GenomeNet

Database: RefSeq
Entry: NC_006676
LinkDB: NC_006676
Original site: NC_006676 
LOCUS       NC_006676               2687 bp    DNA     circular CON 23-MAY-2013
DEFINITION  Gluconobacter oxydans 621H plasmid pGOX5, complete sequence.
ACCESSION   NC_006676
VERSION     NC_006676.1  GI:58038486
DBLINK      Project: 58239
            BioProject: PRJNA58239
KEYWORDS    RefSeq.
SOURCE      Gluconobacter oxydans 621H
  ORGANISM  Gluconobacter oxydans 621H
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
            Acetobacteraceae; Gluconobacter.
REFERENCE   1  (bases 1 to 2687)
  AUTHORS   Prust,C., Hoffmeister,M., Liesegang,H., Wiezer,A., Fricke,W.F.,
            Ehrenreich,A., Gottschalk,G. and Deppenmeier,U.
  TITLE     Complete genome sequence of the acetic acid bacterium Gluconobacter
            oxydans
  JOURNAL   Nat. Biotechnol. 23 (2), 195-200 (2005)
   PUBMED   15665824
REFERENCE   2  (bases 1 to 2687)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JAN-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2687)
  AUTHORS   Prust,C., Hoffmeister,M., Liesegang,H., Wiezer,A., Fricke,W.F.,
            Gottschalk,G. and Deppenmeier,U.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUL-2004) Goettingen Genomics Laboratory,
            Georg-August-University Goettingen, Grisebachstr. 8, Goettingen
            D-37077, Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000008.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2687
                     /organism="Gluconobacter oxydans 621H"
                     /mol_type="genomic DNA"
                     /strain="621H"
                     /db_xref="taxon:290633"
                     /plasmid="pGOX5"
     gene            320..865
                     /locus_tag="GOX2732"
                     /db_xref="GeneID:3248831"
     CDS             320..865
                     /locus_tag="GOX2732"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="YP_190452.1"
                     /db_xref="GI:58038487"
                     /db_xref="GeneID:3248831"
                     /translation="MKSKQVGLTTAPNGTWVQVERAAMERWSKLAVSNPRAAAVMMLM
                     TSQMGRNNALVASQATLAKMAGCGLNTLKRALSVLREGNWIEVRQIGPTGTACAYVVN
                     DRVAWSGNRDGIRYSLFSASVLLADNEQPDKDEIGLQPSLHPVPDLYPGEKQLPTGPG
                     LPPPSQPSFDGMEPDLPATEK"
     misc_feature    419..574
                     /locus_tag="GOX2732"
                     /note="Helix-turn-helix domain; Region: HTH_36; pfam13730"
                     /db_xref="CDD:222348"
     gene            complement(919..1164)
                     /locus_tag="GOX2733"
                     /db_xref="GeneID:3248832"
     CDS             complement(919..1164)
                     /locus_tag="GOX2733"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_190453.1"
                     /db_xref="GI:58038488"
                     /db_xref="GeneID:3248832"
                     /translation="MNNPPMTEHEINEQIWKELSTLESYDGGKRHRFSLGLPIYYSDD
                     DTPDGLTIREYPDGRRELVRRHSEGEEIVRVLSASLR"
     gene            complement(1198..1395)
                     /locus_tag="GOX2734"
                     /db_xref="GeneID:3248833"
     CDS             complement(1198..1395)
                     /locus_tag="GOX2734"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_190454.1"
                     /db_xref="GI:58038489"
                     /db_xref="GeneID:3248833"
                     /translation="MTALLQCLPTARHTGCHRTGASAARERRRPPKASGRAASGSLRE
                     TLGRTPEEGTNESLCKCALRE"
     gene            1539..1964
                     /locus_tag="GOX2735"
                     /db_xref="GeneID:3248834"
     CDS             1539..1964
                     /locus_tag="GOX2735"
                     /codon_start=1
                     /transl_table=11
                     /product="PemK-like protein"
                     /protein_id="YP_190455.1"
                     /db_xref="GI:58038490"
                     /db_xref="GeneID:3248834"
                     /translation="MPASGPAGRLGRRARPGSRFLPRGRGRRSGRLGGVRRGDFVTVA
                     LQGDLGKPRPALVVQADRFDTTAAVTLLPLSSALVDAPLLRLTIEPDERNGLRRSSQV
                     MVDKPTTIAREKVGPTFGTASDTLMLAVSRALALFLGLA"
     misc_feature    1653..1952
                     /locus_tag="GOX2735"
                     /note="PemK-like protein; Region: PemK; pfam02452"
                     /db_xref="CDD:217045"
CONTIG      join(CP000008.1:1..2687)
//
DBGET integrated database retrieval system