGIEMGDHLWM
                     ARFLLLRIGEEWGITPSLHPKPLKGDWNGAGCHSNYSTKDMRTPGKGMAAIEDAIKKL
                     EKKHLEHIAVYGEDNDLRLTGKHETASMTTFSAGVANRGASIRIPRHVGAQGYGYLED
                     RRPASNVDPYRVTAILVETTVLNN"
     gene            1177920..1179862
                     /locus_tag="CNA04380"
                     /db_xref="GeneID:3253350"
     mRNA            join(1177920..1177955,1178213..1178252,1178454..1178566,
                     1178623..1179862)
                     /locus_tag="CNA04380"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530950|gb|CF676791.1,gi|41530955|gb|CF676796.1,
                     gi|41565448|gb|CF711289.1,gi|41565916|gb|CF711757.1,
                     gi|41565924|gb|CF711765.1"
                     /transcript_id="XM_566796.1"
                     /db_xref="GI:58258766"
                     /db_xref="GeneID:3253350"
     CDS             join(1178463..1178566,1178623..1179805)
                     /locus_tag="CNA04380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566796.1"
                     /db_xref="GI:58258767"
                     /db_xref="GeneID:3253350"
                     /translation="MPPQPSHHGTARYGSLATHSGGLRGGKQPTKLEIESLASMDKPS
                     YYDPPSSPSSSRSASPPPPSMMSNSGNKLVSGAQFMRRGKIYPWGPSFEVAKTNQHAR
                     KRLKLCLEQFMPPAAAEVNADIPANISGAEERRREKKRKREEEKEYILPHLRSPSPPM
                     STAKLASLLALPQTYTDLLLNPAMRHSLGNDNMEQGLQRTAGELLEGEKPLLQALGRL
                     RDVVRVLERDVPVAKPRAQADRDAVPSSTANGNDNLSQSYPHLIPPLPHISDTDNLWR
                     VTQELLSQPGQAQSVPVPTLTYSATPPGAAAPSLDSIAEPEPIPTPLQRLFTCPSGIT
                     LHAVPSASHPGYAYPQGHSLHPQTVKYNLDLKNQCRAVDDAWERISELLADCNEYRER
                     LEEARDRVADVARVRKRVWRTIKERAGWELERESKP"
     gene            complement(1179900..1181215)
                     /locus_tag="CNA04390"
                     /db_xref="GeneID:3253348"
     mRNA            complement(join(1179900..1179918,1179973..1180114,
                     1180169..1180566,1180619..1181215))
                     /locus_tag="CNA04390"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545739|gb|CF691580.1,gi|41545743|gb|CF691584.1"
                     /transcript_id="XM_566798.1"
                     /db_xref="GI:58258770"
                     /db_xref="GeneID:3253348"
     CDS             complement(join(1179911..1179918,1179973..1180114,
                     1180169..1180566,1180619..1181147))
                     /locus_tag="CNA04390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566798.1"
                     /db_xref="GI:58258771"
                     /db_xref="GeneID:3253348"
                     /translation="MLLANYGSDSGSDSESEAPVAPPPKPAPISAASSSSKVPQPKKK
                     KPVKITLDLPKASDGSEDEKNVGNNVEMGEDERETKRAKLPKGGKGTSSLLGMLPPPK
                     RKLPQSSTLATKGTGLTVNKAMARPQLPAPPRVIDEDSDDEDSVPKVRDMLPASLARK
                     QQKMESKEEVIDVFGLKTASAPLAKPTIATPSLKPPSISSAPVAPDFVPPEPTANDPY
                     PGYYQLPSGEWRAYDPDYYHSFFHSSAPVSDKQDADDGRVGRHWDAFEKGQFQGQVLD
                     IDANKDLAEARAEEERRALMKKPKLPGEEFVYQPKGQVKGLASQRHQLTSLLNTAYSQ
                     REELEERIAANKKGMRAAGTKYGF"
     gene            complement(1181876..1183455)
                     /locus_tag="CNA04400"
                     /db_xref="GeneID:3253643"
     mRNA            complement(join(1181876..1182568,1182623..1183455))
                     /locus_tag="CNA04400"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542508|gb|CF688349.1,gi|41542518|gb|CF688359.1,
                     gi|41550487|gb|CF696328.1,gi|41576626|gb|CF722467.1,
                     gi|41576634|gb|CF722475.1"
                     /transcript_id="XM_567168.1"
                     /db_xref="GI:58259510"
                     /db_xref="GeneID:3253643"
     CDS             complement(join(1182084..1182568,1182623..1183442))
                     /locus_tag="CNA04400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567168.1"
                     /db_xref="GI:58259511"
                     /db_xref="GeneID:3253643"
                     /translation="MSPLHTSTLTHPSSPSSNSGTEVVLTPTTMAEERHTNSDVHIEQ
                     AAEESAQVVAERAPKKAKTSDSGSFGQENDIDFAGITNQRLTVFPMFTGAWNEATESN
                     STSPIPTHPANAMQSPNHQQSQQQNGLDPLLALRSPSATHSTPQVNVDVGLTPELRFP
                     DETLASATADVSQETSQGDHAPIQVDESSQQQSASGMLTVPSSHTGPSSTSESGQASK
                     KENNAAFSRSPELRVSHKLAERKRRKEMKDLFDELRDELPADRGMKASKWEILTKAIE
                     HIKHTKSQQVEMHREIEHLRRELEIARAGNAHYHPHAYPTYSIPYPPGPFAAHPHHAQ
                     AQPPTSGTTSQAQTPQPQTQTVAQPQLQSQMTQQPQQVQQQPQSQPQQQIQPAAHVQT
                     VSQVQQQQSQPSQQQSQTSGLQTPTQEVQQQPLSAQGTPAPV"
     gene            complement(1183697..1186033)
                     /locus_tag="CNA04410"
                     /db_xref="GeneID:3253346"
     mRNA            complement(join(1183697..1184069,1184118..1184192,
                     1184243..1184411,1184460..1184597,1184642..1185019,
                     1185071..1185130,1185188..1185311,1185363..1185481,
                     1185536..1185754,1185818..1186033))
                     /locus_tag="CNA04410"
                     /product="endoplasmic reticulum protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530960|gb|CF676801.1,gi|41530967|gb|CF676808.1,
                     gi|41530997|gb|CF676838.1,gi|41531007|gb|CF676848.1,
                     gi|41533611|gb|CF679452.1,gi|41533616|gb|CF679457.1,
                     gi|41538847|gb|CF684688.1,gi|41538855|gb|CF684696.1,
                     gi|41551741|gb|CF697582.1,gi|41555846|gb|CF701687.1,
                     gi|41557467|gb|CF703308.1,gi|41557474|gb|CF703315.1,
                     gi|41558249|gb|CF704090.1,gi|41558259|gb|CF704100.1,
                     gi|41563215|gb|CF709056.1,gi|41563221|gb|CF709062.1,
                     gi|41568300|gb|CF714141.1,gi|41568309|gb|CF714150.1,
                     gi|41569121|gb|CF714962.1,gi|41572576|gb|CF718417.1"
                     /transcript_id="XM_566800.1"
                     /db_xref="GI:58258774"
                     /db_xref="GeneID:3253346"
     CDS             complement(join(1183805..1184069,1184118..1184192,
                     1184243..1184411,1184460..1184597,1184642..1185019,
                     1185071..1185130,1185188..1185311,1185363..1185481,
                     1185536..1185754,1185818..1185944))
                     /locus_tag="CNA04410"
                     /codon_start=1
                     /product="endoplasmic reticulum protein"
                     /protein_id="XP_566800.1"
                     /db_xref="GI:58258775"
                     /db_xref="GeneID:3253346"
                     /translation="MKDSAILISLLFSLLLFTPVTFAAQEEQKVVVPSQIQGLNPSLY
                     DKYEPTKSGLFHCLDSSKSIPFSAINDDYCDCPDGSDEPGTAACSNGLFWCKNEGHIP
                     GSVRKSRVNDGLCEPECCDGSDEWATGACPNNCEAIGKEWRAAKEASEKIRKTGAKVR
                     GTYIKWAQGEKKRLEEDLARKRQELVTKEQEVAKAKAILDKTEARSQEDLERKKQSPV
                     YISLLSHRLALARLRSKTSSLEAEIESLHSLLREMAKGYNPNYQDMAVKAAVVGYEEL
                     TGIKYREGESEGEMEVKKEQNEEDDKEEEITEEELEELEKEDLEALLLSDTTDENEED
                     EEDDGTSLLWKLDEYIPDSLYGSWEHVRDVAIDWMIRFGLAGRSKAKTSSGDGPQAAA
                     AREKHRLLNNELVKLNGAIRNTEDTLKNMEFHYGPEGEWKKLDGTCVDKVVGDYTYEL
                     CFFGKATQKSNKDKSSNNLGSFNQWNTAAEQGSFGYYSQQLYKNGAKCWNGPNRSVTV
                     DLSCGTSNALISVSEPEKCEYRFKITSPALCWPDVPDSPADDVKVKEEL"
     gene            1186796..1189209
                     /locus_tag="CNA04420"
                     /db_xref="GeneID:3253344"
     mRNA            join(1186796..1187176,1187262..1187947,1188001..1188165,
                     1188215..1188537,1188597..1188763,1188818..1188939,
                     1188990..1189068,1189125..1189209)
                     /locus_tag="CNA04420"
                     /product="oxidoreductase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533151|gb|CF678992.1,gi|41533154|gb|CF678995.1,
                     gi|41535116|gb|CF680957.1,gi|41535122|gb|CF680963.1,
                     gi|41541696|gb|CF687537.1,gi|41541708|gb|CF687549.1,
                     gi|41542659|gb|CF688500.1,gi|41542665|gb|CF688506.1,
                     gi|41542808|gb|CF688649.1,gi|41542810|gb|CF688651.1,
                     gi|41560831|gb|CF706672.1,gi|41560834|gb|CF706675.1,
                     gi|41567289|gb|CF713130.1,gi|41567296|gb|CF713137.1,
                     gi|41567665|gb|CF713506.1,gi|41567671|gb|CF713512.1"
                     /transcript_id="XM_566802.1"
                     /db_xref="GI:58258778"
                     /db_xref="GeneID:3253344"
     CDS             join(1186882..1187176,1187262..1187947,1188001..1188165,
                     1188215..1188537,1188597..1188763,1188818..1188939,
                     1188990..1189068,1189125..1189135)
                     /locus_tag="CNA04420"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_566802.1"
                     /db_xref="GI:58258779"
                     /db_xref="GeneID:3253344"
                     /translation="MAIITPISRLATSRTLTAASRSSSGALLRRPTALRIRTFASEAK
                     FDPESVERAQDEVDVCIVGGGPAGLSAAIRLKQLEQERGGDELRVVVLEKGGEVGAHI
                     LSGAVIEPRALNELIPDWKELGAPLNQPALSDSMRFLTSNSSFPLPHPPQMNNKGNYI
                     VSLSRFTAWLGEQAEALGVEVYPGFAGAKVLYTEDGKGIKGVITGDVGLDKDGNPKDN
                     YEPGMEFHAKVTLIAEGAHGSLSKELQKKFNLREGKDPQTYGLGIKEVWKVKDEVYEP
                     GKIVHTLGWPLDYKTYGGSWMYHMEDNMVSIGLVVGLDYQNPYLSPYKEFQRMKHHPF
                     FANILKDGQCIAYGARALNEGGFQSIPKLHFPGGALIGCSAGFLNVPKIKGTHNAMKS
                     GMLAAESAFAAITSTESSEEVSLDTNPADLSNYATAIENSWIWSELKEVRNLRPSFHN
                     PLGLWGGMAYSGLDSLILKGRVPWTFRNSVEDYEATKKASEEKPIDYPQPDGKLSFDI
                     LTSVSLTGTNHAENQPVHLRLPKVEGARASHTKINVEDYAGLLGRVCPAAVYEYADAE
                     GSEVDADGKKFVINSQNCIHCKTCSIKTPTQDISWDVPEGGGGPKYSIT"
     misc_feature    1189518..1189538
                     /note="AT_rich"
     gene            1192469..1197268
                     /locus_tag="CNA04430"
                     /db_xref="GeneID:3253342"
     mRNA            join(1192469..1192659,1192706..1192728,1192789..1192843,
                     1192909..1193023,1193143..1193205,1193259..1193267,
                     1193328..1193442,1193494..1193586,1193638..1193731,
                     1193784..1193986,1194041..1194219,1194264..1194622,
                     1194671..1195161,1195213..1195589,1195641..1195929,
                     1195978..1196184,1196242..1196367,1196415..1196773,
                     1196823..1196952,1197007..1197268)
                     /locus_tag="CNA04430"
                     /product="U2 snRNA binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530583|gb|CF676424.1,gi|41534339|gb|CF680180.1,
                     gi|41538253|gb|CF684094.1,gi|41541388|gb|CF687229.1,
                     gi|41541398|gb|CF687239.1,gi|41546665|gb|CF692506.1,
                     gi|41546670|gb|CF692511.1,gi|41546770|gb|CF692611.1,
                     gi|41548628|gb|CF694469.1,gi|41550642|gb|CF696483.1,
                     gi|41551400|gb|CF697241.1,gi|41562650|gb|CF708491.1,
                     gi|41562660|gb|CF708501.1,gi|41565687|gb|CF711528.1,
                     gi|41565699|gb|CF711540.1,gi|41566208|gb|CF712049.1,
                     gi|41566215|gb|CF712056.1,gi|41575967|gb|CF721808.1"
                     /transcript_id="XM_566804.1"
                     /db_xref="GI:58258782"
                     /db_xref="GeneID:3253342"
     CDS             join(1192509..1192659,1192706..1192728,1192789..1192843,
                     1192909..1193023,1193143..1193205,1193259..1193267,
                     1193328..1193442,1193494..1193586,1193638..1193731,
                     1193784..1193986,1194041..1194219,1194264..1194622,
                     1194671..1195161,1195213..1195589,1195641..1195929,
                     1195978..1196184,1196242..1196367,1196415..1196773,
                     1196823..1196952,1197007..1197222)
                     /locus_tag="CNA04430"
                     /codon_start=1
                     /product="U2 snRNA binding protein"
                     /protein_id="XP_566804.1"
                     /db_xref="GI:58258783"
                     /db_xref="GeneID:3253342"
                     /translation="MHLLNLTLSSPTNVSTAVVGSFSGSKSQEILCVRGGTKLEIFKL
                     NATTGQLDTIVSTEAFGTIRNIAGFRLAGMTKDYILATSDSGRLSILEFVISPTPHFE
                     SLYQEVFGKSGSRRIVPGQFLAVDPKGRSCLVGSLEKTKLVYVLNRNTEGKLYPSSPL
                     EAHKNHTLVTHIVGVDQGYDNPLYAALETDYSESDQDSTGEAYENTQKHLTFYELDLG
                     LNHVVRKWSEPTDRRANLLVQVPGGQNANSDRFEGPSGVLVCTEDHIIWKHMDVEAHR
                     IPIPRRRNPLVQRGDKSRGLIIVSAVMHKIKGAFFFLLQSEDGDLYKVWIEHNGEDVV
                     ALKIKYFDTVPVANSLCILKRGYIYVASEFSDQNLYQFQSLAEDDGEQEWSSTDYPEN
                     GNIDGPLPFAFFDPQPLRNLLLVDTVPSLDPITDAHVVNLLGASSDTPQIYAACGRGA
                     RSTFRTLKHGLDVAEMVSSPLPGVPTNVWTLKLTEDDEYDSYIVLSFPNGTLVLSIGE
                     TIEEVNDTGFLSSGPTLAVQQLGNAGLLQVHPYGLRHIRAADRVDEWPAPPGQTIVAA
                     TTNRRQVVIALSTAELVYFELDPEGSLSEYQEKKALPGNATCVTIAEVPEGRRRTSFL
                     AVGCDNQTVSIISLEPDSTLDTLSLQALTAPPTSICLAEIFDTSIDKNRATMFLNIGL
                     MNGVLLRTVVDPVDGSLSDTRLRFLGAKPPKLVRANVQGQPSVMAFSSRTWLLYTYQD
                     MLQTQPLIYDTLEYAWSLSAAMCPDGLIGISGNTLRIFNIPKLGEKLKQDSTALTYTP
                     RKFISHPFNSVFYMIEADHRTYSKSAIERIVKQKESEGRRVDTLLLDLPANEFGRPRA
                     PAGHWASCVRVLDPLANETIMTLDLDEDEAAFSIAIAYFERGGGEPFLVVGTGVKTTL
                     QPKGCKEGYLRVYAIKEQGRILEFLHKTKTDDIPLCLAGFQGFLLAGIGKSLRLYEMG
                     KKALLRKCENNGFPTAVVTINVQGARIIVGDMQESTFYCVYRSIPTRQLLIFADDSQP
                     RWITCVTSVDYETVACGDKFGNIFINRLDPSISEKVDDDPTGATILHEKSFLMGAAHK
                     TEMIGHYNIGSVVTSITKIPLVAGGRDVLVYTTISGAVGALVPFVSSDDIEFMSTLEM
                     HMRTQDISLVGRDHIAYRGYYVPIKGVVDGDLCESFSLLPYPKQQAIALDLDRSVGDV
                     LKKLEQMRTSSAF"
     gene            complement(1197601..1197701)
                     /locus_tag="CNA04440"
                     /db_xref="GeneID:3253974"
     tRNA            complement(1197601..1197701)
                     /locus_tag="CNA04440"
                     /product="tRNA-Leu"
                     /codon_recognized="CUU"
                     /db_xref="GeneID:3253974"
     gene            complement(1199420..1199520)
                     /locus_tag="CNA04450"
                     /db_xref="GeneID:3253956"
     tRNA            complement(1199420..1199520)
                     /locus_tag="CNA04450"
                     /product="tRNA-Leu"
                     /codon_recognized="CUU"
                     /db_xref="GeneID:3253956"
     gene            complement(1199990..>1200533)
                     /locus_tag="CNA04460"
                     /db_xref="GeneID:3253340"
     mRNA            complement(join(1199990..1200129,1200192..1200367,
                     1200503..>1200533))
                     /locus_tag="CNA04460"
                     /product="expressed protein"
                     /transcript_id="XM_566806.1"
                     /db_xref="GI:58258786"
                     /db_xref="GeneID:3253340"
     CDS             complement(join(1200097..1200129,1200192..1200367,
                     1200503..1200533))
                     /locus_tag="CNA04460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566806.1"
                     /db_xref="GI:58258787"
                     /db_xref="GeneID:3253340"
                     /translation="MSGNNDNSEKTFNILPHPAKTNNPADLTGEPAEHGGLQSASANA
                     YNAKPPYIPSKEIAEGLEKPKTREELRAEAQQLNS"
     gene            <1200892..>1201650
                     /locus_tag="CNA04470"
                     /db_xref="GeneID:3253338"
     mRNA            join(<1200892..1200949,1201005..1201132,1201190..1201363,
                     1201408..>1201650)
                     /locus_tag="CNA04470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_566810.1"
                     /db_xref="GI:58258794"
                     /db_xref="GeneID:3253338"
     CDS             join(1200892..1200949,1201005..1201132,1201190..1201363,
                     1201408..1201650)
                     /locus_tag="CNA04470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566810.1"
                     /db_xref="GI:58258795"
                     /db_xref="GeneID:3253338"
                     /translation="MDSLTDEIEAVLFVAREVMVYQIPPRTTTAGYKAAEWNVESFLW
                     KGRMRVLDVGSRSEIRLEDPNTGELFAQVNYVSPWNQVEPVLDSSRYFVLRVEGEGGK
                     RAYIGMGFAERGESFDFQVALQSVTKRSQNISSASNPSEPPQPTAPPKDYSLKDGQTF
                     TIKIPGREGKKPSPSQTPSSGGGGGGGLFSLPPPPPGRRG"
     gene            complement(1201677..>1202535)
                     /locus_tag="CNA04480"
                     /db_xref="GeneID:3253336"
     mRNA            complement(join(1201677..1201922,1201969..1202062,
                     1202112..1202435,1202525..>1202535))
                     /locus_tag="CNA04480"
                     /product="sterol metabolism-related protein, putative"
                     /transcript_id="XM_566812.1"
                     /db_xref="GI:58258798"
                     /db_xref="GeneID:3253336"
     CDS             complement(join(1201716..1201922,1201969..1202062,
                     1202112..1202435,1202525..1202535))
                     /locus_tag="CNA04480"
                     /codon_start=1
                     /product="sterol metabolism-related protein"
                     /protein_id="XP_566812.1"
                     /db_xref="GI:58258799"
                     /db_xref="GeneID:3253336"
                     /translation="MVPSRAAQMGQQSKSSLWTFLPILLFLPLLSSFLTQSYTFNLSP
                     YVLPHLRNFWAETPLNIWRREMKEFTPLQLAMFDGSPDRPVYLAIDGIVYDVSANRRI
                     YGKGGSYNMMAGRDASRAFITGCFETHLTHDIRGLSKEELASLEHWKSFFAKSDKYFK
                     VGTVLNPPIDTESPIPPSCREDESASGADIHAPGEAAAKKGKIKPGPVHGQ"
     gene            1202937..1205161
                     /locus_tag="CNA04490"
                     /db_xref="GeneID:3253334"
     mRNA            join(1202937..1203251,1203301..1203417,1203462..1203921,
                     1203963..1204048,1204112..1204256,1204307..1204991,
                     1205047..1205161)
                     /locus_tag="CNA04490"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531164|gb|CF677005.1,gi|41531170|gb|CF677011.1,
                     gi|41533798|gb|CF679639.1,gi|41533810|gb|CF679651.1,
                     gi|41534781|gb|CF680622.1,gi|41542294|gb|CF688135.1,
                     gi|41542303|gb|CF688144.1,gi|41547411|gb|CF693252.1,
                     gi|41547417|gb|CF693258.1,gi|41557135|gb|CF702976.1,
                     gi|41563748|gb|CF709589.1,gi|41564985|gb|CF710826.1,
                     gi|41564993|gb|CF710834.1,gi|41568237|gb|CF714078.1,
                     gi|41573971|gb|CF719812.1,gi|41573978|gb|CF719819.1,
                     gi|41575047|gb|CF720888.1"
                     /transcript_id="XM_566814.1"
                     /db_xref="GI:58258802"
                     /db_xref="GeneID:3253334"
     CDS             join(1203051..1203251,1203301..1203417,1203462..1203921,
                     1203963..1204048,1204112..1204256,1204307..1204991,
                     1205047..1205119)
                     /locus_tag="CNA04490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_566814.1"
                     /db_xref="GI:58258803"
                     /db_xref="GeneID:3253334"
                     /translation="MPDLGIDNLTVVLLALLAALAIYHRFFAAPSPLVHPLLLSKQSE
                     VSAVRKSGETGIYRSWATGQGTPLTVRPANTVKTVQDVARPPKADPKEKATRPDQRCI
                     LDVQLTDEALAEIVRLVPLGIEILFPRSSPMIASSIVTLIPPSPNSALPLLLLSLSAT
                     PHRPLAILPNPRLLTAALTGHGAHPTAGIVVVFADLLAEVVEQVWEDEGDKVGVLIIG
                     DENKLQRSVVEEARRKGLTIHWWEEIWEMAESEMAEKIQLQNAHFSDVHSYYYSESED
                     PEKPVIVKVTHMNVTAGIASLLSIFPADKRPSSKLHDVVASAVRLDTPLGMTIALASI
                     WNGAGYRMIGNQEPVFDVEDIECVEHLTALADPTKDLPKPTILFITPKYHRALLDSLQ
                     FSYEAHPWASLAALHKARDLSHGHVDRDGIWDKILWSGMRENVVGGVAGRKLRAVILV
                     GDAPSPTALGASHLLLSLPLTRLHPSLYSSGPVFVSHFYDLQSPGVNHVLKQVDMWES
                     TEKSHSGPPASNVEVMLKGEDVDEAHDRGDKWIEGRVFIRGPSILERVDGGGRVQDGW
                     VDTGEHAKVQTNGTFIVNGLAK"
     gene            complement(1205222..1206640)
                     /locus_tag="CNA04500"
                     /db_xref="GeneID:3253332"
     mRNA            complement(join(1205222..1205802,1205864..1206251,
                     1206305..1206384,1206423..1206640))
                     /locus_tag="CNA04500"
                     /product="endoplasmic reticulum protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531641|gb|CF677482.1,gi|41531644|gb|CF677485.1,
                     gi|41532674|gb|CF678515.1,gi|41532685|gb|CF678526.1,
                     gi|41564526|gb|CF710367.1"
                     /transcript_id="XM_566816.1"
                     /db_xref="GI:58258806"
                     /db_xref="GeneID:3253332"
     CDS             complement(join(1205282..1205802,1205864..1206251,
                     1206305..1206384,1206423..1206492))
                     /locus_tag="CNA04500"
                     /codon_start=1
                     /product="endoplasmic reticulum protein"
                     /protein_id="XP_566816.1"
                     /db_xref="GI:58258807"
                     /db_xref="GeneID:3253332"
                     /translation="MGLLHLLAVAGGIAAFLFVTLSLASGLLWLAELIEEHSKYAKTV
                     GMRAIYAIIGLHIVLYFTDNLPITPILFSITCHFVYLSNFSSSWPLISLTSPRFILSC
                     ILVVGDHFVWFFHFAAVAQEAKDYRVPKYRYGGQQAKAAGNNPSFGDVAAFFAVCVWF
                     VPLYLFLSLSANDNALPSFDSSAPPSPSSSHVNLGSPRLHAHADRKHATSLIKSALLP
                     LLSLLPSIRSRSRVRNPEGLIAPRSPSKSSPLPSPALQAPNYYPWGTEEKPMSSPGFI
                     TPHRSMTPLGGPKTPPPPRRTQSELQISTRGNSHSGPRAEEGMRKVSVGRPAGLASST
                     NLAPATGGETELSKRKAD"
     gene            <1206622..1207701
                     /locus_tag="CNA04510"
                     /db_xref="GeneID:3253330"
     mRNA            join(<1206622..1206784,1206834..1206853,1206902..1206979,
                     1207027..1207242,1207292..1207558,1207612..1207701)
                     /locus_tag="CNA04510"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /transcript_id="XM_566818.1"
                     /db_xref="GI:58258810"
                     /db_xref="GeneID:3253330"
     CDS             join(1206622..1206784,1206834..1206853,1206902..1206979,
                     1207027..1207242,1207292..1207558,1207612..1207623)
                     /locus_tag="CNA04510"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein"
                     /protein_id="XP_566818.1"
                     /db_xref="GI:58258811"
                     /db_xref="GeneID:3253330"
                     /translation="MRDMWKYTSSNLISACQTSTTAFAGSQTITFVITFLLPFSSTYI
                     RRLSSMSNLEKSLFQLKFTAKSLQRQAKKATKDEAAEKNKLKQALAKGNTDGARIYAQ
                     NAIRKKNEGLNLLRLSSRIDAVASRVETAVTMRSVTNSMGSVVKGMDKAMESMNLERI
                     SLVMDKFESQFADMDVQTSYMESTMSDTTAMATPQDQVDSLMLQVADEAGLEIQHGLG
                     EAKVPAKEPTLGEASKEEDSNLAERLRALRPAT"
     gene            complement(1207647..>1208362)
                     /locus_tag="CNA04520"
                     /db_xref="GeneID:3253328"
     mRNA            complement(join(1207647..1208068,1208122..1208253,
                     1208306..>1208362))