GenomeNet

Database: RefSeq
Entry: NC_006676
LinkDB: NC_006676
Original site: NC_006676 
LOCUS       NC_006676               2687 bp    DNA     circular CON 29-MAR-2017
DEFINITION  Gluconobacter oxydans 621H plasmid pGOX5, complete sequence.
ACCESSION   NC_006676
VERSION     NC_006676.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603293
            Assembly: GCF_000011685.1
KEYWORDS    RefSeq.
SOURCE      Gluconobacter oxydans 621H
  ORGANISM  Gluconobacter oxydans 621H
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
            Acetobacteraceae; Gluconobacter.
REFERENCE   1  (bases 1 to 2687)
  AUTHORS   Prust,C., Hoffmeister,M., Liesegang,H., Wiezer,A., Fricke,W.F.,
            Ehrenreich,A., Gottschalk,G. and Deppenmeier,U.
  TITLE     Complete genome sequence of the acetic acid bacterium Gluconobacter
            oxydans
  JOURNAL   Nat. Biotechnol. 23 (2), 195-200 (2005)
   PUBMED   15665824
REFERENCE   2  (bases 1 to 2687)
  AUTHORS   Prust,C., Hoffmeister,M., Liesegang,H., Wiezer,A., Fricke,W.F.,
            Gottschalk,G. and Deppenmeier,U.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUL-2004) Goettingen Genomics Laboratory,
            Georg-August-University Goettingen, Grisebachstr. 8, Goettingen
            D-37077, Germany
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP000008.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 03/29/2017 16:02:05
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.1
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 2,836
            CDS (total)                       :: 2,765
            Genes (coding)                    :: 2,607
            CDS (coding)                      :: 2,607
            Genes (RNA)                       :: 71
            rRNAs                             :: 4, 4, 4 (5S, 16S, 23S)
            complete rRNAs                    :: 4, 4, 4 (5S, 16S, 23S)
            tRNAs                             :: 55
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 158
            Pseudo Genes (ambiguous residues) :: 0 of 158
            Pseudo Genes (frameshifted)       :: 102 of 158
            Pseudo Genes (incomplete)         :: 55 of 158
            Pseudo Genes (internal stop)      :: 21 of 158
            Pseudo Genes (multiple problems)  :: 19 of 158
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2687
                     /organism="Gluconobacter oxydans 621H"
                     /mol_type="genomic DNA"
                     /strain="621H"
                     /db_xref="taxon:290633"
                     /plasmid="pGOX5"
     gene            320..865
                     /locus_tag="GOX_RS14370"
                     /old_locus_tag="GOX2732"
                     /db_xref="GeneID:31477235"
     CDS             320..865
                     /locus_tag="GOX_RS14370"
                     /old_locus_tag="GOX2732"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011251600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="WP_011251600.1"
                     /db_xref="GeneID:31477235"
                     /translation="MKSKQVGLTTAPNGTWVQVERAAMERWSKLAVSNPRAAAVMMLM
                     TSQMGRNNALVASQATLAKMAGCGLNTLKRALSVLREGNWIEVRQIGPTGTACAYVVN
                     DRVAWSGNRDGIRYSLFSASVLLADNEQPDKDEIGLQPSLHPVPDLYPGEKQLPTGPG
                     LPPPSQPSFDGMEPDLPATEK"
     gene            complement(919..1164)
                     /locus_tag="GOX_RS01130"
                     /old_locus_tag="GOX2733"
                     /db_xref="GeneID:29627062"
     CDS             complement(919..1164)
                     /locus_tag="GOX_RS01130"
                     /old_locus_tag="GOX2733"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011251601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011251601.1"
                     /db_xref="GeneID:29627062"
                     /translation="MNNPPMTEHEINEQIWKELSTLESYDGGKRHRFSLGLPIYYSDD
                     DTPDGLTIREYPDGRRELVRRHSEGEEIVRVLSASLR"
     gene            complement(1198..1395)
                     /locus_tag="GOX_RS14375"
                     /old_locus_tag="GOX2734"
                     /db_xref="GeneID:31477236"
     CDS             complement(1198..1395)
                     /locus_tag="GOX_RS14375"
                     /old_locus_tag="GOX2734"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011251602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011251602.1"
                     /db_xref="GeneID:31477236"
                     /translation="MTALLQCLPTARHTGCHRTGASAARERRRPPKASGRAASGSLRE
                     TLGRTPEEGTNESLCKCALRE"
     gene            1426..1644
                     /locus_tag="GOX_RS01135"
                     /db_xref="GeneID:29627061"
     CDS             1426..1644
                     /locus_tag="GOX_RS01135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010518053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_024716910.1"
                     /db_xref="GeneID:29627061"
                     /translation="MTPVAVRVQKRRDTLRKAGLRPVQIWVPDTRAKGFDEECRRQAR
                     LVASADAHDPDLASFLEAAAADLDGWEA"
     gene            1641..1964
                     /locus_tag="GOX_RS01140"
                     /db_xref="GeneID:29627060"
     CDS             1641..1964
                     /locus_tag="GOX_RS01140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019092698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mRNA interferase PemK"
                     /protein_id="WP_024716911.1"
                     /db_xref="GeneID:29627060"
                     /translation="MRRGDFVTVALQGDLGKPRPALVVQADRFDTTAAVTLLPLSSAL
                     VDAPLLRLTIEPDERNGLRRSSQVMVDKPTTIAREKVGPTFGTASDTLMLAVSRALAL
                     FLGLA"
CONTIG      join(CP000008.1:1..2687)
//
DBGET integrated database retrieval system