GenomeNet

Database: RefSeq
Entry: NC_006676
LinkDB: NC_006676
Original site: NC_006676 
LOCUS       NC_006676               2687 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Gluconobacter oxydans 621H plasmid pGOX5, complete sequence.
ACCESSION   NC_006676
VERSION     NC_006676.1  GI:58038486
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603293
            Assembly: GCF_000011685.1
KEYWORDS    RefSeq.
SOURCE      Gluconobacter oxydans 621H
  ORGANISM  Gluconobacter oxydans 621H
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
            Acetobacteraceae; Gluconobacter.
REFERENCE   1  (bases 1 to 2687)
  AUTHORS   Prust,C., Hoffmeister,M., Liesegang,H., Wiezer,A., Fricke,W.F.,
            Ehrenreich,A., Gottschalk,G. and Deppenmeier,U.
  TITLE     Complete genome sequence of the acetic acid bacterium Gluconobacter
            oxydans
  JOURNAL   Nat. Biotechnol. 23 (2), 195-200 (2005)
   PUBMED   15665824
REFERENCE   2  (bases 1 to 2687)
  AUTHORS   Prust,C., Hoffmeister,M., Liesegang,H., Wiezer,A., Fricke,W.F.,
            Gottschalk,G. and Deppenmeier,U.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUL-2004) Goettingen Genomics Laboratory,
            Georg-August-University Goettingen, Grisebachstr. 8, Goettingen
            D-37077, Germany
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/05/2014 13:33:09
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 2,787
            CDS                          :: 2,637
            Pseudo Genes                 :: 82
            rRNAs                        :: 12 ( 5S, 16S, 23S )
            tRNAs                        :: 55
            ncRNA                        :: 1
            Frameshifted Genes           :: 73
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2687
                     /organism="Gluconobacter oxydans 621H"
                     /mol_type="genomic DNA"
                     /strain="621H"
                     /db_xref="taxon:290633"
                     /plasmid="pGOX5"
     gene            complement(919..1164)
                     /locus_tag="GOX_RS01130"
                     /old_locus_tag="GOX2733"
     CDS             complement(919..1164)
                     /locus_tag="GOX_RS01130"
                     /old_locus_tag="GOX2733"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012817664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011251601.1"
                     /db_xref="GI:499570818"
                     /translation="MNNPPMTEHEINEQIWKELSTLESYDGGKRHRFSLGLPIYYSDD
                     DTPDGLTIREYPDGRRELVRRHSEGEEIVRVLSASLR"
     gene            1426..1644
                     /locus_tag="GOX_RS01135"
     CDS             1426..1644
                     /locus_tag="GOX_RS01135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010518053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_024716910.1"
                     /db_xref="GI:639668960"
                     /translation="MTPVAVRVQKRRDTLRKAGLRPVQIWVPDTRAKGFDEECRRQAR
                     LVASADAHDPDLASFLEAAAADLDGWEA"
     gene            1641..1964
                     /locus_tag="GOX_RS01140"
     CDS             1641..1964
                     /locus_tag="GOX_RS01140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019092698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="growth inhibitor PemK"
                     /protein_id="WP_024716911.1"
                     /db_xref="GI:639668961"
                     /translation="MRRGDFVTVALQGDLGKPRPALVVQADRFDTTAAVTLLPLSSAL
                     VDAPLLRLTIEPDERNGLRRSSQVMVDKPTTIAREKVGPTFGTASDTLMLAVSRALAL
                     FLGLA"
CONTIG      join(CP000008.1:1..2687)
//
DBGET integrated database retrieval system