GenomeNet

Database: RefSeq
Entry: NC_006679
LinkDB: NC_006679
Original site: NC_006679 
LOCUS       NC_006679            1085720 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 10
            sequence.
ACCESSION   NC_006679
VERSION     NC_006679.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 1085720)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 1085720)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1085720)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 1085720)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017350.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1085720
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="10"
                     /note="MAT-alpha"
     gene            172..>4804
                     /locus_tag="CNJ00010"
                     /db_xref="GeneID:3254129"
     mRNA            join(172..2574,2845..3344,3396..3768,3814..4455,
                     4509..>4804)
                     /locus_tag="CNJ00010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567259.1"
                     /db_xref="GeneID:3254129"
     CDS             join(183..2574,2845..3344,3396..3768,3814..4455,
                     4509..4804)
                     /locus_tag="CNJ00010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567259.1"
                     /db_xref="GeneID:3254129"
                     /translation="MDAAERCALAYIAQPSDSTLLAFLALPKVGLTQALAPEQPLRPS
                     TFLQQFPHIPWPEQPPARRPPSNIRPDTTKQVIKLVENGRLGAAERVLEEDASVAELD
                     QGVIDQLITKHPKGPSCPFGNAVGPTPGKAPDIDTIQKALDSFNPDTAPGVSGWSVPL
                     LKTAAKREPVKQFLQLLCAAIANNTAPGRSMLRTSRLIPLKKDDGSIRPIAVGELIYR
                     LCAKALIISHFQPDFLLPFQLGVKSIGGVEPIVRLTERVLEGSAGAEFSFLASLDASN
                     AFNRVDRAEMAAAVKTHAPTLWRTCKWAYGDSSDLVCGDKILQSSQGVRQGDPFGPLF
                     FSITLRPTLHALSQSLGPSTQALAYLDDIYLFSNDSQVLSKTTQFLADKQHIIKLNEK
                     KCKLISFDEIRQEGFKMLGTMVGGKEKRAEFLEGRIRKEMAKVGKLKDLPHQHALLLL
                     RFCIQQNLRHLQRSLRSDDLVDLWERLDTMLWEEVKRMRMRQREDTVEEEALGRSLTK
                     LPARLGGLGLLSFKDVAPLAYRSAAEASDTLLDNLGLLSSPEEPPTPIPQRTRCAELW
                     ESQQEAILHNLGDTERKRLTENASRLGRSWLSVIPYLQPLRLSNVEIASGLHDRTLVG
                     SSIPVCRFCGSDSPLGHDELCRARNPWTQRRHNAINRVIYQHLKQIQGATVEIEPHTL
                     SGQRRNDLRVRGSSALAFTDYDLKVYSLGDRDARSTATPSTPNSKLAGFCLDRCVNWL
                     DKVGQVVSKNAPKVTGGVFKPIILSTGGLMSRSTADEWKEWREAMPVGGFEKMEKRIG
                     SPLTSLSRASASDSPLSSLVSSHQTLPENSNSPRDDPIAYGGHPKNKDRPYPLSLVPF
                     DLSEPYEASEYLTIRSYDETCRFDYLGQPWANEYRDGMIEDEQMFDDSVFRRYLDRFI
                     QENYNHITRATDFFHQSNLKSVFYSRKDKEWEKLDLVDAYRRQTGKVLGVHSSSQDSL
                     RSRNDGATTPDASLIGVVKDLSCSSGWKRTLYAVIELKWMKLATFLIGEAKRQTDEKA
                     LIYLCQEGVFQTMWYIILGYAISGCIFGLSIVNEYFYRVVYLYRDSTPDIPVLALEAD
                     NGYSVEELAELQDFWSSPPNCLISDRANAILNKEARYHLDATILLFLAHAAALPAQRF
                     LNDLPLPFAHRVPVDATAHSAADMSLKGLEAGSRRHSLHSTKRNKRTSATLHDEEKGE
                     EDKPGDDKPPGKDNDGSQGGNSGPGADNSRGGGSGSAGGSRPGGRGAGGGSSSRRAEA
                     FDTRTSTAPQEFRGGLERLSAPKEMLDMKTSIMTSHLSNDRARCSRAPSSVDSDSSGQ
                     SDSSFDTSFDSNKGALILDDLPDDPPQIVNKSDPVDIDLEDIDPESGELTLAAFKGRL
                     AMLGVRVKLVTREQMDVLLSRG"
     gene            complement(5615..7281)
                     /locus_tag="CNJ00020"
                     /pseudo
                     /db_xref="GeneID:36393046"
     gene            7445..8417
                     /locus_tag="CNJ00030"
                     /db_xref="GeneID:3254237"
     mRNA            7445..8417
                     /locus_tag="CNJ00030"
                     /product="cysteine-type peptidase, putative"
                     /transcript_id="XM_567261.2"
                     /db_xref="GeneID:3254237"
     CDS             7567..8325
                     /locus_tag="CNJ00030"
                     /codon_start=1
                     /product="cysteine-type peptidase, putative"
                     /protein_id="XP_567261.1"
                     /db_xref="GeneID:3254237"
                     /translation="MSPKKILIIMSDASSIPLHKTSQCGETTADQSSGFFLMELAKPL
                     SKFLSAGCEVTFASPLGKTPTPDPTSESLVAFALNFYERKRENDLIARMMRENGFASP
                     RTFQSISDEELDGFAAVFIPGGHAPLADLGADPELGRILAHFHHEGKPTAVICHGPYG
                     LLSTKATPEGTFLYKGYKITSWSDAEEKMMETLWGGEVPRVESTLREAGAEMVEGLGE
                     KIGRITVDRELISGGNPLAANALAEQVLKMVEAQ"
     gene            complement(9549..11023)
                     /locus_tag="CNJ00050"
                     /db_xref="GeneID:3254281"
     mRNA            complement(join(9549..10066,10130..10237,10402..10530,
                     10606..11023))
                     /locus_tag="CNJ00050"
                     /product="expressed protein"
                     /transcript_id="XM_567263.2"
                     /db_xref="GeneID:3254281"
     CDS             complement(join(9683..10066,10130..10237,10402..10530,
                     10606..10932))
                     /locus_tag="CNJ00050"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567263.1"
                     /db_xref="GeneID:3254281"
                     /translation="MSASSQPRLSVREAALAAVQARLNPPPSYDSSSAHASNPGVSGA
                     APQAATNNGSTVAEQTPFSPPGSRASPRPTFTDKEERELKLKFGKLLDRGIVRDNGYK
                     ESAEAVETLLKIANNILSSDDPKYRTIKATNGMLQKKVLSVKGGHDYIIALGFRTKTV
                     DFVKIYVFEKTLRSTHELKIGAEILQGHLTSLKERVNLSSQSLLNYNQEEAARRAQAL
                     REIEADRESVKIRAERERQARETKEQAKRERRERGEAEEAEEVVDRDDERRREMANAV
                     VRNDRDYRRNTVEDEYSEDDDYPPTYGETFFGEGRRLGD"
     gene            11336..13315
                     /locus_tag="CNJ00060"
                     /db_xref="GeneID:3254276"
     mRNA            join(11336..11470,11568..11891,11964..12168,12293..12383,
                     12479..12616,12704..12751,12839..12952,13013..13315)
                     /locus_tag="CNJ00060"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657909.1"
                     /db_xref="GeneID:3254276"
     CDS             join(11425..11470,11568..11891,11964..12168,12293..12383,
                     12479..12616,12704..12751,12839..12859)
                     /locus_tag="CNJ00060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513591.1"
                     /db_xref="GeneID:3254276"
                     /translation="MDYLKKMATEQLENALNGGQNNQQQGNNNDSYGNNHQGSLNDNN
                     QQQYGGNQNQGYGQQSGGYGQQSGGYGQQSGGYGQQSGSYGQQENYGGQNQGYGQTGG
                     SEYNRPHGQGGASSGNSGFPNIDSNTAVSAANQHNSNGNENSSLFSSALSFIGNMNKN
                     DTDIDEGKVQRDHQQAYGQGNTSGMTSSSLGAAAAMQALKSFTSGGADTSSNKQGGGD
                     MQSKIMGMAMSEAAKLFDSSGGNVQGNKQDAVTSAGQVIMKMMLKSQVSGMIGGSNSG
                     GLSGLANMASKFLN"
     gene            complement(13700..16318)
                     /locus_tag="CNJ00070"
                     /db_xref="GeneID:3254230"
     mRNA            complement(join(13700..14101,14153..14252,14308..14651,
                     14732..14787,14850..15092,15156..15283,15341..15564,
                     15615..16318))
                     /locus_tag="CNJ00070"
                     /product="drug transporter, putative"
                     /transcript_id="XM_567265.2"
                     /db_xref="GeneID:3254230"
     CDS             complement(join(13922..14101,14153..14252,14308..14651,
                     14732..14787,14850..15092,15156..15283,15341..15564,
                     15615..16274))
                     /locus_tag="CNJ00070"
                     /codon_start=1
                     /product="drug transporter, putative"
                     /protein_id="XP_567265.1"
                     /db_xref="GeneID:3254230"
                     /translation="MPSVPPGEKAPPSTSAPVPDSDACPPLSTTCQDQIQKESAAADP
                     IIPATSTAIPQASPDLTLRCKYEGNEKADLTDEGKQLYNDGCASSTRTVSEETPPEFQ
                     SSSLPPGCSWGPELAPDLLNALKLDPSHYPSTTSSVGASAGVSETVPRIIWVSFPPSC
                     PHNPFFFSRARKLGITAVATCFTLLTSVNVSAYSIGETSMCRDLGISTEIAAVGLGIY
                     CFGFAITPMILAPLSEEFGRRWTYVAAVFIFLVFHIMMAAAKNLATMLIARIIQGCAG
                     SVGSTLVGGTIADIYLPVQRGLPSAVFAFAAIAGSGMGPVIYAWVESTPRLEWRWIWW
                     LQSMTIGALFPFILLIMRETRESVILRRRAAKLRKEHQSGDNHEKGYHNLFQAPDGVI
                     GRFTARSEMNRIGLWEAMRTSALRPFTFLIVEPVVAFFALWMSIAWGVLYIQIGGLPY
                     VFRNIYGFSTNQIGLIYLSIVIGALIGFFANFVQDAIYRRRFHLDGVEARLYAPMVAG
                     ITFPLGCFLFGFTSLQSIYWLVPCIGIVIIIASCLTIYISAFVYLSECYGSYASSAIA
                     AQSFLRNAFGGAFSMFTVKMYIAITPRWTIFTWGVVALILATVPFIAFYKGTVIRAHS
                     KYSKILMREERERIEREKEN"
     gene            16738..19297
                     /locus_tag="CNJ00080"
                     /db_xref="GeneID:3254125"
     mRNA            join(16738..16914,17010..17050,17099..17364,17415..17732,
                     17781..18556,18614..18811,18872..19297)
                     /locus_tag="CNJ00080"
                     /product="ferro-O2-oxidoreductase, putative"
                     /transcript_id="XM_567266.1"
                     /db_xref="GeneID:3254125"
     CDS             join(16801..16914,17010..17050,17099..17364,17415..17732,
                     17781..18556,18614..18811,18872..19057)
                     /locus_tag="CNJ00080"
                     /codon_start=1
                     /product="ferro-O2-oxidoreductase, putative"
                     /protein_id="XP_567266.1"
                     /db_xref="GeneID:3254125"
                     /translation="MTRISALLATIPLLAQAVSAATIEHWWNISYAVANPDGLFERRV
                     IGVNGSWPPPPLLATQGDTILIHAYNGLNDPNIGTALHTHGISFNGSNYYDGAVGITQ
                     CSIPMGETLDYVIDTNLQAGTFWMHGHYLGQYVDGLRSPLVIEPQNATGRSDDLTWDD
                     DYTLVVSDWYHRQHLDLLTNDFLTWENPTGAEPVPDSAVIYLVKDGKYYPSAEDVANG
                     AAVSDNLSIPFEAGKKYKIRVINMSALAMFYIALDQHDINIIEVDGVEVEPYSVDALP
                     LSVAQRYSILVEAKNETDRNYAMTVMQDVEMYDYLPDELVLNNTIQISYSSSNPHADE
                     VVYPEEFTDIDDTLLTPLLRSAMAPADIEYTLHVNFDTYDDGNNRGSFNNVTFQEPPT
                     ASIFTALTMGNASFLPSVYGAQTNAFTYPHMANIQLTVYNWDAGSHPFHFHGHEFQVV
                     QKSFDVTDEEDEGNGEIVEGQENPMRRDTITIPATGKVVLRWRADNPGAWFFHCHIDW
                     HLSSGLAAVFIEAPEKFQENTVVPQTIVDHCKYWGLPTSGNVVGLNSTTDFDGQPWGP
                     FPLVIGWTPAALTSIFFCVTTAVIGIATVLWYNQDTLDSRDMEEHIRRKIEAKKRRSG
                     LLRRLRGE"
     gene            complement(19816..20864)
                     /locus_tag="CNJ00090"
                     /db_xref="GeneID:3254154"
     mRNA            complement(join(19816..19923,20007..20269,20332..20459,
                     20527..20603,20696..20864))
                     /locus_tag="CNJ00090"
                     /product="u3 small nucleolar ribonucleoprotein imp3,
                     putative"
                     /transcript_id="XM_024657910.1"
                     /db_xref="GeneID:3254154"
     CDS             complement(join(19900..19923,20007..20269,20332..20459,
                     20527..20603,20696..20752))
                     /locus_tag="CNJ00090"
                     /codon_start=1
                     /product="u3 small nucleolar ribonucleoprotein imp3,
                     putative"
                     /protein_id="XP_024513592.1"
                     /db_xref="GeneID:3254154"
                     /translation="MRQLKHHEKKLLKKVDFLSWKQDASQREVKVMRKYHIQDREDYH
                     KYNKLCGSLRSLIHKLSLLPANDPFRQQKEAEMLDKLYDMGILDIGSKPSDIENKVTV
                     SSIARRRLAVVVARLKMSETVSDAVRTIEQGHIRVGPTPVTDPAMLVTRRTEDFVTWV
                     DTSARKRTIMKYNDELDDFDLL"
     gene            20926..25325
                     /locus_tag="CNJ00100"
                     /db_xref="GeneID:3254271"
     mRNA            join(20926..21159,21314..21429,21784..22981,23039..24036,
                     24107..24163,24235..24721,24785..25325)
                     /locus_tag="CNJ00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_567268.2"
                     /db_xref="GeneID:3254271"
     CDS             join(21823..22981,23039..24036,24107..24163,24235..24711)
                     /locus_tag="CNJ00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567268.1"
                     /db_xref="GeneID:3254271"
                     /translation="MSPSRQQSSVFNALGSYADRIKDANGNFIKSSPSSSSSATPEST
                     SLSSSTSGKNAFSTATSKSGQQKQSSSPQQEPITAEDDGPWETVQSTRARQRSDRSEE
                     KEKEKRGSSSKNWRDRTHRDEKNQDDGEKRSGREKSKKEKGDKGSSAPPVGSATSDEK
                     TAKSLSSSTKNAWGATSSSQGASPIASNPVPKQKAQNDSTSRSSSAAAPIGPTTSSIN
                     EIIKQSEGSDEDNWRARPAKVEKNGKTEESASITQAQPQPQRQLAPPPSINIWDLRKK
                     MSVPALFSPTSASSTATVIPPKGDKERSLTNGMLKEEGSATGKSLSKKKSAAAAAAVG
                     TPSVPPSIHDATLWPDITQAAEVAKAGEDKKAKERLNSESASVTEESTIGTGKKPKWT
                     PIPAHKLLAAADRAAEQSRKQNRMEAKKRASAREGGESGPTGSGAPGKGNKTRKGMQA
                     AEGKKAKKEGAQQKEGHASSKAGDAIGAGTGKANGDVKETKEADVRSTSQQESSSHRS
                     GPSISASANAENDSSLHARTKSTPNATTTPLPPHAFNLASSSHLSRSIRGRGEGRGSF
                     GGGRARGGFRSSGALGPKGQLGHGHGHVHGHGQGQGLGYGYGSPPLGVAGLPVEGIVY
                     ASINPGVGAGSTPNLYQRGFGMGFQPFYPAATAAASAGGGGPTGTAAGDAAGVYDPAA
                     AVYGNMGMYKSASMPPPPMPQTVVPNLDPLRFYVLGQVEYYFSMQNLAMDFFLRQQMD
                     SEGWIDIAMIASFNRIKSLTPETSVVRECMTLSNYLEVREDKVRLSGAESHRWVLPDA
                     PPSKFGPDPRSPSLAEGAESSEERDGTASGSQSGLVTVGEEGAQGLQASPRRMFGAQD
                     VKDALMKSSALSTVNGEIKEKEEVKALANESEETEKDEQQ"
     gene            complement(25455..26940)
                     /locus_tag="CNJ00110"
                     /db_xref="GeneID:3254047"
     mRNA            complement(join(25455..25561,25617..25646,25720..25826,
                     25893..26288,26346..26439,26496..26657,26719..26940))
                     /locus_tag="CNJ00110"
                     /product="rRNA (adenine-N6,N6-)-dimethyltransferase,
                     putative"
                     /transcript_id="XM_567269.2"
                     /db_xref="GeneID:3254047"
     CDS             complement(join(25549..25561,25617..25646,25720..25826,
                     25893..26288,26346..26439,26496..26657,26719..26894))
                     /locus_tag="CNJ00110"
                     /codon_start=1
                     /product="rRNA (adenine-N6,N6-)-dimethyltransferase,
                     putative"
                     /protein_id="XP_567269.1"
                     /db_xref="GeneID:3254047"
                     /translation="MPKATSQTFRAQPASAAQRPKKGGESSAAAAAGGGARNHLFDTA
                     KFGQHILTNPLVAQGIVDKANLKPTDVVLEVGPGTGNLTVRILPACRKVVAVEMDPRM
                     AAEVQKRVLGKPEQKKLELIVGDFVKADLPYFDVLISNTPYQISSPLVFKLLSQRPIP
                     RCAVLMFQREFALRLVATPNTKLWGRLAANVQLYARVEHVMKVGKGNFRPPPQVESSV
                     VRIMPRDPPPPVKFEEFDGLNRIIFSRANKTLRAGFKAKGVVELLEKNYRTWCAEQGA
                     IIEDNFDIREKVESILVETGFADSRAAKMDVDDLLKLLAAFNVEGIHFA"
     gene            complement(27045..27134)
                     /locus_tag="CNJ00120"
                     /db_xref="GeneID:3254051"
     tRNA            complement(27045..27134)
                     /locus_tag="CNJ00120"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:3254051"
     gene            27302..31171
                     /locus_tag="CNJ00130"
                     /db_xref="GeneID:3254187"
     mRNA            join(27302..27497,27559..27615,27669..27839,27906..28294,
                     28353..28511,28561..29429,29494..30017,30074..30337,
                     30403..30529,30582..30748,30811..30923,30988..31171)
                     /locus_tag="CNJ00130"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_567270.2"
                     /db_xref="GeneID:3254187"
     CDS             join(27360..27497,27559..27615,27669..27839,27906..28294,
                     28353..28511,28561..29429,29494..30017,30074..30337,
                     30403..30529,30582..30748,30811..30923,30988..31021)
                     /locus_tag="CNJ00130"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_567270.1"
                     /db_xref="GeneID:3254187"
                     /translation="MTEGERPTFDIAVPAKDPEPKEDDKPKHTGDKGKARDESKDEGP
                     EMSEEDLQLKAELEMLVQRLREPDSGLYQPALESLRTLIRTSTSSMTSVPKPLKFLRP
                     FYEEMGKIRDGWSEDLKEQRSLLASILSVLAMTYSDTGKRETLYYRVLSGSEEAPGLW
                     GHEYVRHLAAELGEEYAATYAALGEDADIPQPDTKYTTDQLRALSIELVEFFLKHNAE
                     ADAVDILLEVENISAITKYVDDKTFERVCRYMVSCVPLLVNPDDNAFLETASVIYSKY
                     DRYPEALALAVRLNSPELIRKYYEAPTNPVMKKQLSYFLARAQIPLHWVHTNEDAEPN
                     DTIPTQPEDVLECLGNVKLSTHFRNFGKAVGVEEAKSVDDIYKTHLEPSSRNTAIPDS
                     ARQNLASTFVNAFVNAGFGNDKLMVNAPEGQSWIYKNKAEGMMSATASVGLSLLWDSE
                     SGIDHIDKYSYSAEEHIKAGAFLATGIVHSGIRSDPDIAFALLEEHVDSQSIPLKVSA
                     INGIAIAYAGSERQDIADKLLPYVQDESTSMEVSSMAILALGFVFVGSSNGDIASEIL
                     QTLMEREENQLASEWTVFACLGLGLLYLSAQEKSEPTLATLKAIEHPIAQIAQTIVNI
                     CANAGTGNVLKIQEMLYICSEHATEKKDEKKEDTAAEGEGESPVASSEVPGAIPAAGP
                     PVPPTAAGVPGTDIEGDVDMSDVAAEAGAPDGGAQSAVTGEEGEKEKEAEKTAEQLKH
                     QAFATLGIALIAMGEDVGAEMALRQFQHLMTYGDPVIRKSVPLALGLISASNPQLSIL
                     DTLSKYSHDSDLDVAINAILAMGFVGAGTNNARLAQMLRGLAVYYAKEVDCLFMVRIA
                     QGLVHMGKGTIGINPFYSDRQVMSKTAVAGLLSVLVSFTDARKFVLGKYHWMLYWIVP
                     AMFPQFLITLNEELEEIPVTVRVGQAVNTVAQAGTRHGISGFQTHQSPVRIATTERAE
                     LGTNEFFPYQSVLEGLVILKKNEQYNAEDLH"
     gene            complement(31864..35016)
                     /locus_tag="CNJ00140"
                     /db_xref="GeneID:3254290"
     mRNA            complement(join(31864..32068,32138..32193,32255..32303,
                     32372..32388,32492..32923,32990..33198,33249..33304,
                     33357..33510,33579..33842,33924..34025,34075..34197,
                     34256..34472,34536..34567,34629..34637,34712..34789,
                     34876..35016))
                     /locus_tag="CNJ00140"
                     /product="fumarate reductase (NADH), putative"
                     /transcript_id="XM_567271.1"
                     /db_xref="GeneID:3254290"
     CDS             complement(join(32046..32068,32138..32193,32255..32303,
                     32372..32388,32492..32923,32990..33198,33249..33304,
                     33357..33510,33579..33842,33924..34025,34075..34197,
                     34256..34472,34536..34567,34629..34637,34712..34789,
                     34876..34962))
                     /locus_tag="CNJ00140"
                     /codon_start=1
                     /product="fumarate reductase (NADH), putative"
                     /protein_id="XP_567271.1"
                     /db_xref="GeneID:3254290"
                     /translation="MSKVKVIIVGGGLSGLSAAHTVLERGGNVLLLDKNSFMGGNSTK
                     ATSGINGANTQAQQTLGIPDTSAKFFADTKKSARELARDDLIRVLTYKSGDAVNWLIE
                     RFNLDLSKVSRLGGHSEKRTHRGTQQFPGMTITYALMEKLEDMAAQHPDRVKILKKAK
                     VTKLLQEDGKVIGVDYERDGKHYTEYGPVVLATGGYAADFTADSLLQQYRPEYYNLPT
                     TNGDHCTGDGHKMAMLIGAKGIDLEKVQVHPTGLVDPKDPDAKVKFLAAEALRGVGGL
                     LINRDGERFVDELEHRDYVTGKMWENDKFPVRLVLNSTSSKEIEWHCKHYVGRGLMKK
                     FNSGEELAKEIGCSPEALKKTFDDHNRYAKNPGTDPFGKKFFSGGDFSMSDTYHAAIM
                     TPVLHYTMGGLEIGINAAVHNANGGEVEGLYACGELAGGVHGANRLGGSSLLGCVVFG
                     RVAGDSVSSYLLSSLANTDANVKAAKRLGTINNHLVETKIKLDPESKALQLSFSWGDE
                     TGDQNQKDAGGAQVPASSAPGQKGDRTAAEIEPEALPTPPAKKGSDKGDKKEYTLEEV
                     AKHNTEKDCWVVIGGQVLDVTNFLEDHPGGVKAIMLYAGRDATEEFDMIHPPNAIAKY
                     APDTVIGTIKS"
     gene            35286..35865
                     /locus_tag="CNJ00150"
                     /db_xref="GeneID:3254040"
     mRNA            join(35286..35327,35395..35481,35579..35865)
                     /locus_tag="CNJ00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657911.1"
                     /db_xref="GeneID:3254040"
     CDS             join(35325..35327,35395..35481,35579..35752)
                     /locus_tag="CNJ00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513593.1"
                     /db_xref="GeneID:3254040"
                     /translation="MATSDKLLGGAMLFIAAFVFVYYTIWALLLPFLPPTSTIPSFFP
                     PRSYAIKIPLFLLLAGICGVTLFFGRVMLAEARKKRVKGGKKV"
     gene            complement(36051..39074)
                     /locus_tag="CNJ00160"
                     /db_xref="GeneID:3254157"
     mRNA            complement(join(36051..37047,37136..37255,37314..37853,
                     37901..38623,38888..39074))
                     /locus_tag="CNJ00160"
                     /product="g2/mitotic-specific cyclin cdc13, putative"
                     /transcript_id="XM_567273.1"
                     /db_xref="GeneID:3254157"
     CDS             complement(join(36844..37047,37136..37255,37314..37853,
                     37901..38623,38888..38905))
                     /locus_tag="CNJ00160"
                     /codon_start=1
                     /product="g2/mitotic-specific cyclin cdc13, putative"
                     /protein_id="XP_567273.1"
                     /db_xref="GeneID:3254157"
                     /translation="MPSGIPTRRVRLVDENAPPPPGAVVTRTRSRALASTTSTATNVK
                     PTTTSIPMMKRQRSTISSENKIVDKSDVRRNALGEVRNGKGGEKEKESGKGKVVAIER
                     KPLATTQAKAQRVTRSASAQPVMGVKDGDKKRKAVITSKIPSRSRSTGAEPAQVEVKP
                     TIKTEEEPVRKRRKTSSPVVEVGEDGPTVDGKELLLSSGSKNATAFRSPKIKAKDDGW
                     TDLDAEDEGDPTMVSEYVVEAFKYMMDIQGQTMPDPEYMDNQAELQWKMRQILMDWII
                     EVHSKFRLLPETLFIATNLVDRFLSKRVISLVKFQLVGLTALFIASKYEEVCCPGVEH
                     FLHMSDGGYTVEELLKAERYMLSTLQFDMSYPNPLNFIRRISKADGYDIQSRTVAKYL
                     VEISCVDHRLLGYTPSMLAAASMWLARLCLERGEWNANLVHYSTYSEDEIRPCAQVML
                     DHILDPDFDESTSFYKKYASKKHMKASVYVREWATQLWPASADGSAVERGTELELLKM
                     FLEDEEEENNKGSKRRMKAVDEEEEY"
     gene            41522..43131
                     /locus_tag="CNJ00170"
                     /db_xref="GeneID:3254294"
     mRNA            join(41522..42126,42226..43131)
                     /locus_tag="CNJ00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_567274.1"
                     /db_xref="GeneID:3254294"
     CDS             join(42017..42126,42226..42790)
                     /locus_tag="CNJ00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567274.1"
                     /db_xref="GeneID:3254294"
                     /translation="MTSFKFLSLLTTRALDSLPLPLLVIIFVACLVLLHCPASPTPSL
                     LPLYTPPPSLSSSPSIFEKGNRVSSFLFSFPPSHSSPTNRPRGTDPFSFPGSLPAGSP
                     SFPHTSLPASSSSSQLYSHSRLPLVFSFPLGETAWICTEQQQHHDGSPQETTKPAAKE
                     KHARRGSNNNGSHGKRKIGSKSFGLKGWKLELGVVSEEAEAEPDVVDVEANARGPVET
                     KRVLEV"
     gene            complement(43204..44909)
                     /locus_tag="CNJ00180"
                     /db_xref="GeneID:3254202"
     mRNA            complement(join(43204..43416,43495..43674,43737..43890,
                     43971..43992,44049..44067,44138..44176,44231..44313,
                     44376..44474,44547..44573,44635..44909))
                     /locus_tag="CNJ00180"
                     /product="nucleoside-diphosphate kinase, putative"
                     /transcript_id="XM_024657912.1"
                     /db_xref="GeneID:3254202"
     CDS             complement(join(43393..43416,43495..43674,43737..43890,
                     43971..43992,44049..44067,44138..44176,44231..44313,
                     44376..44474,44547..44573,44635..44659))
                     /locus_tag="CNJ00180"
                     /codon_start=1
                     /product="nucleoside-diphosphate kinase, putative"
                     /protein_id="XP_024513594.1"
                     /db_xref="GeneID:3254202"
                     /translation="MFANSLRQGLRTASRSSARAFSTIPARAPRTNVVGALALGTAVA
                     GYALYETTRSPVMLEGARTIAGEKGTVTERSFVMIKPDGVSRQLVGKIVSRFEERGYK
                     LVAIKSLTPSDALAKEHYADLSARPFYPSLVKYITSGTPVVAMVWEGKDVIRQGRRIV
                     GATNPLDADAGSVRGQYAVSVGRNLIHASDAFESATKEIGLWFAPEELSEYEPIAWPW
                     VMADN"
     gene            complement(45620..46778)
                     /locus_tag="CNJ00190"
                     /db_xref="GeneID:3254082"
     mRNA            complement(join(45620..46324,46681..46778))
                     /locus_tag="CNJ00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_567276.2"
                     /db_xref="GeneID:3254082"
     CDS             complement(join(45675..46324,46681..46714))
                     /locus_tag="CNJ00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567276.2"
                     /db_xref="GeneID:3254082"
                     /translation="MQDLFGFLVMAWAGNTALSLLLARPPAWLSSPTPWLVYPPVYLL
                     LVPTGLAARAVHRLPPVLIDTLAAAVDALSRGAAIASIGPMAHASGKFPAHPTGQRAE
                     ISPWTYAILSALAVSAGGFLVSLFSLHEPAYRLAVPSVFRRGAGAWATMDVWAAGLAG
                     LGYWAMVTLRVEDVQQRFGVAASMANGEAPLMHSLAARTVCVLFLGSVLVLRAVRCSY
                     RGARKKVTE"
     gene            complement(46850..49233)
                     /locus_tag="CNJ00200"
                     /db_xref="GeneID:3254174"
     mRNA            complement(join(46850..47188,47237..47436,47488..47604,
                     47658..47863,47912..48016,48073..48181,48236..48324,
                     48374..48554,48605..48685,48746..48804,48867..49003,
                     49091..49233))
                     /locus_tag="CNJ00200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567277.1"
                     /db_xref="GeneID:3254174"
     CDS             complement(join(46873..47188,47237..47436,47488..47604,
                     47658..47863,47912..48016,48073..48181,48236..48324,
                     48374..48554,48605..48685,48746..48804,48867..49003,
                     49091..49212))
                     /locus_tag="CNJ00200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567277.1"
                     /db_xref="GeneID:3254174"
                     /translation="MGHNSDKLYVTHSEHAAGSHTASSFGKRQETGKSEFQRLPFDCC
                     ALSLQPFKNPVAVISETKAGEAPRADVFDLLNIVPYIRKFKSNPVTGKPLETSQLIKL
                     NFSRNAEGNLHDPITYKVFSPHIHIVFLKNTGNVFDMASLQLLAIKPKTWRDLVNDEP
                     FKRKDIITIQDPENLAARDLREYDYVKKDLKVSEDELAGDPLRGINVDAAGGASKVLK
                     MIAEKNKSGQSPAPTPSKIDDGKGQEKKEGVVAKRKVEQMAYNASNYSSGRAAASLTS
                     TSLMPETKSERAMFDEEEYMFEELSRPTKDKERQKSKAYATITTNFGPLNVELHGDRA
                     PKTVYNFVQLAKAGKYDNVVFHRLIPGFMVQGGDPTGTGRGGESYWGEPFRDEHGEKG
                     AYKHDSRGVLSMANSGPRTNGSQFFFTFRPTPHLDGKHTVFGKLVGGEETLDKIERVN
                     VRPGGDRPVRDIVIQGVTVLQDPFEAYQARLQARLARQDQSDAALKRRAEAQKEREKD
                     RTTWLGTKLGEKGAVGKRRMEEDVGVGKYLKVGGEAGQRTTLDVVDYGVEKKKKKAGG
                     FGDFSGW"
     gene            49365..52646
                     /locus_tag="CNJ00210"
                     /db_xref="GeneID:3254079"
     mRNA            join(49365..49591,49637..49656,49719..49896,49948..51084,
                     51140..51326,51371..51884,52000..52122,52202..52646)
                     /locus_tag="CNJ00210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567278.2"
                     /db_xref="GeneID:3254079"
     CDS             join(49411..49591,49637..49656,49719..49896,49948..51084,
                     51140..51326,51371..51884,52000..52122,52202..52558)
                     /locus_tag="CNJ00210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567278.1"
                     /db_xref="GeneID:3254079"
                     /translation="MDGQECMAYAILLTYFLLIFLSFGLVFRSLVAGIQLDKLFEGKA
                     FFFLRSALGALLCTWYFMIQFMSWSYQDFAVYNSPSTVGQWLANTGLFEQAWSIVCNG
                     PGNWWWSSWICTWTVAFTAIVWFESGRRGITYPYAYMLLGQLVAMSVATSLFLVALSL
                     HPRIHPSPRTIPLYIALPLVMAFVPIYFLPQDVGTGRFMKMLLWLHGALFLVLTSPPA
                     SGEDVASRKGVSPSFLNTVFIALAGVIHIPATIRLITAIPTGQSLTSYLYTTLFSHPA
                     QSSISLDVVWVFLILSIWSVLSGSSLSRFLKSTFFLSGLGLALVNYTGINWGLVASIV
                     PMLLLLSVGGCALYINSLRKTNALKRATLLEKMGMPDNVLIHGTTTTPPYMSTKKTIV
                     GFWHPYCNAGGGGERVLWVAVRYIQRQEPDTLVLVYSGDYPTASKEEIIGKVYERFSI
                     ELDPARLHFVPLKKRYLISDGYWKRFTLLGQSLGSLVLAFEGLCGEDGLWGDLFIDSM
                     GYAFTFPLVRLIAGSQIAIGSYTHYPTVSADMVKRVKARTVGVENGGAAKSWVRTKIK
                     LLYYHIFTSVYSLSLLYCQHILTNSSWTQAHIQSLLLSARQSFLASLLLKDDLTLEKR
                     RERGELQEGDDAGDTRCEVVYPPCDTRKLSSLPLSLPSPTPKRGRKREFVSLAQFRPE
                     KDHKKQLEAFAILLKEHPEMREGEGGVKLVMMGGVRDEGDQQRLEGLKKIATELNIED
                     NVEFVVSAPYSEIVRRLGQASVGLNTMMDEHFGINVVEFMAAGLIPVVHASAGPLLDI
                     VVPFHNQRTGFHATTAASFAEAMYQAMTMSDKEAMKMRKAARQAAEEKFSEKRFEEGW
                     EKGWRRLTGLIGGVGVGDGDGEGSKIAGNRKSRGSKGTREKS"
     STS             51974..52756
                     /standard_name="Pst13"
                     /db_xref="UniSTS:470958"
     STS             52521..53232
                     /standard_name="Alu2"
                     /db_xref="UniSTS:470957"
     gene            complement(52640..55406)
                     /locus_tag="CNJ00220"
                     /db_xref="GeneID:3254163"
     mRNA            complement(join(52640..54709,54759..55162,55226..55406))
                     /locus_tag="CNJ00220"
                     /product="RNA helicase, putative"
                     /transcript_id="XM_567279.2"
                     /db_xref="GeneID:3254163"
     CDS             complement(join(53111..54709,54759..55162,55226..55355))
                     /locus_tag="CNJ00220"
                     /codon_start=1
                     /product="RNA helicase, putative"
                     /protein_id="XP_567279.1"
                     /db_xref="GeneID:3254163"
                     /translation="MLPRQLSRAPRALGYVLPRFSPPSSVLRTVTPAFARSTQLSLRR
                     ILEKRGYAVSAVAEKDDDFFSGAELAPSSNTVVIPPQLDDPGHPASEPLVDTVPFESL
                     KGRINHDTLKALTVKPFKFTAMSEVQKRVLGLLPHLSGGKLRSKAREEAEQEGEVEMK
                     EEREDLLVKAKTGTGKTMAFLVPAIDARINTLERLSKAPNPDGTIPDKHAQGRNHRAI
                     SRSHLGALIISPTRELATQIAVEAEKLCTWHKDLTVHSFVGGESRLRQLKEFSRRSKD
                     VVVATPGRLRDLISEPLVKDALAKTDMLVLDEADTLLDMGFSEDLKFIIDHLPKERQT
                     LFFSATVSKEIAAIARHSLRKGHKVIDCVPKNESNVHLHIPQYATVVPSSADAMPHIM
                     RLIAQDQMANPKSKIVLFLNTTKQTMLTATLVRELVDTLPAQTAVYEIHSKLDQNKRT
                     RSSDKFRREHRPAVLVTSDVSARGVDYPGVTRVIQLGVPSTTEQYIHRVGRTGRAGKE
                     GRGDLVLFPFEAGFLDHLKGIPIQRISTSDLTSDVIAKAPSSYASVIDSLPSAVESLL
                     PTLDPKAVEEVFMSMLGYYHSKQQMLDASAQDILKGLKAWSVEGGGLIEPPYVSEEFL
                     KKVGFSEKRRNTRNGGGGSRGGFGRSSGGFGRGSGGFGKRDGGRREDSGGFGGRGQGG
                     GGSGFGARRDGGGGFAGKSRSGGFKRDY"
     gene            55578..56770
                     /locus_tag="CNJ00230"
                     /db_xref="GeneID:3254176"
     mRNA            join(55578..55767,55815..56770)
                     /locus_tag="CNJ00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_567280.2"
                     /db_xref="GeneID:3254176"
     CDS             join(55666..55767,55815..56354)
                     /locus_tag="CNJ00230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567280.1"
                     /db_xref="GeneID:3254176"
                     /translation="MFEDDDWLNGPQQGGAQDPLVEQEYTRIASKYSDAGYREGITDG
                     KLSTLQQGFDEAFAQSVPLSRRIGALRGRAAALLAFAKASSFSSPTSIPTLNSIPHSR
                     QALLDDLHDYIKQISSIRRSEVLPEDLERIVHEREDYAAASASANNGVFELDTTHERK
                     MESLEKSLEMFGSTSGTKASQDDKEEGEEKKYGEEGIERLEAKLRELEGRFRG"
     gene            57039..58826
                     /locus_tag="CNJ00240"
                     /db_xref="GeneID:3254181"
     mRNA            join(57039..57189,57257..58826)
                     /locus_tag="CNJ00240"
                     /product="expressed protein"
                     /transcript_id="XM_567281.2"
                     /db_xref="GeneID:3254181"
     CDS             join(57127..57189,57257..58486)
                     /locus_tag="CNJ00240"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567281.1"
                     /db_xref="GeneID:3254181"
                     /translation="MVSSRKLFKKTLLIAIKPSRSATSTLTTRPSTPTDLPIFPQEIF
                     EQIISHLTDNPSALRAIALTCRALSPLALNPLWYRVPVGLQSKSPLKTHYFGPTTREI
                     ISLGLIKPLPFPNLSAELRGMTRVIDFYFRHFGWSLALYRREHRFLELFNKVKAIRIH
                     LDSLCGYMSSTGVPSKFRDEDAGYENYAPRLPASEKVVFIGPCYDPYYGSWFCSWKGH
                     EWLSSKAPKKLVLLLKTNAHPISFRPGSFAASVLLSTSIPDLRDIVIIFHQGAKRYKP
                     LRTIEGDPWRQVRKEMVVLLAALRKKYPGTRVTLVNTGCFRATWLGYNKPVEEEAVQQ
                     KVMEGLKKVGAAKGIKLFGRFSNYPHPHSSGTSPAVKSLVVDGRTTDKNNRGKSARDG
                     IGTPNAGNEKERLMSLGEYLRVEDWEGELDEREIGSWL"
     gene            complement(59937..64476)
                     /locus_tag="CNJ00250"
                     /db_xref="GeneID:3254044"
     mRNA            complement(join(59937..60152,60221..60346,60409..61934,
                     61975..62637,62682..62756,62793..62915,62955..63435,
                     63495..64476))
                     /locus_tag="CNJ00250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657913.1"
                     /db_xref="GeneID:3254044"
     CDS             complement(join(60030..60152,60221..60346,60409..61934,
                     61975..62637,62682..62756,62793..62915,62955..63426))
                     /locus_tag="CNJ00250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513595.1"
                     /db_xref="GeneID:3254044"
                     /translation="MPLLKRKPVHLTPLPSLSAVLQPIPASSSTSDPLQTQAPTPLTH
                     EQLQQFIPPDGKDDAEQLEKLLAVFRGEFTNGHTTVVGKKSKGKAVAPSSTMVNGESP
                     QDGEPSATVQEEPAVAWRIHDRDCWYIPETGEIFTDYESYSARKAFYDQQIFQCEVSG
                     KSSMPYLDALRSEQKEIRQLHTRFPKQLKKAVLSAVQFQIEGKLENLADKIFERFHNR
                     FFDDEKVFVDVQGDKYLARIIKTVPPSPSLTLIPSTSNGLTLETHPLAIDLNLASEDV
                     LEKDDPGQYIYVVKLVEDGVEDDDQENALQVTADKISRDRINFSRAMLKRFIRDCVER
                     DAAVYSPWIVKPAVARRWGIPMEMSESTRLFISSYRERQMGKRKREREERLGLNVEDE
                     EVEEKPKTKKQMKEEEKRMKEEEKAKKKDEERRMKEEEEERKKKKQMKWPNEDLLVEW
                     SEEDVRVRPQLVRTLPFGDQFEKLLNSWSFLNVMGTPLNLSPFTIDEFEQSLYHTTSP
                     SPPLIAEIHACLLSVLIADAASGHSPVRPISATGRQPEDDRDYWEGEKGATTETLSPV
                     AEKLAQSWKDTEIPLRDNRRGWEAALIGCLWERASLESLPNFLDNILHLTFEPKPAPT
                     RPTWSTGPSSSTSSSGLGLVPAKIPTRYPTLHHLHKLDIIVFLIELVGQTEKVRGFME
                     ESIAALTEVRKEQVDVKREVRRVQAEREGLEPKTEDVEAVEGEAGMDVDVDVKVNGHV
                     NGGGEGEDELEDDLDSEMRPPEDDSYSALSSPPSADQGHHAQTAASRRRAMAEKARER
                     AAEEAMHRERAIKEREEARLSKYNASEKKRLLEEEEVLAAKLKKLDYEFRSHIWTLRS
                     KPLGLDRFGNRIWWLDAQGSAPMLAPDGKLTYGTGRLYIQGVDEPEETYYLNAANAVL
                     EGMGVKEEVKKEDVERRRKMEEGGKLGRGEWGCYDDVEQVREFMRWLNPKGIREKDLL
                     KALTFWQPELLGGITKRRQVMGLDGQSENEEPARRTRPTRRAAGDDEEKGYMGWRNRR
                     AGGKE"
     gene            65081..66751
                     /locus_tag="CNJ00260"
                     /db_xref="GeneID:3254319"
     mRNA            join(65081..65274,65325..65481,65531..66053,66106..66284,
                     66336..66751)
                     /locus_tag="CNJ00260"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_567283.2"
                     /db_xref="GeneID:3254319"
     CDS             join(65114..65274,65325..65481,65531..66053,66106..66284,
                     66336..66389)
                     /locus_tag="CNJ00260"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_567283.1"
                     /db_xref="GeneID:3254319"
                     /translation="MSASPSATAPPEASPTATPTTATTSKRPASPDNAEDSAKRPKQD
                     QNKMADVEMQNEGSPKTAPSSEPTAPAKPDPGPQQISMRSLIVTQDASIIIGRGGAHV
                     NEIREKSSARVTVSESIPGNPERILNVSGPLDAVAKAFGLIVRRINDEPFDVPSVPGS
                     RAVTIKFIIPNSRMGSVIGKGGSKIKEIQEASGARLNASEAMLPGSTERVLSVSGVAD
                     AVHIAVYYIGTILLEYQDRYPSNATGSYKQSQSRGPPPNSNAPPPPGMQTQQIFIPNA
                     LVGAIIGRGGSKINEIRSQSSCQIRVTDPGTTVPGGAAANPEERLVTITGYPDNINAA
                     VALLYSRVEAERAKLVEQNAGGM"
     gene            67470..68561
                     /locus_tag="CNJ00270"
                     /db_xref="GeneID:3254146"
     mRNA            join(67470..68085,68177..68315,68375..68561)
                     /locus_tag="CNJ00270"
                     /product="expressed protein"
                     /transcript_id="XM_567284.2"
                     /db_xref="GeneID:3254146"
     CDS             join(67882..68085,68177..68315,68375..68376)
                     /locus_tag="CNJ00270"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567284.2"
                     /db_xref="GeneID:3254146"
                     /translation="MTPFKPSIPKRISSTPQVNNLLVHNTHFNSLTMSTSTSHAVDPV
                     NQSAVPSSIQKKAPEGLEKTLPDSVHNTDPSKDERYVSHATGPSMVPEAIQKAAPEGL
                     EKALPESIHPTN"
     gene            complement(69839..73634)
                     /locus_tag="CNJ00280"
                     /db_xref="GeneID:3254289"
     mRNA            complement(join(69839..71018,71088..72056,72114..72274,
                     72329..72816,72901..73150,73203..73634))
                     /locus_tag="CNJ00280"
                     /product="LIM-homeobox protein, putative"
                     /transcript_id="XM_567285.2"
                     /db_xref="GeneID:3254289"
     CDS             complement(join(70190..71018,71088..72056,72114..72274,
                     72329..72802))
                     /locus_tag="CNJ00280"
                     /codon_start=1
                     /product="LIM-homeobox protein, putative"
                     /protein_id="XP_567285.1"
                     /db_xref="GeneID:3254289"
                     /translation="MSVPAPQQGHPNSLDGYRGYDQQRQPVTGPSNYGRETYIPVSNG
                     YAAYPPNQAGDGSQPARIPIQPHIPPEPHTYQRSYQSQPAAYMHPYAADMHQGMPSYS
                     YGADVAPTYQFGSLPAAPQSLLPQQSTRPMTAHAGDTVPFGEDGPKDGNDTLNTLEGL
                     QVKHRRRTTPEQLKVLEFWYDINPKPDNQLREQLAAQLGMTKRNVQVWFQNRRAKMKG
                     LAKKEAEGQESKKSPENQEGTSSAIGPSPPLTDSAVSSSHFNLLPPPASVNMGRRASL
                     ANGEAAKIEIFVAKRAAAQKREEVLYNVGDAGANSPALGQAHAARRGSVPYPTPLASV
                     PPASTSPLSPKFSPAIRGPSTLHMAAVRNNTRRSSIPGVSQLITSGPFTPPRVVSNQH
                     QTAAQSKGTRELSPIQDHEVYDTYDAEFQPWSSDFPPNMHLPPAEGFHDGRPFSHDSP
                     LPNPAFSFGSAPQGLDMHGIASMGQLDERQQQMFMMMQQRGRLGSIASIGTMGTETGT
                     EGGESSKGEWLVDGPEGFDPDTRRASAPADLLHQIGLMGFAALPNGAPAPIRPSPLNA
                     HFVPDSFQSTPPYYPPSTSSSSTYSFPLHPSSDSLSIESPTTAHFEAPKPGSRGEQAH
                     QPQTQSQLQQNHRNLEPGNRMPSYTSTTASHWPNSDVSPYSNHSISYTGYQDGWNPSP
                     QQQAFQQQHLTPSGEHTPNMGVGVGGGADAGADAGMSIGLGHPSNPHLGHHRDPSPAQ
                     QLQVAASVDEKTPTADPPLPQPLGHPGSNSNSLDSRNGQEGGVTGGNEEGKDQFLYFS
                     ESGGHDAVNVLV"
     gene            76187..80364
                     /locus_tag="CNJ00290"
                     /db_xref="GeneID:3254173"
     mRNA            join(76187..76471,76690..76926,77715..78217,78266..79872,
                     79948..80364)
                     /locus_tag="CNJ00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658746.1"
                     /db_xref="GeneID:3254173"
     mRNA            join(76593..76926,77715..78217,78266..79872,79948..80363)
                     /locus_tag="CNJ00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_567424.2"
                     /db_xref="GeneID:3254173"
     CDS             join(76672..76926,77715..78217,78266..79872,79948..79997)
                     /locus_tag="CNJ00290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567424.1"
                     /db_xref="GeneID:3254173"
                     /translation="MSMFSQFSFRPLDEVPKPRIHTDSDYNSPTPSTDIDSPAKFGDS
                     YDSDEFLEHHSSPSSLSLSRSWSRPSRRDKIPEEDEENEGDIRASNPVRSRTSSPVLP
                     KFGSSLPPSRRGSQDHFKQAQFHSVPQSMAGNRENTDHLAAPSPPLSIRGSRSGTSPS
                     SRPPKLNALSPLQAFSPLQSMKTPMHVSDTAGTGSLTRSRSSSSVTRSLSRRESMVEN
                     AQRWRSGLDADDDGKGLFSRLTLVKAPRKKDDVRRHSRSKSSSSLAPFNSFSSSFDAP
                     ATSASGPRRSFAASSFGAVPPSVPSINLPSNNIEPSNDTLHRVHSHGDAGSVGIQRKV
                     LSPDEVLDMARSFQSPMLAPEGSFGNSQSQASSLKRRKSAGSIFERSPEPPVTAELEP
                     VEYVQMEDDVLLPFVDRCAEVRDLMSHQSNTKLFALLRAAFPKDPARETWKKISPEEW
                     NWEEFVKHLTEVDRDELDDYDWVYKDRQAVRNRSVALWEKLGVCLGCDEDLLNAGSED
                     DSPSSWAGLGLGDEGDYDPAMNHVFIAGIEPVDQEEQARAERQFMDEFGDIVEDENEQ
                     AAAGMTALLGSPMATIGEETPSFSSGKPSRQETASKPTPAQRAGNRANIDPMLSSSVE
                     DSPPRTARFAAEAHRPSQSHSINTNKNQLDRPRRSFVGLQICTSPANTTPTLPFERSR
                     SNSLTFSQGQTPHQASGGLGLATSPLSISSGAAPVPLYERGPGSPLFPSSFSSLSLEP
                     NLGRKASAVNRGAAVPIKEELKGWKQAQQAHAGHGGLGRKASQAGLSESAITFVSESD
                     WSNSAT"
     CDS             join(77850..78217,78266..79872,79948..79997)
                     /locus_tag="CNJ00290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514428.1"
                     /db_xref="GeneID:3254173"
                     /translation="MAGNRENTDHLAAPSPPLSIRGSRSGTSPSSRPPKLNALSPLQA
                     FSPLQSMKTPMHVSDTAGTGSLTRSRSSSSVTRSLSRRESMVENAQRWRSGLDADDDG
                     KGLFSRLTLVKAPRKKDDVRRHSRSKSSSSLAPFNSFSSSFDAPATSASGPRRSFAAS
                     SFGAVPPSVPSINLPSNNIEPSNDTLHRVHSHGDAGSVGIQRKVLSPDEVLDMARSFQ
                     SPMLAPEGSFGNSQSQASSLKRRKSAGSIFERSPEPPVTAELEPVEYVQMEDDVLLPF
                     VDRCAEVRDLMSHQSNTKLFALLRAAFPKDPARETWKKISPEEWNWEEFVKHLTEVDR
                     DELDDYDWVYKDRQAVRNRSVALWEKLGVCLGCDEDLLNAGSEDDSPSSWAGLGLGDE
                     GDYDPAMNHVFIAGIEPVDQEEQARAERQFMDEFGDIVEDENEQAAAGMTALLGSPMA
                     TIGEETPSFSSGKPSRQETASKPTPAQRAGNRANIDPMLSSSVEDSPPRTARFAAEAH
                     RPSQSHSINTNKNQLDRPRRSFVGLQICTSPANTTPTLPFERSRSNSLTFSQGQTPHQ
                     ASGGLGLATSPLSISSGAAPVPLYERGPGSPLFPSSFSSLSLEPNLGRKASAVNRGAA
                     VPIKEELKGWKQAQQAHAGHGGLGRKASQAGLSESAITFVSESDWSNSAT"
     gene            complement(80302..83057)
                     /locus_tag="CNJ00300"
                     /db_xref="GeneID:3254298"
     mRNA            complement(join(80302..80703,80778..80913,81027..81323,
                     81384..82299,82353..83057))
                     /locus_tag="CNJ00300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567287.2"
                     /db_xref="GeneID:3254298"
     CDS             complement(join(80641..80703,80778..80913,81027..81323,
                     81384..82299,82353..82779))
                     /locus_tag="CNJ00300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567287.1"
                     /db_xref="GeneID:3254298"
                     /translation="MQDHQWVHPEGLSSAGSPLSFTNSTPTPNASLFNYAPSQHHHRP
                     STSSGYHMINPSGLGRSSSGIYVGGIGSLTTVAPTAIPPPVAVEKPLVPVFGGDSGRG
                     RPKSKNPKAKPQGLGTERKARKKVAKACLACQKSHLTCDEQRPCTRCVKKGMADKCVE
                     GVRKKAKYLMEGDERLSSSMQSQASSVHSMSPQSIHQSLPTMATLPTQSTDSQIQDVW
                     LANAIQRQNPTPNINIAPGMSMNQSDVWGTQSAEITPGTYSGYSTTAGTAANNEYQML
                     DAMFSSLSPVFPGLNDSLDDTSRQIANVTQAGTNLDLVNNSGPNSFDPQQPWINPSPS
                     QSANTYNPTPSGSSVPGTGISPSTYGGSEVSPHQQWGWGSMDAPGQVMLDGSGVPGQR
                     NQVDLGQVRGPGTVTASNEWRRTNKALTPQEVYRAVVRPYEYTQGYHVLMDYLTKNFE
                     TSDVLRVVRSLASFRPSLIALQMSMSEEDEVFLEKSFQRTMIELEKLISYCATPTAVW
                     RRTGEVCYANPEFCELVGKTDNELLSRKTYIYQLFAKPSVVSYWEGFSTHAFENTTQN
                     FFQSISLALDAGEVNPCTCCFTIRRDVFDLPSVVIGQFLPIPSETQ"
     gene            complement(83271..85259)
                     /locus_tag="CNJ00310"
                     /db_xref="GeneID:3254161"
     mRNA            complement(join(83271..84657,84761..85259))
                     /locus_tag="CNJ00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_567288.2"
                     /db_xref="GeneID:3254161"
     CDS             complement(join(83422..84657,84761..84829))
                     /locus_tag="CNJ00310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567288.1"
                     /db_xref="GeneID:3254161"
                     /translation="MPAAAPIILGTIAVIGTGYMFKKFVYDPHLAPYIESAWETSRSR
                     AEAVADRVGVPSVHYFHRHPRGHRYERVEDEEEDEEVDGKAIAMPVIGTSTAILSPGG
                     ERRGEGKSLRRRGSKRAGSEEFESEFKPANPLFELPPSSSSSPSPNMIGKPFKTFKAP
                     TPVTSAVGTSAAKGWQTPEYTVTRPDSAQDAEVRSVIFNVPSTFTPPSRSAPPSWSNT
                     HIPVRLSSPISAVGVSSPNEEGDIFTSPSPFSPVTGSGLALAPSTTFSFLSLSQQSSP
                     TYIPQALNELTFDRHDRMGEGAAAGSVDSPRMNREGGGAREDDVVSLAETSTTGFEDA
                     EAYSPTPLSRTLSGSSGSPRSQAGNLCNMSNNAGGDAFIDTLGLTYVMPPPPSHAHAS
                     GLSSYPHPQRRGPMSVVSISESEADEGRTDSEWEAVGSEYGR"
     gene            85701..88303
                     /locus_tag="CNJ00320"
                     /db_xref="GeneID:3254046"
     mRNA            85701..88303
                     /locus_tag="CNJ00320"
                     /product="expressed protein"
                     /transcript_id="XM_567289.2"
                     /db_xref="GeneID:3254046"
     CDS             86549..87565
                     /locus_tag="CNJ00320"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567289.1"
                     /db_xref="GeneID:3254046"
                     /translation="MSTLAATERVKSPNTIANLVARAQLASGESSLEMLGHTFALGVE
                     LDEDDFRALLQDMALLSNECRQRAAKLKGHKGAVVSTLAWESLRQLVDAKIIYANMLR
                     WVWRQRKPRRNGHTKTENPGSFGTPSRNHDTRENVGQAIKEEGEGDIEPHPFPVKHGS
                     VCQSQAPSSRQESNSSSNDSDGLDAAHRKGSNPLIAVSEDAELSSFAIHPRYRSSATS
                     IPTPGRRSAWLPSPTDMSSLYSSRNQSIASHEGSHEGLPVLYRTQRISSTGSLILPNG
                     ISAWNRNPPSCTSRPTMSFRLFIRQILSSLRGYYLRPASNITECVLISSLTPTSPPPS
                     PSQE"
     gene            88509..91324
                     /locus_tag="CNJ00330"
                     /db_xref="GeneID:3254055"
     mRNA            join(88509..88879,88948..89115,89170..90306,90359..90578,
                     90636..90912,90975..91324)
                     /locus_tag="CNJ00330"
                     /product="PRO1 protein, putative"
                     /transcript_id="XM_567290.2"
                     /db_xref="GeneID:3254055"
     CDS             join(88620..88879,88948..89115,89170..90306,90359..90578,
                     90636..90912,90975..91309)
                     /locus_tag="CNJ00330"
                     /codon_start=1
                     /product="PRO1 protein, putative"
                     /protein_id="XP_567290.1"
                     /db_xref="GeneID:3254055"
                     /translation="MFIPRQEVPAVQYESPESQSSSSSSSATTNITFISAFSKIDPST
                     NNRSMDSPMAGNGENGEVGEASGSNQNGDNASETAQERRRIVRGKTGCITCRLRKKRC
                     DEAKPICATCSRLGIECMGYGVKRPKWLREKDNAQKAKEHIKATVMKRSMARGQGAAP
                     EHEDIYMYNGDVNLSASTDTVMNNIWGGEDNMVGAEMADTYDWGPPGSAADFLQAISL
                     APSIPVPPLDPRGNTDSTINSVDAFSLPFYAPGPDPSIFPPAPATNMTVVNANGSADT
                     RGEGNDDELGDLWTSLFGQTFPASWGNVPSQGLPSLTPSPTQSNQPSPFFALPSPFAD
                     LGLTPPPPPAQRNPKDLSYLNHYLKVVLPMQYRIMGISVLMGDFVAPLALYHPEVLAS
                     VSSLAALHLVSQRTKHRNRIFPTDPSINSPSIMTTGSGAFRVGSASLTEIGDDEAIVA
                     TAAHQRSIERLRFLSPQELTAGDVIISVLFAISYHLFSGGTSKHLKEMLAISQRCLSA
                     ALASSPELSEDGIRSNPSPARHTPWKKYRHLIEHMIWTDVIASVSQNKASRLLPTYRR
                     ILIHFPADTPETAESMILMDKVMGCDSTTLLAYAEVVALSEWRERVERMGCLSLKELL
                     RRGAAIEKLLDERAWREAHLERPSSPPLNREGPSDDLRRVMSDVFYGAAKVLLASVIN
                     GPFPRVPDIAGGVQDTLEALSRLDTEHQDSGHNIHRALVLPITIAGCHCETPAQQAFF
                     RNCFERLGPEAKAFGNTGPALELMEEVWRKRSMAEPYAKICMRDTMKEMGWEVELLLI
                     "
     gene            complement(91331..92390)
                     /locus_tag="CNJ00340"
                     /db_xref="GeneID:3254043"
     mRNA            complement(join(91331..91887,91940..92010,92079..92390))
                     /locus_tag="CNJ00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_567291.2"
                     /db_xref="GeneID:3254043"
     CDS             complement(join(91373..91887,91940..92010,92079..92326))
                     /locus_tag="CNJ00340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567291.1"
                     /db_xref="GeneID:3254043"
                     /translation="MASQPSADIRLYKNRASYSLRAALDIFREGMVAHVAFVHPGDEE
                     GESKQRRKETIMNIPLITVMVCEGEDEDDQDSYVVYLHSHKYSGLVEACTRGSGNFTA
                     TTTRIDGLVLSPTAHDHSLNYRSATLHLHEPVVLSDETDHEEKRAALAAVTNTILGYD
                     RIASVGQPMDANVKGTTVIRCKISAVSCKQRYGAFNGGKEPVTEVIPGEEANAFKGVI
                     PCWTQWGNLIGFGNDREELELLFESRNVEGKVFAQKSAWAHEDGAIEGLGKKRKPVTR
                     L"
     gene            92629..95898
                     /locus_tag="CNJ00350"
                     /db_xref="GeneID:3254256"
     mRNA            join(92629..93027,93093..93415,93465..93573,93623..93992,
                     94043..94802,94856..95129,95183..95381,95448..95475,
                     95533..95567,95643..95898)
                     /locus_tag="CNJ00350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567292.2"
                     /db_xref="GeneID:3254256"
     CDS             join(92773..93027,93093..93415,93465..93573,93623..93992,
                     94043..94802,94856..95129,95183..95381,95448..95475,
                     95533..95567,95643..95725)
                     /locus_tag="CNJ00350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567292.1"
                     /db_xref="GeneID:3254256"
                     /translation="MAIETSAAHDVDSAPHGLLKNAPTDDLTLEDESWQHSVCVHSYP
                     SPPLNGGVTEIIFDIEVKDPWRALEDQGSEVTKKFIEEQNHLSVPRLSNHPLRTELEI
                     AVEQCYNHERMTCPELQASGYYYWKYNQGTSPRDVILRSKNLESDFGKFASEDGKGPE
                     LFFDLNTEENISLYAHSFSPSGKLWCAILQQSGGDWLRLRVYDTQTKKAIERSVGGAK
                     FTFGATWVGEKGFIYKRVIDYDTTDGNYQAKEGQFGLFYHQIGTPQSEDVLVWKAPEG
                     VFQYIGKPLIITSDAKEENKKRAWFMLDIYRNTSPETEVLMVELPGGTAGPVGHTLPS
                     LVLHGKKWVSKGFTGMTNYIGSLSDDTHLFTSFTDGISTGRIISVSAADYDACGVNEA
                     IKFNTVVPANSEGHQLRHAYLIGDQVIVLDYLKHGCSFLVFLDARTGKSVGSSDSRGT
                     RGDAAIDPDVEVPVPEEEVAEQSPTEDQVIIPQHASINELQSRPDSNDFYFSVNTFVA
                     PPYVLRGELIKNHKVEKGIKISGISKSHTMPQETLVCSQLFYESHDGVKIPMFICHAH
                     DLDLTKPNPALVHAYGGFCSPSLPRFDPMFVAFMRNLRGIVAVAGIRGGGEYGPEWHE
                     AALGIKRWVGWDDFAWAAKYLQGKGLTTPALTATYGTSNGGLLVSAAMVRNPSLYSVV
                     FPDVAITDLLRYHKFTLGRIWMDEYGSPEKAEDFPILHSTSPLHSVDGDPAVQYPAVL
                     ITTADHDTRVVPSHSLKFLAELQARKSENKGVFLGRIYENAGHELGSKPTKKKVEEAV
                     DRLVFVLYNLKEQ"
     gene            96219..98309
                     /locus_tag="CNJ00360"
                     /db_xref="GeneID:3254201"
     mRNA            join(96219..96666,96724..97029,97082..97434,97484..97916,
                     97974..98062,98117..98309)
                     /locus_tag="CNJ00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_567293.2"
                     /db_xref="GeneID:3254201"
     CDS             join(96282..96666,96724..97029,97082..97434,97484..97916,
                     97974..98062,98117..98197)
                     /locus_tag="CNJ00360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567293.1"
                     /db_xref="GeneID:3254201"
                     /translation="MMSSSRFRSSADPPSYTTFSPPVMSLSLSSKALGSSLPTEAIPL
                     LPSDKPRRSCFPPIPRVFFTSFLLAMTFSFTQTSLIYAFRIMTCDEYYKTHDEWVGTG
                     DRCSIPRIEADSASQIAIMSTVTTSCTIANLFITGWFIKKFGCKAAMFQQTFWAALRN
                     LTQMYALSIGGGTGMQIIQTTQLFNVLGSGGGYQIASNVFISTLVAAEERTSQFGVLT
                     GVIMLGSSSGYTFGGLAYKWFGLLAPFQCAFALLCFCTVFGSLFLPYIPPEGDQCTDD
                     KKKMKKSFFSPLKIFVPTKTAVNDKTKDDYNLLLLACGAFFSVLATGYVSMGLQLVGT
                     DKFGFQPGESGIMQSLNLLVKAFFLSICFPRIIAVGRRYVSHRQDVPSFPATEHPEDP
                     YQAEEPDDIGAPRQEQAQAPTDAKHGSLFDLYFLRWSIFTDGVLTALTALSTKGWHLY
                     AAACVLPFASGTGSACKGVVLDFVDSEERADALSAIALVEKIAQVSTISVFGYVFAWL
                     SEEGKPTLVFLVNGLTAIIAFLFLLFVNIPRHGEGKVAIR"
     gene            complement(98229..100025)
                     /locus_tag="CNJ00370"
                     /db_xref="GeneID:3254356"
     mRNA            complement(join(98229..98633,98732..100025))
                     /locus_tag="CNJ00370"
                     /product="expressed protein"
                     /transcript_id="XM_024657914.1"
                     /db_xref="GeneID:3254356"
     CDS             complement(98745..99965)
                     /locus_tag="CNJ00370"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513596.1"
                     /db_xref="GeneID:3254356"
                     /translation="MKCKSREQHQTIINNRRMPNIVIKQDNVTDPLQSIIPIPKHAVP
                     IIEELLPDILKLCDRSTILSIIQVSKYWNTVGSPLIYETVRVDCEKWWIIPRNETKET
                     KKGTWVFRKVFSRERGSTLNPAEEADGGRLINYNRLHIDHHRPVSSYFVYTHHLTIRC
                     HNEGCGSAIFPSPGEILPKLETLNLEIIPGSEDKCAYSKEMGLITGFTRDLSPRTVIL
                     SNVLSLGRICHELYHSPTSLRESAVNSVAKLVVSLPSCRPPRYTLKITNSLERLRSSF
                     PQVKEMVFLLKPKVLGERLDEYAELEKTKGDSDQFYRAETADTYSAELSRLFGYWGSP
                     ITIVGLENLGDDWYKSLTRNPTAEEVVNASKRRAGAERRMDIKVVTLRDWLKDEWNWK
                     GVFTAQERELWMGE"
     gene            complement(100211..100305)
                     /locus_tag="CNJ00380"
                     /db_xref="GeneID:3254077"
     tRNA            complement(100211..100305)
                     /locus_tag="CNJ00380"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:3254077"
     gene            100421..103881
                     /locus_tag="CNJ00390"
                     /db_xref="GeneID:3254112"
     mRNA            join(100421..100971,101028..101298,101353..101483,
                     101535..102287,102338..103881)
                     /locus_tag="CNJ00390"
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase, putative"
                     /transcript_id="XM_567295.2"
                     /db_xref="GeneID:3254112"
     CDS             join(100467..100971,101028..101298,101353..101483,
                     101535..102287,102338..103770)
                     /locus_tag="CNJ00390"
                     /codon_start=1
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase, putative"
                     /protein_id="XP_567295.1"
                     /db_xref="GeneID:3254112"
                     /translation="MLPRAHRLVNQRPGIALRPHASHVSSAATSAVRRSVASQAQVAQ
                     PPIHPEIDGTFNDLIGEGTMNMGMKPRGSDRTSLPYRNINEIELADHQPVRHSGRKWS
                     SLGLRIEQSDLVIDESPEVYNSASEGEYHDFGREERRSPAAVLGSKRLGMVVLPEEMQ
                     RGIQRQIDLMDNPRDIRKSYLALPNVPTPISATKSERRDKPFRTPEGELAKASAILPG
                     EYGAVKNVLEELERRLGREWLTSAKEGEILEFSSSLGSGLWAIMDVMGGLLSSRRRWQ
                     EGQDKLKYQFVHSSRHGLDLVQRIAEVIPEESADVQFNRRHVHSSTPSLILSTFHLTS
                     FPTLPTRQLYLRQLLELSSPYIVLIERSTPQGWAAISQARSYLLEKSTSENPLHVVAP
                     CPHDGKCPLVGTKDVCGYSQRLQRPSFLRKTKHSSRGEEEKGYCYLVIAKGERPSVGT
                     VAEDMKVAGRMGKVGREAAEKALIKSQGRSIIQEVEGHEAVMEVVRLHEIEPGMENYF
                     EETSPSVNSEELEENLRKEAYSWPRMVAPPMKRKGHVTMDTCCADGNIQRLTYTKSHS
                     KQSYHDARKSSWGDLFPHTSKGKPVIRTRGVRRLAKSENNGDADAVISELLSASLEEE
                     MELEKAMEAVEVDELKELEMLGIKTPRAEVSKERQDDDMLVWKSNKNGPFASGQKRSY
                     RTLTSTRSTSQPKTPPSIQTRSMSARPAPPIRPKATLSSLLSLAKSGTPISVLTAYDY
                     PTALLSESCNLDMTLVGDSLSQVALGHETTTAITLDEMIHHARTVVRGAKTPFVFADM
                     PFGSFETSLEEGVRSVLRMVKEGGVDGVKIEGGREIVPLVRRLSAIGIPVMPHLGLQP
                     QRATSLSGYLVQGRTAQAAYEILQSARELANAGAFAFLLEAMPSKVAKLVTEEVGKKG
                     VFTIGIGAGNGTNGQVLVITDVLGIYAEDPPEDIATPNVTGETELVSTSRDFTKPLDA
                     PRFVRQFGSLGQEMRRAVRAYVQAVKGRSFPDSKESYGMKKEEWETFLEMVKREKDQH
                     "
     gene            complement(103850..108510)
                     /locus_tag="CNJ00400"
                     /db_xref="GeneID:3254253"
     mRNA            complement(join(103850..104065,104121..104226,
                     104285..104441,104504..104634,104706..104818,
                     104879..104977,105034..105179,105247..105604,
                     105669..105794,105856..106034,106105..106517,
                     106583..106719,106771..106852,106907..107162,
                     107256..107425,107494..107672,107735..107818,
                     107930..108052,108138..108510))
                     /locus_tag="CNJ00400"
                     /product="DNA topoisomerase type I, putative"
                     /transcript_id="XM_024657915.1"
                     /db_xref="GeneID:3254253"
     CDS             complement(join(103892..104065,104121..104226,
                     104285..104441,104504..104634,104706..104818,
                     104879..104977,105034..105179,105247..105604,
                     105669..105794,105856..106034,106105..106517,
                     106583..106719,106771..106852,106907..107162,
                     107256..107425,107494..107672,107735..107818,
                     107930..108052,108138..108218))
                     /locus_tag="CNJ00400"
                     /codon_start=1
                     /product="DNA topoisomerase type I, putative"
                     /protein_id="XP_024513597.1"
                     /db_xref="GeneID:3254253"
                     /translation="MRVLCVAEKPSIAKSITEILSGGRWDTRNGRHQYIRNYDFLYNL
                     APPLGNGRGANFTVTAVLGHLTSSDFDDDHRKWGSCDPFALFDAPVITFVDQKLKTVE
                     SNLQIEARNADILMIWTDCDREGEHIGSEVVAACKKVNRNILVKRARFSAIIPAQIHQ
                     ACRQANDLDMRQADAVATRISLDLKVGSAFTRLTTMTLQVRVPDLAEQLISYGPCQFP
                     TLGFVVEQYTRVQAFVPETFWYIFVALEREHEDGEPSTVEFRWKRNHLFDLDLAAVLY
                     EQCTVNPQTRVLKVESKPATKWKPLPLTTVELQQSGSRLLHMTPKRILDLAEKLYQKG
                     IVSYPRTETDQYDPKFDFNSLIQKQTLDNQWGAYAQKLLDGAFQKPRNGRKNDKAHPP
                     IHPTAHAGNLEGDERRVFELITRRFLASCSTNAEGQNTTVEISIADEIFSTTGLVVLR
                     RNYLEVYPYDKWATHALPNFEEGEVFIPDVIDLKEGTTSRPSLLTEADLVGLMDKNGI
                     GTDATIAEHIAKIIERGYVTEKQEARIKYLVPSTLGIGLVEGFNAIGFDRSLSKPHLR
                     RETEHRMQLICDGVRGKREILQTTIEEYKEVFVKARREFQTVIDCVENYLHGAGEAQE
                     ALRAAARGGRGGRGTRGARGARGGRGTGGRGRGGGGVVAPRGGRDDDNDDDDDDDDDQ
                     GPPRGGVRERARGAATTRGRGTSTARGRAGAAGAGTAAGRRAGSPTFGADDGGGDTKM
                     CNCGREAVSRVVAKADSAHKGRSFWTCPQPQGEQCGFFEWGTDGDMARSAGPSKSRTA
                     SAQPPPSKRQKTTNRNDPPPSKDGVPSCKCGLDAAFATVIKEGPNKGRQFWACPNNPK
                     ARCGFFQWEDDPNLGSGGSNGGDTYNGGGGRSGTSGECYKCGEAGHWANACPNDGDGK
                     GGGSSSSRAKSNSKALSKGKSGDSGSDVFGGINVVNKAIGPLIVPIIQAEGEVALVLG
                     PPVMGLVDIVSNATNQAIGPATVRMMKVEDRHIGVRVAVEVGGEGEEEEEVNDSTTLM
                     TVVQHHP"
     gene            109538..111785
                     /locus_tag="CNJ00410"
                     /db_xref="GeneID:3254363"
     mRNA            join(109538..109687,109995..110102,110162..110260,
                     110326..110435,110499..111546,111605..111785)
                     /locus_tag="CNJ00410"
                     /product="glycine hydroxymethyltransferase, putative"
                     /transcript_id="XM_567297.2"
                     /db_xref="GeneID:3254363"
     CDS             join(109589..109687,109995..110102,110162..110260,
                     110326..110435,110499..111546,111605..111640)
                     /locus_tag="CNJ00410"
                     /codon_start=1
                     /product="glycine hydroxymethyltransferase, putative"
                     /protein_id="XP_567297.1"
                     /db_xref="GeneID:3254363"
                     /translation="MPRPILAALRTTIRPAFSKQFRMASSIPVPTDFNACLYKPLAEA
                     DPEINSLIEKETWRQFSGLELIASENLTSLAVMEANGSMLTNKYSEGLPGARYYGGNE
                     FIDVVENLTRERALKAFNLDPKIWGVNVQPYSGSTANFAAFTALINPQDRVMGLGLPD
                     GGHLTHGYYTAKKKITASSIYFQSFPYRVDPKTGIIDYPQLETNANLYKPRLVVCGGS
                     AYPRDWDYGRLRKIADSQGAYLLSDMAHISGLVAAAEQNSPFEYCDVVTTTTHKTLRG
                     PRAGLIFFRKDKESDLEARVNAAVFPACQGGPHNNTIAGVAVALKQAADPAFKEYAKQ
                     VRANAAAMAAVLFKHGYRLQTDGTENHLILWDLRPIGLTGSKVEKICDAAHITLNKNA
                     VAGDTSALVPGGVRIGTSALTSRSMKEQDVEKVAEFLHRVVQIALKTQEEAGSKLLKD
                     FVKTYESGNGEAPKLIAELKEDVMKFATSFPLPGVPDTSKIVRPEGVNL"
     gene            111993..114496
                     /locus_tag="CNJ00413"
                     /db_xref="GeneID:36393047"
     mRNA            join(111993..112090,112210..112337,112451..113890,
                     113954..114496)
                     /locus_tag="CNJ00413"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658747.1"
                     /db_xref="GeneID:36393047"
     CDS             112543..113883
                     /locus_tag="CNJ00413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514429.1"
                     /db_xref="GeneID:36393047"
                     /translation="MLPTDSPTSSPTPTHASTPISPPTPLALPPLLNSFTVKRWSVPR
                     KPKRGRSQDDAASSLALPTTTSGTEWGRFSSTDDLIDDPMDDTRPVREKEIEKDAPLM
                     LGVGGKVPTVIPAPRPMVRARSSKAKFGRRVDYSSMSGSNGHVNPSSLSSPELSLART
                     ISPAISHSHPHSYSPSASASAYVPGSSSGSSMSPSIPAAVSTSIPPSTTVSVSPDTYM
                     AEPAPKRARQRSCSTSSQSSLTGLLVDQDVVIGNGNISENGTEGWGAGGGVGGLGTPR
                     STARSGQVYNYIPSPLATTPITSTSTSPPSPLPLPTPSLSHPHPYSHQLAFPPDQIEI
                     DLIPTAAQLQATKSRAARARAHAFWRDVEDLGTELGNVLRLGLGRGLNRGVGGVGFGG
                     VGVGGAGGLGVGGQRKPSRLRSSLNARLEEDSDHEKENENAEGQEEETMHMDED"
     gene            complement(114588..116138)
                     /locus_tag="CNJ00415"
                     /db_xref="GeneID:36393048"
     mRNA            complement(join(114588..115065,115177..115375,
                     115523..116138))
                     /locus_tag="CNJ00415"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658748.1"
                     /db_xref="GeneID:36393048"
     CDS             complement(join(114649..115065,115177..115375,
                     115523..116067))
                     /locus_tag="CNJ00415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514430.1"
                     /db_xref="GeneID:36393048"
                     /translation="MADLQDLFNSPPRPPPPRSVHSLSPSTPARATRPNQTPLFFSPG
                     LSPGYEPGGRETSGIGAGARDISIFGRSPSPAAGPQVIRVEEQREQDATNGIVRIRQA
                     VNVLPADGSAFGEGGAGTFPVGTAGATGGGRGGEWNNGVFVNNSVIHDPLAGLGGDDD
                     EDNEEGDGIGRKRVIAKVDADRLLGENGIPALCRAAKKFKPRGKGREADDLRRVLNMY
                     QMWAHGMFPKGDFAHTMHRTETVCRSRRMESALSGFKDAFNPRPPTLPREFSNSPQAS
                     PSRSGSPSRARSTSPDSNPNPFRVPTYATTAHPNMREPLFNPADPEDEPNDGPDMEDL
                     LAMEAEMAMEAEAAAEAERAEAEAGARTEAGGHGAEIGATEGEEDEFGGLYD"
     gene            116270..116359
                     /locus_tag="CNJ00420"
                     /db_xref="GeneID:3254158"
     tRNA            116270..116359
                     /locus_tag="CNJ00420"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:3254158"
     gene            116648..119143
                     /locus_tag="CNJ00430"
                     /db_xref="GeneID:3254069"
     mRNA            join(116648..117273,117328..117462,117513..117641,
                     117696..117815,117864..118100,118149..118365,
                     118422..118814,118889..119143)
                     /locus_tag="CNJ00430"
                     /product="tryptophan-tRNA ligase, putative"
                     /transcript_id="XM_567298.1"
                     /db_xref="GeneID:3254069"
     CDS             join(116717..117273,117328..117462,117513..117641,
                     117696..117815,117864..118100,118149..118365,
                     118422..118814,118889..119026)
                     /locus_tag="CNJ00430"
                     /codon_start=1
                     /product="tryptophan-tRNA ligase, putative"
                     /protein_id="XP_567298.1"
                     /db_xref="GeneID:3254069"
                     /translation="MPPRHRLLKALSFSFSLTRRAYTTKKPKPTMQTPDQPSKSGAMT
                     PGAIAKQLSMLDLPAPTGLKLSTSNLQSSANPDSALSPFSDATTDTGDISGPEPEAIV
                     QARHKARSESMSEQLSERLAKMKLPQPERIFGPEEGGSSASREDNGGKQGVSADDWEK
                     IKLADEVPEAVKEPKRMTHSRHTSRAEPALPRTPTIPEAEEISAPATVKEQKITPFDV
                     EGGVDASGRELAIDYEKVTKRFGATLISQELLERFERLTGQKPHPLLRRGTFYSHRDF
                     NLILDRYEKGQPFYLYTGRGPSSDSMHMGHLVPFMFTAYLQRVFNVPLVIQITDDEKY
                     LLERDAKKQQELMKKIKAKKPLDLLRYYKKMGQDNIKDIIACGVIPEKTFIFSDLNTV
                     SGVFYENVNLISKTITLSQSRNIFGFSDSDNVGMFHFAAVQATPSFCNSFPQIFGTRD
                     DIPALIPCAIDQDPYFLLTRDSADRLGYKKPALLHAKFLPALQGAGTKMSASKENTAI
                     FMTDDAKKIAKKIKSHAFSGGGATKEDHEKYGGNPDVDIAYQYLSFFEEDDAKMEKLA
                     TEYRKGTLSTREMKEACIEKLQEVVAEFQKNRAAVTDEVLQYFQDPTRKIDPRPKAKE
                     TSESAPAATSVPGVGAV"
     gene            119342..119438
                     /locus_tag="CNJ00440"
                     /db_xref="GeneID:3254030"
     tRNA            119342..119438
                     /locus_tag="CNJ00440"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:3254030"
     gene            complement(120021..120117)
                     /locus_tag="CNJ00450"
                     /db_xref="GeneID:3254274"
     tRNA            complement(120021..120117)
                     /locus_tag="CNJ00450"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:3254274"
     gene            120446..122049
                     /locus_tag="CNJ00460"
                     /db_xref="GeneID:3254034"
     mRNA            join(120446..120613,120674..120737,120826..122049)
                     /locus_tag="CNJ00460"
                     /product="C-3 sterol dehydrogenase (C-4 sterol
                     decarboxylase), putative"
                     /transcript_id="XM_567299.2"
                     /db_xref="GeneID:3254034"
     CDS             join(120471..120613,120674..120737,120826..121965)
                     /locus_tag="CNJ00460"
                     /codon_start=1
                     /product="C-3 sterol dehydrogenase (C-4 sterol
                     decarboxylase), putative"
                     /protein_id="XP_567299.1"
                     /db_xref="GeneID:3254034"
                     /translation="MSNSPPTFESYLVVGGCGFLGRHIVEQLLGRGETQVSVFDIVQR
                     HFDSNVNFYIGDLSNPQDVENALAKSQATVVIHTASPTHGMGRALYEKVNVTGTRTLL
                     DAILSPSSTVSKLVYTSSGGVIYSGKEDICNADERLDYPAVPLDAYNETKVAAEKMVL
                     EANGQEKGGEGGAKLLTCAIRPAGIFGPGDRQMISGFYSVVKNGQTKWQIGDNTNLGD
                     FTYVGNIAHAHLLAADKLGSAYPYHALREPLPAINITLGDYRIPTSAARPLGPNEHPT
                     QADLLAAQRFEGGWVDETDLRPVLRTKMDQFSADAQRDEDEKGDEEDEGIPIAGQAYF
                     ITNGEPIYFWDFARTIWRQLGHVPPYTIVLSTMIGLILASIAEFFSKLSGKEPGFTRF
                     RVSQATQQRFYDIEKARRLLGYSPVVGMEEGMKTWTTWYKGELERQNEMQESEKTK"
     gene            complement(121997..123937)
                     /locus_tag="CNJ00470"
                     /db_xref="GeneID:3254343"
     mRNA            complement(join(121997..123524,123576..123681,
                     123852..123937))
                     /locus_tag="CNJ00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657916.1"
                     /db_xref="GeneID:3254343"
     CDS             complement(join(122113..123524,123576..123681,
                     123852..123887))
                     /locus_tag="CNJ00470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513598.1"
                     /db_xref="GeneID:3254343"
                     /translation="MAPSVGSFVNLADALRFKRNKSSTNLAAPREVSLPRRPQSSLNL
                     HHTANTRRKDIDEHLPTQVLVRILTFCSPSTLAHCLTVSRLFFHLAGDLLYNDISLTS
                     KDFFLVFRGSAVVHEAATGKVAVGRKKFKDRLLKHTRQVTLYSHGDDEDEDQVLNDTA
                     CPPTPLNTVMPKLDTLRIVLADAFDYHMTFCPRYPHHCPLLKELSIEKLVILGARTPL
                     VVLPLAFPNKTSQPTTPVGMETVSSYLSVPALEVAPSIASSTTTTTPPSHGNHSTFSL
                     IPHRNHSRNPSVTLTFTPPSNQTSQSGKTPSRAPSPSNTHHSPRLPPLSELTIVMPTG
                     LSYDAKDYQPHSHCFRHKRTLATIEKVSIVFYTPPPASGKKTWGKEQEQTQTQAQRPW
                     QTAFYLGGNSNSMTSYISLAEDIAETVLSLPSATEIFVVGCETLDGELFNMGMNTMQE
                     GKKKVGRVMRETICGRLEAKWWASREKGDVKKVVGKVRFFELEEWLERGGREDVDGWD
                     LDKWAEDDE"
     gene            complement(124029..125097)
                     /locus_tag="CNJ00475"
                     /db_xref="GeneID:36393049"
     mRNA            complement(join(124029..124376,124467..124478,
                     124537..124581,124662..124740,124838..125097))
                     /locus_tag="CNJ00475"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658749.1"
                     /db_xref="GeneID:36393049"
     CDS             complement(join(124167..124376,124467..124478,
                     124537..124581,124662..124740,124838..124845))
                     /locus_tag="CNJ00475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514431.1"
                     /db_xref="GeneID:36393049"
                     /translation="MPSATDQTLENQNEEELNSLHSKIRSLRSVTIDILDDANRQNDQ
                     LDRTTNTFSSFASSLFSTSRHHSRSVAASSALRQYRVIAYIVMGVVVLWLVMKVWRNG
                     PGPTAPAATPLEGEY"
     gene            complement(125263..126628)
                     /locus_tag="CNJ00480"
                     /db_xref="GeneID:3254348"
     mRNA            complement(join(125263..125414,125527..125563,
                     125750..125863,125940..125990,126066..126164,
                     126252..126361,126531..126628))
                     /locus_tag="CNJ00480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657917.1"
                     /db_xref="GeneID:3254348"
     CDS             complement(join(125340..125414,125527..125563,
                     125750..125863,125940..125990,126066..126164,
                     126252..126361,126531..126578))
                     /locus_tag="CNJ00480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513599.1"
                     /db_xref="GeneID:3254348"
                     /translation="MFSSEIARMRKLGVQGMLFQALNLLTVVASGLMMWKGLCLFTNS
                     ESPIVVVLSGSMEPAFYRGDILFLINPTDVPYEVGDITVYKVPGSEIPIVHRVIESHT
                     TNTTQLLLTKGDNNPGDDVVLYNGLQWIERRHIIGKVRGFLPYVGYVTIAMNDYPQLK
                     YALLGTIGLVMLVQQEQ"
     gene            complement(127492..131622)
                     /locus_tag="CNJ00490"
                     /db_xref="GeneID:3254355"
     mRNA            complement(join(127492..127596,127650..127838,
                     127900..129019,129071..129227,129278..129791,
                     129844..129888,129938..130029,130079..130340,
                     130393..130537,130587..130634,130687..130768,
                     130875..130892,130985..131063,131174..131212,
                     131520..131622))
                     /locus_tag="CNJ00490"
                     /product="Eukaryotic translation initiation factor 2C 2,
                     putative"
                     /transcript_id="XM_567302.1"
                     /db_xref="GeneID:3254355"
     CDS             complement(join(127588..127596,127650..127838,
                     127900..129019,129071..129227,129278..129791,
                     129844..129888,129938..130029,130079..130340,
                     130393..130537,130587..130634,130687..130768,
                     130875..130892,130985..131063,131174..131191))
                     /locus_tag="CNJ00490"
                     /codon_start=1
                     /product="Eukaryotic translation initiation factor 2C 2,
                     putative"
                     /protein_id="XP_567302.1"
                     /db_xref="GeneID:3254355"
                     /translation="MAPKLAPQGDVTSAFSNLSFGDLPRGMQETLDGCPPRPGYGSSG
                     KGITVNANMFMARFRKQGLTVNHYDIEINPVIKTKEAKKPRPLLQKIWNQMVADATGP
                     VKEALEAAAYDQQKSFYTPHTLPMEGGKLEIIVGLVEDGIVPTDDRRRFRAVIQPAEN
                     MKIDLDTIMDYCKGDTQTEQARDTMLRAVMAVNVLFRQDPAQRFTMSGAAGRKFFTDE
                     DGTPLSNGAVLYKGFQQSFRWTSAGFPAVQIDTAYSAFVEPGMLVDVAPKVLGLAPSG
                     GFGGRGGRGGRGGPPRGGFMGAAPGPARPIQELNPAQTKRLNDILRGAKFTVTHRKTE
                     RVFSIIKLTSQPADNIKFTLNGKDGQPDRTVSVAQYFQEQYNVRVTRPRLPCVQYGKN
                     FIPMEFVKLEPFNSIPMMRITPDQTAEIIKDAAKPPPMRQSAIAAWRQKLNYSNLPKL
                     KAWQVEVNTNMMAVPARVLPAPSVIYEGNKTIRANFGGWNMKGVRFTKAGKPLVSWAV
                     ISFDERCTVPDLQKFVTYFVNVLGQYNCPVQNKRPVCFQYNPNAGGPNMGIKPALQQA
                     AKNSYMETKANPQIIFCILPKKDPSIYQAIKACAAEQLFKPVVTQCLQSLKIKSDRGI
                     EQYCGNVAMKVHAKLGGLTHQVSHQLERTTMMVGADTGHPPAKGGALPPSIAVTVAAV
                     NGENNRFVSGVRLQEGRVEIIQDLENMMATHIQTFEKNTGAKPLSILFFRDGVSEGQY
                     AHCVNQELKSIKKAAAKFGNYNPKVTFVICAKRHSMRFFASSDADKDRTGNLPPGTVV
                     DSLVTSPIIHDFYLQAHAGLQGTARPTHYVVVADENKYSADKLQGLVNVLCYSYARAT
                     RSVSLVPVAYYADIVAEKAREWIYNDDSETATVPSTASGSRVEQMSFDALRISKRFES
                     NPEFNSVAWFM"
     gene            complement(132177..135597)
                     /locus_tag="CNJ00493"
                     /db_xref="GeneID:36393050"
     mRNA            complement(join(132177..133881,133953..134095,
                     134185..134494,134594..134894,135003..135597))
                     /locus_tag="CNJ00493"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658750.1"
                     /db_xref="GeneID:36393050"
     CDS             complement(join(132213..133881,133953..134095,
                     134185..134494,134594..134894,135003..135255))
                     /locus_tag="CNJ00493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514432.1"
                     /db_xref="GeneID:36393050"
                     /translation="MPAIIPFFIPDTSPIFTYTSTSSSLSNTFNATSTSTSSKGTDIT
                     DSAVAEVKGEGGWIAAYSPIGNGYDQTFHYGQGVISGNFSASALKFYTSSKSSNSSAA
                     SLSCPAEYRLNASSTWSSACASSSSSASADEKENGKGDGEGDGDEYVIDNLPAGTHQV
                     ELRSVGGNVEFLGIGGLLDVGSSGKMSNLTVDNTSPSFIYSSSSSWSQLSSPISSASS
                     SSGNSSFTSLFNTTIDNFYNETMSITTEEGAKVELNFEGEAIYVYGFSSVNGGKGEVW
                     LDGVLQGSLNMIMPWDSYSSLLYVGSGFSASNHTLTITNTFPGGQLVIDYVLLTVKTS
                     SSTSHLVLIVGIIGGTSAFFLILGAIAYILYVRRRLPVSQRNGQPRYAFSKGYGNRDY
                     MSQDAGSKVDLWRKMMGGTSTPGDSLTASSAAPTPISFAKDGGVNLTPGSGSGMGTDR
                     SPTPEYPDYVPYRGPIEPHPPHTASFSIPGSGQEKVLAYTGMTASPLSSAGGRMGSTR
                     SSSSRSSTPRLPLVAGANPSATGWLLARGGQQAWNISPISSREGGEGLSRDGSQSTNR
                     SGGSRAASLESWSAGESRRDRDREREDGFDEIVLVDHQAPVSPPPFSGVTCPSSRSGR
                     STGTGTKIVPQSPTSSISTPSSLGLSGIQARAVPASRSVARLWPARDAVPSSYRVDSS
                     FRRGMSALSSASLALNPSTSVDALPHAPPNSTSSPTLRRGVSIKSIKTMRSFFSGLIF
                     LPPSSNAGAVGLGGNGASPIPSSPALPMTAARPDSGIFPVFGGLSRGPSKVDRGRVPK
                     GYSNTSSTVPPAPRSGSTSKQHHTPALPIIRSGNGSSLQRHGAEEEEEERGDGSPHFF
                     IELNPNSPIMASRPASLWTRYTRASGPGFHGTWEP"
     gene            complement(135625..136213)
                     /locus_tag="CNJ00495"
                     /db_xref="GeneID:36393051"
     mRNA            complement(join(135625..136015,136084..136213))
                     /locus_tag="CNJ00495"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658751.1"
                     /db_xref="GeneID:36393051"
     CDS             complement(join(135718..136015,136084..136196))
                     /locus_tag="CNJ00495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514433.1"
                     /db_xref="GeneID:36393051"
                     /translation="MAKVRKEVNDILLIINYGLLSLISIPHLSPLPTSSNARSARDTF
                     PPTTQTTNHKYFFHCPPSALLFRHDRYPFQGGLSALRLALARFNLMSPFGPRFRSSVG
                     MEISYIKSQRIVFPLPSFFILKYVVSLVLTDWPD"
     gene            complement(136273..137783)
                     /locus_tag="CNJ00500"
                     /db_xref="GeneID:3254124"
     mRNA            complement(join(136273..136948,137018..137070,
                     137126..137240,137383..137462,137569..137609,
                     137662..137783))
                     /locus_tag="CNJ00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657918.1"
                     /db_xref="GeneID:3254124"
     CDS             complement(join(136500..136948,137018..137070,
                     137126..137240,137383..137462,137569..137609,
                     137662..137664))
                     /locus_tag="CNJ00500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513600.1"
                     /db_xref="GeneID:3254124"
                     /translation="MSSPKRRVDTDVMKLLMSDYDVTLVNNKMSEFFVKFKGPTETPF
                     ANGVWKIHVELPEQFPYKSPSIGFMNKIFHPNIDETSGSVCLDVINQTWSPMFELINI
                     FEIFLPQLLRYPNPADPLNGEAASLLMRDPKAYAKKVESYVERFASAEDADQAGGDDE
                     SDEEYEPVPPKVKAKTNGVNGNVNGNGNGQPNGHANGNGNDNASGVNGVNGHGEEHEE
                     DDEEDEDEKMSDMGEFSEDEEDIMGTMD"
     gene            138009..139030
                     /locus_tag="CNJ00510"
                     /db_xref="GeneID:3254367"
     mRNA            join(138009..138228,138288..138346,138395..138450,
                     138570..138710,138807..139030)
                     /locus_tag="CNJ00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_567304.2"
                     /db_xref="GeneID:3254367"
     CDS             join(138038..138228,138288..138346,138395..138450,
                     138570..138710,138807..138905)
                     /locus_tag="CNJ00510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567304.2"
                     /db_xref="GeneID:3254367"
                     /translation="MSSSAHPLLPPLPASAATRYPIPAVHEAEHTFHPHSSLSLATNI
                     AVRSAGVGLLVSATQNALDKHNHGAMGIFTRTGSTITLFAAMGFSYSFITSLTANIRK
                     TDGPLNSAAGGCAAGFVAGVQRKSIPVAVGACAGMAALLGTFNAAGNNFTGVRRNDIP
                     RPEREEIRQQFFKQQKATQEE"
     gene            complement(139182..141870)
                     /locus_tag="CNJ00520"
                     /db_xref="GeneID:3254308"
     mRNA            complement(join(139182..139344,139440..139559,
                     139632..140495,140549..141065,141130..141543,
                     141600..141757,141812..141870))
                     /locus_tag="CNJ00520"
                     /product="regulation of translational elongation-related
                     protein, putative"
                     /transcript_id="XM_567305.1"
                     /db_xref="GeneID:3254308"
     CDS             complement(join(139243..139344,139440..139559,
                     139632..140495,140549..141065,141130..141543,
                     141600..141757,141812..141835))
                     /locus_tag="CNJ00520"
                     /codon_start=1
                     /product="regulation of translational elongation-related
                     protein, putative"
                     /protein_id="XP_567305.1"
                     /db_xref="GeneID:3254308"
                     /translation="MARIASDIRRTFPRTDEVVVSYITGLIDDEDEEVEDIVDMIKGM
                     LGGGPSSEDNGKVLDEFMNRLLEYLESQSTKRVRKSTTATKLDKTIHMRSQAMSATIA
                     MSGKVDLESNTKGQASRVDLNKLAKAEAKLKAKIEKRAKKDNLYQGSKLIDMQRQQQS
                     YEEMFMQVNPLDLSGAAKGKSKDIHLLNIDVSFGSNRILSGATLSMAHGRRYGLIGRN
                     GIGKSTLLRHLALREVPIPTHISVLYVEQEIAGDATTALDSVLQADVWRHKYVTEERE
                     LNLKLEELEKASAKEGLLGDEKAQIDQDREDVSSRLGEVQKTLIDIEAETGPARAGSL
                     LAGLGFSEEDQKRVTSSFSGGWRMRLALARALFVKPDLLMLDEPSNMLDLNAIAWLEE
                     YLQTWPSTLLVVSHDRAFLDAVATDIIHQHNQRLDYYKGNFSQFYATKTERAKNQRKE
                     YETQLQYRQHLQAYIDRWRYNAARAAQAQSKIKILEKLPELEPPEDDDSENFKFPDPE
                     KISPPLLQLDEATFGYTSDKIILRNVNIDVQLDSRIAVIGPNGAGKSTMIKLLTGAIQ
                     PITGRATHNSRCRIAYFTQHFVNQLDMTVSPVAFLQAKFPGKTEQEYRSHLGSFGITG
                     LTGMQKIDTLSGGQKARVAFAVLSMQKPHILLLDEPSNHLDIEGIDALIEAIKNFKGG
                     VISISHDERFITNTSNQLWVCADGKVTKFMGDVEEYKKIVTQELQAKLRP"
     gene            142349..143971
                     /locus_tag="CNJ00530"
                     /db_xref="GeneID:3254175"
     mRNA            join(142349..142655,142705..142731,142781..142937,
                     142999..143077,143135..143314,143367..143971)
                     /locus_tag="CNJ00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657919.1"
                     /db_xref="GeneID:3254175"
     CDS             join(142433..142655,142705..142731,142781..142937,
                     142999..143077,143135..143314,143367..143807)
                     /locus_tag="CNJ00530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513601.1"
                     /db_xref="GeneID:3254175"
                     /translation="MALKIPNKPAEILTPFPRPDPSPEGLKILRQICRKAVESDEVYS
                     VTFSDLLCPEGKNHLFTLKPYFWEVEPGKWEKRDGKRNPYCDKPGGQKQLETAAVTIH
                     NLALGAAYLPEFRDGCAKRLERVLSVFFIDPETRMVPEVWYAQCNPGNKPLKGDYAFE
                     IALRNIILVDQGMRLAASFLNKRTVDTLTNWIATQAKWIRDSDQGAAARKYEDNKRIW
                     LEAITASHLSFISPPEGNSYAISFFQTYAPSHPPKKFFEHELQRTRPRHYTLFALEPL
                     FILAELTLPSSRRLDRYIAQYLRSLLEFAKQVAPGEIERPLEEQGRYEGRWQWYERML
                     ADWTGQGQRGGEEPDGRAWEGGFTQRMRMIWGFI"
     gene            complement(143909..147667)
                     /locus_tag="CNJ00540"
                     /db_xref="GeneID:3254373"
     mRNA            complement(join(143909..144423,144474..144555,
                     144605..145707,145760..145990,146047..146360,
                     146414..146694,146747..147003,147052..147376,
                     147424..147493,147541..147667))
                     /locus_tag="CNJ00540"
                     /product="L-aminoadipate-semialdehyde dehydrogenase,
                     putative"
                     /transcript_id="XM_567307.2"
                     /db_xref="GeneID:3254373"
     CDS             complement(join(143998..144423,144474..144555,
                     144605..145707,145760..145990,146047..146360,
                     146414..146694,146747..147003,147052..147376,
                     147424..147493,147541..147598))
                     /locus_tag="CNJ00540"
                     /codon_start=1
                     /product="L-aminoadipate-semialdehyde dehydrogenase,
                     putative"
                     /protein_id="XP_567307.1"
                     /db_xref="GeneID:3254373"
                     /translation="MPVPTFVAQSVTELISIRAETQANDAAIHTGASEYGEKLMTLTY
                     SDFSKAVDRLAAHYAALNIQPQCGPSEVPPERIVAVLTSTAIDETLLEIALAKLGLAS
                     LLLSVNNSTAAVAHLCKVTKSASLIYGPKFEETAKDAQKLLAQEGIEIRTIPETRYPL
                     WGPEGARESKIAPYPPRLTPQQESKRTCVVLHSSGSTGFPKPVFITHYGLIANAAQSL
                     PKTGFSALPLFHGFGHYSVFRCMYHGKTFTLMPPNLPLTSANICRIIRSSPTPPVQHF
                     AVPYVLKLLGETDEGVQTLANFEAVSFAGAAVPDDLGDRLVKAGVNLISFYGTTETGA
                     LMTSRREFDSDKGWNWLRAEGPIADYLELIPQGSDTFEAVVKDGWPAKIMSNREDGAY
                     CTKDLVLRHPQNKTWFKYIGRLDDTLTQTLGEKTNPVPIELAIRGNSPLVQECIVFGD
                     GRPQTGALILPSEQGAELSKDKKKYIEAVWPVIADANSNAPSHSRILPEMVDILPYGT
                     EIPVATKMSILRPACYKKFSSIIDAIYERFERGTGEPKRDISSKPEMESFLTGTILKA
                     LGDKAGPDLSPSTDLFSYGVDSLQATRVRNVISKSLELGDAKIGQNIVYEYPSISQLA
                     DYLLEIKTGKAGQNGPEKDYKTMWEMVERYTSQLIKEDSSAVAADVTSNGHSSHVIVL
                     TGATGSLGAHILDQLVRRPDVSRVICLSRAKSHQDSLLRVQESLSQRLRMLTPEGESK
                     IVSYAADVNRPDLGLSAEEYEGLRQESTAVIHNAWPVNFVLSIDSYNEHIGGATNLLN
                     LTLKSPKAVKPGFFFSSSVGTRQGLTEPVVEEDFPESPETANALGYGRSKWVVEKIME
                     KAGKETKARCGVLRIGQLVGDTENGVWNETEAWPLMFKSIDVIQSLPMLDEKPSWLPV
                     NHAAATISEIVTSTSTSFTPSSAAVYHVLNPYFASWSDILSGLSAGGLKFDTVSRAEW
                     LDRLAKSNPDVAVNPTYKLLGFYQNRIGKKDEKPTVEFKVDRTEKESETMRDEVKKVG
                     PELVALWAKRWRQSGFLH"
     gene            147863..151291
                     /locus_tag="CNJ00550"
                     /db_xref="GeneID:3254126"
     mRNA            join(147863..147934,147989..149029,149079..149156,
                     149206..149220,149276..149422,149483..149597,
                     149649..149814,149877..150109,150164..150209,
                     150394..150729,150799..151025,151093..151291)
                     /locus_tag="CNJ00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657920.1"
                     /db_xref="GeneID:3254126"
     CDS             join(148736..149029,149079..149156,149206..149220,
                     149276..149422,149483..149597,149649..149814,
                     149877..150109,150164..150209,150394..150729,
                     150799..151025,151093..151097)
                     /locus_tag="CNJ00550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513602.1"
                     /db_xref="GeneID:3254126"
                     /translation="MPTKQIIMPSGNATDFVPAHLDPAADLKDLEANKGETEHVEHAS
                     VKNEEGDLGFAISEDNSKPRKGLRRLLRRNPSAEFLREVAEANEHELDPVEVKKVERK
                     LFWLFVPALAVDYAFYYIDKTTLSYAALFGLKEDLKLHGTDYSNLSSIFYVGWIIWAI
                     PGNLLMGKFPLAKYLAINIFLWGIFLMAQGASQNYGDMVGLRFVSGMFEAVADPCFVA
                     LTGMWFTRKQQPTIIGYWYSFNGVGIAFGGLIGYGIGHIKSSLASWRYEFIIIGAACS
                     LWAIFMGIVLPDAPHTAKWLTRREQIIVVSRKRHDYHNVDRRQFKLDQVLETFKDPKT
                     YLYFLLGTFANIPNGATSNFGTLVIKGLNFTTMQTTLLQIPYGAFIAFMIYMAIYVNH
                     KTHRFNVRTLLMACVTVLTVVGFAMMAFTKPTASRLIGYYFTGSSNAVFVLALSLVSG
                     NVGGVTKRVLASASIFLGVALGNIVGPYSFLDSEAPTYHTGIIVCMCSRAAEIVVILA
                     LRLCFVIPNNRRDKKFAEGDERYDPNVQVFEDMTDKQNLHFRYVA"
     gene            153883..157262
                     /locus_tag="CNJ00560"
                     /db_xref="GeneID:3254198"
     mRNA            join(153883..154411,154465..155153,155202..155234,
                     155283..155346,155396..155679,155728..156021,
                     156071..156367,156417..156582,156636..156961,
                     157016..157262)
                     /locus_tag="CNJ00560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567309.2"
                     /db_xref="GeneID:3254198"
     CDS             join(154144..154411,154465..155153,155202..155234,
                     155283..155346,155396..155679,155728..156021,
                     156071..156367,156417..156582,156636..156961,
                     157016..157033)
                     /locus_tag="CNJ00560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567309.1"
                     /db_xref="GeneID:3254198"
                     /translation="MSTNLGINHNSNQYLDDEKDLVLEKKESDLHGTHIAEVHYYTTK
                     NGVRITVGDTPKEVKAVAVEVDDVNEPCETFRAYVIGTILAAVGTGLNVWFGARQPGI
                     YISPFIIQLISHPLGLILSKILPTRRFTLFGQEWSLNPGPWTIKEHAIITMMSTVSLP
                     TATALDVVVAVRQPTFFNDSEMGNSQGFRWLVVLSTQFLGLSLAGLAREYLVYPSDMT
                     FPLNLAKLSLFNALHRRKVDENGMVQVAEHHLHEDENEKDPPVHGWKISMFKFCLIAT
                     AGSFIWFFFTAFIFPALTYFNWPTWIAPDNKKLAIVMGSITGLGLNPIPTFDWTYISG
                     AGLTPLITPWWATLQTFIGCTIGFFAILGIYWSNVWYSAYLVPNSNQAFDRFGAIYNI
                     TGVLSADKTLDVEAYRQYSPMYFGAGYNIVIAGFFASYSAILVYAALEHGSQIKNGLA
                     TAYGKTVSFVRRSSAPEESHNRPEYDIHYAIMHKYKEVPQWAFILVLVFSLVTGIIMV
                     EVYKTTMPVWGIFVCLALAFIFLIPAGIIQALSNMQITLVILAEIIPGVAIPGRPYAN
                     MIFKLYGWVALVMALLYVQDQKLAHYLHIAPRATFRVQMWGVLVSSIVSVGVLTWQFN
                     AIPDMCEIGQKDLMTCPYYTTFYSSALMFGVVGPERMYGANGLYKWTMFAFLAGAIAT
                     FAAWLVKRKWPNKYTKSVNIPVVITGLLYYAPYNWSFVWSGVPLAWFFMSYVYNRYSS
                     WWSKYCYVLSIGLTVGAALSGVVQFFCITYPGGAMPSWWGNTAYASGCDGLGCPLLEM
                     PEQGYFGPGPGEFS"
     gene            157752..160724
                     /locus_tag="CNJ00570"
                     /db_xref="GeneID:3254140"
     mRNA            join(157752..157978,158064..158165,158227..158354,
                     158431..159606,159661..159877,159933..160209,
                     160261..160724)
                     /locus_tag="CNJ00570"
                     /product="expressed protein"
                     /transcript_id="XM_024657921.1"
                     /db_xref="GeneID:3254140"
     CDS             join(157970..157978,158064..158165,158227..158354,
                     158431..159606,159661..159877,159933..160209,
                     160261..160589)
                     /locus_tag="CNJ00570"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513603.1"
                     /db_xref="GeneID:3254140"
                     /translation="MMSQIEMSPPADEQQLLGHTSSKRGKTGCITCRLRKKRCDETKP
                     LCATCNRLGIECMGYGIKRPDWLRQKENARKAKQEIKATVMSKRFKRAKTAESTVVDD
                     KNSSYDQRVGSHDSERSGSLSTKETVLEDVPLPFEMGRKDRRKQPVNPRKGPEAPEDS
                     DGREGQVHSMGEDNFSQWAAANQELSEYYTGESHTFQSSASVLDTLDPAVLMTNDSNE
                     NILQPFSDPSGPSLPLVFTSTAIPANEGMDELWSTIFGSVDPAFWGTNSPQTTAVPKS
                     PESLSSYLMIPTPTAGLSPGNSDRMRYLHHYLNVVLPLQYRMLNISISMSDFVAPLAL
                     SFSEVFDSVSSLAALHMVSQRTKKRVDITTADYTARLSVIHDALERDPSGSATIEEFS
                     DDDAKIAVSAHQKAVERLRFLSPQDLTAEDVIVSALFAISYHLFSGGTSKQLKEMILI
                     NQRCLSAALSSSPEFSEGHQSRVPFPADSPWSRYRPLIEHMIWIDVIASVSNGKGSRL
                     LPTYRRILKHLPTDSNMGMNRPFLQMDKIMGCDSTTLLAIAEIVALSEWKEKAQHAGC
                     LSYIELINRSSAIQKLLDERAWRECHLDQPSLSSSEREDTNDSMRRIMTDIFFGSARV
                     LLACVINGPFPRVPEIAQGVQDTLEALNRLDIEHPDADIHRALVLPITIAGCHCHTPQ
                     QQAFFKSCFERLSVEARAFGNTGPALELMEEVWKRRATKESDEAVCWRETMTSLGWEN
                     GILLI"
     gene            161202..164344
                     /locus_tag="CNJ00580"
                     /db_xref="GeneID:3254304"
     mRNA            join(161202..161610,161660..161976,162027..162135,
                     162184..162553,162602..163355,163406..163679,
                     163742..163940,163992..164019,164072..164106,
                     164161..164344)
                     /locus_tag="CNJ00580"
                     /product="Prolyl endopeptidase, putative"
                     /transcript_id="XM_024657922.1"
                     /db_xref="GeneID:3254304"
     CDS             join(161353..161610,161660..161976,162027..162135,
                     162184..162553,162602..163355,163406..163679,
                     163742..163940,163992..164019,164072..164106,
                     164161..164240)
                     /locus_tag="CNJ00580"
                     /codon_start=1
                     /product="Prolyl endopeptidase, putative"
                     /protein_id="XP_024513604.1"
                     /db_xref="GeneID:3254304"
                     /translation="MSGQQASHSFSTDKTGHGTLKNVHASDFTISPGQWKKNVNFSPY
                     PVPPQHGGITEIIHGIEIEDPWRALEDPDSEVTKKFVKEQNDFSVPRLTNHPLRKELE
                     AAVEQCYNHERMTSPELQGDGYYYWKFNPGTSPRDVIVRSKDLKRDFGKAPGGSGPEI
                     FYDLNKEENISLYAHSFSPSGKLWCAVLQYAGSDWQRIRVIDTESKAVLEKDLGGSKF
                     TFGVTWVGEKGFIYKRSIDYDATSDGYDGIDGSFGMFYHAVGQHQSTDVIVWSPPPGE
                     FQFIGKAKVVAVDEKEENNKRAFLALDIYKNTSPETELLLVELPGGTAGPAGVLLPEL
                     VTKEMKWVSRGFTGETHYIGSSSAERHFFTSFTDGVSTGRIIAFDSADWDATDIDSPL
                     PMQEIVPADPEGHQLQSAYFIGDRLLALIYLKHACASVVFIDARTGKPLGSADAQGTH
                     GNVAADPETQVPVPEEEVQHAKEGQVVIPEHGAITSISCRPDANDFYFTVDTWVAPSY
                     VLKGELIKNKAGRYEVDISSVNSSETAAQETLVCSQVFYTSHDGTRIPMFICHPHDLD
                     LTRPHPLLLHAYGGFCSPLIPHFDPMFAVFMRNLRGVVAIAGIRGGGEYGKAWHEAAI
                     GIKRSVGWDDFAAAARYVQSRGLTTPSLTAIYGSSNGGLLVSAATVRNPELYSVVFAD
                     VAITDLIRYHKFTLGRMWMTEYGSPEEPETLAVLRANSPLHNISRDPSVQYPAMLLTT
                     GDHDTRVVPGHSLKLLAELQTLKAKNHGAILGRVYINAGHEQSTKSTEKKVEEAVDRL
                     VFALDNIKI"
     gene            165319..166638
                     /locus_tag="CNJ00585"
                     /db_xref="GeneID:36393052"
     mRNA            join(165319..165576,165676..165756,165815..166638)
                     /locus_tag="CNJ00585"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658752.1"
                     /db_xref="GeneID:36393052"
     CDS             join(165526..165576,165676..165756,165815..166558)
                     /locus_tag="CNJ00585"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514434.1"
                     /db_xref="GeneID:36393052"
                     /translation="MMCIKHMLVYVLVFPLSASPPIFLACLGIAVLLRIKPCGYCLTL
                     ATILFLSSSPNSPFLKHSSPSLQSNQIQPLSSLPLDAPVPNRTWLTLNAGQIWDPCLV
                     GYREMSKALEMERNTTSVAGHGGRQGRRLGGIWQEGSRAVKEYVLAVREGLRKGQRPA
                     LVEKVYQPKKTLVRLVSRREGLVEKSEERRYLPAFYVDWRYKGIGFVLDFGLKRSEEG
                     LKWEIEEMLGRAWDREELKSMEKKNDWGGVSGETVDAIERSSTQAEETVVASEKVEAE
                     TKQSRWRKIPLVGSW"
     gene            166980..170574
                     /locus_tag="CNJ00590"
                     /db_xref="GeneID:3254336"
     mRNA            join(166980..167037,167425..167643,167699..167761,
                     167816..167944,167998..168115,168169..168496,
                     168546..168764,168813..169313,169366..169478,
                     169538..169925,169985..170574)
                     /locus_tag="CNJ00590"
                     /product="glycogen (starch) synthase, putative"
                     /transcript_id="XM_567312.1"
                     /db_xref="GeneID:3254336"
     CDS             join(167519..167643,167699..167761,167816..167944,
                     167998..168115,168169..168496,168546..168764,
                     168813..169313,169366..169478,169538..169925,
                     169985..170202)
                     /locus_tag="CNJ00590"
                     /codon_start=1
                     /product="glycogen (starch) synthase, putative"
                     /protein_id="XP_567312.1"
                     /db_xref="GeneID:3254336"
                     /translation="MPRSVHNPFLFEAAWEVANKVGGIYTVIKTKVPVTVREYGDRLC
                     LIGPLSYKSAPVEVEAEEPGPGPFGDALRSMQERGVKLLYGRWLIEGAPRVLLFDTGS
                     CYDRMDEWKGDLWNLAGIPSPPNDHETNETIVFGYMVAWFLGEFAARETDNAIVAHFH
                     EWQAGLAIPLCRKRHIDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGI
                     YHRYCIERSSAHCADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVVKFAAMHEFQNL
                     HVQSKEKINEFIRGHFYGHYDFDLDNTIYMFTAGRYEFRNKGVDMFIESLARLNHRLK
                     KMGSKTTVVAFIIMPAATNSYTIEALKGQAVTSQLKDCVEQVTNRISKRIFEHACRYS
                     GEHGTEVPNPEDLLSNEDRVLLKRRVFALKRNSLPPIVTHNMADDANDPILNQLRRVQ
                     LFNRPEDRVKVIFHPEFLNSNNPILGLDYEEFVRGCHLGVFPSYYEPFGYTPAECTVM
                     GIPNITTNLSGFGCFMEDLLESPEDYGCYIVDRRGQGIEESVDQLTGQLLSFTTKSRR
                     QRINQRNRTERLSELLDWKSLGLEYAKARQLALRRAYPDSFNDDEPDFTGVQKVGAPL
                     SAPASPRMRTGMMTPGDYATLTEEMEHLSTQDYMGAKSWKGINDDDDENHYPFPLVMK
                     PRKRSDSLASAISGNATPSGGRKLSENDLARADAALSNVEGVHADGINGHH"
     gene            170999..173358
                     /locus_tag="CNJ00600"
                     /db_xref="GeneID:3254240"
     mRNA            join(170999..171769,171822..171935,171989..172959,
                     173033..173358)
                     /locus_tag="CNJ00600"
                     /product="response to drug-related protein, putative"
                     /transcript_id="XM_567313.1"
                     /db_xref="GeneID:3254240"
     CDS             join(171436..171769,171822..171935,171989..172959,
                     173033..173206)
                     /locus_tag="CNJ00600"
                     /codon_start=1
                     /product="response to drug-related protein, putative"
                     /protein_id="XP_567313.1"
                     /db_xref="GeneID:3254240"
                     /translation="MSSQFTSNARSDADGRNENVPGPSAPEPFAPDDQEYGNEEKVRS
                     RAGTGQSGKTFRNSSGEEKSLDVEDVPKASEFHAPEAKATNNLTPAAGVAAAEPGGGK
                     PKLEKFKYSFWDPEMAMFRKIAFKILGGTIVITTIIMWLCLPFYWGSLWKSNRYTDKL
                     TVRIIDRDGGEIGQTFSQGLLSQTNLNYFVTDPSEFPTADDVAHDVVEEGVWASIVIN
                     AGVSDALVSARENGNSSWSGPSVIDVFYAQARQETAINSYLLPFVQEVLGQLCFQYNA
                     QSAATYLQANVNNATALSLVAQAPTTITNDVWYTLNNLRPYNQPVAQAITLVGLIYML
                     IFSFIMTMTNNAVREIIAPFLTTRAYIIYRLVSPICLYFPVSFFFCMVNLPFKIDFGA
                     HYTYAGGFFLWWFALFLGMSAVGLSTEAAITVLGPKFMAFFLVPLIIVNVSVVSLPQE
                     LQPWIYRYGVAMPFYNCNHIVRTIIFNTKNEIGQNMGILVAWVALNFITISLGTWLFR
                     RQSINQHNKEVGENEMDSADKV"
     gene            complement(173418..174899)
                     /locus_tag="CNJ00605"
                     /db_xref="GeneID:36393053"
     mRNA            complement(173418..174899)
                     /locus_tag="CNJ00605"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658753.1"
                     /db_xref="GeneID:36393053"
     CDS             complement(173948..174850)
                     /locus_tag="CNJ00605"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514435.1"
                     /db_xref="GeneID:36393053"
                     /translation="MELPPNIVLTPTSFPVYRRRLLAHLSIHAPHLASHLLHGPAEPY
                     RKPEDSLVHLVESALFHPHGQSAGDQPPCALVSTTGFKVCGIQLEEWDDWARNELALR
                     DVFKMTFGREMWDRLGRMWSTKEIWEVLESEYMPSPIERQSQIVYYLRSSRLPSSATQ
                     DDMLKLWETFNALVIEARDAGLYMKEKEVMDRFLMAIGKGDLAESVKQQFYGLSDWVV
                     GSGRWKGLRRILKKQFSPILLLETLEDIHSPDETDERLSGPTRGRAVLAEKDLNGQNR
                     TMEHHHQCNRTERQRKDSLDVILT"
     gene            175137..179412
                     /locus_tag="CNJ00610"
                     /db_xref="GeneID:3254059"
     mRNA            join(175137..175247,175356..175448,175531..175594,
                     175663..175680,175739..175820,175868..175915,
                     175998..176142,176200..177103,177156..177312,
                     177374..177474,177531..177546,177598..177898,
                     177954..178022,178073..178105,178153..178271,
                     178330..178713,178768..178867,178941..179129,
                     179186..179412)
                     /locus_tag="CNJ00610"
                     /product="Argonaute-like protein, putative"
                     /transcript_id="XM_567314.2"
                     /db_xref="GeneID:3254059"
     CDS             join(175549..175594,175663..175680,175739..175820,
                     175868..175915,175998..176142,176200..177103,
                     177156..177312,177374..177474,177531..177546,
                     177598..177898,177954..178022,178073..178105,
                     178153..178271,178330..178713,178768..178867,
                     178941..179129,179186..179194)
                     /locus_tag="CNJ00610"
                     /codon_start=1
                     /product="Argonaute-like protein, putative"
                     /protein_id="XP_567314.1"
                     /db_xref="GeneID:3254059"
                     /translation="MAVNAPPSIGLETLDGCPIRPGFGTSGKAINVFANMFAARFDKS
                     DAVVYHYDIEINPVVKTKEAKKPRPLLQKIWDQMVQEATGPLKTALESAAFDQQKNFY
                     TPHVLDLKDGKLEIIVGLKEDGIVPTDDRRRFKAVIQAADNCQIDLDTIISYSKGDKQ
                     TEQTRDVMLRAVQSVNVLLRQDAAKRFSMHGAAGRKFFTEEDGVAISGGAVVYRGFKQ
                     SFRWTSSGYPAVQLDNATSAFIEPGMLVDVAPKILGLAGAGGGRGGRGGRGGPRGGFH
                     GGAPGPVRPIQELNPLQIRKLSDLLRSAKFTVTHRKTERIFAIARLTSQPAEGIKFTL
                     NGKDGQPDRTVSVAQYFQEQYNIKVTRPRLPCIQYGKNFVPMEFVRLEPFNAIPMMKI
                     TPDQTAEIIKEAAKPPSLRQGSIQGWRQKLNYENLPKLKAWHLQVQTQMMSVPARVLA
                     PPAINYAGNQSLRANFGGWNLKGVKFNKAGKPLTSWAVVSFDERCTVPDLQKFINYFT
                     GVLVQYGCPVQNRRPALLQLNPNAGGPNMGVKPALQQAAKAAFADSKVNPQIILCILP
                     RKEASIYQTIKSVGAEGLFKPVVTQCLQSAKIKSDRGIDQYCGNVAMKVHCKLGGVTH
                     QVKHNVDKTTMLCGADVTHPPSRGRVLYPSIAATVASINGENNYFAGCVTEQGGRVEI
                     IQLLDEMITHHIKTFEKNTGAKPQKILFYRDGVSEGQYRFCVDEELQSIKKACKALGG
                     NYNPKITFVICAKRHAMRFFAASDADRDRTGNLPPGTVVDRGVTSPHNFDFYLQAHAG
                     LQGTAKPTHYVVMADEAGYTADALQNLTNTLCYSFARATRSVSLVPMAYYADIIAEQA
                     RLISYNEDLETATTAPSSTSGKLETVAFDPHRHFKRQFVGSDFGFTGWFM"
     STS             178117..179722
                     /standard_name="ha2747"
                     /db_xref="UniSTS:515592"
     gene            complement(179459..181629)
                     /locus_tag="CNJ00620"
                     /db_xref="GeneID:3254300"
     mRNA            complement(join(179459..180253,180304..180489,
                     180542..181058,181161..181266,181383..181629))
                     /locus_tag="CNJ00620"
                     /product="serine-type endopeptidase, putative"
                     /transcript_id="XM_567315.2"
                     /db_xref="GeneID:3254300"
     CDS             complement(join(179710..180253,180304..180489,
                     180542..181058,181161..181266,181383..181586))
                     /locus_tag="CNJ00620"
                     /codon_start=1
                     /product="serine-type endopeptidase, putative"
                     /protein_id="XP_567315.1"
                     /db_xref="GeneID:3254300"
                     /translation="MRFTAASLLLLPLVALASPIAQPTLAPLEAPSGGDHIDDAYIVV
                     FKKGVDASQIALHIGEVQELHAASPLHSSLTDDGEVDEGGLRHVYSPPSPSSSSGFFG
                     YAGKFSPSTLDAIRAAPEVAYVEKDQIMTTLEVPRGVDDDASDEQVEQVDVSASGITT
                     ELGAPWGLARISHRDRLSLSTFQKYLYYSGGGDGVVAYVIDTGINTDHVEFEGRAVWG
                     KTIPKNDVDKDGNGHGTHCAGTIGSRKYGVAKDVKLVAVKVLGSNGSGTMSDVIAGVL
                     WAAEQATEDAERAAQEVATTGKTKHKGSVANMSLGGGRAKTLDDAVDAAVEAGLHFAV
                     AAGNDNKDACNYSPAASKFAVTVGASTLGDERAYFSNHGKCVDIFAPGLNILSTWIGG
                     NSTTNTISGTSMASPHVCGLLAYFVSIYGTESFPHIKSDFNESLAATRPSIVSMAYAQ
                     AYAMLPSLAQTVLPKPELLPVPPKNDTLTPDMLKKALVGLATKDMLSDLPEGSPNLLA
                     YNNATLPKRK"
     gene            181804..186385
                     /locus_tag="CNJ00630"
                     /db_xref="GeneID:3254186"
     mRNA            join(181804..182032,182084..182140,182198..182403,
                     182450..182456,182505..182615,182664..182746,
                     182795..182829,182890..183074,183142..183321,
                     183385..183481,183537..183650,183707..184174,
                     184242..184651,184716..186104,186159..186385)
                     /locus_tag="CNJ00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658755.1"
                     /db_xref="GeneID:3254186"
     mRNA            join(181804..182032,182084..182140,182198..182403,
                     182450..182456,182505..182615,182664..182746,
                     182795..182829,182890..183074,183142..183321,
                     183385..183481,183537..183650,183707..184174,
                     184242..184651,184716..186104,186159..186179,
                     186231..186385)
                     /locus_tag="CNJ00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657923.1"
                     /db_xref="GeneID:3254186"
     CDS             join(181889..182032,182084..182140,182198..182403,
                     182450..182456,182505..182615,182664..182746,
                     182795..182829,182890..183074,183142..183321,
                     183385..183481,183537..183650,183707..184174,
                     184242..184651,184716..186104,186159..186179,
                     186231..186272)
                     /locus_tag="CNJ00630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513605.1"
                     /db_xref="GeneID:3254186"
                     /translation="MVATCSSADAAVEDINEIHVQISKDKSRGWQKRAQKWAKGRKLL
                     GKLLGDPTLRSENTSLTEWIEDEFETATSSADISLTVALLLNLVKHIYTTFIKPSAFP
                     TQEPHTLLTEGQNQQGQLGTLHIAGRVIVSLTELLLTNKKLNNHIVASHVDLFVRLLE
                     ACTEGKILQAQAHTNLGELILSIVNAEHSECRTFLSEDSVLGFANIGKLLWKSQSSSI
                     TLHLLSTLQFLLPAHTAGKDSPRTVACRNVVMNQGWSKNIIKESFSAIGKMDKKLDPG
                     LLMKCINIFAEDHSFLRPKAFQLTSFIIDDEDQIVSHKSKKNLKNGHLALYADRYCCR
                     FTLYGDDEHESPRIFAHTEIEEFIRLNTKDGGSTDFEFQVPSFDDRISIVKFGIKTAE
                     ASDFETLMKKAKNPKPQTLEGEAEKKAPATTVAQPDPLAPADKRADGKRKTRFSSLAR
                     SISPGINSNKISEPEPLSKARSIMSNRSSKVRVSLDVAEEEKDSALALHGASKKNEGN
                     EKTPKAGKGEKLGTMEMKKAEWKTAGSDAAADSDESGIVLIGKTSTPMTRSTKTYGSR
                     GSRSSSARRPMQSKPPLPPMESSDSELDTKPLPPPNSNRRTSLLQNRLKKDVDEKSKA
                     TPTIRAPTLKSRAKSLASSIAEGRAATPVSRGPTPATGGINEQLFGSDGGNRGKDGKK
                     AGMTKSWRGKKDKVAEEALPVSIIAPIPEPSSTSRRALIKKRFPQQSSDEEEPSEAEP
                     WTKAGRTSLQPQIRTKVKNRAPSLPPTTSDDEPLRERVNTMNFDCDSMAEDETKDPQK
                     KLTKQTTSKSTVKAASIPRKKGDLAAPVSESESNLQPEEYRSQDSRHCQQNMVDLACS
                     APSFVTVKDITNRRRPKTKKIISRCEDEDDDEQVQELEEEYDEADVQTKKRGLRPIRG
                     VLDKNNIKNQKQKQISEFKLDESDSQSNSDLRSDSDHPPTKKYKANSKSKTAAMAKST
                     KAEIKAQSKARKNRSRRMESSEDEESPTDNQASEPCPNVESNPESEQSEQDVKRGKKL
                     TKGRKSSTAATASSMSTKTKAQVKEIKSSRRPYMFSKPLKKRKDMTESESEGKDEEDA
                     EERPPLKKTKKAQPSTKRKRDERSGSEEEGRASQPSSKLAKVIREGRGKTMIQGKAEK
                     KVEEAAVEEEPPKISDLLSGISKAMRKRVNTRSRLR"
     CDS             join(181889..182032,182084..182140,182198..182403,
                     182450..182456,182505..182615,182664..182746,
                     182795..182829,182890..183074,183142..183321,
                     183385..183481,183537..183650,183707..184174,
                     184242..184651,184716..186104,186159..186197)
                     /locus_tag="CNJ00630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514436.1"
                     /db_xref="GeneID:3254186"
                     /translation="MVATCSSADAAVEDINEIHVQISKDKSRGWQKRAQKWAKGRKLL
                     GKLLGDPTLRSENTSLTEWIEDEFETATSSADISLTVALLLNLVKHIYTTFIKPSAFP
                     TQEPHTLLTEGQNQQGQLGTLHIAGRVIVSLTELLLTNKKLNNHIVASHVDLFVRLLE
                     ACTEGKILQAQAHTNLGELILSIVNAEHSECRTFLSEDSVLGFANIGKLLWKSQSSSI
                     TLHLLSTLQFLLPAHTAGKDSPRTVACRNVVMNQGWSKNIIKESFSAIGKMDKKLDPG
                     LLMKCINIFAEDHSFLRPKAFQLTSFIIDDEDQIVSHKSKKNLKNGHLALYADRYCCR
                     FTLYGDDEHESPRIFAHTEIEEFIRLNTKDGGSTDFEFQVPSFDDRISIVKFGIKTAE
                     ASDFETLMKKAKNPKPQTLEGEAEKKAPATTVAQPDPLAPADKRADGKRKTRFSSLAR
                     SISPGINSNKISEPEPLSKARSIMSNRSSKVRVSLDVAEEEKDSALALHGASKKNEGN
                     EKTPKAGKGEKLGTMEMKKAEWKTAGSDAAADSDESGIVLIGKTSTPMTRSTKTYGSR
                     GSRSSSARRPMQSKPPLPPMESSDSELDTKPLPPPNSNRRTSLLQNRLKKDVDEKSKA
                     TPTIRAPTLKSRAKSLASSIAEGRAATPVSRGPTPATGGINEQLFGSDGGNRGKDGKK
                     AGMTKSWRGKKDKVAEEALPVSIIAPIPEPSSTSRRALIKKRFPQQSSDEEEPSEAEP
                     WTKAGRTSLQPQIRTKVKNRAPSLPPTTSDDEPLRERVNTMNFDCDSMAEDETKDPQK
                     KLTKQTTSKSTVKAASIPRKKGDLAAPVSESESNLQPEEYRSQDSRHCQQNMVDLACS
                     APSFVTVKDITNRRRPKTKKIISRCEDEDDDEQVQELEEEYDEADVQTKKRGLRPIRG
                     VLDKNNIKNQKQKQISEFKLDESDSQSNSDLRSDSDHPPTKKYKANSKSKTAAMAKST
                     KAEIKAQSKARKNRSRRMESSEDEESPTDNQASEPCPNVESNPESEQSEQDVKRGKKL
                     TKGRKSSTAATASSMSTKTKAQVKEIKSSRRPYMFSKPLKKRKDMTESESEGKDEEDA
                     EERPPLKKTKKAQPSTKRKRDERSGSEEEGRASQPSSKLAKVIREGRGKTMIQGKAEK
                     KVEEAAVEEEPPKISDLLSGISKVRPYY"
     gene            complement(186344..188243)
                     /locus_tag="CNJ00640"
                     /db_xref="GeneID:3254235"
     mRNA            complement(join(186344..186533,186615..186984,
                     187044..187105,187161..187217,187278..187370,
                     187436..187511,187571..187668,187719..187836,
                     187892..188004,188058..188243))
                     /locus_tag="CNJ00640"
                     /product="adaptation to pheromone during conjugation with
                     cellular fusion-related protein, putative"
                     /transcript_id="XM_567317.2"
                     /db_xref="GeneID:3254235"
     CDS             complement(join(186441..186533,186615..186984,
                     187044..187105,187161..187217,187278..187370,
                     187436..187511,187571..187668,187719..187836,
                     187892..188004,188058..188189))
                     /locus_tag="CNJ00640"
                     /codon_start=1
                     /product="adaptation to pheromone during conjugation with
                     cellular fusion-related protein, putative"
                     /protein_id="XP_567317.1"
                     /db_xref="GeneID:3254235"
                     /translation="MKYQQFVNSFTHPLQHEDHTPLLRLLSVHGKAAKGIADTVGAID
                     EKRLKNPGHTLPDLWDEIAVRHCACVYALYKTKDYTEAFNQQDKLLSLFYRWFVDQSS
                     WVLPVLYMMLSDLRDLAEQADQTIHAETGKMPSLEICTRTVSKAFSLCATDRQFKGEE
                     SRRRGVYHTACLTIKCYFKVGKPNLCKNIIRAVVSDPKTPSVDTAPLPDQVTWHFYIG
                     MLAFLNGEDKKADEELSWALKHCPADAKRNQELILTYLIPLRLLHGRFPSASLLSQHP
                     RLELVFTPFINAIKNGDVEEYDRRLEWAQVRLVGMSVWLVVERAREGCLRSLFKKAWM
                     ASDKSTRVPIETFRLALKLHGVDVESDEVECMVANMIYRGYLKGYISHEKKMVVLGKT
                     NPFPKMSTIAR"
     gene            188595..190184
                     /locus_tag="CNJ00650"
                     /db_xref="GeneID:3254179"
     mRNA            join(188595..188762,188816..188870,188924..189525,
                     189576..189803,189894..190184)
                     /locus_tag="CNJ00650"
                     /product="eukaryotic translation initiation factor 6
                     (eif-6), putative"
                     /transcript_id="XM_024657924.1"
                     /db_xref="GeneID:3254179"
     CDS             join(188753..188762,188816..188870,188924..189525,
                     189576..189646)
                     /locus_tag="CNJ00650"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 6
                     (eif-6), putative"
                     /protein_id="XP_024513649.1"
                     /db_xref="GeneID:3254179"
                     /translation="MAVRTQFENSTDIGVFSKLTNSYCLTALASSTNFYSVFEAELAD
                     VVPIVHTTIGGTRIIGRLTAGNRHGLLVPSSTTDQELQHLRNSLPPTVAIQRVEERLS
                     ALGNVIACNDYVALVHPDIDRETEEIIADTLKVEVFRQTIAGNVLVGSYCALSNQGGL
                     VHPKTSRSELDELSSLLQVPLVAGTVNRGSEVIGAGLVVNDWCAFTGLDTTATEVSVI
                     EATFRLQGQTSTAVINEMRDSLIDHYA"
     gene            190469..192842
                     /locus_tag="CNJ00660"
                     /db_xref="GeneID:3254279"
     mRNA            join(190469..190796,190854..190873,190924..191082,
                     191130..191180,191227..192842)
                     /locus_tag="CNJ00660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567448.2"
                     /db_xref="GeneID:3254279"
     CDS             join(190554..190796,190854..190873,190924..191082,
                     191130..191180,191227..192709)
                     /locus_tag="CNJ00660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567448.1"
                     /db_xref="GeneID:3254279"
                     /translation="MIIQPSQRAASYRLKRGTKLAEVPPQPPTPSVPPLSTLNGPFQL
                     AEYLALKVKHDPHDVNGLVKVPAGDGSMDGKGPDRDVWIYEHLRRIPIDLTPLITALL
                     PICTRETCPQMRSSEWSYFCVAHGSGTRECSTIDYILHTLDSTVTLLNNSKHFPSRMH
                     IPPASVSHFPSIFRRLSRIFSHAYFHHREAFIMAEVENSLYARFVELCEAYELVGERL
                     LVIPKEVVSQFRDDDEEDIGRGKGKEKSSTHDETEDAKEPVKISSGPSKLAVRGSSTF
                     GRNQILGRGKAARSTPAQDEDVAEGSSSTPAANVTNAVEEEENEEEEGHGEQKLRSRS
                     DSLSSSESTSSVQTAVHVSDIEALSQDIETEHVEDASPPPVAEFVTREEKKDEEEVTK
                     DEIDLLEDERKLQKEADMAPLPVAEEPKEEEAEQEETRPVDETRLAEQQVQPKSGDQV
                     ALETFQEGDSSRVKEDKEVDKEEEAELENVKSDDEEEEKEATASEPPSKAPAPIVVVP
                     VVESSSSNPPATSGISAQPESKTAESAVQQEQTSTTTSAAPELGSTPTGETISEPSSE
                     SELETELSPLSPGLFPATSSAEEKQDDKKGSLSKKRAKKAAQKARAKEREREVKAQAQ
                     AQTEGEVPENSGETDKLESKKDAQQEK"
     gene            193422..196534
                     /locus_tag="CNJ00670"
                     /db_xref="GeneID:3254283"
     mRNA            join(193422..193581,193842..193984,194057..195075,
                     195131..196534)
                     /locus_tag="CNJ00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_567449.2"
                     /db_xref="GeneID:3254283"
     CDS             join(193856..193984,194057..195075,195131..196052)
                     /locus_tag="CNJ00670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567449.1"
                     /db_xref="GeneID:3254283"
                     /translation="MATTNSPSIAFSQGDIDMTTHNDVANFEELFNFEEFESAGESST
                     HGNSPATESNATPSPLPTQDPLFHDTSFDFFNTSMDTDYPIGLSLGDSKDSKAAFADD
                     IVVKQEPIDYPVFDSQSPASNPVPTQLAPLSFGGLPVDQQAALQQLMENIMNYQKKFG
                     AELPGVAASPAEGNAQTIEPSMLFTNSPASDSAVIPVQPMAVAPAAQSAPATTSNTPP
                     VAVAPSLVPASLAAPTPVPPTTQPVEKLEEPLRSISEEPNRTRAGSTMSFEDLDSRID
                     RLVPLPDIFSAGKGKGGKKGGGMSSVVREDGEDLDDDESWRPSPEEYKKLSSKEKRQL
                     RNKLSARAFRTRRKDYIGTLEAHIKDRDMVIDEMRNELIHSRNENQDLRKELAALKAS
                     TMSILHPESASKSFSPAMVSALAKSPAIANAASSATPNGPVRRPGTPLNTYNPRKDLP
                     SSLKGGWSNDNMFGGGSTICHTIMTPDLVLPSSNPAPLRSFADLPRVNLNPNLNEPAP
                     STLPHTLSNPASGADGSSTFSEWSENTPWSLRSMDSYRMQIWSRLAKEAAADKANLAG
                     DLRPKFFVEGPSTPSPSAADVAGAATSHVTSKLASSFWSAFTQGSSKSLDNDKLAAVV
                     TGQAKLKVVPINQQEGEEDVLATLMGGLKMQSGVSPFERRRAEGARENPLGVLCGFLK
                     HAGAMTC"
     gene            196857..199460
                     /locus_tag="CNJ00680"
                     /db_xref="GeneID:3254350"
     mRNA            join(196857..197000,197091..197155,197218..197579,
                     197629..197708,197758..197930,197984..198302,
                     198354..198429,198481..198619,198672..198709,
                     198759..199460)
                     /locus_tag="CNJ00680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567450.2"
                     /db_xref="GeneID:3254350"
     CDS             join(196966..197000,197091..197155,197218..197579,
                     197629..197708,197758..197930,197984..198302,
                     198354..198429,198481..198619,198672..198709,
                     198759..199337)
                     /locus_tag="CNJ00680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567450.1"
                     /db_xref="GeneID:3254350"
                     /translation="MSDMEYFIGFDVGTGSGRACLVDRNGNLIAEHAEPTLTHRSPTD
                     ARIFEQSTRNIWKSLSTCSKKILSESGIKPEQVKGLGFDATCSLAVVDKQGKPVSISR
                     TGQTEEDEKDANLGSEGEWNVILWADHRAEEEAEKINSTGEGVLGFVGKTMSLEMEIP
                     KTLWLSKHMAQEKFKQCMFFDLPDFLTYNATSDIARSTCSLACKCSFVPIGATMTHDC
                     DGGKEEVSSQGWSARFFEKIGLHDLVEEDFASLGGIPGKNGLVLTAGQPVGKGLSKRA
                     AEDLGLLEGTAVGSGVIDAYAGWIGTVAAAAGEDQAQPTLEDASTRLAAIAGTSTCHI
                     AQSKDGILVPGVWGPYRDAVFPNLWMNEGGQSSTGQLIDFMMQSHPAYPKLLELSKSS
                     GKSTFELLAERLETLQAEKAAKTLTHLTKDLHFYPDLHGNRSPLADPRMKGMITGLVL
                     DDSLNDLAAKFNVTLEAIALQTRHIVDEMNAKGHKIDSIYMSGSQAKNGPLMRLLATV
                     LQMPVIIPPQPSAAVVLGAAMLGRYAYYLTTERQGKPISSQQEAEEAKEKEGWRLWDV
                     MVQMTRPGKRIEPRNDEFGTSEKRLLDVKYKIFREAVEVQRRWRQMIADEVKEEE"
     gene            complement(199458..202430)
                     /locus_tag="CNJ00690"
                     /db_xref="GeneID:3254372"
     mRNA            complement(join(199458..200292,200359..200441,
                     200495..200919,200978..201100,201150..201246,
                     201296..201360,201414..201501,201552..202430))
                     /locus_tag="CNJ00690"
                     /product="uracil permease, putative"
                     /transcript_id="XM_567451.2"
                     /db_xref="GeneID:3254372"
     CDS             complement(join(199638..200292,200359..200441,
                     200495..200919,200978..201100,201150..201246,
                     201296..201360,201414..201501,201552..201698))
                     /locus_tag="CNJ00690"
                     /codon_start=1
                     /product="uracil permease, putative"
                     /protein_id="XP_567451.1"
                     /db_xref="GeneID:3254372"
                     /translation="MTTRLRVKRILKKLESDHAEGLTSTEMFLATEDLLPVKEEQKTW
                     DGWNFASFWIADSFNLNTFTIASSMISAGLSWWQAFICVIIGYSLVGPLIVLSARPGA
                     VHGIVFPAVCRTTFGLFGSLWPVLNRAGMAAIWWGVQGWLGGECVYVLLRAIWPSYPN
                     IKNIMPASTETTSAYVLAFVIFWLLSLPTIWVPIHKLRWLFAAKAIVGPIVGFTLFGW
                     SITRAGGIGPVFSQPATLSGSALGWQMLISISSCFNNMFTLVVNAPDFASRAKKPSAA
                     VWPQLISMPLGFTVTSFLGIVIASASAPQFGTQIWDVVQIMDRMLDGASSSTRAGLVF
                     ISAGFVYVQLLLNVAANSISAGCDLTALFPRYLSIRRGGYIAAIIGICMNPWLLYTSS
                     STFSTYLSAYGVLLSCIAGPMITDYWFVRRGHMRVNDLYSAEKSGWYWYTWGINWRGY
                     LGYIIGFACNAPGFINSINPNIYVPVGAQRVYYLSWITGTGISGFVYYLACLISPPPG
                     MNRTFMEVDESKDELRVDEIARMRMPQEGVEAPEISEKKVSQEGQVSVVEAA"
     gene            complement(202555..203995)
                     /locus_tag="CNJ00700"
                     /db_xref="GeneID:3254203"
     mRNA            complement(join(202555..202736,202793..202945,
                     203004..203346,203422..203526,203602..203995))
                     /locus_tag="CNJ00700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657925.1"
                     /db_xref="GeneID:3254203"
     CDS             complement(join(202699..202736,202793..202945,
                     203004..203346,203422..203526,203602..203796))
                     /locus_tag="CNJ00700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513640.1"
                     /db_xref="GeneID:3254203"
                     /translation="MANLYEQVNTHYSSIAREDEASNAEHMKKVALSFGYNVEDLACI
                     PDGSNLGVSCGNPLTIAGLKEGETVVDLGCGGGFDVFQAARKVGVKGLVIGVDLSDDM
                     LARARANAEKSSTTNVKFVKTPITEIELPSDSTDCIISNCVINLVPHDDKHLVFKEIY
                     RLLKAGGRVSVSDLLAKKQITPELQSHLGLYVGCISGASLVGEYENWLKEAGFQDIML
                     VNKNSDINIYKERVQEDEENSSSCCGTKIPVSETNNAVANIDFNEWVGAFNIYAVKPS
                     S"
     gene            complement(205039..206814)
                     /locus_tag="CNJ00710"
                     /db_xref="GeneID:3254108"
     mRNA            complement(join(205039..205752,205808..206128,
                     206190..206814))
                     /locus_tag="CNJ00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_567452.2"
                     /db_xref="GeneID:3254108"
     CDS             complement(join(205406..205752,205808..206128,
                     206190..206211))
                     /locus_tag="CNJ00710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567452.1"
                     /db_xref="GeneID:3254108"
                     /translation="MTMSEKPRLHLDFNSPVCPAPVYSPQTFSSPPTSPPSPFGGFSS
                     QQYSPPFMPSRKSFSGVDSERGAPLSPTMSEKSLGSRMQSSPRILMGAMVSVSPRQNS
                     EELSLEVPGIVLTEPPHLNPRPFPPPKQTVLLAPTSLPLPSLGSCSSIFQGHCQHSSI
                     STKSAHQFSPAFSSFLSGAATPYQQHHGRRNRMKAMLMLGIVVVGGWHLWSTLMYEGW
                     GGLVEEAVEAI"
     gene            complement(207074..210667)
                     /locus_tag="CNJ00720"
                     /db_xref="GeneID:3254282"
     mRNA            complement(join(207074..209692,209744..210167,
                     210224..210318,210380..210484,210556..210667))
                     /locus_tag="CNJ00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_567453.1"
                     /db_xref="GeneID:3254282"
     CDS             complement(join(207366..209692,209744..210029))
                     /locus_tag="CNJ00720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567453.1"
                     /db_xref="GeneID:3254282"
                     /translation="MEGSPLSRFPPINASSSMSTSTNGASGKRKSTLLTFLRRPSAEG
                     NTIAVPQRQSVFHDMERQPQKPLRHEELLNAAGDEKDIDPNLPTVRLVPPDDEGEPMM
                     LYPFPLSPPPSLDTQSPPRQRTPPFSPSTPSPLSRRPPLATANRSRPTSTYASNPAWN
                     GMADGFVLPPPRFSRSGAGFNPRGRASVVMPKTKIQVVEEKKRRMSAMMEWEMGYGGA
                     ERSATNRPMSLGQEMKPPNVLEAEKERAAMANVASQSRPTKPDEEEKIEELSEEPVTD
                     TSTPSAPTAPGPPTVTIKTESPVTSQPPSQLPKDDAPRPSTFKPSRRSRTLSLSAAFS
                     VPLFTKNESPTITSAPPIPPVPPVPREQTKRVPKKQKSLKNLFFSSSTPPEATLGPSK
                     YDDFSPVAEAKPVLKDKTERPKEKKPMLSRPRSKPSLHIDIDATKPSSSLKSAPAAPS
                     SSKTSATPITPALSSGRSEKTNSIPATPSTASTATTTPTSTSSVVSKPKLNKRFSLSN
                     MAVFKKRSNSAPSVEHRSLADMASGNAKEEVPKVPELPKAYKKEKEARRTMSEMLPAK
                     EEVAVVPPAPLANEIVTSPVAEMPKGPIELPSTHSADISTDDSSLIHSPRDSTATIEP
                     TSASMSSDMSDVDDEDDILNAQFMQLPSPRSPIDRDPALSLQDFLNSAPGRKSEVVVV
                     QEGRRSLEALVVLGPTSVRPNTVSTNSRMSASGSEASFASCDSGSTLNFGTSPQRKQS
                     LYPSVEVRRDSASSDASDDIEGLVTPVQDSVEMFRVQRQRQESQSEESNAGESTDSEG
                     MRNCGSSRKMGPTVPAIDSSSTSKSAPTRALPAPPATMSLEEKKKLGSLHFDNLGLNF
                     GEWDGRGEEVSVRT"
     gene            complement(211379..214176)
                     /locus_tag="CNJ00730"
                     /db_xref="GeneID:3254099"
     mRNA            complement(join(211379..212601,212654..212850,
                     212905..213084,213151..213156,213208..213654,
                     213741..213764,213884..214176))
                     /locus_tag="CNJ00730"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_567454.2"
                     /db_xref="GeneID:3254099"
     CDS             complement(join(211607..212601,212654..212850,
                     212905..213084,213151..213156,213208..213563))
                     /locus_tag="CNJ00730"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_567454.1"
                     /db_xref="GeneID:3254099"
                     /translation="MIAPLLLLILPFALANPVPTSSPATSIAPAPTSPPVARGFSASL
                     SHGQGAVARAKAYEKAKSKRGFFSRDVEMDDEALPPSWLLWAGARVDTKYNEGKGGFA
                     AAYASALSKRAKNGEVTLTDHSLDTSYSASISVGTPAQTLNIVLDTGSSDLWLASTEC
                     DTTACESMDRYNPSDSSSSINLTTSFSIEYGSGSTSGSLFQDLITLGGYSVASQTFAS
                     CDDVSSGLLSSGVSGIMGLSWQALAYSKATPWWITLAKSSSWSDPLFAFYLARYRNVA
                     GASATESDGGVANFGYLDSSMYSGDVTYVNVGDNAQYWQIEMASVTIQGSSVSLGSSN
                     MAAIDTGTTLIGGPESVVASIYAKISGSQRMTGSYSSYYEYPCNTSVDFEITFGGYTI
                     KITDQDFNLGRYSSDETMCTGAVYIQTLSSSSPVQWIVGDAALKNTYTVFRYSPAAVG
                     FADLASAVASSEAAQSTTIVDASSLLAAASSTASTSVSASTSSSSSVAAASTSSARTA
                     QTNSTASVSSEAPHVVTVSDSSTIGVASGSEATASASATDTSSGALPALGGGSKWLAI
                     FVGVAVGVFVL"
     gene            complement(215899..218010)
                     /locus_tag="CNJ00740"
                     /db_xref="GeneID:3254144"
     mRNA            complement(join(215899..216012,216070..216506,
                     216558..216617,216677,216731..216843,216895..217042,
                     217090..217171,217223..217248,217301..217390,
                     217478..217749,217798..218010))
                     /locus_tag="CNJ00740"
                     /product="metacaspase, putative"
                     /transcript_id="XM_024657926.1"
                     /db_xref="GeneID:3254144"
     CDS             complement(join(215981..216012,216070..216506,
                     216558..216617,216677,216731..216843,216895..217042,
                     217090..217171,217223..217248,217301..217390,
                     217478..217749,217798..217910))
                     /locus_tag="CNJ00740"
                     /codon_start=1
                     /product="metacaspase, putative"
                     /protein_id="XP_024513650.1"
                     /db_xref="GeneID:3254144"
                     /translation="MSWNQYPGGGHHQQGGYGYRPPPPQWAQQGPPPPPNMGYRPPPP
                     PQAYYNNPPPPQQYQRPAPQQNGYQQGGYQQQQQSQGNYRTSNGGYVPPTGAPVEASY
                     HHTGAGYTPPSGTPQRTSAPYGAGAPIRPPSQAQHYGPQLQGQGGQSAQPYFQYSQCT
                     GKKKALCIGINYVGSSSALAGCINDAHNVQKFLIERYGYKSEDIVMLTDDARNPRQIP
                     TRANILAAMHWLVQGAQPNDSLFFHYSGHGGQTPDLDGDEDDGYDEVIYPLDFKTAGH
                     IVDDDMHNIMVRPLPAGCRLTAIYDSCHSGTALDLPYIYSTEGVIKEPNLLAEAGQGL
                     LSAGMSYLRGDTGGMLQGIMGIGKKVMNQNSGAMEKARQTKTSPADVISWSGCKDSQT
                     SADTQEAGRATGAMSYAFIAALTKYPQQSYVQLLNTIRDELKGKYDQKPQLSASHPMD
                     TNILFIC"
     gene            complement(218170..219234)
                     /locus_tag="CNJ00750"
                     /db_xref="GeneID:3254353"
     mRNA            complement(join(218170..218462,218519..218624,
                     218694..218766,218826..218888,218951..219026,
                     219137..219234))
                     /locus_tag="CNJ00750"
                     /product="MBF1, putative"
                     /transcript_id="XM_567456.2"
                     /db_xref="GeneID:3254353"
     CDS             complement(join(218331..218462,218519..218624,
                     218694..218766,218826..218888,218951..219026,
                     219137..219139))
                     /locus_tag="CNJ00750"
                     /codon_start=1
                     /product="MBF1, putative"
                     /protein_id="XP_567456.1"
                     /db_xref="GeneID:3254353"
                     /translation="MSDWDKPTVIGFRQQKPTVAKGSTLNAAQRAGLVISSESKGAGQ
                     SKGPADHQRIAKLDRDDAPKPPEKVSADVGKAVATARMAIKNAEGKSMTQKELATSVN
                     AKPQDIADLESGRAVPDQALLGKLERKLNVKLRGAKNLIGTPLHPKKK"
     gene            219406..223084
                     /locus_tag="CNJ00760"
                     /db_xref="GeneID:3254100"
     mRNA            join(219406..219683,219737..220190,220256..221192,
                     221250..221358,221410..221424,221475..221550,
                     221602..221823,221877..221954,222000..222094,
                     222148..223084)
                     /locus_tag="CNJ00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658756.1"
                     /db_xref="GeneID:3254100"
     mRNA            join(219406..219683,219737..220190,220256..221192,
                     221250..221358,221410..221424,221475..221550,
                     221602..221823,221877..221939,222000..222094,
                     222148..223084)
                     /locus_tag="CNJ00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657927.1"
                     /db_xref="GeneID:3254100"
     CDS             join(220373..221192,221250..221358,221410..221424,
                     221475..221550,221602..221823,221877..221954,
                     222000..222094,222148..222667)
                     /locus_tag="CNJ00760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514437.1"
                     /db_xref="GeneID:3254100"
                     /translation="MSSHLPSYIIPFLLPPLRPSSCLFLPSSISPPACLTMSSQLASS
                     PICYIPSQSSTLTSTSTNTTPSPSVDDSIATSHSDAVSKDHEKDIPPSLPHNTARSFG
                     AGWNSSPVIPSSKKLEHHCLSPHIDGIMPTRTRSPSLPVLPSQSTIYQPQPHPCFQEL
                     PDYSLYTSAAISFPNPSQEIGFVAGLHHQPSLSPVVFDYDDHRYSPTRLVSTQRSLLR
                     QSTPNLHSKRSELTARRSCRSVRFDIDEDDASEGSSTKGLSNNMLVLPRTGEGRNVFI
                     HRVSHTLTDDELHKIAISFGEIVSVKVQNRVAKPHAFVMFKKPEQAQRFIAHLKSRDI
                     DCEFGKEDYQVQNKALEDPNSANLYISGLPTDITFDELADLVAPGRICSWKPLMDELG
                     NRRGPVMARLQTRPQADDAIRKLSNKYYPGMSELLQVRIADSDVSVIFEQKHFKRYQM
                     RERLPPNPDPVLLRRRASMPAEDIAHDVDDLSILLQRQTLLTTQLNTINEKLARSAHG
                     TPHPSLPPVRLSSIHTVPFPSSPITEDIDCPVLSPTNSSYRGRLSSTVSSHIHSTDSI
                     WASPSRMMTEPMWLDGWPIKSRLGDIMMRESDSQLPKRLQRHDGTVKSQGEVNLHYVK
                     SSPELGVNLNGVLGRRTSNN"
     CDS             join(220373..221192,221250..221358,221410..221424,
                     221475..221550,221602..221823,221877..221939,
                     222000..222094,222148..222667)
                     /locus_tag="CNJ00760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513651.1"
                     /db_xref="GeneID:3254100"
                     /translation="MSSHLPSYIIPFLLPPLRPSSCLFLPSSISPPACLTMSSQLASS
                     PICYIPSQSSTLTSTSTNTTPSPSVDDSIATSHSDAVSKDHEKDIPPSLPHNTARSFG
                     AGWNSSPVIPSSKKLEHHCLSPHIDGIMPTRTRSPSLPVLPSQSTIYQPQPHPCFQEL
                     PDYSLYTSAAISFPNPSQEIGFVAGLHHQPSLSPVVFDYDDHRYSPTRLVSTQRSLLR
                     QSTPNLHSKRSELTARRSCRSVRFDIDEDDASEGSSTKGLSNNMLVLPRTGEGRNVFI
                     HRVSHTLTDDELHKIAISFGEIVSVKVQNRVAKPHAFVMFKKPEQAQRFIAHLKSRDI
                     DCEFGKEDYQVQNKALEDPNSANLYISGLPTDITFDELADLVAPGRICSWKPLMDELG
                     NRRGPVMARLQTRPQADDAIRKLSNKYYPGMSELLQVRIADSDEQKHFKRYQMRERLP
                     PNPDPVLLRRRASMPAEDIAHDVDDLSILLQRQTLLTTQLNTINEKLARSAHGTPHPS
                     LPPVRLSSIHTVPFPSSPITEDIDCPVLSPTNSSYRGRLSSTVSSHIHSTDSIWASPS
                     RMMTEPMWLDGWPIKSRLGDIMMRESDSQLPKRLQRHDGTVKSQGEVNLHYVKSSPEL
                     GVNLNGVLGRRTSNN"
     gene            complement(223539..227200)
                     /locus_tag="CNJ00770"
                     /db_xref="GeneID:3254270"
     mRNA            complement(join(223539..226346,226392..226835,
                     226886..227200))
                     /locus_tag="CNJ00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_567458.2"
                     /db_xref="GeneID:3254270"
     CDS             complement(join(224061..226346,226392..226835,
                     226886..227128))
                     /locus_tag="CNJ00770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567458.1"
                     /db_xref="GeneID:3254270"
                     /translation="MSEQPEIVSHESKEEERRAASPTPADNEQSNGTLEPETKHEKVE
                     QTTGNDAPETLEAQATKEAQEEARPHNDAESAKRVRAPSPLVIPTSEELTAAHPAEAL
                     HPPDSPTSSLISSLRSQLLSLSDQTHALNSKLIASISHSADLEDELQLVRDRHVALGE
                     RAKSLEEERNRWEESMKTGLLVERDQIRDEMQRLAAGLVEEERRRGSAEEKRAQVENE
                     VDDLTAKLFDQANTMVATERMSRAQAEARLRSTEENLANAEAVVQAMQVQLQSLSVVT
                     SGDKALSGPFLSRKYVSSHIPYAEFISFIQHLRAARPLVDHAKQSSSPPIVTNLLAQP
                     FLARVMAEDHEPTVRLESAPALSFLSRRTVGNAIISGDLVIEPVSLANVLQSTGSSQH
                     DLACSLCGKKVFHAVPSSPATGGYFATPVSHPQRNSGSGTSRFSLKPFFNTSNSLSNG
                     SSVSPKNSPLTSPSLPGSSSSTSTHVFVFRIARSQGTTTPLGEKESSSKLYPICKSGW
                     CLERLRATCELWHFVRTGIVHVVWHSEDGVPAVAGGPRNSSPAPASAPAPIVDRAAPL
                     EAASEPSTPTPSQHFEPPPLPARKKSWGLGWAWKNSGSEANNPDGNTANDDGDEVGSV
                     GAEKDDVSGPAIVTEAIEAAKADEAAEQAEKVSAELMDVESKGKEKEIVPIEGEEANG
                     PETIKEETEEAQKEHTEEQLNSTSSSPSLKLPGTLSRVNSSSTIPGSDVSFSTPKGES
                     LELMAEDAVAIAEVTEQSMNEGEAEEIKAEETKAEEAKPEELKEKEDGAEMINEDENQ
                     DEEKRKEEQFISLNTPTVDSAPIVDSSTTPMTAVNPPPVPKRAAARNKLSQLGGANGS
                     IASLGLITDEAKEDEKEEAKENEDVDEAIGVEGATKSSEPSESVTASDSSQFPPPPHH
                     PSIQPPALPPRNAPTQFAPPPRRRLPSQQPVPEGEEKKDKTYLSENAESWEDKTWKGV
                     VRLKENMWKARVGVVDEE"
     gene            226867..229349
                     /locus_tag="CNJ00780"
                     /old_locus_tag="CNJ00790"
                     /pseudo
                     /db_xref="GeneID:36393054"
     gene            complement(229258..233499)
                     /locus_tag="CNJ00800"
                     /db_xref="GeneID:3254311"
     mRNA            complement(join(229258..229528,229584..230352,
                     230404..232379,232432..232616,232665..232985,
                     233040..233157,233294..233339,233444..233499))
                     /locus_tag="CNJ00800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567460.1"
                     /db_xref="GeneID:3254311"
     CDS             complement(join(229461..229528,229584..230352,
                     230404..232379,232432..232616,232665..232985,
                     233040..233157,233294..233306))
                     /locus_tag="CNJ00800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567460.1"
                     /db_xref="GeneID:3254311"
                     /translation="MSTKAIREYDAKQLVSYWLNRSPTPIPCKTDTSFTAVQVAQVQW
                     DPATKQLSPPIKPGQGLPDWVFSSKLVGKPDQLIKRRGKAGLLCLNKGWEETGAWIEE
                     KAGKPVTVEKTTGTLNTFIIEPFCPHPAETEYYVCINSAREGDWILFTHEGGVDVGDV
                     DAKALKLLIAVGEEFPTRETIISTLLANVAPAKQDVLCDFLIRLYGVYVDLHFAYLEI
                     NPLVCLDAVDGKPAEIQYLDMAAKLDQTADFLCGPMWAVARDVSSTTTGATGIKADRG
                     PAMVWPAPFGRDLTKEEAYIQKLDASTGASLKLTVLNSEGRVWTMVAGGGASVVYSDA
                     IAAAGFAHELANYGEYSGAPTEGQTYEYAKTIVDLMTRGTPHPEGKVLIIGGGAANFS
                     DVAATFKGIIRALKEYKEGLVRHSVKIWVRRAGPNYQEGLKAMRLCGESLGVFMKVYG
                     PESPITAIVPMALGIERPPTAITRDVTPIPSAPVTPPNGAASGIANMANNVGAVKADG
                     SREQPNDQIVRFDTEPISGTRPWFRPFDEHTRSFVFGLQPRAIQGMLDFDFSCGRKVP
                     SVAAMIYPFGGHHIQKFYWGTKETLLPVYTSVGEAIKKHPDVDVVVNFASSRSVYAST
                     LEILSFPQIKAIGIIAEGVPERHARELLHLALKKQVIIIGPATVGGIKPGCFRIGNTG
                     GMMDNLIACKLYRPGSVGYVSKSGGMSNELNNILSYTTNGVYEGVAIGGDRYPGTSFI
                     DHLLRYEADPECKMLLLLGEVGGTEEYRVIEAVKKGIIKKPIIAWAIGTCAKMFTSEV
                     QFGHAGSMANSDMETADAKNRAMRAAGFIVPDTFEDLPDTLKAVYNQLVTKGAIVPKA
                     EIEPPQIPMDYQWASKLGLIRKPAAFISTISDERGQELMYAGMRISDVFKEEIGIGGV
                     ISLLWFKRRLPAYACKFIEMVLQLTADHGPAVSGAMNTIITARAGKDLISSLVAGLLT
                     IGDRFGGALDGAAAEFSNGLTSGQTPREFVDSMRKANKLIPGIGHKIKSKTNPDLRVV
                     LVVDFVRKHFPNHKTLDFALAVEDVTTQKSGSLILNVDGAIAASFCDLVSGCGAFTEE
                     EAQEYLKNGTLNGLFVLGRSIGFIGHYLDQRLLKQPLYRHPHDDIFYPSVERVVVQPG
                     KKA"
     gene            233844..237785
                     /locus_tag="CNJ00810"
                     /db_xref="GeneID:3254275"
     mRNA            join(233844..234082,234127..234265,234314..234579,
                     234626..234749,234803..235276,235326..235554,
                     235601..235702,235750..235997,236053..236149,
                     236198..236416,236473..236991,237041..237165,
                     237221..237403,237473..237785)
                     /locus_tag="CNJ00810"
                     /product="RNA polymerase III transcription factor,
                     putative"
                     /transcript_id="XM_024657928.1"
                     /db_xref="GeneID:3254275"
     CDS             join(233904..234082,234127..234265,234314..234579,
                     234626..234749,234803..235276,235326..235554,
                     235601..235702,235750..235997,236053..236149,
                     236198..236416,236473..236991,237041..237165,
                     237221..237403,237473..237586)
                     /locus_tag="CNJ00810"
                     /codon_start=1
                     /product="RNA polymerase III transcription factor,
                     putative"
                     /protein_id="XP_024513652.1"
                     /db_xref="GeneID:3254275"
                     /translation="MSADFAIDPALLDENVTGVSSPLQDLGTSDSDDLYGDSDNEYQD
                     SQPDEVGEPDSDVVFGRLAGLASKTASGKGKINNAEFQRELELADEEELPQSRRSGKA
                     PQKQPRRAHKPSHEVNYLLGQANGAYLVEDYDKAISSFLEVIRLDPYVPAAWVTLSSC
                     YKELGDEEKARQMRFLGAHVDDEGDLWRELAQEFREIGHLEQSVYCIRKALKCEPDQI
                     DLLWDLGAIYRIQGQKTRGCNVFRAMLQIEPELANNFEFISTFHPLLVSMNLRGLVAQ
                     TTRRGFDYQIATYPSPNQRPRVSDAPPPMTYENITTLIDDLLALEEYEDALVVVKQGQ
                     RWLQGRAEQKGWDTMDDDREYDPPGTIREEVESEGFEMDVGMRHRLALLRIKLDDAHE
                     ADIHIDHLLSLDVLTHYTYLQELGDALMTRDQWERALDCFGAVQECEELPDDPPLIYK
                     IGVCQWKMGDLDEALEALQWVASEVPDNLEAKLRIANVLEDMGRKAEALDIVTEVIRT
                     RGERGTLSSTIQMQPGVRVSKRMLEEQLRSQMQNLWADVQEAERGTMEGEEGALERFV
                     ESAGLLIENYRMDRSNFTKNRGMVRVLKSKKYKKTDVDDQAAEMQDRLERTLGLEEVD
                     DDNPYHVFRKTSFYGLSNEEWLTLVVKYCCVLMVRREEEVAMDILEHVVWSGLFHNRR
                     CEIALRLTIIACAMRLKAYDKIVDSARKLALRSQFLPQPFLIMLAAISTGGSAARAVF
                     TDTSLQNFINRDIRAYDEAVRNGDKGLHYLEGKGRWSANKGKTKGESKGGDGKKKGGK
                     KSKGKKKADAQIDPDLDEEEEAEDRVYGVEGEIGWGYKPVLPKKFSPYLNVILGQEML
                     ASKAFKGAIFYLTRAYELDPWNPFICLLIAQAYLGRAMTRQSDNKNYQIAQGMVFLSQ
                     YRKLSPASGPGMEEVEYNFGRAFHSIGVPHFAVKHYEKVLDSVQKRMDESMFPEEVRK
                     SSLAWEAAHNLMLLYSMAENMALVKEKSKWLAI"
     gene            238189..240404
                     /locus_tag="CNJ00820"
                     /db_xref="GeneID:3254278"
     mRNA            join(238189..238846,238900..239005,239056..239294,
                     239351..239640,239691..240404)
                     /locus_tag="CNJ00820"
                     /product="expressed protein"
                     /transcript_id="XM_567462.2"
                     /db_xref="GeneID:3254278"
     CDS             join(238241..238846,238900..239005,239056..239294,
                     239351..239640,239691..240051)
                     /locus_tag="CNJ00820"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567462.1"
                     /db_xref="GeneID:3254278"
                     /translation="MPSDTHRRSRFGNFASKFAPHSDPQRRSSHSGSLLSPLDPNSPQ
                     SGSKENYYGRPSSPTYSDQLSSNNHGQPQEVSYRIDDDLVPPVAPFAPQADSALSSRR
                     SSISFLADKDSLKNRASSLSLNYVPAKFTRLHAPGDYAHRRKQGGGRDAFASNAQRMG
                     QVGTVDDDEGVIFQISESGLKRKKPKLRWNRFKWVLFLANSVLFIYGMATLVCAILVW
                     LNIFYQSDVIRVGNRTELIISTVAASMITFTSLLGFAGIFLNNRTFLAIFTLLLWVDF
                     GLLVAPGYITYKQKTFNLEGKINSQWSRYLGTEGRLRIQDALRCCGYYSPFVEATVSP
                     LCYSRSNFPGCKSQYLRLERRVLGIWFTVSFAIVPAHLLIILAALLCSNHVTYRFGKG
                     LMPERYRLDLGSMAVIMDEYAGQIAAQYGPTVAQEAVERSSINLATPTPCRSEYDVSL
                     LSVPNSRRGSSSNLEAMRRGALPGSTRGVSLYDPSNPRASMDHRPESSFGGNTHIASG
                     SGSHNGSHQADESVASFSNDDHRRR"
     gene            complement(240309..243720)
                     /locus_tag="CNJ00830"
                     /db_xref="GeneID:3254037"
     mRNA            complement(join(240309..240691,240745..241872,
                     241968..242155,242512..243106,243270..243472,
                     243554..243720))
                     /locus_tag="CNJ00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657929.1"
                     /db_xref="GeneID:3254037"
     CDS             complement(join(240446..240691,240745..241872,
                     241968..242155,242512..243106,243270..243472,
                     243554..243689))
                     /locus_tag="CNJ00830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513653.1"
                     /db_xref="GeneID:3254037"
                     /translation="MADEEVDWGFDEQEDEWRGAGPAENDNAARADDDVISLEGAEDA
                     EDARRAASPGRKSNANGRQPPTGPSSKNPPTGPRRGRVDTRARPDSAGNATIVPSGPR
                     GDSRANIDDNKASTRNNGQANNVREDSPPLPPGWTAVMSKSHNRPFYYHKESNRTVWE
                     KPTLPVEQLQETEPLTPASQSEPAPAEIQRKAEIKQTEKRVPSGPAAQTAAAVAADTS
                     ANEGNRNIASAYARRNAAPHAPAPSSGSIGPNPPQQQQQQQQQQRRIRARSPPPHMRS
                     RLGPGHDDGNDPKRFKHEDGGRRTPPHAAPQGDYRRPAPMSYPSRGQVPQNVTPTGPA
                     AGRYDGPRDRYDRSGPAPLLSRGPIGPPPDARGFDRRHPESRPPPRAAAPDIVKGANS
                     APITNNRWGQSTGPTTPSTSTPLHSSLPSAPIPAPIGGGGGGRRDVRDHESDYNPRPY
                     PPPVTAPAPAPPAVSGAYDETPEAKRQRLREEARKAEEVLLKVKEEEARLEEEERRRA
                     EREREEKEREERGRVERERERLRQLDFERDRDFRERDFRERDMRDRDFDRRGPPPPLP
                     RGGERDRFDPIRRNEEDRRRPGDARMFPRDDRDGRERRRGPPGPGPDNLGPPSDYPEP
                     LSRGGGGSVPMRDRLGPRDRDQRNMRDRDMDRGGPPIRRPLSPPPFRRSPQPLRGPPG
                     RSPPPPFGGPGPFPPRDRDPRNRDYPLPPPGRGGDPGLAGPAPKDLLFRLGRRVDNQL
                     AEPMSAGAKFDRDDRRDRDRRGPPPGQGRPLAERMSAGSTPNGGKGGGRRRGRGGGNV
                     GAGGRSNGGNEGNGRGNGGSDGNDGGDEDGERR"
     gene            243856..244748
                     /locus_tag="CNJ00840"
                     /db_xref="GeneID:3254315"
     mRNA            join(243856..244022,244082..244167,244223..244748)
                     /locus_tag="CNJ00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657930.1"
                     /db_xref="GeneID:3254315"
     CDS             join(243929..244022,244082..244167,244223..244609)
                     /locus_tag="CNJ00840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513654.1"
                     /db_xref="GeneID:3254315"
                     /translation="MARIPEYLQPYLEKFPLQAGPLLTSVKDLSLSVGWCDLRIVPLS
                     GDASDWVVMVGHKRKEDPLRAVLPLPLHTTSLRPSVLKAIFKDLASIEVASLPEPISP
                     FAPTLDELREQLGQTQTSDDAGKLQEEQQESEKKEESERTEEGKPGEESEEFDRETIY
                     MAIVTGDSTVVYYKLSKGIKKPADIPDE"
     gene            244868..246623
                     /locus_tag="CNJ00850"
                     /db_xref="GeneID:3254239"
     mRNA            join(244868..245409,245461..245679,245739..246623)
                     /locus_tag="CNJ00850"
                     /product="glutathione synthase, putative"
                     /transcript_id="XM_567465.2"
                     /db_xref="GeneID:3254239"
     CDS             join(244910..245409,245461..245679,245739..246570)
                     /locus_tag="CNJ00850"
                     /codon_start=1
                     /product="glutathione synthase, putative"
                     /protein_id="XP_567465.1"
                     /db_xref="GeneID:3254239"
                     /translation="MSAATTLPQWPPALEDDQLQSLTLLASVWSLAHGFTLLPHAPAH
                     PPTSTIPAPLSLLPTPFPRQLYDLAVSLQPVYNALYARIALDWEFLDRVMGGSVSKVD
                     DFQGELWRGWKSVRDQLVQRKQLGLFRSDYLLHEQDGGLGIKQVEFNTIAASFGALSQ
                     RAGELHKYLAKASRNYYDISPQLSNPANYPANEPLKKLATGLAAGWKAFGDEQAVVLF
                     VVQDGERNVFDQTWLEFELLETHGIHSVRRTFSELSTLSLPSSSDLILPPSSQSSEPL
                     RVALIYYRSAYTPTDYPTEKEWTTRIVLEKSTAIKCPSMALQLAGAKKIQQVLTEDGV
                     LEDFLLGPERPDVGFGKGAGSLTKKDVDDLRSTWIGLYPMDNSALGQEANKLARQEPE
                     RFVLKPQREGGGNNIYRESIPPFLESLAATPVMEGEPDKKEGYILMELIQPPEKLENW
                     LVRGGEGKPRKGEVVSELGVYGVTLFGGEETLNERAGTLLRTKGRESDEGGVAIGISS
                     IDSPLLVD"
     gene            246922..252104
                     /locus_tag="CNJ00860"
                     /db_xref="GeneID:3254068"
     mRNA            join(246922..247052,247120..247226,247288..247378,
                     247446..247841,247892..247972,248022..248394,
                     248446..248594,248644..248708,248764..248859,
                     248912..249122,249179..249245,249295..249431,
                     249483..249814,249862..249982,250032..250202,
                     250257..250456,250504..250630,250686..250820,
                     250874..250925,250974..251130,251194..251305,
                     251359..251589,251639..252104)
                     /locus_tag="CNJ00860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567466.2"
                     /db_xref="GeneID:3254068"
     CDS             join(246954..247052,247120..247226,247288..247378,
                     247446..247841,247892..247972,248022..248394,
                     248446..248594,248644..248708,248764..248859,
                     248912..249122,249179..249245,249295..249431,
                     249483..249814,249862..249982,250032..250202,
                     250257..250456,250504..250630,250686..250820,
                     250874..250925,250974..251130,251194..251305,
                     251359..251589,251639..251968)
                     /locus_tag="CNJ00860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567466.1"
                     /db_xref="GeneID:3254068"
                     /translation="MAPRTSLAKLDFKEPLLQQGKRETSDALLKRLKTLRQKLAALEQ
                     DMTDTKSLDPIRKPLIQQTLLHHKDRGVKAYTACCLADLLRLYAPDAPYSDVQLRDIF
                     QFFLTQLQVNLRPSTSAPQNRPQAKSKATDASQTTLMQRITDIPYYTDYYYLIESLAT
                     IKSIVLICDVPGSEDLMDGYFNGFMEIARPDMNKTLMRYMRDVLVAIIEEASSLPAGV
                     MDCIIGQFEMYASKPETPSFQLTVDVCNEVADKLKRPFYAHFSEIQLAHGRDPSPNDL
                     KILSQSHDLLLTINRFCPDTLLNTVPLLEENLKAADEIPLRQLSTRTLGHLFAQRAGS
                     DDPAKRYPSTWRAWLLKKTDKAVQVRLSWVETTQQILVAHPEVRRELEDAMVGRFEDP
                     DEKVRVAICKVIGSLDYETALHHVRAKTLQVAGGRMLDKKSAVRAEAANALAKLYELA
                     YSEIEANNSEVVDQFAWIPQAMIAALFRGEATNEMRIQISTIFKTSIIPLPQDAEEEQ
                     AWVDRLLLISMHLDEDGMTGLKRMTNLIGYAQGNWPFSAFAGLLESYGGGENEQSEQI
                     KGPLNFCINMIARTVYGEPEKAKKDLLSFADISEPRLYKLYKTCVDITSSLSAIVKAR
                     NEFLRRVHQSHEDLLPTLTALVDMSAWNVLNHSSIPPLIRRLQRADSEDIASAAAQFL
                     GLMAKEGPPMYKSHVQKLVAAVADKKNDRLVEIGFQGLAAVCKIYPEVAPTDSRTIER
                     AINVAQEGTPRQAKFATRFLARSKDAASHCSKLIDAILKSVSKEVDGERQLTLLTALS
                     ELARSAPKTFERKSTEIIKYVMNEVLLKTSPSQEVDGDEWVPLETLEPLDHAKTIALR
                     VCTHWSLAFARDEDASALIRPTLTLLSAVLSNDGMINENTREGGPARCHMRLRASLCL
                     LKLAHVKTFDKIVSQPTTFELVGGTVQDPCYMVRHLWLKKLQAVLLPQRLLPRWNLMP
                     ALAAMDPDQDNVSLAKKILSAIPASCARLSSAERIERIEMPFARLLHLLTHHPDFEWH
                     EPGENEEDEKNKEGITSMQNLKDIARFIELYLDCLAHRDNVGLLFAIAGHLKAVRDRF
                     SDNNKPLYSLSELAQIIIRNRAEKHGWSVPVYPGKISMPRDIFHNAETPEERTKVLRT
                     QYLSEEVRGWARGLGRRAVAVPSVRRVTENNSSPRKRTKSSTKASRKKRRQSETSDED
                     SDASSSESEVESEIEVEDEPEQDGEEETVLGRGGKRGAKTKANRAVGKKARREKAEKK
                     KKDEEMDVDEGESEASE"
     gene            complement(251890..253251)
                     /locus_tag="CNJ00870"
                     /db_xref="GeneID:3254312"
     mRNA            complement(join(251890..252268,252319..252633,
                     252688..252718,252757..252764,252818..253251))
                     /locus_tag="CNJ00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657931.1"
                     /db_xref="GeneID:3254312"
     CDS             complement(join(252139..252268,252319..252633,
                     252688..252718,252757..252764,252818..253155))
                     /locus_tag="CNJ00870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513655.1"
                     /db_xref="GeneID:3254312"
                     /translation="MISATHGIESLQNTRGASSTSHAPSLAPRDIEPPPPIPPRPGSP
                     ASANSVTKEPSQSRSVPSQPKGKEREVPELPTETIKDGKGEKLFYRTFRGEEKDLENI
                     MKLVEEELSEPYNVYTYRYFLFDWPHLTFLVFPSPTSTRAIATIICKQDMHRGTNRGY
                     IGMLSVAKDYRRRGIGRRLVEIAVEEMAKRGAKQVMLETEYDNETSLALYDKLGFLRE
                     KRLHRFYSNEKDAFRLILPIDTEDEHDEVLSQQLERTGPGLGHIDEEDEMSPYFT"
     gene            253444..255643
                     /locus_tag="CNJ00880"
                     /db_xref="GeneID:3254340"
     mRNA            join(253444..253617,253678..253792,253850..253918,
                     253970..254093,254144..254288,254347..254502,
                     254555..254790,254843..254978,255028..255090,
                     255155..255643)
                     /locus_tag="CNJ00880"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /transcript_id="XM_567468.2"
                     /db_xref="GeneID:3254340"
     CDS             join(253535..253617,253678..253792,253850..253918,
                     253970..254093,254144..254288,254347..254502,
                     254555..254790,254843..254978,255028..255090,
                     255155..255500)
                     /locus_tag="CNJ00880"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /protein_id="XP_567468.1"
                     /db_xref="GeneID:3254340"
                     /translation="MATPPVLIIDNGAYEIKAGISGVDWEPRVLPNSIARSRTEKRVY
                     VGDEIDNCKDLSGIVYRRPFEKGMLVNWDAERIIWDRLFSPSVLNINPTETSLLVTEP
                     YFNLPNIAETYDQMIFEEFEFQSYFRCAPAALIPYGGLYESDQGIPPQCTIVIDMGYS
                     YTHVVPIRDGQIVWEHVKRIDVGGKLLTNHLKHLISFRQWNMIDQTHVVNSVREACGY
                     VSLNWKGDLETCKAKPRKNPIIQEYVLPDFSANSTSRTGYIRSGPNAAPPEETNGTGE
                     VNGKQKPEEEEQVLWMGNERFAGPELLFHPSDIGLKQTGLPETIAYVISQMPEELRGM
                     FWAHIGIIGGLGNIENLGERLERDLQALCPVEYEIGIYEAFDPASLAYTSATALTSSE
                     VYMSTYPVTRTEYFEQGSSLCRRKFGSFGAPAYNIDPPGFSSGVDARTEVSDDEMEMR
                     YAMGLESKKGGKGKRRKEEEEVTSGNWGGRRRRTTGLGGF"
     gene            255691..257473
                     /locus_tag="CNJ00890"
                     /db_xref="GeneID:3254261"
     mRNA            join(255691..256037,256137..256197,256253..256304,
                     256357..256411,256476..256563,256614..256767,
                     256818..257069,257124..257137,257190..257260,
                     257320..257473)
                     /locus_tag="CNJ00890"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_567469.2"
                     /db_xref="GeneID:3254261"
     CDS             join(255846..256037,256137..256197,256253..256304,
                     256357..256411,256476..256563,256614..256767,
                     256818..257069,257124..257137,257190..257260,
                     257320..257328)
                     /locus_tag="CNJ00890"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_567469.1"
                     /db_xref="GeneID:3254261"
                     /translation="MSQRIHLNPNVPRQSPMMGGIGGGYAPDPISRPTETQRFSDNEM
                     LANIQKWSSKVEDVIETYTQPIRPYVPALARFLIVVTFLEDALRILTQWGDQLWYLQK
                     HRHFPWGISHLFLLINVVAMLAGSFGVISKRYPEYSVFCLLGVVATQGIGYGLLFDLS
                     FFLRNLSVVGGLLMVLSDSLQKNKKLFAGLPTLSETDRRKYFQLAGRILLIFLFIGFV
                     FQGNWSFARVIVSIVGLGACVMVAVGFKAKWSASFLVALLSIFNVFINNWWSVHAAHP
                     QRDFLKYDFFQTLSIVGGLLLLVNIGPGGFSMDEKKKVY"
     gene            complement(257379..259188)
                     /locus_tag="CNJ00900"
                     /db_xref="GeneID:3254118"
     mRNA            complement(join(257379..257599,257655..257840,
                     257900..258268,258323..258388,258443..258721,
                     258778..258861,258922..259188))
                     /locus_tag="CNJ00900"
                     /product="enoyl reductase, putative"
                     /transcript_id="XM_567470.2"
                     /db_xref="GeneID:3254118"
     CDS             complement(join(257552..257599,257655..257840,
                     257900..258268,258323..258388,258443..258721,
                     258778..258861,258922..258972))
                     /locus_tag="CNJ00900"
                     /codon_start=1
                     /product="enoyl reductase, putative"
                     /protein_id="XP_567470.1"
                     /db_xref="GeneID:3254118"
                     /translation="MSVPQIPQTMRAWVQTEDNTLAIKEIPVPQPKANQVLIKVEYAA
                     QNPTDWKHAEFLSLPGVINGCDYAGTIVKVGSDLKTPLKVGDKVAGTVHGGYFKDEGS
                     YADYAAVDSNMCFVVPEGMKLEDAATFGVAWVTACQTVIQRQGKAFPPGDTKVSGNPW
                     YIVYGASTSVGLFAIQVAKSLGYKVLGVCSPHSFDLAKSYGADATISYRDQEKAIAEA
                     LKITEGGVEYALDTISEGDTFKVTIGMMGKKGKQLNCILAVPDEVKQINPGLRIEWSV
                     MYTLFGADFIFTPRIPNSEVWPASKEDRAFGEEIFAKTPELITKFGIKPNPVVIAGGF
                     EDVVKAFDALKNGEVSGKKQVIKISA"
     gene            complement(259639..260797)
                     /locus_tag="CNJ00905"
                     /db_xref="GeneID:36393055"
     mRNA            complement(join(259639..260177,260234..260797))
                     /locus_tag="CNJ00905"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658757.1"
                     /db_xref="GeneID:36393055"
     CDS             complement(join(259755..260177,260234..260743))
                     /locus_tag="CNJ00905"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514438.1"
                     /db_xref="GeneID:36393055"
                     /translation="MRYPFTSPPPVTNYPFSSSPLNPYTHPHSFSNVCPSMPASSSSP
                     PHSSPTPCSRQLPHPAPLFRSSPVSGKSKLLTRFQRSARKSLPSSLTAGPSDLGTRDT
                     DLFSEGTTPLEGAMWRERFSRRMEERERRRKARDANLNRRRGIDGLGLSGVTLDEDEA
                     ERKAQEDDEEIFRRIVILQRKKANHAALVSEEQETGGSDPNLPEFWEEELETMKNEER
                     ELLRKLDQHVEDGPWNERSEIEEDIWAREAAEAEEVEREAEMAKMMEDFERNALLGMP
                     SHQHSQPSQKQQHHFIGDVDMDVDWNRIDSIDTE"
     gene            complement(261033..262515)
                     /locus_tag="CNJ00910"
                     /db_xref="GeneID:3254057"
     mRNA            complement(join(261033..261216,261266..261385,
                     261443..261758,261815..261852,261907..261939,
                     261999..262075,262138..262515))
                     /locus_tag="CNJ00910"
                     /product="transport-related protein, putative"
                     /transcript_id="XM_567471.2"
                     /db_xref="GeneID:3254057"
     CDS             complement(join(261141..261216,261266..261385,
                     261443..261758,261815..261852,261907..261939,
                     261999..262075,262138..262341))
                     /locus_tag="CNJ00910"
                     /codon_start=1
                     /product="transport-related protein, putative"
                     /protein_id="XP_567471.1"
                     /db_xref="GeneID:3254057"
                     /translation="MASPLLPLSGSSHPSSTGGDSRRWDLSGGAGFGGSRNMGLGIEM
                     DTGLGTGRGGLSTQLKRLTKFRSMDFELAFWQLTYLVVAPRRVYKQTYHHKQTKNQWA
                     RDDPAMLILIAGCLAAAGVAWSLVYRLPFSNLITLPLLMIFRDFLLSSLAVATILYFL
                     SNRLLLAPSVPHASASDNRVEFAYAFDVAVNSFFPMFLTVYVGLLPLAVLVVRDNWVC
                     LWAGNTLFLIAQVQYVYVTYLGYAALPFVARSQILLSPLLPIFGGYLLSLLGFNTAKH
                     ALELYFRQSWK"
     gene            complement(262888..267539)
                     /locus_tag="CNJ00920"
                     /db_xref="GeneID:3254211"
     mRNA            complement(join(262888..263398,263451..264541,
                     264588..266011,266078..266157,266222..266234,
                     266441..267539))
                     /locus_tag="CNJ00920"
                     /product="Rab family GTP-binding protein, putative"
                     /transcript_id="XM_024657932.1"
                     /db_xref="GeneID:3254211"
     CDS             complement(join(263235..263398,263451..264541,
                     264588..265924))
                     /locus_tag="CNJ00920"
                     /codon_start=1
                     /product="Rab family GTP-binding protein, putative"
                     /protein_id="XP_024513656.1"
                     /db_xref="GeneID:3254211"
                     /translation="MSVLATPLPHRPFSDTELFTSSSGSVPAHAELPPVPPHIALPIP
                     LPPQGTSFSTFQQRHTSSYPMPQQQTFSALGPAQPDVVPTNAIMPHAETSPSAPQGSA
                     VGLADLTPDIHPQTPLPPTPEPSPPRRKVLGPTMMIKLAPPADDHSYHRYDVLGTEAE
                     PSSVHSGESSGSTSTTPRRLPTLSIDIESFDSSPSHRTPSPKLGTSSGTPSQARVKSS
                     SSTDPKPPRPKSMGPPPRPRRSQTAYPHGPVSVRMAESRSADSRERKLRATSVLRASS
                     YSQVRSGSPGPSRAFSDAGSGSVTPRAFSASDLALPDLGGPDGLEAKVVLLGSQGVGK
                     TSLILRYTTRTFSVTPAPATIGSSLHTRKLVHSGVRVKLQIWDTAGQERFRSMAPIYY
                     RGAHVCVLVYDISDKQSFEDVRSWLEELGRSVPKETVIFVAGAKIDLNDRREVEFDFA
                     KEMIRSWISPPSPPPPVLTPMTSPPQRSLFRSSTSTSRIDSPSPTPTISRAPSTRIHS
                     YSSHITEPTLRSAPISSSSRHSADSPRPLASVPFPSPKDIPVSPEKSKAKEIANEKRS
                     RRHSAKPFPVKVTNSASTSLATSPSRLEFPTLQSPTGPTSATFTEPVGPLLASPTSSP
                     GHRSSGGRFSISGISEVLGLNRTVSMSGAISSLHQLTEAPSPPPLQTSSPGSSSFNPP
                     QLPSSPRTRVESSPLFPSYGSDRNARRKSDEWSRGGWKMGEGPGVAEALGEFGAGVKR
                     RESEELLGGTNRSLPVLGNPSYKVNQVRSRAGSLGRDPRLIGELEEVEDEWGVQVENV
                     RLGECSALTGEGVEKLFKAISSILVERKDKIERERVLRHKDSVILVDPSTNPRGLDKE
                     KKSGCCV"
     gene            complement(267788..270063)
                     /locus_tag="CNJ00925"
                     /db_xref="GeneID:36393056"
     mRNA            complement(join(267788..268066,268169..268519,
                     268573..268856,268913..269141,269193..269484,
                     269538..269593,269642..269667,269726..270063))
                     /locus_tag="CNJ00925"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658758.1"
                     /db_xref="GeneID:36393056"
     CDS             complement(join(267926..268066,268169..268519,
                     268573..268856,268913..269141,269193..269484,
                     269538..269593,269642..269667,269726..269852))
                     /locus_tag="CNJ00925"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514439.1"
                     /db_xref="GeneID:36393056"
                     /translation="MHSATMKASPTILCPYGYSHGTCGYCSPPGERSRKKESSKYGMV
                     AKQLSPQYYQMLMDRGWRRSGTYVYHPDMASTCCPQYTIRLDAFNFKSNKKQNQVVNR
                     FNRYLEQGVKPGEQMVAERQKESSKGAKGKVGKGRANGGGRDIVSEVHEFEVGYGREN
                     DAVHRFETQIVPAKATEEAFKMYKTYQISVHHDKPEDVTMKGFDRFLCSGPLIVTPIK
                     YEDEETGRKGVQEGRLPENYGPYHLLYKVDGQLIAISVLDITPLGVSSVYCIWNPDWA
                     WASLGKLTALYEINLARRLGAAGAGKEFSGTGMKWVYMGYWVPNCQKMKYKSEYAPSY
                     LLDPGTNEFHELTRDLEMYLVNHPRGYFPFKDIEAEVKKSQTKKLNVPSAPKSPIVAT
                     SNEVGPDGDQDSDEEGEPGYLPTPPPPGFADPATISEKEVDEVLVLLSLRKSHFGGKQ
                     LFQISELEFVDSYYVRETVRQMLAAVGKEWIANERDRVTGIAAEKGIMFLG"
     gene            270376..271348
                     /locus_tag="CNJ00930"
                     /db_xref="GeneID:3254058"
     mRNA            join(270376..271190,271251..271348)
                     /locus_tag="CNJ00930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657933.1"
                     /db_xref="GeneID:3254058"
     CDS             join(270445..271190,271251..271272)
                     /locus_tag="CNJ00930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513657.1"
                     /db_xref="GeneID:3254058"
                     /translation="MSTPRKIAVILGTGPGLATSIASLLTPTHSLVLLSRSLPGSLSS
                     LPLPKIDPSNILALSSDGSPDSLKIAFEEMDKKWPSARVDVGIYNVNAKFDLRGFLEK
                     SEADLRTGLEAGVVTGWNFAQAIIPRFLANPAPSTLSSQDKASREARGTLLFTGATMS
                     LKAGVQFSSLAPGMFARRALAQSLAREFSPQGVHVAHVIIDGVMDTPPVQQWLGEDTE
                     GKRIRTDEAAQVYLDLINQKKSAWTHEIDLRPDIEKW"
     gene            complement(271302..274004)
                     /locus_tag="CNJ00940"
                     /db_xref="GeneID:3254284"
     mRNA            complement(join(271302..272536,272590..272969,
                     273034..273208,273286..274004))
                     /locus_tag="CNJ00940"
                     /product="expressed protein"
                     /transcript_id="XM_024657934.1"
                     /db_xref="GeneID:3254284"
     CDS             complement(join(271532..272536,272590..272969,
                     273034..273208,273286..273690))
                     /locus_tag="CNJ00940"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513658.1"
                     /db_xref="GeneID:3254284"
                     /translation="MRALRLLTPLALLIPPSVAETSTPNTGDQIQAFQFAFTSSNLVL
                     PITYTCPTPLTLTKISSTSAQTSDPSAPYTLVALVHEQLYDGAGTQYERVYSASLDMG
                     DMSTEQTISHPWGNGTQFIACMWAANGVSGGCQDLYTVVPSELTAESYEDESSTCRTP
                     DVLGSWVTPASETLDVTVEGVSGDIAINAWPPACSDLRFSPNNGTAPYTLIIAPAAHP
                     PVNITSADGSSVNYTVRLTHGQAFMAAMYDSEGNSWVYGPLHSGQSDDLSCLAVATGQ
                     EESKTKSGYGVAILAGSIAGAFVLGAIGAGLVMWCLGRRSGPMTSPSTEDLYANPRPA
                     SYRTASGSIFGKPLNANSTPPMDFDTPSTLYDPHLPGPSGAYPQPKLSPILNRESPNS
                     ASTSSRDRAFPRSSVGQDNVGEYINPYDLPSGYRDSISMADFRPLGSQASENTARSAT
                     HMSPTGSGDRSSHIQETSWNSRCSMPLPPTVQSPTPPSGSHRRYSSFSPRPGSYHSLN
                     SPGAEDSGSSPTPGTTPTSRMRNVYVVHSDAGDADVTIRLPDGHNHVVELPPTYRETP
                     SPASARDSYNHGDHSPALSGRHSIPSMLPPLKRHGSSWESDMASPPRPNALELTRTRV
                     SGFSIGSGTGEEELRARAEAAMKEKERLLS"
     gene            274379..276891
                     /locus_tag="CNJ00950"
                     /db_xref="GeneID:3254106"
     mRNA            join(274379..274508,274569..274632,274717..274805,
                     274860..274932,274981..275232,275295..275586,
                     275636..276070,276122..276324,276381..276889)
                     /locus_tag="CNJ00950"
                     /product="pyruvate decarboxylase, putative"
                     /transcript_id="XM_567475.2"
                     /db_xref="GeneID:3254106"
     CDS             join(274402..274508,274569..274632,274717..274805,
                     274860..274932,274981..275232,275295..275586,
                     275636..276070,276122..276324,276381..276737)
                     /locus_tag="CNJ00950"
                     /codon_start=1
                     /product="pyruvate decarboxylase, putative"
                     /protein_id="XP_567475.2"
                     /db_xref="GeneID:3254106"
                     /translation="MSDNEQVAFFTYILERLKQCGVKQIFGVPGDFNLTALDYIEKDP
                     ELQWVGNANELNAAYASDGYARVKGTLAVVITTFGVGELSALCGIAGCLSERVPVLHI
                     VGAPSTSLQAKQSLLHHTLNLPESFSTFSSMSAPLSCSQALINNIEPKTPTSWTEAFD
                     KTLKAVLEQCRPGYVEVPTDAVHAKVSAEGLKQPLPPPHSAPPPESMGTSLSNTSASA
                     ASRGAAQVSLSTAPTNVPSAPSSDDVTAHVVEDITKRFGEAKKPIILVDACAGRFGMA
                     IEVRKLVDACGIRFFETPMGKSLMDERHPLYGGCYAGANSLPTVQKEVESADFVLYVG
                     ALKSDFNSGSFSVNIDPKVIVELHSFTTTIGYASYPTTDIRTILPLLRPAFEKLGRGK
                     QSEGQSVEQKVEDKSVDSPVVPDPKGDEIKHEWLWPRVGKWFQDTDIIITETGTSSFG
                     LTNVVLPSNSTYIAQILWGAIGWSVGACLGAAMAAKENGNNRRTVLFVGDGSLQLTLQ
                     EIGTMLRRGVHPYIFVLNNDGYEIERQIHGWTAEYNDIQLYDHQLLLPFLAGKKTKTP
                     YQSYAVHTPQEFSKLLDDEEFNKPDRLRLIEVFMPRGDAPAGLIRQAKLTAEANDRI"
     gene            276890..281964
                     /locus_tag="CNJ00960"
                     /pseudo
                     /db_xref="GeneID:36393057"
     gene            complement(277187..285336)
                     /locus_tag="CNJ00965"
                     /db_xref="GeneID:36393058"
     mRNA            complement(join(277187..280971,281029..281631,
                     281681..281740,281801..281944,282009..283902,
                     283951..285336))
                     /locus_tag="CNJ00965"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658759.1"
                     /db_xref="GeneID:36393058"
     CDS             complement(join(277247..280971,281029..281631,
                     281681..281740,281801..281944,282009..283902,
                     283951..285138))
                     /locus_tag="CNJ00965"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514440.1"
                     /db_xref="GeneID:36393058"
                     /translation="MASPDTAAREAITIVSVLALLFIASIFTFVIGGRRKNNQLDVPD
                     KGSSQTGDGSPDDRRKSRDAKNNRSEEEDRSSRGKKPKKERRDDKSRKKDEERWGDRD
                     EGGTRGDGGRRVGGEEGSGDGGDHGVRRHGGSSTTPDSSDLSSAYTVGGGGNDNLPPG
                     PPGTRAGTMKDVFRIADDLKLTVQSNPDDRYRIRTIYNVDSDDWAPGGGSWPRQGDGP
                     GGGAEAIRIPFTSMGPATPLTPGFVPAFDLPPTTPGPFWQTERTPNTPVMTPVSAYPP
                     VTATLQHVYPVLVSDVSEDGLDPWAYTSAAPAKTTFTAEELGWYKQRKEATKPETLSD
                     ELRAPGLDETLGPGLDPGNKYASTMFGHLGRTRTANVGDITVGSPRMETSGAWGEAPL
                     MSPINLNPIYVRDPKDRSDDQIPILLSPLKAPNKVNQIRKGGVDLEEKMKADDRKHSK
                     VTIPPLPIKIPMTSKVRFEEVSSRPTTSFDIEEVDEARWMKKNDSDSKVKIRNVKKKE
                     TANEQEQEEEKNEVKAAFEDEDIVEDEKPKGKPKKKEKIEKTAEKKENSTEKVKKSEE
                     VEILVGDPKTGKTVKKKIEKEIEESEDEKVEAKNSSKKNKEKNNNRTEGEVPKRTNRK
                     EKKKENRKQLSGDETEEKEEEEGEEEEDGENDKNGKKQNKKLVKKKKTKKENKRAAEE
                     EAKNRERKRSMERGDEVVEDQAQDESSEEAVYEKYTDSNGKKRLRRVPIDTTRIKRKP
                     KKNKQRMADAGQYNEYIDDEEEMDEVQEAARVKKTKASKQQQPRQETRQGRIFHDEQY
                     FQDTAPINLATSDQINQMQPFRRQRSYNKELLQTRLEDIEDEYDNPNLTTNERRDIAS
                     RRLRMLSNHKAAEKEADELQRLMAEGGRGDVGDPPDEVTRERKSLREKIKEKFDKTEE
                     AKREDAQTDESNIRLRTEKEEIALEDNVRVTAEVRQPTKPQKTSTLHDQDTHAPVLEL
                     ASTNADDRKPDASPLAASTEKLREDESQEKPKERKIDPRLDLLASRRPGQVADPRQPI
                     QAPRALAPSARSMEELEANRLHLRERRHPKKEETREETEAEEKDQVDETNEGEGLHTL
                     RSETGSHVTSHPDPENPAEVAGLATRREVGPPVSTPEQESDESQSVAHSQRISDNTAQ
                     EPEIEIEKIQPPIVGVQLQRWMTQDEETETELTTAEAAKRAALERRAHWERERETAGE
                     STNLTQLPSESEAVESHSRELLDLNNVRLPSAEDRQVEEAVMNDDHQSQIITARKSIE
                     LQPPSANSDHQIVTRSHAVARRQTPLTVAPNALQNISDHRLLADHYESTGQEIETHQQ
                     TDYLPAAIRAEHEFDGADEEMLTKSGMVIEGKKRPMAIVNSASFNETENGQAIGSDLV
                     QPNSRAGERQVQVLDSDSITERGTGTVGPQSIASLKARQQEPLVGNKQVQMDSQPSSD
                     IARQIPDVDRHRPVFDLTDLSEEQIAEYELTGSLPPALRADYDLEEHSDGGPATTSVQ
                     LGIRSGRRRQAAFGSTSHGEKEEMTESQIVPSNRAPSQPAPERPVIDSMSLHDRQTIE
                     ERSSQLVPSSTGALLGRVRERERPALSSVPHESSDSEEEAEVDGNALVRSKDLLRERE
                     RPQLDSVPFEERERIEETGTDFERAKAARRRLESVSGPRTLDFMSYEDRQGPASDNPS
                     FLGETDTYDEIDVEHLTNERRQRLLAETAHYLDESGHEESGERIMEETTKMDMKPFNF
                     SQDDVESERMADTDIVRATMPRSPKKLADPISPDQDNVVVPRQRAVPTRIVTNKPIDN
                     DGESIPPLSGSTAINSSDEEEFADQTHAQMINIKNMEADQTVAIKNALADNPALAHEY
                     QEARLRQRNEDDIQINHRKEYARRQKNKGADDSDRDAEDLGRIPFGYEPDNTNDIVSI
                     HITSDEDTHEPASQQPSRQPPLQLSPRQQPSPEQGTDSPDPLRSPVEITSSENENEVS
                     TESTDRTPAEVARDHWKNQSDRERQQRANEDQAQKPSTHEAGSDQQSDDEPAAADSQS
                     QEKKADSTEGQRPPLAPPSRTGDELSSPKTQPDRQHETDQKRKKHRRFGHEDRRGRKE
                     NLDEEIIPEMSKKELREQRLEDMAKGREADEKRENERDEVKHRDAKSKENGKKRDGDQ
                     GSGGGRAKEGKITGDEKKDSINRALYNSRIALGPVTLVKASWHILKIAPVWSFFVVAT
                     LALYIEVSRQLFEMLSVAAGTAVLTKRAISNSTPVDLSVTQSWFSDLVKNLSFEPTAF
                     FAFISMWSIICIPMMGLLIHKTLSVAAEPKGTNYWKHMWQDFKEYGRGSLRVLIMGRH
                     FSTPRVFWRRSTRWTYLRILIFSIQLVGAVLIIRQMMSLIYIVGTGSSTSFSSLPDVA
                     SSQKSMKEVAESLDAEGAFAIVNFLFFLFLLTIAGSWYALLHPRIRSLSKRSSSETTD
                     KESNSGRQGRYHLPGVRTSLKWLFILVVVVTFTASLLYFRDIASYITKQSGDSANGNM
                     MILGVNCIFMSLMAAMGYVVYELDKIWVGQLKEKFVKTSGKGFRLSGCWRDKDESMA"
     gene            complement(285392..289572)
                     /locus_tag="CNJ00970"
                     /db_xref="GeneID:3254234"
     mRNA            complement(join(285392..285546,285599..285861,
                     285922..286077,286135..286775,286832..287112,
                     287161..287279,287333..287800,287848..287919,
                     287970..288417,288466..288533,288584..288654,
                     288702..288805,288860..288971,289024..289178,
                     289232..289349,289413..289572))
                     /locus_tag="CNJ00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_567476.2"
                     /db_xref="GeneID:3254234"
     CDS             complement(join(285541..285546,285599..285861,
                     285922..286077,286135..286775,286832..287112,
                     287161..287279,287333..287800,287848..287919,
                     287970..288417,288466..288533,288584..288654,
                     288702..288805,288860..288971,289024..289178,
                     289232..289349,289413..289498))
                     /locus_tag="CNJ00970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567476.1"
                     /db_xref="GeneID:3254234"
                     /translation="MAEPSPDAILSVPCHLSGVTRLCFSLDGTTIFTGGSDCLVRIHE
                     AGNPESEPGFHDEHTEAVTCLACSKDELVTGCVDNIVRQFSYPENKFTGFVTRSSGVP
                     IRWLSVDKAGERVAVCSDDMVVKIVNLKDTTKVSLVSDNNKPVRSATWDPTGKYLTTT
                     SCDGKLKVYDTSGSTPYCVKVFEGVIAASDSDSDTSCYAQWHPSGNYFAVPTRTNDIA
                     VFGRDGWGRQSSYTPDGPKALIGELAWSPNGKYLAVAAATNLYIFSSETRQPIGSYTC
                     PDGAISGLQFSPNANLLGFTSLDGSFHRWMEPIPSELPDPYTSEAAQAKKLEKLLDDD
                     FPDDDDDIEERGEDIGDEDIFGDDNWIVDDDGNLGGYGGDDDEKKWGKGRTEVVNVTK
                     AQAPFTPGSTSFRNKKRYLAFNMIGVIDVTDQETHNVINVEFHDKSARRGYHFQDHNK
                     FTLASLGEQGIVYACPAEGDQPSLVYYRPYDSWTSQSDWTLNLLPGENVVCVTAGGPA
                     NPETGMGSVVVATSKGWVRFLSASGIQKYMWRLGEEVVSMAAGVDRVLIAHREGGTSL
                     DGCQNLRYTLLDLESYDIVQEGKIPLPKKTTLTWLGFTSDGAPAVFDTSGLLSILDRH
                     RRPNQGRWVPLLDTTSLARDGRKEGYWPVGVSATHLSCVLLKGLETEPSFPKPLIQEV
                     ELHMPMLNMDNQQGKLEESYVRGSVNLSNLADSSDPDAPYVLKETELAMDKEMLQLVQ
                     GACKADNLQRALDVARLMHHSATIEAAAKVAAFYHLPGLQERIQSVKGEKEKEKREKK
                     REATRAPERSYRYSSPPPEKAASREFTDFAPRTTNRRSFAGAGAGVNRDSTPAASGPP
                     STFIPETPGLEVDTAPAPGLHEDTALSDMKRKKDMEIDDFAMPRSKKRGSDFSFDKPT
                     GAAKNPFASRKSNVPASNPFAKGSTGGKPLDAIKSTSFFDRVDDLESNGAPKPKKTKA
                     KKEKIAEGAISGAGGKQTTLFGAGIMKKTASSKSVNGTPIESESDRDTETLVPETLLE
                     EMQETPAVEEDETQEDETQTEETRD"
     gene            289753..290482
                     /locus_tag="CNJ00980"
                     /db_xref="GeneID:3254306"
     mRNA            join(289753..289944,290005..290230,290290..290482)
                     /locus_tag="CNJ00980"
                     /product="60s ribosomal protein l37, mitochondrial
                     precursor (yml37), putative"
                     /transcript_id="XM_567477.2"
                     /db_xref="GeneID:3254306"
     CDS             join(289758..289944,290005..290230,290290..290338)
                     /locus_tag="CNJ00980"
                     /codon_start=1
                     /product="60s ribosomal protein l37, mitochondrial
                     precursor (yml37), putative"
                     /protein_id="XP_567477.2"
                     /db_xref="GeneID:3254306"
                     /translation="MNFTSYTVSDRLFAYIPRKHRMIALRPLTNLTSRRSIQVARIGA
                     VSFSSSSSCASPKTKSGRAVVSSCPAGTPLTNLSVLKDKPDPVALPDDQYPAWLWTLL
                     EDNSKAHKAEENAVHLTQEGESGFNMQAEKKKLKNLNRQNIKAANYLKSTA"
     gene            complement(290529..291399)
                     /locus_tag="CNJ00990"
                     /db_xref="GeneID:3254132"
     mRNA            complement(join(290529..290717,290786..290944,
                     291051..291273,291329..291399))
                     /locus_tag="CNJ00990"
                     /product="expressed protein"
                     /transcript_id="XM_567478.2"
                     /db_xref="GeneID:3254132"
     CDS             complement(join(290583..290717,290786..290944,
                     291051..291273,291329..291354))
                     /locus_tag="CNJ00990"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567478.1"
                     /db_xref="GeneID:3254132"
                     /translation="MRGLRQAILHPLLTVFLACFVLITVSAAKEPPPKYIYTNRSLLV
                     EENHLEKRTPAKKPEYVAHKAGDLTCRPFGECSPCPKDELDQAFCLPFGNRRLLHCIP
                     AYANTSISQQGEVPAWEACGKVVKKEAQDFYEFVTANLLFLIVALSILWARTSALAAE
                     QYRQLAARIGIPGGNWVRVG"
     gene            291571..293271
                     /locus_tag="CNJ01000"
                     /db_xref="GeneID:3254171"
     mRNA            join(291571..291736,291798..291900,291989..292108,
                     292169..292755,292806..293034,293092..293271)
                     /locus_tag="CNJ01000"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_567479.2"
                     /db_xref="GeneID:3254171"
     CDS             join(291674..291736,291798..291900,291989..292108,
                     292169..292755,292806..293034,293092..293213)
                     /locus_tag="CNJ01000"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_567479.1"
                     /db_xref="GeneID:3254171"
                     /translation="MAVATQKMPKAPTSAPGGSIKTYYQNKIEAAELDITRKTQNLRR
                     LEAQRNALNARVRLLREELQVLQEPGSYVGEVIKVMGKKKVLVKVQPEGKYVVDFSPD
                     IPISALTPNIRVSLRADSYLLHSILPNKIDPLVSLMMVEKVPDSTYEMVGGLDKQIKE
                     IKEVIELPVKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCRFIRVSGSE
                     LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGGSRGEGAGKSGDSEVQRTMME
                     LLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNPEARITILKIHS
                     RKMSLQRGINFRSLAEKMGNCSGAEVRGICTEAGMYALRERRQYVGQEDFEMAIAKVL
                     KKNADNNMSVNKLFS"
     gene            complement(293230..294150)
                     /locus_tag="CNJ01010"
                     /db_xref="GeneID:3254344"
     mRNA            complement(join(293230..293630,293739..293867,
                     293973..294150))
                     /locus_tag="CNJ01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657935.1"
                     /db_xref="GeneID:3254344"
     CDS             complement(join(293393..293630,293739..293867,
                     293973..294013))
                     /locus_tag="CNJ01010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513659.1"
                     /db_xref="GeneID:3254344"
                     /translation="MSQPGELADQWHTVTLKIPFHTSEHAVIARRALDVDREQNGSLV
                     RREMNVEGDVLVVNYATTSVRLLRLSTNSFLSSADLVLRTMSSFAPDPSDRIPTDEEL
                     EELRQEANRNTGVGRGIELKGDGKGAGSGEEVR"
     gene            294160..295287
                     /locus_tag="CNJ01020"
                     /db_xref="GeneID:3254214"
     mRNA            join(294160..294246,294347..294428,294517..294742,
                     294798..294878,294927..294952,295014..295287)
                     /locus_tag="CNJ01020"
                     /product="E2 ubiquitin-conjugating enzyme, putative"
                     /transcript_id="XM_567481.2"
                     /db_xref="GeneID:3254214"
     CDS             join(294238..294246,294347..294428,294517..294742,
                     294798..294878,294927..294952,295014..295123)
                     /locus_tag="CNJ01020"
                     /codon_start=1
                     /product="E2 ubiquitin-conjugating enzyme, putative"
                     /protein_id="XP_567481.1"
                     /db_xref="GeneID:3254214"
                     /translation="MIKLWSVKKNEEAAAKKRPKVTAAQLRIQKDLTELDLPSTMKTV
                     FPDPNDVLNFKLTITPDEGIYKGGVFTFSFVINPNYPHEPPKVKCLEKIYHPNLDLEG
                     NVCLNILREDWKPVLTLSSVMIGIQYLFLEPNPDDPLNKDAAEDFRRNRESFIHNVKT
                     AMRGGSIRGESFDRVLP"
     gene            complement(295255..296672)
                     /locus_tag="CNJ01030"
                     /db_xref="GeneID:3254080"
     mRNA            complement(join(295255..295664,295720..296157,
                     296222..296672))
                     /locus_tag="CNJ01030"
                     /product="mitochondrial matrix protein import-related
                     protein, putative"
                     /transcript_id="XM_567482.2"
                     /db_xref="GeneID:3254080"
     CDS             complement(join(295359..295664,295720..296157,
                     296222..296659))
                     /locus_tag="CNJ01030"
                     /codon_start=1
                     /product="mitochondrial matrix protein import-related
                     protein, putative"
                     /protein_id="XP_567482.1"
                     /db_xref="GeneID:3254080"
                     /translation="MARRITSISGNTLYGTGSRTAVLTYALFVRSYSAPARETVTKPT
                     AYDRLRPVISTFQAPIDWAAAYGSGVLPQASYKPPAPGDAGPLTDLLISTPDAEAFHK
                     INLEQNPRHYPVYARWMGGKGVGWVQEKWGAGVWYVTMVDINGVNVKYGVISTPTLEK
                     DLKEWTTFYLSGRLHKPVLTLLPPPPSLYSALSTNSHSALSLALLLLPPSFTEDALWE
                     QIAGLSYSGDPRMSVPGAENPEKVRNIVRGEGARNGFREVYGGLLKGLGIRWEGGEKG
                     GEETWEWKGNGEEVMVRPDGSEYLVSLALSLPLPLRQSLTIHYPTLSSASASRELSSW
                     APVVQDSKFRANLSEALRKIIHGPALRQSIKGLFTAGPVKSFWYSLAKVGKWFKGRKT
                     K"
     gene            296806..298943
                     /locus_tag="CNJ01040"
                     /db_xref="GeneID:3254116"
     mRNA            join(296806..296887,296950..297962,298021..298136,
                     298208..298703,298757..298943)
                     /locus_tag="CNJ01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_567483.2"
                     /db_xref="GeneID:3254116"
     CDS             join(296869..296887,296950..297962,298021..298136,
                     298208..298703,298757..298858)
                     /locus_tag="CNJ01040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567483.1"
                     /db_xref="GeneID:3254116"
                     /translation="MSFGGFGQAAGGAKPLFGGFGQQPTTSAQPATTGGGLFGSQSQP
                     QQQPQQQQQSTGGLFGSQPKPAGTGMFGSTSQPQQGQQGGGLFGSTTGAGTTGTEGGF
                     FGSTTQQQQQQQQQQPSGGLFGSTASAPAQGGGGLFGQTQQPQQQPQTGGGLFGSTAG
                     TAGTSTGGLFGQQNQNQQKPAGGLFGSTAAPATGAGLFGSTQQQPQQQQGGGFFGSTT
                     QQPSQTGGLFGSAAQPQQQQGQQQGGGLFGNLGQSQAKPTGGLFGGSAFGAQPQQQQQ
                     QPQQQQGGLFGSTFGQSTNQVNQLQQSQAPHQSMQQSVFGVKKEMDIESRIKAVQNAW
                     DTSSPDCRFKYFFYNVVEEGTANRYGRPAGANDDAKWAKALRDNPDPNSMVPVLAVGW
                     ADVKKRQQLQENLASVHQERIKEITAALAHTRQTSLSSSIRLANLQARQSQLVHRLIH
                     LAAQTPQHVPIIQSTVFKQEEADMAKQLEGVKAELEGHGRNSVKRVEARGEVSRGRLL
                     GQVNELWGQLEEIRRKRKVRGPDGREQWVGDEKMLSEIAEVLATQQTALQKLSDLAQD
                     ANLDADVMLSHGGDR"
     gene            299049..300948
                     /locus_tag="CNJ01050"
                     /db_xref="GeneID:3254358"
     mRNA            join(299049..299681,299738..299938,299997..300948)
                     /locus_tag="CNJ01050"
                     /product="protein-ER retention-related protein, putative"
                     /transcript_id="XM_567484.2"
                     /db_xref="GeneID:3254358"
     CDS             join(299068..299681,299738..299938,299997..300786)
                     /locus_tag="CNJ01050"
                     /codon_start=1
                     /product="protein-ER retention-related protein, putative"
                     /protein_id="XP_567484.1"
                     /db_xref="GeneID:3254358"
                     /translation="MDIDSPPSNSIPDILQPDPHSHILLPSFSASFPLPFRVLFLVGL
                     ATLLWAVNLHVLSAIGIDMSWVLDLRDDPGGGDISLEESDDGGELAEQGMHLEISPRL
                     QQLGNITTTTTSLNEPDTPIRPTNTRIVRPSANKLHGPMYKLFLMYCAWVGTAWVLFR
                     YLSGDEEEAMERWRVIPGLAMVGVVAGVAVPWRGVVERERAGFRRAIKRILLPHINDP
                     VHFSDVILADILTSFAKVLGDLWISAIQIWSGGITQGRVSQRGWSNYITLLMVSLPYM
                     LRFRQCLLEYYQSSWQSPRPLANALKYFSAFPVIFLSALQKSVVSDIASQKGISVQEL
                     TERHDRWFGEHRLFRLWLLAVCVNSMYSFWWDVEMDWGLALCEADTWLGAKKEGGGRH
                     EGWIERMKKMLRKRRDTGHHQRSPCPTPSPFVTSPSISPTRGSSRPAKPFFAFGLRPT
                     LLLPDPVIYHLFTIIDLILRFTWSLKLSNRLHTISEIESGVFLMETLELLRRWMWVFI
                     RAEWEAVKMKEHRWGRGKLVWEEEEQ"
     gene            complement(300904..301468)
                     /locus_tag="CNJ01055"
                     /db_xref="GeneID:36393059"
     mRNA            complement(join(300904..301000,301058..301153,
                     301280..301468))
                     /locus_tag="CNJ01055"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658760.1"
                     /db_xref="GeneID:36393059"
     CDS             complement(join(300977..301000,301058..301153,
                     301280..301351))
                     /locus_tag="CNJ01055"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514441.1"
                     /db_xref="GeneID:36393059"
                     /translation="MPSRFKDKQPLKTLANASKSCATQSVAYGKCISKSYTEVSKGMC
                     EAEFKAFKECVQKAVGRKW"
     gene            301728..303086
                     /locus_tag="CNJ01060"
                     /db_xref="GeneID:3254352"
     mRNA            join(301728..302351,302427..302636,302701..303086)
                     /locus_tag="CNJ01060"
                     /product="expressed protein"
                     /transcript_id="XM_024657936.1"
                     /db_xref="GeneID:3254352"
     CDS             join(302124..302351,302427..302636,302701..303066)
                     /locus_tag="CNJ01060"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513660.1"
                     /db_xref="GeneID:3254352"
                     /translation="MLTKEDWENIREDTNKQLNPTSPHRFKTGETARRRWYYLKETHD
                     VINQVKAHSGTVWDRKNCAVSAPDHMWETWIAANANVHRIRNRSFPLYALVDRLAADL
                     HPDGRAVHNLHQPPQPSTRSNQHSSSSPFRPHDGVSDHFEELDDLSSSASTEEQGSRE
                     VHPSFATLARESRRGRQSAKAFKEACEAVKEMARCSSHSSSYFTQLALKRVVEYLNTR
                     DDLSSMQKAALLRNCVENDGTRDSVVLAAENPEIPWLRGVVDDILNELF"
     gene            303846..305900
                     /locus_tag="CNJ01070"
                     /db_xref="GeneID:3254228"
     mRNA            join(303846..304153,304219..304350,304401..304780,
                     304835..305320,305383..305900)
                     /locus_tag="CNJ01070"
                     /product="ada3 protein (ngg1 protein), putative"
                     /transcript_id="XM_024657937.1"
                     /db_xref="GeneID:3254228"
     CDS             join(303865..304153,304219..304350,304401..304780,
                     304835..305320,305383..305853)
                     /locus_tag="CNJ01070"
                     /codon_start=1
                     /product="ada3 protein (ngg1 protein), putative"
                     /protein_id="XP_024513661.1"
                     /db_xref="GeneID:3254228"
                     /translation="MGDDVKKKDRKRKEREDEDREKEKEKDMDREKEGERERAAIEAN
                     ERASMRLEVAEKARLAHAQGVAGKKKGLSAVAGKGSSSTASPTGVKVKRERSLSPAPS
                     NASTTTSFKPSASQQTYSGQIKKKKKIKRVLDSDDETPSTRERSMTLASPPPYPSTTS
                     GLKLKISHTQPKRPSVDTTHSPASSSTPLPGAHIDFSLPAQPSRPLVPTRQGPRQPMK
                     PGPKKQSEVDEDYSNKKAPNQVAFPTFWSAVEPYLRDMREDDLAMLGFKTDPAESYEI
                     PPRGRHYTEVWDEEDGNPPGTRTRFPVPNLRQQQIQQSQTVNHTRKNMALAAAATPHI
                     PHFVPAQEMRDENLVDEQRGLGGLTERVVAAVVGTFVGEDKEKERERERERRERERME
                     SGEVGERVDPAKVDVVDLEERMKHELRAVMLLGEHEEFDPNNRDDDEITSALRQCQRL
                     LVHQTAVNEARKTRLAEIAKQRLAYTEYRAALDGVEKSIEEAWLKRIKKYGLSPKKKL
                     MAEAGGTGTVVGEHGEVVQLNASGRPPVPDALKRLVDTRKSWMGSVGRVIKERPRGEL
                     VGIPGESVYKDIERGESGV"
     gene            306243..307041
                     /locus_tag="CNJ01075"
                     /db_xref="GeneID:36393060"
     mRNA            306243..307041
                     /locus_tag="CNJ01075"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658761.1"
                     /db_xref="GeneID:36393060"
     CDS             306266..306964
                     /locus_tag="CNJ01075"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514442.1"
                     /db_xref="GeneID:36393060"
                     /translation="MSAIQRPSTPYPYTHTLVHGHGASYFQPHPLHHHASTQPLHFHM
                     ARMPQRVPPSLLHRVSSASAPRSPRLVPVSPPHAQPQPVASSSRESPLDRRASTGSSA
                     YSPALPTTPPLLPTLIAPTPLTLPPSALYPASLGQVEELLPVGLEQLDKSHASVWHVE
                     VEDEEDRGRKRSVEQETRFRRSQTPAVLLEALKRLSKCVAVEEKRERTPETEGERGKV
                     LRSMVDGGAWVVVG"
     gene            307329..310517
                     /locus_tag="CNJ01080"
                     /db_xref="GeneID:3254165"
     mRNA            join(307329..307555,307612..308112,308166..309120,
                     309178..309849,309914..310517)
                     /locus_tag="CNJ01080"
                     /product="6-phosphofructokinase, putative"
                     /transcript_id="XM_567487.1"
                     /db_xref="GeneID:3254165"
     CDS             join(307384..307555,307612..308112,308166..309120,
                     309178..309849,309914..310358)
                     /locus_tag="CNJ01080"
                     /codon_start=1
                     /product="6-phosphofructokinase, putative"
                     /protein_id="XP_567487.1"
                     /db_xref="GeneID:3254165"
                     /translation="MSDSPAATPLPKDPEGITEQIQSVSTPPPPPQAQKPARQKKIAV
                     LTSGGDSAGMNAAVRAIVRQSIARGCQAYIIREGWEGLVRGNTSGPTPAPTAPQSPTL
                     SASSKTVTFSSLPPSQQFDKLTSTLNKESLANEVSFSDPNEVTPLEDTPLSFGYGQLL
                     RDGAGEGDVEELASHGMQGLAIADREDEKGRSLKNKYIVRVGWDDVRGWQGEGGTLIG
                     SSRCPAFRTREGRLQAASNLIHSGIDCLAVCGGDGSLTGADKLRGEWPSLVEELYTEN
                     KITDDQREAYHHLNIVGLVGSIDNDMALTDLTIGALTALHRICESIDSISSTASSHSR
                     AFVIEVMGRHCGWLALLAGIATGADFIFIPEDPPKCEDWETEMCDLLQAHRKVGKRKS
                     IVIVAEGALDRNLKPIKPDYVKKILVERLGLDTRVTTLGHTQRGGKPCAFDRILPTLQ
                     GVEAVQTLLSATPETPSYMIGIQENKITKIPLLEAVARTQMVAEAIENRDFAKAMSFR
                     DSEFREMLQAFQISSSLDVSQNAPVDKRLRIGIIHVGAPAGGMNAATRQAVRFCHNRG
                     HVPVAIYNGFEGLLDDNVSELSWLRVDSWTTRGGSELGTNRSLPSIDIGSVAAGFQRY
                     SLDALLVIGGFEAFHSVVLLSQNRTNYPAFQIPIVHLPATLSNNVPLTDFSLGSDTSL
                     NALVEACDAIKQSASASRNRVFVVETQGGMSGYIATMGALAVGAVLVYTPENGISLKL
                     LQEDVEFLIKRYKLDEKGKSEGRLVIKAEKSSSVYTTETLTKIFKEEGKDLFDARSAS
                     LGHTLQGGVPSPLDRTRAARLSLRCMQFLEEHASPNSQASHHKPKSAAHPHAGAKSIA
                     KDTAAMIAIIGSKVVYATMDDVLKVTDMKLRRGTDEWWSDCKELAETMGGRTGLMAKH
                     "
     gene            complement(310544..312200)
                     /locus_tag="CNJ01090"
                     /db_xref="GeneID:3254324"
     mRNA            complement(join(310544..310942,311007..311424,
                     311519..311819,311890..311968,312103..312200))
                     /locus_tag="CNJ01090"
                     /product="xylitol dehydrogenase, putative"
                     /transcript_id="XM_024657938.1"
                     /db_xref="GeneID:3254324"
     CDS             complement(join(310631..310942,311007..311424,
                     311519..311819,311890..311968,312103..312165))
                     /locus_tag="CNJ01090"
                     /codon_start=1
                     /product="xylitol dehydrogenase, putative"
                     /protein_id="XP_024513662.1"
                     /db_xref="GeneID:3254324"
                     /translation="MSTNQKSQKAVVCHGAVDLRVEERDIPEPKADEVQIKVAMTGMC
                     GSDLHYYLHGANGTFKIREPLVLGHESCGVITAVGSNVNSGFNLKVGDRVAMEVGVYC
                     KTCKMCRRGRYNLCANMRFASSAKTYPHLDGTLREVMTWPAELVYKLPPNLELPLAAL
                     AEPLSVVLHAYRRAHLSPGSRILVIGAGAVGLLTCALARASGCTTVVAVDIEQGKLDF
                     AAQQSWTTNTFCLPKGPRVSGAEALEVAGKQWDALKASDAVQSVEGLEDGFDAVFECT
                     GVESCMQMAPMAAAIGTKVLFVGMGTKVLALPCGPSLLSEVDLIGVFRYCNTYPDALA
                     LLASGKLGDVSKMASHYYSLDQAAEAFEDLKRGKDKDGRTVIKPMVGNLEMCGIKK"
     gene            complement(312527..315194)
                     /locus_tag="CNJ01100"
                     /db_xref="GeneID:3254114"
     mRNA            complement(join(312527..312767,312815..313261,
                     313311..313332,313384..313487,313538..313929,
                     313989..314072,314133..314536,314588..314782,
                     314930..315194))
                     /locus_tag="CNJ01100"
                     /product="proliferation-associated serine/threonine
                     protein kinase, putative"
                     /transcript_id="XM_567489.2"
                     /db_xref="GeneID:3254114"
     CDS             complement(join(312713..312767,312815..313261,
                     313311..313332,313384..313487,313538..313929,
                     313989..314072,314133..314536,314588..314782,
                     314930..314954))
                     /locus_tag="CNJ01100"
                     /codon_start=1
                     /product="proliferation-associated serine/threonine
                     protein kinase, putative"
                     /protein_id="XP_567489.1"
                     /db_xref="GeneID:3254114"
                     /translation="MMSWKFGKKFKEGGFLSGKHHSSNNNSPSDTSRSTTPTPGNPHP
                     EDAVKPPVPRSGMLKIRVTAAKGLNLPQGVSVPAPIQEALTTNPTPASRIATSPPTAI
                     VKAAGANRDSLQRRQVWWLPYLVLEFDKNEVLVDALGGDLASPVWMYSATFDVSRISE
                     ISATVYLRTREPHAEGREKSNGEGEGEDMGNSDLCLGSIRFTPNLDSLRVTDDWVTVQ
                     GGGGSGSINVQVSFKPASGQILTIDSFELLKVIGKGSFGKVMQVRKRDTLRIYALKTI
                     RKAHIVSRSEVTHTLAERTVLAQVNCPFIVPLKFSFQSKEKLYLVLAFINGGELFHHL
                     QREGKFNETRSRFYSAQLLLALEHLHSFNVIYRDLKPENILLDYAGNIALCDFGLCKL
                     NMSNSDTTNTFCGTPEYLAPELLSGHGYTKCVDWWTLGVLLYEMLTGLPPFYDENTNE
                     MYRKILTEPLRFPDGVRSEARSLLTGLLNRDPRQRLGVNGAQDIKNHPFFAKHINFTK
                     LWNKQIQPPFKPAVASAIDTSNFDEEFTNEVPLDSVVDDSHLSQTVQQQFEGFSWSVS
                     PLGESVGRY"
     gene            complement(315420..316586)
                     /locus_tag="CNJ01110"
                     /db_xref="GeneID:3254197"
     mRNA            complement(join(315420..316237,316291..316406,
                     316463..316586))
                     /locus_tag="CNJ01110"
                     /product="expressed protein"
                     /transcript_id="XM_567490.1"
                     /db_xref="GeneID:3254197"
     CDS             complement(join(315529..316237,316291..316406,
                     316463..316567))
                     /locus_tag="CNJ01110"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567490.1"
                     /db_xref="GeneID:3254197"
                     /translation="MPRSLTPSRSRSRPLSSRSRTRSPYSDRSPSPPPKGPRTPHLIR
                     MFVTKGRHAPLADFDAGLFPTRDEFQVYAWQTSTPSELIKLLYPSFPAPYRSPQTRFH
                     FRHVYVDASPRGLYRFKDLTSFIGRDLQSGSNDDSMDLDEDRELGRRGRKIEEKSLDD
                     YGFVTGDFLSVSINVPEPRHPVNSLAAGALAGIAGNSSAGPAGLRDREGPRGGFGWGD
                     RGGDRERPQRAVAPSSAPGEGSDATRWGRGVPLPPQDRTGPRGGRGGYERASLPEGRW
                     NRGDDRNGPSGPARDRSRSPRRDRRESWSRRRD"
     gene            316807..319399
                     /locus_tag="CNJ01120"
                     /db_xref="GeneID:3254361"
     mRNA            join(316807..317157,317230..317336,317420..317499,
                     317559..317758,317814..319399)
                     /locus_tag="CNJ01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657939.1"
                     /db_xref="GeneID:3254361"
     CDS             join(316880..317157,317230..317336,317420..317499,
                     317559..317714)
                     /locus_tag="CNJ01120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513663.1"
                     /db_xref="GeneID:3254361"
                     /translation="MISVLRPTLLRATPRLVRPFASTPWLSQSQPKTPLPSSKDPSHP
                     HLFYHPNSSYVSLSFLPHPPAVYGSRTVLGYLPLGDAALDDFREEPKFRKVLDDAVKS
                     GLEQGKATTVQFEAETRPVDGWVHITDERAIPPAGRIGETEDIIGSVYVQEGNIVADT
                     YSPLPTYRLVTTNGVMRLPEGLDKHLIEVLEGIDKEERTQAAADLM"
     gene            complement(317766..320225)
                     /locus_tag="CNJ01130"
                     /db_xref="GeneID:36393061"
     mRNA            complement(join(317766..319339,319390..320225))
                     /locus_tag="CNJ01130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657940.1"
                     /db_xref="GeneID:36393061"
     CDS             complement(join(317857..319339,319390..319709))
                     /locus_tag="CNJ01130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513641.1"
                     /db_xref="GeneID:36393061"
                     /translation="MQSSSSRTLHGAYLLLGLLMWTHIFPCFVNGQSAAATSTARTSA
                     AAATTSTGAATSTPAVATTSAAQSATSTPTAVTTSAASSAAATGKPYLTIRNVETMTA
                     CGLGQIYWNVYNEDASKVNITIYAVNAGVDQDIPSASTSAVTSQTTSSAVTSGAAATS
                     SAARSTTAAAASTAVANATLSRRTNLNINRTIITQLANHGYEWEPVALPEGRYYIYGY
                     VDDGYGTSNKSNIFSVIEGSNTSCLAAYESMSKTATATGQASQSATLGAGTSDSDTSE
                     SSSGIGGGAIAGIVVGVLAGLGALAALAFFCLRKRRRDRKFGNRWDGDGHQMGMTHHR
                     VISGSTAPSDPGHSPGYNSIGMGNKGMDKGETEGNTVVVGALRKDGSYKSSRTQASAE
                     GIGQTVEGLPVTPAGADQFTTDVEKDDQEVLQDGSSQGHDPFKTPTIPVLSFQPTQHS
                     QPVFSPIETDSNRHLSSDPIPPPPIAATNSTNQPRTPHSESRSSQPRPASQVQTNRKT
                     SQSSMGPGDSPNPNAGGSGLGRSNSSRRKPVPSLGPELRGELARQTSLKTKEEGAKAM
                     PQVGLGLKRGQEAVRNEEGQKSYVLMPDPPMVQD"
     gene            complement(320654..321837)
                     /locus_tag="CNJ01135"
                     /old_locus_tag="CNJ01130"
                     /db_xref="GeneID:3254052"
     mRNA            complement(join(320654..320821,320876..320961,
                     321021..321153,321207..321396,321454..321512,
                     321562..321630,321707..321837))
                     /locus_tag="CNJ01135"
                     /old_locus_tag="CNJ01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658762.1"
                     /db_xref="GeneID:3254052"
     CDS             complement(join(320891..320961,321021..321153,
                     321207..321396,321454..321512,321562..321630,
                     321707..321754))
                     /locus_tag="CNJ01135"
                     /old_locus_tag="CNJ01130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514443.1"
                     /db_xref="GeneID:3254052"
                     /translation="MEDDYFSITSILADNHKMSCTFALDAEGLGYLEGSTENDIHEGT
                     KVELPFWLAQTLSVNQFTTFTLPLPYSSRVQSALVASPVSVKLSNLVGGNGWWYRWGK
                     KLADMLEDEQATNIRNMLLRAFTGRLPTLQDLAAHHASADHTMPELSTSKAEMFRDGM
                     EGDERELFSIGQDSGRLFKAWYDRKKGSR"
     gene            322046..322903
                     /locus_tag="CNJ01140"
                     /db_xref="GeneID:3254225"
     mRNA            join(322046..322195,322278..322426,322502..322903)
                     /locus_tag="CNJ01140"
                     /product="expressed protein"
                     /transcript_id="XM_567492.2"
                     /db_xref="GeneID:3254225"
     CDS             join(322117..322195,322278..322426,322502..322831)
                     /locus_tag="CNJ01140"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567492.1"
                     /db_xref="GeneID:3254225"
                     /translation="MRPTSILAGASRIPLTGKRGNKDFYKGTGQSRVPGAGHRTGAPG
                     VHVVRGKSKYRLLDDRVRVFVGPGKDALDNTELRPYVATRDDDDQSHTTFFNPFSRAS
                     ASRPNLPSFSPNVPPPAFGERVTRKDYTRFSKKYAQLSGEERQWVIMEQRRKWWAGMM
                     QLYGKQEETGAQESERLEGEEKKSA"
     gene            complement(322864..325698)
                     /locus_tag="CNJ01150"
                     /db_xref="GeneID:3254041"
     mRNA            complement(join(322864..323458,323522..324099,
                     324153..324392,324440..324598,324646..324960,
                     325010..325307,325374..325548,325602..325698))
                     /locus_tag="CNJ01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_567493.2"
                     /db_xref="GeneID:3254041"
     CDS             complement(join(322963..323458,323522..324099,
                     324153..324392,324440..324598,324646..324960,
                     325010..325307,325374..325548,325602..325632))
                     /locus_tag="CNJ01150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567493.1"
                     /db_xref="GeneID:3254041"
                     /translation="MNFEDIEDKDGVRFSWNVWPSSRLEATRTVVPISALYTPLKERE
                     DLPPVMYEPVTCKGSSCKAILNPYCQVDVRGKMWICPFCLQRNPFPPHYHQDLSPNNL
                     PPELLPKFTTIEYTLSRPAQIPPIFLYVVDTCVDEDELKALKETLVVSLSLLPPNALV
                     GLITYGTMAMVHELAYADCPKAYVFRGSKDYQPKQIADMLGLNPSNRPIQPVRPGQPM
                     PAPAASKFLMPVQACEFQLTNILEQLQRDPWPVEQDKRPLRCTGVALSVAVSLLETAF
                     PNTGARIMLFSGGPATDGPGMVVGPELREPIRSHHDIDRDSVKHFKRASKFYEALSKR
                     ASVNGHAIDIYAGCLDQVGLLEMKSLTNATNGVMTISDSFMTAIFKQSFLRTLGKDEQ
                     GYLKMGFNATYDVLTTKELKISGVIGHVISANKKSSCVGETEIGIGQTSAWKVCSLTP
                     KSTLATYFEVVTPAGQALTPNQSGLIQFVTHYQHSSGQYRLRVTTVSRVFQEGGHPSI
                     AASFDQEAAAVLMARIAVFKAEIDDSPDVLRWLDRMLIRLCQKFADYRKEDPTSFQLS
                     PNFSIYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNDSDVNNSLIMIQPTLMSYGFD
                     SEPHPVLLDSVSIRPDVILLLDTFFHILIFHGETIAQWRKANYQEQEDYANFKELLEA
                     PIGDAQELLEDRMPIPRYVVCDQGGSQARFLLSKLNPSTTHMSGSNYGAGPAGGQAIF
                     TDDVSLQVFMEHLKRLAVGASTS"
     gene            326792..329274
                     /locus_tag="CNJ01160"
                     /db_xref="GeneID:3254293"
     mRNA            join(326792..327211,327267..327557,327609..327648,
                     327695..327839,327891..327997,328051..328436,
                     328489..329274)
                     /locus_tag="CNJ01160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567494.2"
                     /db_xref="GeneID:3254293"
     CDS             join(327072..327211,327267..327557,327609..327648,
                     327695..327839,327891..327997,328051..328436,
                     328489..329086)
                     /locus_tag="CNJ01160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567494.1"
                     /db_xref="GeneID:3254293"
                     /translation="MFLPLIISTAAAVAPLARAYLVNSSDYSSGALGAAPAQTFKTVN
                     WTAAEWNFNVFPSTDLPSGYLLLAPRGSDVETPTGIIYTNDGEVVMYGKEFGIGQTMS
                     FSVGTYQGNQVITTWGGQFYGNGYGNGFGLIYDQNYNLVANISSTISGSGIDFHEFVL
                     TDKDTVLATVYIKEQYNLSSWNVTTEDGTSGWILGGAFEEIDVATGEALFSWKSLDHI
                     DPSECYNDPGSTGVAESSAWDYFHINSIEKDLEGNYLVSSRHCHAVYQISASTGEVLW
                     TINGRNSSFSMGRGTTFEWQHDARWINNYTQISIFDNAASSWESDESMARGLLLNVDT
                     DAMSITLAQEYLPWNETVSPSQGSMQEQTNGNYLLGWGQIPFFSEYSSDGTLLSSAQF
                     GVGSVQGYRVLRSNWTGYPQTTPALTVISNSTTDQYDIYTSWNGATEISSWVLYGATS
                     LSGSASSSKLNQVDKTKFETYFSLSKDTAASYPWVQARAVSSNGTVLGYSYYVSLNGS
                     DSVAPSSTQASATEATSAAATSSTGTATTSSATNNPTSGAENLRAGFALVVAVVGAAL
                     LL"
     gene            329378..331388
                     /locus_tag="CNJ01170"
                     /db_xref="GeneID:3254150"
     mRNA            join(329378..329763,329839..331388)
                     /locus_tag="CNJ01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_567495.2"
                     /db_xref="GeneID:3254150"
     CDS             join(329428..329763,329839..330762)
                     /locus_tag="CNJ01170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567495.1"
                     /db_xref="GeneID:3254150"
                     /translation="MPIAIPAAQSSSTASPNARAPVVPPAPRNPVRLSVAARDHPQPS
                     AGPSTASSTPVHTTSVPSGNNSIAPAGGEDAEALKRAAVRKAQLQRRVERWMDKLMEE
                     TVDRATFKKTVSHFTPPQYLEITHERHLNSLCSYPVCPNPPYRPYSSSRRFVISTRAR
                     TIKPKEGNEEEGYCSKKCRARSGWVEGKLDKEAVWLRGKVEDVELLEELEERGEVNLE
                     AITKEEPKTTSRKESTARATPSPVPKPALPTKQIISNPKQPLASEVLVPAPSANVVTS
                     LIESLTIHERPVPSVAPAPPSLSGPVDHSTSSHAPPAVEPQPLPLPQPQPQPSLSSHA
                     RRNPNSLLSPSSTLTRSLLSATNSIPAAAISQSSPNGDDSEEEESEASEWEKEMRFGE
                     ETEEVKGWFEEAMAAREMLGDKEETEE"
     gene            complement(331376..333637)
                     /locus_tag="CNJ01180"
                     /db_xref="GeneID:3254042"
     mRNA            complement(join(331376..332503,332560..333010,
                     333059..333290,333343..333637))
                     /locus_tag="CNJ01180"
                     /product="stearoyl-CoA 9-desaturase, putative"
                     /transcript_id="XM_567496.1"
                     /db_xref="GeneID:3254042"
     CDS             complement(join(331547..332503,332560..333010,
                     333059..333290,333343..333487))
                     /locus_tag="CNJ01180"
                     /codon_start=1
                     /product="stearoyl-CoA 9-desaturase, putative"
                     /protein_id="XP_567496.1"
                     /db_xref="GeneID:3254042"
                     /translation="MSAAVPPMTPPLEKEESELVHRRPSPVDQLDPAFTPPHTPEQNP
                     CKSTKGKGIDPIDPTLLASDRHIPDNYVSYTIANQKYLPPITWKNLIYNIQWISFLAL
                     TVTPSLAIYGVFTTAWNTKTAIWSVIYYFITGLGITAGYHRLWAHRAYNASVPLQFAL
                     AIAGTGAVEGSIKWWCRGHRAHHRYTDTELDPYSAEKGFFWSHVGWMLVKPRGKIGVA
                     DVSDLSRNRVVKWQHRHYIPLILGMGFVLPTVVAGLGWGDWRGGFFFAGAARLCFVHH
                     STFCVNSLAHWLGEQPFDNKHSPRDHIITALCTIGEGYHNFHHQFPQDFRNAIKWFQY
                     DPTKWFIWTMSQLGLASHLKRFPDNEVKKGQYTMKLRLLKEQADQLEWPKSSNDLPVI
                     SWDDFKAEAKERSLVAIHGFIHDCSSFVEDHPGGAHLIKRAIGTDATTAFFGGVYDHS
                     NAAHNLLAMMRVGILDGGMEVEHLKRRPAESAASSVTNSPVSSASASSVDIQSLADDD
                     FRLDQTQLNSQGPKPKAPFGQPQAQVADRWTLSVPPSEKLRIVQTVPEIRPGLLTHRS
                     TGKLNKVTKADVGGEINEFIGEKPVAAA"
     gene            334310..336581
                     /locus_tag="CNJ01190"
                     /db_xref="GeneID:3254062"
     mRNA            join(334310..334604,334678..334740,334798..334995,
                     335079..335268,335328..335697,335753..335874,
                     335931..336061,336120..336248,336328..336581)
                     /locus_tag="CNJ01190"
                     /product="acyl-CoA dehydrogenase, putative"
                     /transcript_id="XM_567497.1"
                     /db_xref="GeneID:3254062"
     CDS             join(334554..334604,334678..334740,334798..334995,
                     335079..335268,335328..335697,335753..335874,
                     335931..336061,336120..336248,336328..336468)
                     /locus_tag="CNJ01190"
                     /codon_start=1
                     /product="acyl-CoA dehydrogenase, putative"
                     /protein_id="XP_567497.1"
                     /db_xref="GeneID:3254062"
                     /translation="MSDHPVLRYIPAGTWALVEPLVSDRAKTLLVTLIDFLENDVIPS
                     EALYYAQLPADPATRWQAIPQALENLKIKAKTLGLWNLWLSGGDFQGMAGGEGGGLTN
                     LEYAIMAEIMGHSIVLAPQATNCSAPDTGNMEVLARFGTQEQKNRYLVPLLNGDIRSS
                     FAMTEYGVASSDATNLRNTQATSMSSSTLSLSGHKWWISGAGDPRTSVHIVLAVTDPK
                     NPSAYKRHSLLLVEPKQKGVKIVRPMMVMGYDDAPEGHCEVIYDNVEVDLVKGLVGGK
                     EGLGRGFEMLQARLGPGRLHHCMRSLGIASRALDLLLQRVSDPARKTFGKFLREHGTV
                     LADIAHSRAEIDQSRLLVLAAARQIDVAGAKGALQDIGISKFTVPKMALQVVDRAMQV
                     HGAEGLSQDQPLASWYAQLRTLRFADGPDEVHIQQIGKRELKRVEELQSRTEKIRRKS
                     EKLLKEGGKERAKL"
     gene            complement(336584..337736)
                     /locus_tag="CNJ01200"
                     /db_xref="GeneID:3254287"
     mRNA            complement(join(336584..337178,337226..337736))
                     /locus_tag="CNJ01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_567498.2"
                     /db_xref="GeneID:3254287"
     CDS             complement(join(336649..337178,337226..337649))
                     /locus_tag="CNJ01200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567498.1"
                     /db_xref="GeneID:3254287"
                     /translation="MAVSISSLQAALQQVLTPIHLRYFPFPLLDLYGAMRLSSVVNWM
                     ASGVFDPPSPSSNRAEKGKKDKALGVNKERATALQEVFGILVVVFGGETFLGTSNCDR
                     ISRICMADSGYYAPWAALCTNSTPSWLVNPSVALLFGLTHVIQTRTPIRRMLPAKPSL
                     ALELFLALPDAIGRTLLLTRFSVLPLLHSSSSNTLLPTPSSLILVPFILAVPFASLIF
                     SATSFFCPQPYLSTPMELRPGGWMMVDAWAPVVIPALFLTLIGPVEGWRFGMGWEEDE
                     SVIVCMIAMTIIFALRAIYNFGYKKELWLNMLGLEGKKKTE"
     gene            337991..339172
                     /locus_tag="CNJ01210"
                     /db_xref="GeneID:3254070"
     mRNA            join(337991..338089,338166..338229,338286..338378,
                     338441..338518,338588..338690,338739..339172)
                     /locus_tag="CNJ01210"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_567499.2"
                     /db_xref="GeneID:3254070"
     CDS             join(338060..338089,338166..338229,338286..338378,
                     338441..338518,338588..338690,338739..339057)
                     /locus_tag="CNJ01210"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_567499.1"
                     /db_xref="GeneID:3254070"
                     /translation="MSNFIKAGRKIVAIGRNYADHAKELGNAIPKEPFFFLKPTSSYL
                     VPDNGPVEIPRGVIVHHEVELGVVIGKNGRDISPSAAFDHVAGYSLAVDMTARNVQDK
                     AKAKGLPWSAAKGFDTFCPIGPFIPKHFIADPTKVGLHFSVNGTVKQSGLTSDMIFDI
                     PQLIAFVSGIMKLEEGDLVLTGTPSGVGKIKRGEIFEAKLTYPGLDGEVLSKYEIECV
                     ERQGGYEFMP"
     gene            complement(339147..341721)
                     /locus_tag="CNJ01220"
                     /db_xref="GeneID:3254266"
     mRNA            complement(join(339147..340846,340901..341475,
                     341577..341721))
                     /locus_tag="CNJ01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657941.1"
                     /db_xref="GeneID:3254266"
     CDS             complement(339364..340836)
                     /locus_tag="CNJ01220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513664.1"
                     /db_xref="GeneID:3254266"
                     /translation="MSSVFSFSYSEETSTNLATFFFQSPSLPTSPSAPLGRAPHSPKQ
                     ATKKLGRHIAMKEPSQCGLFTVCEIPETEREFQRHEAIDVESLANEGSIYSCPSAIAS
                     SEALCLTPGRNEVEFSEDAYNESMITDADVTILQTPSPESNRRLHRLSWSSTGSDERP
                     VVTPLMDLENEDPFLCWSHVPSNDGKNDDDFEMAMADVSGTIPQSLFTTSPSLPDNKA
                     FSRARRAPPPLTLNTRFNLPQSSTTSSAVTPTLSAHPVSSASTTASSEILTPRSTSST
                     TGSNLMPPLPIMSSNDWATKFRKAEDIEIKVVTPTTPTSIRDHNSFTDSHQSPISENI
                     DLVSALEDLLSSCGEAAATDSFSCASHDGEFETKPLQFPLPTNRSDLLSPGGSLHTPE
                     KKSKRPSAPYAPRKPSRPHPHSQIPLRREEGRISPRSLAGDHSFLAYLSRSESPASGK
                     WSVKSDSSHSSLGSCSTGNGSSRKLPERMALPVEWFGLIV"
     gene            343858..345161
                     /locus_tag="CNJ01230"
                     /db_xref="GeneID:3254191"
     mRNA            join(343858..343992,344044..344520,344571..344986,
                     345040..345161)
                     /locus_tag="CNJ01230"
                     /product="thymidylate synthase"
                     /transcript_id="XM_567501.2"
                     /db_xref="GeneID:3254191"
     CDS             join(343938..343992,344044..344520,344571..344986,
                     345040..345045)
                     /locus_tag="CNJ01230"
                     /codon_start=1
                     /product="thymidylate synthase"
                     /protein_id="XP_567501.1"
                     /db_xref="GeneID:3254191"
                     /translation="MTATIDDQEKNQRSNPDHEEYQYLDLIRRIINVGEVRPDRTGTG
                     TVALFAPPSFRFSLADNTLPLLTTKRVFLRGVIAELLWFVSGCTDAKMLSSQGVGIWD
                     GNGSKEFLEKVGLGHRREGDLGPVYGFQWRHFGAEYTDADGDYKGKGVDQLQRVIDTI
                     KNNPTDRRIILSAWNPKDLPLMALPPCHMFCQFFVSLPPADSPGSKPKLSCLMYQRSC
                     DLGLGVPFNIASYALLTHMIALITDTEPHEFILQMGDAHVYRDHVEPLKTQLEREPRD
                     FPKLKWARSKEEIGDIDGFKVEDFVVEGYKPWGKIDMKMSA"
     gene            complement(345077..348239)
                     /locus_tag="CNJ01240"
                     /db_xref="GeneID:3254072"
     mRNA            complement(join(345077..345257,345320..345522,
                     345576..345650,345709..345791,345846..346075,
                     346125..346455,346500..346574,346624..347948,
                     348002..348078,348142..348239))
                     /locus_tag="CNJ01240"
                     /product="regulation of cell growth-related protein,
                     putative"
                     /transcript_id="XM_024657942.1"
                     /db_xref="GeneID:3254072"
     CDS             complement(join(345188..345257,345320..345522,
                     345576..345650,345709..345791,345846..346075,
                     346125..346455,346500..346574,346624..347948,
                     348002..348024))
                     /locus_tag="CNJ01240"
                     /codon_start=1
                     /product="regulation of cell growth-related protein,
                     putative"
                     /protein_id="XP_024513665.1"
                     /db_xref="GeneID:3254072"
                     /translation="MAMISDVDYMLQAIRLSSLRTTDDHITPRIISLDPAFAANPYIN
                     ASGLSDIERWPEIKRALDSPPLEEGYLSGSAPGMRNGDAEEPRRGSGLNYTQTIMGPG
                     KIGGAGMRVSGRHAVPGESRRGQAARADSYNSITAPQSPTSKGKELFSRLPEVTTAGD
                     VFSPSGRPRADSAPAPAPLQGSPKHITSSMLSTGRDLGVNAPGGLLHRALSSSQMSNG
                     SGLGQDGVLTMATPEDRGSSIGIEPTTGTQTVEGRLVGGLEDQGSDVDEEEAAEADVR
                     EGGREATAVPDSKRASVDTVSTMEHLDFSPVPLPQGQSLPSQPSALTAALNKFIPHIV
                     STAPHDSSGPLSPIPATTINPFYSLYSTVAAPPGVPSVSLELYFPHSKNPGHPVVAKV
                     RKDATVEEVTGFGLWKYWDDGREPKLEEEGHKEERWSTVGWGLRIVEDDGEVDEDFPP
                     LDRESKISKFSYGQFAIVEATENQIQQNVLKAPTITRRPSRVLAVPFSARPMVQTAAA
                     PRPSLALPQSNQGGSAASSFSSPEFAPLSTTVTAANMGQGRGLGSTVGLSSTQSDVVR
                     LRVRVTASADVHFTTTINVPADMYIADLTEVLCKKKRLQMPATDWVLCLADLTLALPL
                     DRTVASLGVQTDLALVRRQWAMEHGLRIEDRRGGDPSASIFKRQSELAPIQRFGPGLS
                     DFTQTYKKYTVQRKIAIGRHERVLAIDGDYIHIMPSESRAFFDSMKTTSFHISLVAAC
                     KLTGRGGGFKINVWRDGAQKRYEFEAENQRQAVDIVSTIRQLMKTYAAERTSSMLPPP
                     RVTLRK"
     gene            348465..350434
                     /locus_tag="CNJ01250"
                     /db_xref="GeneID:3254359"
     mRNA            join(348465..348835,348884..348963,349026..349790,
                     349850..350434)
                     /locus_tag="CNJ01250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567503.1"
                     /db_xref="GeneID:3254359"
     CDS             join(348475..348835,348884..348963,349026..349790,
                     349850..350392)
                     /locus_tag="CNJ01250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567503.1"
                     /db_xref="GeneID:3254359"
                     /translation="MSGTLISSLVWVPRGRAAEKPKKYQLDEDEIERVGKLGGPGVLE
                     QLKSEIAAVEDGEEMEGGDEEEDWEDEDDEEGNEEADNDDDDEKMDEDKEPEKPFDPN
                     DLSAFKMDEYDEEESKGVAMGAFANIKGLTYYRDNEEDPYITLKEDEEENEDEELVLL
                     PTDSMIISARTTSDLSSLDFHVYADVDENLYAHHDLMLPAFPLCVEWLDFSPGPDANG
                     AAPEGAKPGNYVAVGSFDPSIEIWDADLVDGLYPRAILGPSPSLEKPEAKPLGTGKKK
                     RKQMVQPAANADYHVQPVLSLSWTPNHRNLLLSGSADGTIKLWDLTRESPMGAMRSWD
                     KVHGGEKVQAVEWNRSTVGGLDKVCLSAGYDRTVKVWDGRAVDEAIGLQVASDIECVR
                     WDPWEPYSFYVSLENGLILSYDSRVLSSSKSSSLATGSSKSSGFLTTAQPKFTLSAHD
                     GPASALDINPHIRGCILTAGMDKTVKIWNVQDEESEGIPRRKREINLATSRDLGLGRV
                     FAARWSPDPETPLTVAAAGSKATLQVWDVASNPGARKAFGERLRRHGRELGEIKKGGG
                     IVAVDGGEEEESEGEE"
     gene            350872..352194
                     /locus_tag="CNJ01255"
                     /db_xref="GeneID:36393062"
     mRNA            join(350872..351738,351793..352194)
                     /locus_tag="CNJ01255"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658763.1"
                     /db_xref="GeneID:36393062"
     CDS             join(351578..351738,351793..352018)
                     /locus_tag="CNJ01255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514444.1"
                     /db_xref="GeneID:36393062"
                     /translation="MHKRPLPETHSHPFLHSHFPIFKQKLLRNNFKPLNKQTKLPTIT
                     MVRNITLTSSMKTKNTERASRKSRPNTPLTLTSIASSPSSPSIRSSPVSPMKFVISFE
                     ALSPNCAPRWTTKYMGGTRVLLKRIA"
     gene            354016..356689
                     /locus_tag="CNJ01260"
                     /db_xref="GeneID:3254280"
     mRNA            join(354016..354811,354867..355506,355557..356689)
                     /locus_tag="CNJ01260"
                     /product="DNA clamp loader, putative"
                     /transcript_id="XM_024657943.1"
                     /db_xref="GeneID:3254280"
     CDS             join(354175..354811,354867..355506,355557..356589)
                     /locus_tag="CNJ01260"
                     /codon_start=1
                     /product="DNA clamp loader, putative"
                     /protein_id="XP_024513666.1"
                     /db_xref="GeneID:3254280"
                     /translation="MPTSPKRSRSENDILVPLPNPSTFGSSSRNSLAPSTSTQPPSAL
                     PVTRRQALTRSRSTSYNVSSRGVTTRRNCALSASSSVPNVGLPSGSLIGNGDGLGLGI
                     TILPSRSRMTGTGMLLRTQSTPMLSTTSQASLKAVAAGADSSGCVEKSEKDGFDYTRL
                     RRGKENIPPKKNEENDDDAPRKRLRITSRSSFSDASGRRRSGSVVSVRSETSGGRHGS
                     LAPSTSSSSISSWATGYFPSPNPSESSFCTSNSDLPTPSRALEKSSSSSEVPDTPTKS
                     RINQATCLLTPPPSSPEFATEVIANFKPAREASPYKQLKAALRLCTISGYTANDMIVG
                     REEEKAAISQYLFDEENDKDVGMYVSGPPGTGKTALVTAFGRQKAEQGWRVVEVGCMG
                     LKVNDLWPRLGDELGCGKTEEEVTKFVKLNASQILIILDEVDSLMPPTPSTVPPATSH
                     LFAKLFSLPFGSPNTKLIAISNTLDLTIRARLVLPNGLQPSVLPFKAYGAPEISNIVN
                     ARIATANIQDIKVDSAAITLLGRKVEAQNGDLRMCLGVLGSAISLAEAEWIKKRSQAV
                     NDPSRKVPMIKVAIPHIMKALASYTAQLRASAGSSTGSTSAAGKKIKSVQLQGKMVLV
                     ALLVYLARSRAGMNGCPALGTTVSPPGTPATGSDIPVAALYATYSYLLSQSSSPFPPA
                     AESDYQDLLSNLETLGLISLPSGTGKWANMSTNKVVLCVREEEVKDGMGLLEGQDKGV
                     GEEEVKRIWEREVAKVQRVKQRLGAGVES"
     gene            complement(357944..361929)
                     /locus_tag="CNJ01270"
                     /db_xref="GeneID:3254285"
     mRNA            complement(join(357944..358400,358452..359349,
                     359400..359467,359521..359617,359677..361233,
                     361281..361929))
                     /locus_tag="CNJ01270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657944.1"
                     /db_xref="GeneID:3254285"
     CDS             complement(join(358093..358400,358452..359349,
                     359400..359467,359521..359617,359677..361233,
                     361281..361910))
                     /locus_tag="CNJ01270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513667.1"
                     /db_xref="GeneID:3254285"
                     /translation="MPGSQPTMSHIQVPFPSASPLKSPTTLSTASSDDDYPTISYPDH
                     GDESTNNTPRASSGNISSQPSRGVSSSSASVRDTLLPIQPMPDSLLLKHTFSALDGSA
                     TTLKRFSKSVLAYAAVVHTLSEQLEKAEDDLFGAVGELGLWLETGYGVQTDKQKGGVW
                     DQDGIRKVNREKRRREREEMNVRVEQGLKDVKAHLKRRGLAGGGAQTKYESSAKQFYH
                     ATGVYLAPQSPTLPSHTQQTSGSSAPASGNLQPAHDMAQSVRLAQWDLTRYTHHSLLL
                     SAVPPSSEECLNLLVALYGWVASMLNEQPGFVKEIDEDALAAIRQSSHVRPHQLRRSS
                     SPAQSNQQLKSTLSSCLSQLSNTRASLLSAWARRDDQTRLLQEAAAKRQSEYESICAD
                     EPSGAKLGEGLGLGNIGSGNAMASVSSSGVEHKKQKKHKFGRSMGGRLKDFLSSSSSS
                     HSVAAISPVSERPFRASFDGYMRTDRRNEGVTRVSTTGIVKLPTHSEVLDQPTIVTSP
                     TFISPTTASTPAIMNSPLSAFTPTSPTLTVPYPSGASSMPPPPPPKEYARPYMPSRHS
                     VHMPSGDYISPYIASTSASGSSDYDASLRLPSPFESSPDLRLSVGSGDKVRHSMDSSR
                     PVSGTSYSRTSPNPSMTSVSPHPVPKIGLGHPSAAAILGTVNVGVGGVGGLGAGGDED
                     ELREEAGRKKEGVLWGLGTWEGLTKGSGSKGKWEKYWVVLDHSSIYEYRDISGPPGGA
                     HAVIDLKFASVREGRGTDRRFVFEIVTPSQGRRLYQATSDQEMKQWLYAICNAIESCI
                     NGTSTVRTIDQAKARGPSGAYDDHALPARSKYNLGFSARNLSLGFVPLIQTGRKSMPS
                     TPVEATSGEARIRKTSLKKVLKQSGERFTNAMTGATSSINLAAHMADQPSEKAKRNSF
                     GGLEVPRPTFGRAGSRQSLPASAPDRQPLQQQFNQLLPPISTPPGAKSSWADNDIENR
                     VLEMAGLGLGASPPSRSGGGHGVLSLAESPSSAKRRVKSEAIRKPHANKHKLAQHQGG
                     EGLTRSKSDDGSTMLAEDLADDKKELKKIASEEGNARCADCHGGMKASRWATISLHNT
                     PIVLFLCIRCIGIHRSLGTHISKARSVDMDNWTPEQIALAREWGNIRGNAVWEATRGD
                     EEPRPLGPEGMKEFVKQKYVEGRWLRPDDRLRFGFGPKV"
     gene            362104..362936
                     /locus_tag="CNJ01280"
                     /db_xref="GeneID:3254168"
     mRNA            join(362104..362280,362333..362385,362468..362603,
                     362651..362767,362827..362936)
                     /locus_tag="CNJ01280"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_567506.2"
                     /db_xref="GeneID:3254168"
     CDS             join(362194..362280,362333..362385,362468..362603,
                     362651..362767,362827..362892)
                     /locus_tag="CNJ01280"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_567506.1"
                     /db_xref="GeneID:3254168"
                     /translation="MAEPFDANTAGNAEEIEMQFAVKTVEHLEAYEKILQTIPPKLIK
                     FTPIDDELYNNLLDEFPEFKFEENLRELNEDEMKSAKGKERWRRFIMPYEKRVTDYNF
                     GTLIRRRSDELYTQDNSILITRVQFFAIEIARNRAGLNEAVYLAAQAKKA"
     gene            complement(362909..365040)
                     /locus_tag="CNJ01290"
                     /db_xref="GeneID:3254296"
     mRNA            complement(join(362909..363560,363634..363871,
                     363934..364214,364286..364425,364475..364637,
                     364726..365040))
                     /locus_tag="CNJ01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657945.1"
                     /db_xref="GeneID:3254296"
     CDS             complement(join(362974..363560,363634..363871,
                     363934..364214,364286..364425,364475..364637,
                     364726..365023))
                     /locus_tag="CNJ01290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513668.1"
                     /db_xref="GeneID:3254296"
                     /translation="MPPQQPKTRYFKGKAPTAISESESESEAEEEEDVKPTYKQRQRQ
                     RLEEERNLVAGGAGRVITDVKEIVREGSRAKMGGGMKMDLGNVQVGRKVGDGGVKEES
                     SEEEESEEEEEETVAQAAKADEEESSEYETDSEEESEEEVKKPMFRPVFVPKNARNMT
                     AEKAAAEAEEARKREEEAEEQRKLASKELAGESIRRELVEKEAADIVPEVDDTDGLDV
                     EAEFEAWRARELARLLREKQAQAAKDEEKEEIERRRAMPEEQRLKEDMEFAARTREKE
                     KGQMGFLQKYYHKGAFHQDDDLLRRDYAGATESSVDMTLLPKVMQVRDFGKASRTKYT
                     HLADQDTSQGGWGAALRRPPGAQTTGEGCWNCGGPHLRKDCPNNNVGDPNLIGGMVIP
                     GVAGAGVGASGANTSALGSGSRTWGNGRDDRGERDRRYADRDRDRDRDSGRRRDEGRE
                     RRYDDERRGEKDDRRRDRDRDYGRDRDREREKETARERNRDGDYGRDKDRERDRYDRE
                     RDYARDRDRRRDSPGRKRERDDRDRDYERDEKRRRDERDRDREREKERGVRRDRDRLQ
                     YD"
     gene            365146..367957
                     /locus_tag="CNJ01300"
                     /db_xref="GeneID:3254151"
     mRNA            join(365146..365430,365505..366744,366807..367957)
                     /locus_tag="CNJ01300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567508.2"
                     /db_xref="GeneID:3254151"
     CDS             join(365236..365430,365505..366744,366807..367654)
                     /locus_tag="CNJ01300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567508.1"
                     /db_xref="GeneID:3254151"
                     /translation="MASGLGVRAVRSLGQAAGISSGRRLCPACLGFRHIQAREYSHGP
                     SSRRARSSEFAPTPLKPTKAAPKVKVADSLLRAQFQTVFHNPTKPIDSHQALHAAYPL
                     IFRRNIRPLLDPHTKTIPLLVAPILQQADTTDEERRQALVLLGHCYGKVAVDLLFMGP
                     EVQHVAELFAWGLMLEVNRFNDDREKLRALQDTLEAVLKRLANNGATPVLQAPIAAAW
                     VVLRSKTGTSTVPENAYVWPAQASVEEYLSKVIPAGETVDSYQSQIETLLGKSEAIAD
                     RIPRSKDALDTELASMRNRGDWSGIINLWGRVQAGMLRDAVQSQVGILDPLPEIRFPV
                     LASFLLAFKRPFMRSASLAAIANPPPTSFDTYAAQVLAKCPRPLPRTIAYTLIFLRVR
                     PGDNVGLRAGHEVMSLDMDERSDASENALGNLKATWKETGERDLKMYMMYIEGLGRLG
                     DLHGLQQAWNELVGDEECKKIYLSEERLPSKAPFPPIHALNQMISACLLIPNDGPPLA
                     LDLFSQASRPDSAIRCNLITINTVLRHYAREANIEAMSALFSKAGELKLQPDVVTYTT
                     LVQGLLRARRLDLAKGAMDAMQKQGIVPNERMCSMLIADLAKSGTRVGLEHAEEMLKL
                     MHQKNMQTNEVTWTALASGYFRGGWEADGWEALARMNRLGIKLHRVGYNMLLKQATGS
                     VDSNGGEDDVETVMKLWRRMLHDGVVPNSDSYLIVLTKLLQMDRRKEIEEIMREMRQR
                     GFRPEKGALVRVVESISRRR"
     gene            complement(366865..368097)
                     /locus_tag="CNJ01310"
                     /pseudo
                     /db_xref="GeneID:3254066"
     gene            368386..374242
                     /locus_tag="CNJ01330"
                     /db_xref="GeneID:3254309"
     mRNA            join(368386..368477,368521..368630,368678..368799,
                     368848..369417,369472..369742,369806..370003,
                     370056..370698,370754..370977,371048..371314,
                     371387..372281,372343..372602,372668..373090,
                     373139..373208,373266..374242)
                     /locus_tag="CNJ01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657946.1"
                     /db_xref="GeneID:3254309"
     CDS             join(368693..368799,368848..369417,369472..369742,
                     369806..370003,370056..370698,370754..370977,
                     371048..371314,371387..372281,372343..372602,
                     372668..373090,373139..373208,373266..374176)
                     /locus_tag="CNJ01330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513669.1"
                     /db_xref="GeneID:3254309"
                     /translation="MHGPIHQHLSGGCLAMLMQLGKELVEKQEQSMPQFHERSFRIPG
                     RVIYTDNKRLGFLADLGNRDIPLHWLMRNQIPHGFKGVELLDVMFSPLTTVRQPPPNL
                     APMDPIPIDRAIWLIRVIGSNDIAAHRARQHQTAASVPAPSPAAATPSSTTTVTATPA
                     MPVSSNDWYSQEFTNTVISWLRIQLGQLALPNTVKVAGKLPATKAGSGILQDEKARAK
                     WLAKWDYSTRLLRALHTKHLISTRLFTGWLADHLTHVNLAQLGFLAQLIGEYLDDLVH
                     HLGSARHCLRAACDKLVEVRNSPGKELLQKVEDMLITVIKALYEANPDVLLSPSTWRL
                     HSPLLATILSTSSPQWENLKRRNEALAFKPTVTAGSSNPRRQRMEEIQKLDSICKDTD
                     MRQLTFLFFDGAASPTCSPVDLVKFEEKVFTLLNWSMGLFQLGAHRPYAVYTLLKHWH
                     EQQEEHQASQAKLGKRQHIDLFQVVYKWLDTAPAARNEDNVRAIGITIGELTRRGMFS
                     YGRYLQTLIANGHTARNLRSASDDRSHHLALLKSMPVFVMAKDLLQQRRIALSGDDLE
                     VRRRDELEEKAVLAAFEEQVKEYVPEVYGLESYGQSEALKTMVNYEIPASSQLTRYLY
                     VFARFSIAANAGATLRSDGERRAMDASTFARITQVFRQSHGYATIADFMVRALQEAED
                     DEILDVILDIIKRDADVWTAMDLWPRLGDKLLDRHHALERKGKEHPRLVQLLKVLAQK
                     KRLMPDDEDEVKQLQTSVDKSTSPPAGVKLVDVFEVLPHILTTGKENTAISVAPALFR
                     QCGRFSSWSLKWWTLIVDVVQKAGNTEQKPFLYHVISTHLSAVLGQHGDSLDDAVTSW
                     LENLSAANVVETFGGRTRPAGVLVRLLLFLVSHRFLSTWVVLEKAVFPIWKHAAPFAL
                     PPRKRLSSKQIQAITSTVNIIAQLLISPPLIPDLAPVSLKESLIVQASRQPVLQGSSV
                     GILIQHLPLLVVFEQSKLLPDQVSHRIDEILRNLAMTAEFKTAAFRNLNLLKDAFLAR
                     EWSGPGMDQGLEGKMIDVLKRIMSEKPTQPSPKQGLPNFDTSARFSAWRWTRVVLEMR
                     VEFKALTMRIAEGQNVAEAKQTLNQLVHATLDRETTADDTDLLCEVFKGVDSMVTQEI
                     LAAGMERLATLLGHAIAAESQQQLETHIKSIDQLLRILDSMNNLPSQSVTEPSVLNAR
                     HKLLDLLALALQTVERNLSTTRDGSDLLLPPGISPPQPSHLLKAVMGLLKFTLGSVVS
                     ESVSLTAPKPNFPHLAVCFLKAIFAGDGILDSNSARIMADMLVYIIDCTSPQARLVCQ
                     SALLAETVSPHAQSILSSFPELSAAMPYLSPVQRHMSLVTPDTADHVSDSALPLDDRR
                     WELFEYIGPSKRKIGPQDLFLASAPLKDASSIPITLFDPKITRDAPPNAGTMDAYGKP
                     AEDGELSPTTDPNPASPVEEEPRRSWETFASERNLGDGLAGEPAYAKQAATLLFSVRD
                     NDVLEVAPVKSAPELVITSSTSPQKPKVKRSGSGKDKATGSNKDAPAAAEEDENDEDS
                     GAEVPLSKKQKTAKNNNAAAKAPARKTTGGKGVSKKATGKSAKEGATGKAKGGRRKSQ
                     AE"
     gene            374615..377519
                     /locus_tag="CNJ01340"
                     /db_xref="GeneID:3254134"
     mRNA            join(374615..375387,375458..376127,376192..377519)
                     /locus_tag="CNJ01340"
                     /product="DNA clamp loader, putative"
                     /transcript_id="XM_567511.2"
                     /db_xref="GeneID:3254134"
     CDS             join(374721..375387,375458..376127,376192..377260)
                     /locus_tag="CNJ01340"
                     /codon_start=1
                     /product="DNA clamp loader, putative"
                     /protein_id="XP_567511.1"
                     /db_xref="GeneID:3254134"
                     /translation="MAGPAKRARHHDENSASPADSTSPTPAASAPPAATDLSAPSTPT
                     TAPPTTRAHSASRRPATRSTQSNNTHFTIATRQTNFALHASNSMPAPSGPGMRGVGRA
                     GMNGGSGRALPAGPSTRSGGAGTLQRTQSAPVIASPAQIKAAAGASGGETEPPKGGCD
                     SLGLGERRFGKGKENIPPKKDEDQQPEPARKRMRVTSRGSYSGQGGRKRSGSVNSVRS
                     ETTSSSRHSSLAPSFSSASISGWGGPRFPSPSPSQASSFDASSFDRLSVSDRSGHAAH
                     LPKNRPVTRSIAMLPTPPPSTPPEETAAARDVLGVDILEASDAETEKAPANPYKQLKS
                     FLRLSTSFTAGASVDETIIGRQEEKSAIRAYVGTSEAESDVGMYVSGPPGTGKTALVT
                     AMGRELAEDGWKVVEIGCMGIKATDMWKEIGEALDCGKTENDIRKYVAQEENKVFIIL
                     DEVDSLMPPPPAAAPPSISHLFAKLFALPLTSSTTKLIAISNTLDLTVRARLVLPNSM
                     HPQVLPFKAYGQTEMSAIVNARVNAAKVEGVKVDTTAITLLGKKVEAQNGDLRMCLGV
                     LGSAISFAEAEWTRKISQAANDPEPKPVAMTKVAVSHILKALTSYTAQLRAAAGSSSA
                     SSAGSRSATGKKVKSVQLQGKMVLVAMLVYLSRTRAGMNGCPAMGNSGTNTPSTPTAS
                     GTDIPASALYATYSHLLSHTTSPFPPAPESDYRDLLSNLETLGLITLTSSSGRGISAS
                     ASKVGFCVREEDVKDGLWSAEGQSKGTADEEVKKLWEREEAKVKRVREKMALTKADDE
                     MNA"
     gene            complement(378013..380365)
                     /locus_tag="CNJ01350"
                     /db_xref="GeneID:3254133"
     mRNA            complement(join(378013..378375,378433..378512,
                     378567..378592,378652..378713,378770..378860,
                     378911..379011,379058..379098,379152..379370,
                     379429..379517,379565..379615,379665..379936,
                     379991..380365))
                     /locus_tag="CNJ01350"
                     /product="lactate transporter, putative"
                     /transcript_id="XM_024657947.1"
                     /db_xref="GeneID:3254133"
     CDS             complement(join(378070..378375,378433..378512,
                     378567..378592,378652..378713,378770..378860,
                     378911..379011,379058..379098,379152..379370,
                     379429..379517,379565..379615,379665..379936,
                     379991..380254))
                     /locus_tag="CNJ01350"
                     /codon_start=1
                     /product="lactate transporter, putative"
                     /protein_id="XP_024513670.1"
                     /db_xref="GeneID:3254133"
                     /translation="MSTSHLPHHAQEQKLRHEDESEFALPARRSSSIRDQLAAWHANR
                     GDRSFLRCMIPSLRQPVAGEEPETKNPFKIIRAVSPFGWLMFFSGWLAWTIDGYDFFC
                     VPLTLDSLAEQFDVAPSSITTAITLTLLFRSLGAVIIGLCADRYGRKWTLVFNCLLIM
                     VFELGSGFVNTYQQFLAVRSLFGIAMGGIWGCAAATGLENVPPIARGLCSGILQQGYS
                     CGYLLAAVINLTVVPKSEYGWRAIYLMGAGFSLLAAIVRSCLPESRQFIVAREEAKAK
                     GISSKQASKNFIRELSNMFRTNWLRWIWAVCLMTFFSFFAHGSQDLYPTYLKTTKGLS
                     SPLASKATIISNCGAIVGGTIAGHVSQFVGRRFAILACCVYTACWIPLWILPDSFAGL
                     AAGGFFIQSGVQGAWGVVPVYLGEIAPPAFRALFGGLCYQLGNMASAGSAQIEANAGK
                     SLKLAGTDIPDYAAINGILIGAVIAFGIIVVFLGPEADGSHFEKAKVAIERGGGEVAP
                     TELFENNTDVHRQFLDKPELSHLEV"
     gene            complement(383004..385421)
                     /locus_tag="CNJ01360"
                     /db_xref="GeneID:3254092"
     mRNA            complement(join(383004..383437,383495..383574,
                     383629..383654,383714..383775,383832..383922,
                     383973..384073,384125..384165,384216..384434,
                     384492..384580,384628..384678,384728..384999,
                     385050..385421))
                     /locus_tag="CNJ01360"
                     /product="carboxylic acid transport protein, putative"
                     /transcript_id="XM_567513.1"
                     /db_xref="GeneID:3254092"
     CDS             complement(join(383105..383437,383495..383574,
                     383629..383654,383714..383775,383832..383922,
                     383973..384073,384125..384165,384216..384434,
                     384492..384580,384628..384678,384728..384999,
                     385050..385313))
                     /locus_tag="CNJ01360"
                     /codon_start=1
                     /product="carboxylic acid transport protein, putative"
                     /protein_id="XP_567513.1"
                     /db_xref="GeneID:3254092"
                     /translation="MSTSHLPHHAQEQKIRHEDESEFALPARRSSSIRDQLAAWHANR
                     GDRSFLRCMIPSLRQPVAGEEPETKNPFKIIRAVSPFGWLMFFSGWLAWTIDGYDFFC
                     VSLTLDSLAEQFDVSPSSITTAITLTLLFRSLGAVIIGLCADRYGRKWTLVFNCLLIM
                     VFELGSGFVNTYQQFLAVRSLFGIAMGGIWGCAAATGLENVPPIARGLCSGILQQGYS
                     CGYLLAAVINLTVVQQSKYGWRAIYFFGAGFSLLAAIVRACLPESRQFIVAREEAKAK
                     GISSKQASKNFIRELGNMFRTNWLRWIWAVCLMTFFNFFSHGSQDLYPTYLKTTKGLS
                     SSLASKATIISNCGAIVGGTIAGHVSQFVGRRFAILVCCIYTACWIPLWILPDSFAGL
                     AAGGFFIQSGVQGAWGVVPVYLGEIAPPAFRALFGGLCYQLGNMASAGSAQIEADAGK
                     SLKLAGTDIPDYAAINGILIGAVIAFGIIVVFLGPEADGSHFEKAKVAIERGGGEVAP
                     TELFENNTDVHRQFLDKPELSHIEKSEVQHKEMA"
     gene            complement(386350..389481)
                     /locus_tag="CNJ01370"
                     /db_xref="GeneID:3254096"
     mRNA            complement(join(386350..386758,386811..387269,
                     387317..387899,387950..387980,388034..389481))
                     /locus_tag="CNJ01370"
                     /product="expressed protein"
                     /transcript_id="XM_567514.2"
                     /db_xref="GeneID:3254096"
     CDS             complement(join(386529..386758,386811..387269,
                     387317..387899,387950..387980,388034..389223))
                     /locus_tag="CNJ01370"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567514.1"
                     /db_xref="GeneID:3254096"
                     /translation="MSQSSSSRDTMGESSSSTPEISSAGRLISHFEDKERSHDPESLR
                     ERKQDREDYELSEFDSSSEEESHSLLPYHLLPFGKGKKSGHWALSERPVRRLRPMILS
                     FGAFTIIGILVTAYLFLGESIPYESFSPAPNAANLSLSDPLDNESADSQSWKFMAKSL
                     KSDPTHIVIPAHEAPSIALLEPLHDRLPYSMLSQYFSSGRLPSSVSPSNVPPQRPLDL
                     VYLFVNASSPYWFREMEARAVLEDVKVGKGSGRSRHWRDNGELRAAVRSGVKALGDEA
                     GRVHVVTADWPVREEDTELQVEAGKWRIGQIAEWLDWDSQKREGRLKWHFHSEIFQLP
                     KDGGVVDLGRSVPRNERAEDEKGTQTWNKWQSEEAWRNESLPSFNSFGIEQRLAWVEG
                     LSENYVSFNDDMFLLRPLSTSDFRHPLAGNLVRFDPGLLVPEVMTPDQLSDPGEWGAL
                     QHANQLLSARFSAHKRFYMHHLPKTQSRTILHEASIMWSPQLSTASTRGFRESKRGEG
                     DVEMAWLITHLRVERWREALLWSWIVAKLGREEDVWEENEKREMKKVLGMTSSQGEEI
                     EKAEITRGTRSTLSDLDALTEAAGWEGPKATDYHFSSMDGHLSSSPDDPASGAQCTFH
                     FSTCLPANFFDSSTSFSASSMFTRLAFERPECGDCLITALIKASGRRGLSAFLPEEDQ
                     VFYPEQEEEKGMWKRSEPTLPLVSSWKDGDFSLRANVKAGQDVWDGFEAREDGGVSLR
                     AWCIKLLSRYNYVYGSTPSRFTPVHSFYQLSSALESVDNTPEVAMLCINDDQADSGSD
                     KSRQKFGTWMEGRWGGVIQGVDWERPNVSWVD"
     gene            complement(390025..405976)
                     /locus_tag="CNJ01380"
                     /db_xref="GeneID:3254120"
     mRNA            complement(join(390025..390179,390226..391836,
                     391890..393501,393557..393882,393938..396804,
                     396856..397000,397054..397286,397341..397522,
                     397580..398171,398221..400470,400525..400584,
                     400630..403042,403082..403273,403314..404922,
                     404973..405409,405468..405976))
                     /locus_tag="CNJ01380"
                     /product="midasin, putative"
                     /transcript_id="XM_024657948.1"
                     /db_xref="GeneID:3254120"
     CDS             complement(join(390249..391836,391890..393501,
                     393557..393882,393938..396804,396856..397000,
                     397054..397286,397341..397522,397580..398171,
                     398221..400470,400525..400584,400630..403042,
                     403082..403273,403314..404922,404973..405409,
                     405468..405880))
                     /locus_tag="CNJ01380"
                     /codon_start=1
                     /product="midasin, putative"
                     /protein_id="XP_024513671.1"
                     /db_xref="GeneID:3254120"
                     /translation="MAEDYTMEVDTQVNPPKEVATDAPRPLYIDLWSQVDKFLGDLNL
                     SSTSSHSPISIPDIFFSCSASNQASVSIKQLLQALSSLASYPGVFNHVQLRFQPILMD
                     LLARWIEESESLDYDLLERRLSILSLLVEINPEFWSLVHTFILRTPFRNGPLALVDFN
                     NLPTIPTARLHILLLIYLRLIIVDPSIATRNNWPITQLYTLRTDHPDQGLRLLAIQVL
                     ARQQKWSEKKRMEAEKTFVGNVADIDAEVLFGFETVILPQGGFQIQEVKIDGWMLPVI
                     ESKRINEARRHAAKASTISYLHVPVIDRSDLCSRIVLVADQLMLRSSALNPLFTTMHV
                     RTAPTDEALRALCPLIQRSSPILLTSPPSSGKTHILQYLSSMLFPSQRPSSRILTIPL
                     ADTSIDVKSLIGTYVSSPNKPGTFEWMEGALAKAIRAGRWVVFEDVDRGSTEMLVTLA
                     GIARSLRSARPGQRAMLAVPGRVTVEAGDGFGLFVTRTTRQEHTAPTFYAHHIFSEVF
                     LAAPSDEDILAILTARFQRLPKTVLTTLVNIWHELRPFDKLSGQVKARDIGLRDLEKW
                     CARVERNLPSSASLVALEQSGSVFANSVLQDEIFLEGVDIFVASLDTKKVSREKRKQM
                     VDIIARGLGMDEDRFMALDSRKPNFEVSPASRQLHIGRVIMDMGAPEKGRRDTSSSAR
                     PFALTKPSLILLERIAVSLTLGEPTLLVGETGTGKTTAVQHIASIVRRPLTVLNLSMQ
                     TESSDLLGGFKPIDASVAARSIHARWQKLFCETFAMGKPANGAYVEAASRALSGRKWA
                     RCAELWTSSAKRAIDKLGKGEINSPAPEGSPLKRRKIFKATRVSVQWQTLLADISDFD
                     LHHAKMKSKLVFSFVEGPLVKAMKSGEWLLLDEVNLASQETLEAISTILEGPTASLVL
                     TERGDVEPVARHPQFRLFACMNPATDVGKKDLPPNLRTRFTELYVPPPDDDREALISI
                     IAQYLGDAVAGEKSVILDIAELYTTLKRLSAAKEIVDGSNAPPHYSMRTLARALTFAV
                     QSAPLFGLRRALWEGYLMAFTMSLDVASARIAREAGEKYILGPMKNASAVLAQIPALP
                     SSMDPDNFIRFGPFWLQRGPVSPVPESRYIITPSVQSKLSDLARVILTKRYPVLIQGP
                     TSAGKTSAVEFLARQTGHRFVRINNHEHTDIQEYLGTYVTDPHTGNLVFQEGLLVTAV
                     KQGHWIVLDELNLAPTDVLEALNRLLDDNRELVIPETQEVIKPHPNFILFATQNPPGL
                     YAGRKILSRAFRNRFLEVHFDDVPKHELETILCQRCQIAPTYAKKIVQVFEELRHRRQ
                     ASRVFESKQSFATLRDLFRWAERGAIGYQQLAEDGYMLLAERARQEEDKVVIKQVIEQ
                     VMKVTINDDMYRLFDKSAGILARFPQTTLPPTSMVWTKAMQRLFALVAAALLHNEPVL
                     LVGETGCGKTSVCEIVAHMFNQALVGINCHQNMETADLLGSQRPVRNKLDRRAKVIST
                     LGQYVQLPAAASDDEILDACATLAKTQNVDHQLIRQCQREIKQLSALFEWSDGPLVHA
                     MTAGDLLLLDEVSLADDSVLERLNSVLEPGRTLVLAEKGGIDIDEATIVANERFHVVA
                     TMNPGGDFGKKELSPALRNRFTEIWVPALNDRGDMLQIINQSWKHENLRQCGPLILDY
                     FLWFGKKLGDSSGLGLRDILAWVSFGNDSYAKGLSVPQVFHHGGQMVLIDGLESLPQV
                     AGMSSNSIETLRKDCLAQLDTLAASLGMDYLVSRNLEVKITQDAVSIAGFLIPRGSML
                     SKSTNFRFEAPTTALNTMRLVRGCQLPKAILLEGSPGVGKTSLVSALAGVAGYHLHRI
                     NLSDQTDLIDLFGSDLPVEGGKPGEFQWRDAAFLEAMQKGEWVLLDEMNLASQTVLEG
                     LNAVLDHRGTVYIPELGRSFSRHPDFRVFAAQNPLQQGGGRKGLPKSFLNRFTKVYLQ
                     EHTAQDLMIICRNLLPMPTNIIEKMISFNDTMRIQTMITRVIGREGSPWEFNLRDLFR
                     WFSLLSQKNGLERTDHPAEFFQMVYRQRFRNERDRQAVTDIFHSVFGHEVDSTRPFFS
                     ISPSWMQVGHSIVSRGSNPSVDVTLPHHHLDIAESILKGIELGWLVILAGDSGAGKRG
                     LIRGLAKGAGRLLGEFAMHPGVDTSEILGSFEQQDVSRLLNSVFGNVSDLITQVSDAQ
                     PAILRRLEDLAVIREQCQASFNVETLDAFSTLSQAILSELSSFIDVSLARQSLDSLIK
                     VGPNAMGFAWVDGELIHAIKNGGWYLISDANLCSASVLDRLNSLCESNGVLVLSEKGS
                     STGSPEVLRPHQDFRLFMTYDPHYGELSRAMRNRGLELFLDGKGMSKSVKRQPLILAD
                     DSVLRELTVLQSTVKNESEGYPISSAVASSISLQSQGGLAYLPRFSHTLTGSVGEGYS
                     VLSQYFSYQRLDEICRSHAVEACSLQRLDLGFVGAMPVDLTLNPNIRAVSQRRGAINT
                     VLQTILRGAIQLRHLQSWIADPAHAKTILALSAVSSRRGPSRPKVQAGGDVYPFIISF
                     LEIVQTRLASLVSESPHLLQRLDRVFVYVLLMISHAKSSVFDYSSTKLLARWIEQDTE
                     GITSLCPVLDKLQNLAKTVQLTTGLGQTEIWSLFRETCDQGSSEDLVKLTSLADDVYD
                     PHMKYSILQAFATLGDTPRESTIIQELTSLLTTSRKEMKEKVSGRWTNWPITDSLKLQ
                     ALCNKNSQDVLKILLEDISVKVSSLLPLQNSLGPTHSPAALFEALSGWMKGIWDHSDC
                     SEGILSGPADLFKPARLSSTLRFGLVETVTMAEIPDQDQALNFSVKTILFDAENKDSR
                     RKNTLDLAVHCLSLILSAFGVPCLATQVTPTSMASVEDALDKSIDNPAIHFLHQSYHK
                     WITPAFSEASLRPHDLTNIGQVWLALSRFLLDLYVTNIPIDPGVRRGLQGEVIAEHLA
                     LVKEELAALTAKEMVLKGKIDSKLVADLMGRASVLEKEEESLGPNLKRASDVLKLSYL
                     FNEVHAFLSDLYDRKHMCSLISALQDTHIQAMSRERDFQLGSSAFIQRLSTTYSEMSD
                     LVHPVVTAVLFGKFGLRLIARDVQLRGSRPDSTVPLAVTFPLARGVKQLQKLSVDSPV
                     DQATGVPTELLAASAYLYELNTTQSRIYCVPRLAQRLDRLYQIWSAIRLREQQEAQDA
                     ESLYKVKKTDIEVLSDEEQEAKEFAELFPQYEDAGAEDALPKQKELHLNKENQKGFQP
                     SHVASFNALIRQVFGQSSSTSSSLLKQMIDETLHTNFNPVALDERLDASSLAFQISTL
                     HRRLADVRTSPSQPNFYLSPNEPEARKAHNIVVRLLKRLRILIDEWPEQMVLVHIRDR
                     CERILTLDTRSPVAKILIAMEQLLIHTEDWEAYANRENSLSTFRDETSKLIIEWRKLE
                     LVSWTRLLDDQAEHYASEDNEWTLRLYGALIHGPIGSNDAGKHIEEVLPMVSTYINSS
                     TYGLFTPRLDLLSCFQRMASELSIHHAVLGKVATMLHNVIANARLFESRISDAMASQR
                     AVIDKAVKDFVKLASWKDVNVFALKASAQKSHKALHRSIRKFRDVLRQPIAPLMSELN
                     RIVPQETPVSSEPPPPFFISITTLTSSSLKDREEASPDVPDVLVRLEETLDRYGQVHL
                     KLRDTITGATASLVDSMAVDIIETASSLAKQTPSALTKENEKVVNNLASRKRKAYADM
                     LKALRASGFSQNVRADQMSRQQSSAWLATQLPVSIECMPSSFDTTGAAKVENYHHRLE
                     ILMSAMRAAFNGHNPDIASQDLQRGIGFVESIYASSLNERARIVSHITPLSKLYAILE
                     RLNICARSTSVIGGQSVLNALQITESWACQIDGALREIEDGVRQFRGLQGRQCLPDDL
                     ISVRELRQESSLLIRALATTLESVGRSECLLFTNEEYTLLKTASRIRIKLLDRFQSQA
                     SSQPEFKHLFDPVVDMVQQTSEPSVSYSISGDMGPLWIKSDEVVQALLVVAQQMKSNV
                     ITDVNADEYPHIPTDFKQQNVMITSLRIVDVIERLSSFTTALASTTSPFVPNCLSRIV
                     PFLEIFIQTYIQSISAHIHTVKATYKLCYVVGRVVLDLSQKGFCKPQEEGDSGEGEDG
                     DMVEGTGMGAGTGEKNVSQEIKEESQVEGLQGEEEEEQEEQGGEEDDAFSMDEDFKGE
                     MGEGKEKEEGSGDEEEEEEDHDEHVGDVDPLDPGAVDEKFWGEEQKEEEKKESDELMD
                     QQTQDREGESEMTGKEDEKKEKKDNEKQKQGEEAQEEDQSGQKQDEGGEEGKEGEELE
                     DEEVMGEERNEEGEEQPVGQDQQEASVPEGDTLDLPEDLNLDDDGLEDGQDQEEILDD
                     DMGMSIDGDEENDEDREGEEIDRTNEDEGEEVEEAPAATAHGEDETEEEAQMGQDADL
                     SAANEQAQESEVGKGVGGGLEGDSDRQKEEKKEEEGETEEIGADAQGQDGAAPQSQQQ
                     QTSTSDQQQADGPVDSAGAPLPSDNQSQPQLSRSLGDILQEIRRRHDEILSQQEREEQ
                     PSDNQRAPEETSGQVEYVKEDEAKEDDQQALGKAGDEERQKLEDLKIVDEEETGEERQ
                     AMEDGPEEKDVETEARDHKPADSSHQTRGESDNEKEQTEKALTQADISGKPAGEVVDD
                     GMDVDEEVEGGVERGEIPADDNVDEPDLNILDPAPITNEVAAAEDLWRRYATMTSDLS
                     YALCEQLRLILEPTLATRLQGDFRTGKRLNMRKIIPYIASEYTKDKIWLRRTKPSRRE
                     YQVLLSLDDSRSMSESHSVDLAYQTLALVSQAMNKLEVGQVSIAKFGESVDMLHPFKE
                     GGFTDADGAKIMSSFKFDQQKTDVASLVERTLGYLSEARNGAAMSATAPDLWQLQIII
                     SDGVCQDHARLKRLLRRALEERVMIVFIIVDSLHQTTAPSTAPAGTASASRPSILSMQ
                     TVEYKNVNGEMKLEMQRYLDTFPFEFYVVLRDVEALPGVLADTLRQWMTRVSQSQE"
     gene            406561..408073
                     /locus_tag="CNJ01390"
                     /db_xref="GeneID:3254263"
     mRNA            join(406561..406782,406854..406941,406997..407074,
                     407138..407172,407235..407319,407384..408073)
                     /locus_tag="CNJ01390"
                     /product="expressed protein"
                     /transcript_id="XM_567318.2"
                     /db_xref="GeneID:3254263"
     CDS             join(406706..406782,406854..406941,406997..407074,
                     407138..407172,407235..407319,407384..407926)
                     /locus_tag="CNJ01390"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567318.1"
                     /db_xref="GeneID:3254263"
                     /translation="MAPHQSDIFLFTRQMQGSIPSCVVECMSDGNITSCSSNTDYSCL
                     CASQYYIDSVGACMNSSCTASERIAGEAYTGQACAYYGTPLTNTTSSSTNTSVTASGT
                     AVIADPVIYSRAYVNIQAIFSSICGALLILALLSGFLSCRSRYKREQAFSQNRTWTGV
                     GSTTLGGDTRKTSRFFTRTKDTRDPTATFATDNYGVNSSTFGGATTSHTPGQVSFGPV
                     YGANADYGVSSSEGTGGRFTNRLPAGDMNKSEEWEMEVRKSSIKEEELEVESPTTSKG
                     PGSDTDMDGSTVYLTRLDKDDHHAI"
     gene            complement(408142..410679)
                     /locus_tag="CNJ01400"
                     /db_xref="GeneID:3254087"
     mRNA            complement(join(408142..409403,409452..409495,
                     409552..409657,409706..409749,409800..409890,
                     409939..410048,410098..410221,410273..410679))
                     /locus_tag="CNJ01400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657949.1"
                     /db_xref="GeneID:3254087"
     CDS             complement(join(408203..409403,409452..409495,
                     409552..409657,409706..409749,409800..409890,
                     409939..410048,410098..410221,410273..410604))
                     /locus_tag="CNJ01400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513606.1"
                     /db_xref="GeneID:3254087"
                     /translation="MQNLDNRLASFNAVTKPKSKAKPQFPLEASTHPHLTPRALAEAG
                     FYHTPGTSPPSFDNCTCFLCNLELGGWDEDDDPFEEHAKRAGCAWAEMFCAVKIEKRK
                     RDRSDGQYTTVYETANSLPQSAESIEVRAQTFKKWWPHKQKSGWLPTVKALARAGFVY
                     NPSTESKDAVICPYCEYGVEGWEATDDPWEIHQSKVPDCHFFRATLVGEAEGSGIADK
                     PNKASGRPKKSIAPKKSKRGTTVAPLEPSEPEDAEHHSDAEENTDVEKEKPSKASGRR
                     KKSEAPKRPKRGTIVASVASEVEGTKHIPEEDASASQAITSTRRTTKARVTMTTAVAT
                     TTTKAKATKGKKKTGKNEAVSGSQTIKEDAPVAENHTEIEMESDVEEPIPVKKTRAKS
                     KKEKKEQKATAKSKGKQKVTDEPEAEEIVAAESGIEAPTESEAEPAQKPEKKTRAKAA
                     TTAKGRKKAQNKEVEEEEDSKAGTEVDVPSGSEAELPADEQPTPKVIRPASKASASKS
                     SKSSSRLKALPSLPPSHQPPPVKSPTPSSRPLSQLDRFANIPPTSSPASTPRGKATLR
                     STRPTKLSPHAALPREAMDASLTRGALAARKVVDDLFSSPAGASSTMEEMSQPKQTQE
                     PHLPSQPRPLTEQEKQMKLEALIRAEMQRSYNQLKEEGEKMIEDWYEKAKNDRKKIES
                     L"
     gene            410832..412017
                     /locus_tag="CNJ01410"
                     /db_xref="GeneID:3254119"
     mRNA            join(410832..411811,411868..412017)
                     /locus_tag="CNJ01410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567320.2"
                     /db_xref="GeneID:3254119"
     CDS             join(410861..411811,411868..411987)
                     /locus_tag="CNJ01410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567320.1"
                     /db_xref="GeneID:3254119"
                     /translation="MSRIFRRALATFPPRAGPSSTTPSTLFPSASSAAATLPIAVRRR
                     RTEHPPPKFASPSPLSDPALHDPESGKKFPLPLEQDYRDLLRTSEFDGSLSDAELRAL
                     FLKGTAEWKARVRGYAPRGKKGRHAFLLKVMGGQKEAEGIVPQEAEGQNANPNTIVGQ
                     RIYLPNIQIRLMRNHTPPGEAYDPFVATFRIPPSMTKTDLRSYLAAVYNLQVTFIRTD
                     NYLAPVGRTRTGQVRRLGGKGKTYKRAVVGLTEPFHYPDDLEELHAQSEYEGSGDAVT
                     KARDKWLQDNYSLRMMEEMRDRALFKYYKGSRWRAVSQSNVGVTVKEIMKRRKEREAA
                     VAAAVKERYAAVKESADTTQTA"
     gene            complement(413192..415421)
                     /locus_tag="CNJ01420"
                     /db_xref="GeneID:3254301"
     mRNA            complement(join(413192..413715,413769..413977,
                     414030..414070,414131..414238,414291..414433,
                     414487..414574,414623..414695,414748..414823,
                     414874..414888,414950..415003,415076..415151,
                     415208..415232,415294..415421))
                     /locus_tag="CNJ01420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567321.2"
                     /db_xref="GeneID:3254301"
     CDS             complement(join(413372..413715,413769..413977,
                     414030..414070,414131..414238,414291..414433,
                     414487..414574,414623..414695,414748..414823,
                     414874..414888,414950..415003,415076..415151,
                     415208..415232,415294..415352))
                     /locus_tag="CNJ01420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567321.1"
                     /db_xref="GeneID:3254301"
                     /translation="MIEEKYIGLALALGGTFLIGSSFIITKKGLNDAAARNPDYSHSH
                     QRQSGTRNASDDLSYLQNPIWWAGMITMVIGEVANFAAYTFAPAILVTPLGAMSVIIG
                     AILASFLLDEKLGRLGICGCAACIIGSVIIVLHAPSDKEVETVDEILSYAARPGFLIY
                     ITFVAVFSLYMIYRVVPTHGTRNPMVYLSICSLVGSVSVMAIKGFGVAIKLTLSGNNQ
                     LTHVSTYVFGVVVVGCIVVQMNYFNKALDTFSTNVVNPIYYVFFTTATIIASAILFSG
                     FNTPGGVNTISLICGFLVIFMGVFLLNISREPEQIHHPTSLESGLMNPRMSMSGRMSV
                     ESNSAGWNYGTVPNSGYAPDGSLNSAGHGRRSNLYRSQNSTLFNAFEEEGVPLGQLPE
                     EDESSEDEGNARREQQAPGRSLLGKKGREDVAGGRHPAFQDTDR"
     gene            complement(417151..419437)
                     /locus_tag="CNJ01430"
                     /db_xref="GeneID:3254332"
     mRNA            complement(join(417151..417874,417942..418227,
                     418291..418417,418478..418688,418742..418809,
                     418909..418948,419004..419024,419158..419176,
                     419288..419437))
                     /locus_tag="CNJ01430"
                     /product="dicarboxylic acid transporter, putative"
                     /transcript_id="XM_024657950.1"
                     /db_xref="GeneID:3254332"
     CDS             complement(join(417768..417874,417942..418227,
                     418291..418417,418478..418688,418742..418809,
                     418909..418948,419004))
                     /locus_tag="CNJ01430"
                     /codon_start=1
                     /product="dicarboxylic acid transporter, putative"
                     /protein_id="XP_024513607.1"
                     /db_xref="GeneID:3254332"
                     /translation="MAACCTHPLDVMRVRMQTSTTKTTFINAVRTVLMQDGVRGLYTG
                     LTASVFRQMTYSVTRLGVYDLMKNTMSNNGAKKLRTGDMVICASVAGALGGVAGNPAD
                     IILVRMVADPTKPAENQMHYRNAIHGIYKMVSNEGVASLARGLAPNTIRAILMNASQL
                     VSYDFFKEHILAANLMENGMPLHFVSSALSGTVATTICAPADVVKSRIMNMKAGAGGH
                     GPVGLLLESLKHEGPRFLFKGWLPAWIRLTPNTICMFVFLEQLRNAVDLFRNPTAKSQ
                     SAA"
     gene            419585..421241
                     /locus_tag="CNJ01440"
                     /db_xref="GeneID:3254032"
     mRNA            join(419585..419805,419853..419986,420079..420162,
                     420221..420439,420489..420504,420550..420737,
                     420795..420855,420907..421241)
                     /locus_tag="CNJ01440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657951.1"
                     /db_xref="GeneID:3254032"
     CDS             join(419688..419805,419853..419986,420079..420162,
                     420221..420439,420489..420504,420550..420737,
                     420795..420855,420907..421091)
                     /locus_tag="CNJ01440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513608.1"
                     /db_xref="GeneID:3254032"
                     /translation="MICRVSLKSMQLSSLSTFLCRPLSTWPARLPVSRRAMLYVPGSN
                     PRMLEKSLSSPADSVAYDLEDSVSPGKKADARRLVTELLDGERRPKGEVVARINAIGT
                     GYEDDDLNYVLRTRHVQAIALPKTNSPEHIEYVISRINALAPMHKQSGQPEAIKIIAM
                     IENAQAMVAIEAIAASGKGHLDALLFAAEDYCADLGLTRTSSRQELLYPRSRLVTTAK
                     AFGLQAIDLVCVNYKDKEVLREESEEGRRLGFDGKQAIHPEQIDIIHSSFAPNEIDIL
                     KAARIKFSFEHHDQLGKGAYTLDGVMIDAPVYKQASKVLAKAEAAGLEIPKVTLSDIQ
                     "
     gene            complement(420785..423373)
                     /locus_tag="CNJ01450"
                     /db_xref="GeneID:3254265"
     mRNA            complement(join(420785..421248,421301..421359,
                     421416..421513,421567..421657,421706..421796,
                     421844..422086,422142..422681,422915..423373))
                     /locus_tag="CNJ01450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567324.2"
                     /db_xref="GeneID:3254265"
     mRNA            complement(join(420785..421248,421301..421359,
                     421416..421513,421567..421657,421706..421796,
                     421844..422086,422142..422681,422746..422863,
                     422915..423373))
                     /locus_tag="CNJ01450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567325.2"
                     /db_xref="GeneID:3254265"
     CDS             complement(join(421205..421248,421301..421359,
                     421416..421513,421567..421657,421706..421796,
                     421844..422086,422142..422681,422915..423278))
                     /locus_tag="CNJ01450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567324.1"
                     /db_xref="GeneID:3254265"
                     /translation="MEAYLQYRAFTPSFKPTHAPIVEGKEEEALKTLASSPLIYVTFD
                     ENDARNPQNWSKTYKTFVIGLLAFLTLSLTFASSVSSAAEQGMMEEFGCSQIAATAAT
                     SMFLIGMGVGAMPMAPLSELYGRLPIYLITILLATVFEIACAVAPNVPALLILRFIAG
                     VWSTTPLSNSGGSLNDVGDPVLRTIALPLFTTAGFTGPCLGPIIGGFLAENANYGWRW
                     CYWVTAIWNAVAFLSCFFFMPETLAPALLKFKAINYRKATGEHTWRAPIEDESLRKLT
                     VKYLQRPFKMLAIEPVVQFFVAYLLIVYIVLYGYFDAYPIIFGQHGISGGKGGLMFVP
                     VMLGFLILLGINFIHFERYKGLAEDAKKGIERRGIHEGRVEPEERLVPLMGCAIFFPA
                     GMFWFAWTSGVHFNFWVPMMSGLIFGIGLLSIFQGSTQYMIDAYGPMAASALAGSTLI
                     RYVGAGLVILAFPTMYNNLGDQWATSLCAFLGLALTPIPFIFYLIGHKVRSKCRFTVR
                     Y"
     CDS             complement(join(421205..421248,421301..421359,
                     421416..421513,421567..421657,421706..421796,
                     421844..422086,422142..422681,422746..422809))
                     /locus_tag="CNJ01450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567325.1"
                     /db_xref="GeneID:3254265"
                     /translation="MRRKGVSHGVRITQAGSVPHILYGRLPIYLITILLATVFEIACA
                     VAPNVPALLILRFIAGVWSTTPLSNSGGSLNDVGDPVLRTIALPLFTTAGFTGPCLGP
                     IIGGFLAENANYGWRWCYWVTAIWNAVAFLSCFFFMPETLAPALLKFKAINYRKATGE
                     HTWRAPIEDESLRKLTVKYLQRPFKMLAIEPVVQFFVAYLLIVYIVLYGYFDAYPIIF
                     GQHGISGGKGGLMFVPVMLGFLILLGINFIHFERYKGLAEDAKKGIERRGIHEGRVEP
                     EERLVPLMGCAIFFPAGMFWFAWTSGVHFNFWVPMMSGLIFGIGLLSIFQGSTQYMID
                     AYGPMAASALAGSTLIRYVGAGLVILAFPTMYNNLGDQWATSLCAFLGLALTPIPFIF
                     YLIGHKVRSKCRFTVRY"
     gene            complement(424570..426370)
                     /locus_tag="CNJ01460"
                     /db_xref="GeneID:3254095"
     mRNA            complement(join(424570..424741,424799..424937,
                     425002..425433,425486..425965,426025..426370))
                     /locus_tag="CNJ01460"
                     /product="oligosaccharyltransferase alpha subunit,
                     putative"
                     /transcript_id="XM_567326.2"
                     /db_xref="GeneID:3254095"
     CDS             complement(join(424616..424741,424799..424937,
                     425002..425433,425486..425965,426025..426290))
                     /locus_tag="CNJ01460"
                     /codon_start=1
                     /product="oligosaccharyltransferase alpha subunit,
                     putative"
                     /protein_id="XP_567326.1"
                     /db_xref="GeneID:3254095"
                     /translation="MLLATALLLPLALAITPPPQTFVNTAIARTVELGGATAQVTTQY
                     NIKATVDEPGEYHLALSGDGDEIPAWWEVAIGGKAVEGVRIIDDSPPTVSVPLGHLKN
                     GDTTTLSLTHVLTHMSKPLPAEIDQREAQYLLFTTNSTYVDSWYPTDVERVKYRAPHI
                     ILSHTSVPDTYTHDSTVTKAGSSLTLGPFHSLPATLNKHEFEQQPLSVHYESKQPVIG
                     LKSLKRSAEVSHWGANLNIQDEMSLVNAGPRLKGHFSRLAHQQSRFHASTPPQVLTEL
                     PLRIPATAHSAYYYDTIGNVSTSHFRPGSILTQKVKTSKARTSPKTVDGLLELRPRYP
                     LLGGWNYSFVVGYDMPLEDVLKSDQANGKNVLAVPFMTGIKDVVVDDAELKIILPEGA
                     KDVEVYTPFAVDSIEHSIHKTYLDTTGRYAVTLRKARCTEDHAKTVYVTYSYPFSALM
                     QKPLTVASVVGGLFLLAMGLRRVNYSIDKQ"
     gene            complement(426973..428670)
                     /locus_tag="CNJ01470"
                     /db_xref="GeneID:3254148"
     mRNA            complement(join(426973..427209,427277..427427,
                     427494..427680,427732..427856,427911..428249,
                     428303..428670))
                     /locus_tag="CNJ01470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567327.2"
                     /db_xref="GeneID:3254148"
     CDS             complement(join(427091..427209,427277..427427,
                     427494..427680,427732..427856,427911..428249,
                     428303..428575))
                     /locus_tag="CNJ01470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567327.1"
                     /db_xref="GeneID:3254148"
                     /translation="MDAERRSRWADAPSSSSPAPPVGSSAANDTASDAAARAAAIAAK
                     IAASLRPGVQGTELMKKEKEEGDFVKDIEINDLRNRYVLTKGSTQKQIEEETGASITT
                     KGVWVPDRSKMRPGEVPLYLHVVATSQSILDAAIGKINDLINQELGPLIDERTLVARN
                     RALGLPPPSGAMPNGRVKWPEQRLYIGLESLRNFNVRAKTVGPGGMFVKYIQAETGAR
                     VQIKGQGSGFMESDTGRESDEPMHINIAAPTEDQVERAKVLAEDLLEVLRGEHAKARD
                     AHNQGAQGGAYGGYAAYGGQTAGQDPYAAYYAQTGATATGTPGSQPGATPAAGGGTPA
                     QGSDAWAQYAAYWAAYGYDVNDPQFQAWQAQQYGQQAGQPADAAGAGASATPQAGSAT
                     PAVAP"
     gene            428780..430999
                     /locus_tag="CNJ01480"
                     /db_xref="GeneID:3254177"
     mRNA            join(428780..429552,429626..430215,430284..430416,
                     430479..430999)
                     /locus_tag="CNJ01480"
                     /product="expressed protein"
                     /transcript_id="XM_024657952.1"
                     /db_xref="GeneID:3254177"
     CDS             join(429056..429552,429626..430215,430284..430416,
                     430479..430776)
                     /locus_tag="CNJ01480"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513609.1"
                     /db_xref="GeneID:3254177"
                     /translation="MSSRHPPQPPGAFPEDSEFEDSVQVSISEKDSETGPVDPSMSRL
                     QSKYNYERSLQREYPLSSCSTRVWLEEDYYYDGGTDGDEEDRQLESDKRKTQITDESQ
                     PLRTSRTSRTCYDSRTSGGGNSPVTIETILGDGSSAFGTEESEALRKSPPGSKTHPRY
                     TRIQSSGRFATPDPLKQYMSGAIYLDSGDEAEFAHSSAYNSATTSRRGWVPSILPRSR
                     SHKPGSFSSEEESGTETGPFVQFDVENSDDESPFLPPSRVQDPYPVRSTTIETDDPSA
                     TRQSVFRSWLNKLTSFLSRNAATPTRHTPTITTTPTTTVPPQTTAQVLPDFTTTTTTA
                     PVRKPIWEILDGENVNLTERGWQSVIQRTMGSRHPSLQNSFGGTNHPGPSFYPNFSQN
                     QPPWDATNPSQFSQRDQPTMENLIRYHMMMQMRQDDGDYETEDGLGFRSGMRYVPSSV
                     FTHPSVASNGLGGSRRIVRLPDGRYGPSAFGQFTESSQVQPTFMHNAAQQPNNTF"
     gene            433113..434169
                     /locus_tag="CNJ01490"
                     /db_xref="GeneID:3254258"
     mRNA            join(433113..433348,433433..433457,433506..433643,
                     433698..434169)
                     /locus_tag="CNJ01490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657953.1"
                     /db_xref="GeneID:3254258"
     CDS             join(433125..433348,433433..433457,433506..433643,
                     433698..434048)
                     /locus_tag="CNJ01490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513642.1"
                     /db_xref="GeneID:3254258"
                     /translation="MPPRTFTPSVLTSISRALKPPSLPPIIPPHTQTTASNRPPTDAA
                     VLIPLMNINSEPHILMELRASSMRVHAGEASFPGGKADDTDRDLVHTALREAHEELAL
                     PPSSVEILGMLDPEYSLGNRSRVWPFVGFIHSAPPPFSNAVSSLSSLPLSSLILSSAE
                     VSAILPLPLSALSDPRRRSIHLFRLNRFRPYYKIRADDLVIPLPGSKVDIPEHLEIWG
                     LSGWLLNKFAEKVGWLDTPEIEKSPED"
     gene            435105..437470
                     /locus_tag="CNJ01500"
                     /db_xref="GeneID:3254255"
     mRNA            join(435105..435680,435734..436274,436328..436539,
                     436585..436681,436733..437001,437062..437129,
                     437187..437470)
                     /locus_tag="CNJ01500"
                     /product="solute carrier family 41 member 1, putative"
                     /transcript_id="XM_567329.2"
                     /db_xref="GeneID:3254255"
     CDS             join(435153..435680,435734..436274,436328..436539,
                     436585..436681,436733..437001,437062..437129,
                     437187..437304)
                     /locus_tag="CNJ01500"
                     /codon_start=1
                     /product="solute carrier family 41 member 1, putative"
                     /protein_id="XP_567329.1"
                     /db_xref="GeneID:3254255"
                     /translation="MSPILKRDIADQIRQTKKFAATAIGSSYLEEEPYRIPLFEEQPE
                     SRMLKSENTKDGDRGGPAFTSSSSARQGIGVHGSEIEQDYDYREAKWLNTKAAAVDGK
                     GKSKAISEDLGNLEEVEMDQLVSDRLSVDSRKDNGSFDQGVPSERFGYAEPELEIMPN
                     GAGGDKRKDMMSLLFEATPSILLSLVGLVFTGQLLEHLARWRVFRRVDELFILVPMIG
                     NLKGNLEMCLSARLGTSANIGELDHRVTRRTMLIANMTLLGLQSLIISSVAAFISFIL
                     GLLTVHRLGDIPEGMTYGNSTNPGLESADQEWHEGYTRPGWKQLVMVLATGMGSAGIS
                     SAVLGSFMGSLVVISRWAGADPDNITPPLAACLGDLLTLFILALLGTALVGAMDTIIP
                     LLAVIIMSIAAGWFTRRVVRNVWVKEVAKGGWVPLIGAMLISSGTGMVLSKGVSKYRG
                     FALLAISMTGLTGSIGAIHANRLSTQLHTLLHPTHPHPRPVANLSSLHRGHPGLSPLQ
                     RGIALFFVAFPCQGAFLLFVTGVGWVDMSLGWTVWVAFSSTTLISLVLAYYLTLFFWS
                     KDLDPDSYTLPIHSALVDFLGQLLLVLAYETSIALGRDVVVKNS"
     gene            complement(437428..441724)
                     /locus_tag="CNJ01510"
                     /db_xref="GeneID:3254327"
     mRNA            complement(join(437428..437685,437743..438254,
                     438313..438487,438546..438756,438815..438880,
                     438938..439058,439116..439704,439751..439980,
                     440027..440098,440147..440384,440439..440531,
                     440578..440598,440649..440937,440985..441059,
                     441109..441169,441249..441352,441425..441724))
                     /locus_tag="CNJ01510"
                     /product="mic1-like protein, putative"
                     /transcript_id="XM_567330.2"
                     /db_xref="GeneID:3254327"
     CDS             complement(join(437612..437685,437743..438254,
                     438313..438487,438546..438756,438815..438880,
                     438938..439058,439116..439704,439751..439980,
                     440027..440098,440147..440384,440439..440531,
                     440578..440598,440649..440937,440985..441059,
                     441109..441169,441249..441352,441425..441655))
                     /locus_tag="CNJ01510"
                     /codon_start=1
                     /product="mic1-like protein, putative"
                     /protein_id="XP_567330.1"
                     /db_xref="GeneID:3254327"
                     /translation="MSLPMHLRSYREKSKDEYTRDFFNVPLQEQLSGPSDPPSVVKLR
                     NHHAHNGSGLKAGEMQGMEISAVLSVEGKEEVYAGKLSLLPPFLCFISLDRKSCRSTI
                     PLYTIRRVERLNSRAGVFALSLATWHGMRIVLQLTSLLPAAEQFAILLRDALKSQLPQ
                     MKQFKLFLPSLYSEYLLASPSNSHAQTHTDNLLISTEFSATGTAHDGEGDLRGPGGDG
                     KGEYQRGLGETFGFPGDARKMRERSKMRLWREYFLIHGRNFTLLRYPPFQRLLQVGLP
                     SRLRGELWEVMSGSIYLRFSNPQTYDLLLSQNAGKHSQSTDEIEKDLNRSLPEYKAYQ
                     SEEGLARLRRVLVAYSFRNPELGYCQALNIVVAGLLIYMSEQQAFWLLEVLCDRILPG
                     YYSPSMEGTLLDQRVFESLVHRCLPMIHEHFKSVDVQISVASLPWFLSLYINSMPLIF
                     AFRIVDCVLAMGVKVLFQIGLAVLKINGEALLQVTDDGMFINLMRGYFATIGDSAHPD
                     HADPRIRAITNFQELLVVAFREFSVITDETITTERRRLRAIISDEIEKFSKRAAVRNL
                     KRVGSFSKDQIGIIYDHYFAAVCSPEAGPAVQPNAISLPGDQFDQPRIQVDAQGRVET
                     RIDLSTFKVFLGDIATWAREETVTTNAFIQRTDRKVADHELIDRMFFAWDTQGQGSLS
                     LQDVVLGLDRVMSAGLMESIEWFFELHDKDKDGYLTKDEVIQLSESLLFIFRNEPGDI
                     YLASVSKFILNAFEFGDATAPEGSVTSPQDRETLDGDKETASSARERSDSTAGPHNLP
                     YLNLATFRMVVLADELLENFFDRDLSASFQLERTEEEDYHQAHQRPEGLLGGLMNLVI
                     TNENKNRLNRLADGFGAALGKHAEWRKPSLAKIADPQTIANASSDLRARESLLTPAQQ
                     QGNLQRRRSASFTSQASVKTNNTTNTQDTNIQETKSLADVEARYREESQMVRAAQEAV
                     MHRPNFAIDAIGDSDGEEDEEEGEEETAAIMNEVERFLAQHEADDEGLKGEQKKVATE
                     LLKAEPMGAKVPGDKGDASLVDI"
     gene            complement(442061..444188)
                     /locus_tag="CNJ01520"
                     /db_xref="GeneID:3254188"
     mRNA            complement(join(442061..442279,442337..443275,
                     443339..443468,443526..443595,443644..443780,
                     443847..444188))
                     /locus_tag="CNJ01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_567331.2"
                     /db_xref="GeneID:3254188"
     CDS             complement(join(442184..442279,442337..443275,
                     443339..443468,443526..443595,443644..443780,
                     443847..444046))
                     /locus_tag="CNJ01520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567331.1"
                     /db_xref="GeneID:3254188"
                     /translation="MASRSPTDDQRLLDFRNATNFRSVKRADPSIIAILETSVYSVIY
                     HYDERSGRWEKQKQEGPLFVVKREKSPEYLLYMLNRQTVKNPAIPLVPGEMKLTALDD
                     GMLQVARRGDKTRIGVWFSEGHDIVQKFRATILGIVGEPSKRPEASFSPTPQAPQSAP
                     STAAPAEDGLSKLFAGLMKPSTAQPSVPQQSISSQQDNVYPTSVAVPVSQPIIPSPAP
                     ALAPVPPPTQPTVNIEASVSVPLAFAAAPVAAPAPAASEPTKYETADDLLASILGTAP
                     PAPIIKSSSIAQQTVPQQPPAASAQYRQVSPLSYGSAPTPIHQATSPARAYTPQQQAY
                     GQQANELTSPVQQPLAESHVRKSSKVGDATFAQAAQAAAANSALTSNPPMHALSSSSH
                     YSASNDQVQAQGQSHARSHSQTSPKYSSYQSYQPIQRAYQRTSTPSSYRNGAESRTFM
                     AEAMVDATVHKEQNDDVRIWGIELDAKKRKLEFRRRLVDLMMTDEMFVDNVWVAYLER
                     MSAIRSSNSGQWNEG"
     gene            446313..448455
                     /locus_tag="CNJ01530"
                     /db_xref="GeneID:3254200"
     mRNA            join(446313..446640,446693..446775,446832..448455)
                     /locus_tag="CNJ01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657954.1"
                     /db_xref="GeneID:3254200"
     CDS             join(446473..446640,446693..446775,446832..448332)
                     /locus_tag="CNJ01530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513610.1"
                     /db_xref="GeneID:3254200"
                     /translation="MPPKRPLKRRSEDEGRKQTKRTGKNKREQTYDTYDEALDGGVEM
                     EEKGERYRDGDKAQRFYERAVELYAKASELEETYDATYNRARALYTLATNFLLPPSSL
                     PLLRESITLYQHATTLSNSPLLLMDVAFNLAQTFTTLADIMDDLRTADDAEKDDAVLK
                     LRNDAKVTLAEVMDGQEAYLRTVAAQGGEDTEEAEEVVEQIEGGAENQSVEVDAEDKE
                     DDEGGGNTSTWETHLPTPSTYIDTVLALIDLHLLLWESTPTPQPPTEEEQIAVRVILD
                     RAASIAPTGRQAELDLAEIKVLLAMDRIIWDMYKGEANAVSGIGNSLDGAITAIGAVL
                     TSLDSVPAEDSTVRPEILTTLADTHVTIANRLIFLNMQLPPGPSPLAQTAWAHLTQAT
                     AHLISAVDSPTDANTPREFKPSVFLSLSKVSLARAKLASINDTAQRNVVQLFDNATTY
                     ANRAGETLGWRFLRLGPAPPSVGGTLSIGGGSIGGKDLPYPSGWDSELLGRNIALQQV
                     RVCLYATRTELLPAESKEQYQEGLNKVLEKLGKVEEGERKITGKDVERWLGEMEDEED
                     AFGEVEKGWWTEVTAGL"
     gene            complement(448420..452781)
                     /locus_tag="CNJ01540"
                     /db_xref="GeneID:3254084"
     mRNA            complement(join(448420..448628,448683..448720,
                     448770..448846,448906..449063,449121..449173,
                     449222..449317,449369..449446,449498..449557,
                     449610..449687,449740..449809,449859..449884,
                     449937..450031,450082..450297,450344..450544,
                     450594..450674,450733..451009,451058..451889,
                     451939..452116,452167..452272,452335..452781))
                     /locus_tag="CNJ01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657955.1"
                     /db_xref="GeneID:3254084"
     CDS             complement(join(448560..448628,448683..448720,
                     448770..448846,448906..449063,449121..449173,
                     449222..449317,449369..449446,449498..449557,
                     449610..449687,449740..449809,449859..449884,
                     449937..450031,450082..450297,450344..450544,
                     450594..450674,450733..451009,451058..451889,
                     451939..452116,452167..452272,452335..452707))
                     /locus_tag="CNJ01540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513611.1"
                     /db_xref="GeneID:3254084"
                     /translation="MFDPAFLLSNSKSNNVNLSTSTSTSSSDLLSSVRAERLAREEKR
                     HQELAAIEIQKVWRGRKVARDFRERILDDLERSLGIEGGLNVEKGGREMVVLLRDAKN
                     KKDTDRKQIVSANWCDLGLQVKDGRPNLVEPLNRDPGWGRILGLLSIRLLHVVDCNPT
                     TVHVPSILSGLEAIADPSSYTGFPAQLADTARYEWLEAILNNQWVDKLVSILSKLISA
                     SLPKKKHPSISPIIRLLASPLSAASPSQLAPVLAPMVNQLFAIPNLPSSLPLQALTYL
                     SANFHIFDIVIPFASQNPQILTEGRLSDELGKTYFLANLVTFGISGQLLSRSGIHGAA
                     AWMSVVGAVLSQMHDGWGKWIEGSTQDEDVIMEPIVEDSDDEIPDDTVVMPSRKPPRP
                     RRIPLPLTICSKLVLLSTASHISILTQYILSLPRGAPATLLIDFSSFFLGMLSAYRGS
                     PKWEAVLDSLVDGKRGLALLKSIWREGVRGKWEGTEDRSAWEQFSDNPVAPCLLLLTH
                     MYCHYLLLTPDDEFFSPDRNPFNTDEVLQLAAIWRDLAYWGYISGVSSPGGAPNGKGR
                     DRRGNEEARALFTKGVTRVVERNARRQFARSDFWVMKTQMDMQGFVEAAVYEDAELSG
                     LNDEERDVTSDTLPRWARARHRYSKRQMAYISPRLGLLNNLPMAVPFETRVQVFQMFI
                     EADKAKLGIEYHGRMFRSSAKIRRDHVAQDGFDELSNLGPALKGRVDITFVDQYGITE
                     AGIDGGGLYKEFLTILSKEVFDSNRGLWLVTDQNELYPNPHSYASESHNLSWYRFIGQ
                     VLGKAIYDGILVDVTFAAFFLAKWLGRQSYLDDLASLDKDLYKGLIILKNDPKPEDMA
                     LTFSTTIEEFGVQRQIDLVPGGSDIPVTAENRHEYIQHVCKYKLDKQIAAQSKAFFIG
                     LSDLLDAKWLRMFDQQELQQLIGGEEKPIDLKDLKAHCNFDGFPNDVTPALFWKVVQG
                     FTEEQKRALLRFVTSCSRPPLLGFSQLNPQFGVRFNGGDMDRLPSASACFNLLKLPGY
                     TTEATLRAKLLQAINSGAGFDMS"
     gene            complement(452945..458182)
                     /locus_tag="CNJ01550"
                     /db_xref="GeneID:3254314"
     mRNA            complement(join(452945..454591,454674..455188,
                     455248..455391,455444..456256,456308..456398,
                     456452..456584,456634..456749,456797..457583,
                     457643..457772,457825..457939,458043..458182))
                     /locus_tag="CNJ01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657956.1"
                     /db_xref="GeneID:3254314"
     gene            453003..454689
                     /locus_tag="CNJ01555"
                     /db_xref="GeneID:36393063"
     mRNA            join(453003..453730,453796..454689)
                     /locus_tag="CNJ01555"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658764.1"
                     /db_xref="GeneID:36393063"
     CDS             join(453201..453730,453796..453832)
                     /locus_tag="CNJ01555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514445.1"
                     /db_xref="GeneID:36393063"
                     /translation="MLDQGQVRNLLRDFVRTPREPWSVHAKRYNVNVTTIVKVAHEHG
                     FYRRIMRRKPYLSPKTIAKRKEWARNNVKRDWRDVVKCALELGGGITRRPRTTRHVGE
                     AYAPQHILPTFHSGRQSLMVWGAISYYQKFPLLRLPLAPSTIKNGVRTKAESLNGPRY
                     TEMVMSFEIGEQFWVVRGHRGQMDNSGN"
     CDS             complement(join(454998..455188,455248..455391,
                     455444..456256,456308..456398,456452..456584,
                     456634..456749,456797..457583,457643..457772,
                     457825..457939,458043..458045))
                     /locus_tag="CNJ01550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513643.1"
                     /db_xref="GeneID:3254314"
                     /translation="MATLMDFSHPDRRSDAEFQEILDTFVGDNETVLTGNLPNLLAGY
                     EKDHEIKILEEADFLGVKELCEQYPDLELGPVDLFGFLMAVLQRETSPAYPTPNSAPS
                     PGHITPEDGRRRRRISDRIRSPSDNSSSSSSGEENDIRSNRQGSAPSSSQASFQSSTT
                     APGPAGFAVPVRKKTLSDPNRSDSSLDSPLPVRMRSKDNPPSAFTGGFARPSPASRRR
                     TASSTIHPDDDLKSTDLSNPIKRSFSSSSLRLQSPQPWKRLPSHHSSRPPSPMSPMDQ
                     IDSTSLHERTKSREIDDGKSEEVEQIEQKVIPDVELDQMEDEEGNEKRDGVDHDVGGN
                     ETLLPRLSRISTESMASLHTSHDQLRRLRKENNELSRKLKETEKSLALQGAENERLVE
                     DLQTRLEETQSEIAQRRKDEKEMRGKDRAQLIQISGYEADVLSLQRSLENARANHANM
                     QKMYNSQCDEAQRLRDMLRDRDEEIRELEDAVNAHSADEEKLTQEIRALEDEVKRLEA
                     DLSRARQAESHLQVQKQENLALKETIDRMRFDLDEARAAAALAGGGTGRGTGSAAASS
                     VGGTISRNLGDELGRRLVAVERVEEEEVEDGFVETIVTTQRTRKVGGRSAQSAGSPSQ
                     DPAVRIEKGIREYIDASAATDSALHETISSEPPAYTVEPPPINSDQILQRAHPRDHKH
                     LEGLSESGETIAEEEEYEALVDALGVRCTILEDEVKMKKLERAKNGGGPVRRRHKRHS
                     WTTDQATGGIVQFFFHGTNDSRDTLGRFAVFAVAVFAFGVIAGPHLLGPSAAGLHPRD
                     YKLFQQMNTLASVAGVGEGFLPAHMLGVVENGARLVAGRIPT"
     gene            458462..459651
                     /locus_tag="CNJ01560"
                     /db_xref="GeneID:3254227"
     mRNA            join(458462..458530,458825..458899,458949..459063,
                     459121..459198,459252..459488,459537..459651)
                     /locus_tag="CNJ01560"
                     /product="60s ribosomal protein l20 (yl17), putative"
                     /transcript_id="XM_567335.2"
                     /db_xref="GeneID:3254227"
     CDS             join(458826..458899,458949..459063,459121..459198,
                     459252..459488,459537..459551)
                     /locus_tag="CNJ01560"
                     /codon_start=1
                     /product="60s ribosomal protein l20 (yl17), putative"
                     /protein_id="XP_567335.2"
                     /db_xref="GeneID:3254227"
                     /translation="MARFTEYSVVGRTLPTEADPAPKLYRMRIFAPNEVVAKSRYWYY
                     LRQLKKAKKAHGEIVALNVIHEKKPLKVKNFAIWLRYDSRSGTHNMVKEFRALSRAEA
                     VESMYQDMAARHRARFRNVQILRVAEVEKKDDIRRPYIKQLLEPGLKFPLPHRRTKSK
                     AWFAANRPSTWA"
     gene            complement(459845..461583)
                     /locus_tag="CNJ01570"
                     /db_xref="GeneID:3254149"
     mRNA            complement(join(459845..460578,460628..460996,
                     461038..461583))
                     /locus_tag="CNJ01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_567431.2"
                     /db_xref="GeneID:3254149"
     CDS             complement(join(459947..460578,460628..460996,
                     461038..461554))
                     /locus_tag="CNJ01570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567431.1"
                     /db_xref="GeneID:3254149"
                     /translation="MSVLTDHYNDYPSDSSTSSSGDMTLSSSSSSLSSPSTSVNFVPL
                     SQAPDTIRMSQADGHWDCETRGRTPYASDSTTAPPSPLSTPRRIARRKKLVYDALECA
                     CLLASIANGEIIVRLEIERKDNAQKTGERLKKDKGEEDGSIQRPWERLVKSLRELQKE
                     DPVETKIIERCSAVLNETVETQVRPLTDQKLFMQPLTGFESRAARSLKSKEPVNSLSM
                     SLQNPSALANVPLFLLLRFARFALSPAKSKSYLDLSHLPYPDAKTFLEEMDIDWLMEL
                     VGCEAADVTHLDLSNNFLTQFPHWPAFPFPNVQVLRVTSNPLPSVPYSLIHLPNLRRI
                     PHRHTLLAHPRSGQDCAYKTYFWGTGHPSLPKRVELDKKQVSALPKRERGVPSLVEFG
                     MLMVARQRVEFTPSEDNQWLNEARYFMPVHLSERMENSFVCDRCHQLHIPPSLEMAEV
                     TRKVGQRFGDKVWDAKWMTGWQLKKRHEDRSSTVWLEMVLCPLCLYHVLAVTSGR"
     gene            complement(461986..463279)
                     /locus_tag="CNJ01580"
                     /db_xref="GeneID:3254110"
     mRNA            complement(join(461986..462210,462264..462421,
                     462480..462568,462620..462683,462735..462821,
                     462877..462986,463040..463113,463175..463279))
                     /locus_tag="CNJ01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657957.1"
                     /db_xref="GeneID:3254110"
     CDS             complement(join(462130..462210,462264..462421,
                     462480..462568,462620..462683,462735..462821,
                     462877..462986,463040..463113,463175..463198))
                     /locus_tag="CNJ01580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513612.1"
                     /db_xref="GeneID:3254110"
                     /translation="MFVLIGVRDTVPVAPKTFDIPPVTTITDALNTKYANKLVPEKGL
                     ALSVFDILTAEDGKVTWGNGLMYYKVSFRLMLFAPFVGEVIVGRVLSTTKTYIRVSLG
                     FFQDIYIVPSLLPPNSAYDPQQKAFFWVAIDDESTLTQEQLLNTVISERLYIDLGEAI
                     RFRVDSIEWQDVRPTPQAMLAEMNGEAVEGKDPIEKAGFKILATIAESGLGVTAWWPG
                     REENEEMYEE"
     gene            463464..466490
                     /locus_tag="CNJ01590"
                     /db_xref="GeneID:3254316"
     mRNA            join(463464..463580,463631..465911,465966..466490)
                     /locus_tag="CNJ01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_567337.2"
                     /db_xref="GeneID:3254316"
     CDS             join(463489..463580,463631..465911,465966..466439)
                     /locus_tag="CNJ01590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567337.1"
                     /db_xref="GeneID:3254316"
                     /translation="MADDIELNFAVPASGLVRQVAPKKGGRWTDRVRAKREARDAFKS
                     MKANHLTVQNPSMPTVSASELVPKPAVIKPAPTSASVSRHPQPKSQVVAPPRFTNATA
                     GPSRPAPSPQAASSNVPKSASIPAPATIKHRTSLPTNAFERPPLPPQAGPSRPHPAEK
                     LKTPQFISSLFTSAPLPGVKSSVAPEISTGAPSNAPVDTTTFQGLGLNKLLINHLKGK
                     MGVEKPTGIQRNCLPYMLSSPLNPDKKAGDEGPKEEPLRDVLIQAQTGSGKTLSYLLP
                     IVQTLLPLSRLSYIDRSIGTLAIILAPTRELAQQISKVLEQLLHMSFAASKEGSDDED
                     EDDRPFTRWLVSGLLTGGSTRTHEKAKLRKGVPILVSTPGRLLDHLQNTMSFQCAKTM
                     FLVLDEADRLMDLGFEETIQGIIKALEGRRRNEINIEKEMDKEGGGTMRWPFWDRGRL
                     NVLCSATVDAKVERLAGAALRDPVLFRSEKDEAEAKKKAEGKDDAVIKALNEAQAIVI
                     PQESEEKFTPPSQLSQKYVVLPTKLRLVALVALLRSLISSVAKGISVSNGTKVIVFLS
                     STDAVDFHWKLLGGVQMGQQGQQADGEKEEDEEEEGESVEERESDGESKAKKSKRKAK
                     SKSTDDIVSLASPLFPNTTLHRLHGSLPLRTRLASLKAFATSSSQPSVLFATSVASRG
                     LDLPLVRAVVQYDLPTEGGANEYVHRVGRTARAGKGGEAWAFVSPSEEGWVKWIEGKM
                     GAAEGKSGVNLGQVGVEDVLRKGFGGKSYEYEARATDVQLSFENWVLASEQNAALARK
                     AFASFVRAYSTHPLEEKQFFHTKLLHLGHLAKSFALREAPAQLASALSAGKSKRPKSK
                     AASSATHPGKRKRDEDEDEMEERGGKELTARNETERRMYEAVRKQGRTIKSGGKLGEF
                     SGKGQNKGQKAAATGGEFHIVNTGELERLVARRK"
     gene            467497..470978
                     /locus_tag="CNJ01600"
                     /db_xref="GeneID:3254259"
     mRNA            join(467497..467916,467978..468105,468160..468275,
                     468333..468385,468447..468504,468560..468619,
                     468671..468737,468788..470156,470213..470252,
                     470307..470412,470470..470978)
                     /locus_tag="CNJ01600"
                     /product="expressed protein"
                     /transcript_id="XM_567338.2"
                     /db_xref="GeneID:3254259"
     CDS             join(467764..467916,467978..468105,468160..468275,
                     468333..468385,468447..468504,468560..468619,
                     468671..468737,468788..470156,470213..470252,
                     470307..470412,470470..470836)
                     /locus_tag="CNJ01600"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567338.1"
                     /db_xref="GeneID:3254259"
                     /translation="MPSLLTRIEGWEEIEEPMLHQAMGRDTIALAPQTTPLESDRWMV
                     IVNVVILCLTVLGAGMILSSMAINEFVFSRPGTTRTRIVQALIVSDLLLGIIGLISSG
                     LTLTGDGHLMSHGTTSCSGLGFMLTAILWSEHLWTLLLAFATYMILTNPLHSMTLWLE
                     KKWFYFYIIVWVIAIIMGLIGYEVYGFYPAGGICFYGNNTGLYAELIQFIPRAIVCLT
                     ITVLYSRLIVFLRRPDKIRVKSGSTTGYSDEIISDTRQRSGLLPFTNPFRRNCASTGN
                     PPQGNQNAAIATVSGETSESSQPVESIKDKDARPISAFARKSWSLPTSPTSLPENMAD
                     LPPWERIELPAFQIDGEKFGGPATAVGGSSSLWSGWKGLGGRKRPSTGSSMISPQLQE
                     APRFGSISSSASVDDGTVSPRGVAGKLKVSAQTLVAPRMEIIGSEEVPTAPRDHLSSI
                     SPLPEDVTDDVSRNRHRKASNSGTMVDLSWCTHKMPSHGSFTPSNLPSSDKLSTLENH
                     RPSVATVVDSIESIRASKKLLVSSIAFDDDASIPAVEQLPTAQPQPTRPPSPIFSQSA
                     PSSRPHSPSQPRTTLFSNPKSLHSRQHTLSGPDVGTSSAPAALDEDDLDEELDLMKML
                     AATPPKADDRFALPPGEQYELVPESMSSYLNRKTAMLMLWFPLGYLLLFSVSFVRIIY
                     DFCGNPPHALRAISRWFILAQGLLDAIIYGVVEWHTKRVVRKRVRRGTFSPHHSSTGS
                     RVVNSTARVVNSITSRMTHSRGNGSGSGLGTGSAINCENLPGDNDRVSYQAGQTRSGL
                     HGGHVTNVNSGLGTRPRNGEELVSDEKQKSGNGEVPSKKT"
     gene            complement(470950..472850)
                     /locus_tag="CNJ01610"
                     /db_xref="GeneID:3254053"
     mRNA            complement(join(470950..471256,471309..471355,
                     471405..471428,471482..471502,471557..471738,
                     471792..471921,471975..472028,472095..472113,
                     472169..472270,472323..472850))
                     /locus_tag="CNJ01610"
                     /product="expressed protein"
                     /transcript_id="XM_024657958.1"
                     /db_xref="GeneID:3254053"
     CDS             complement(join(471025..471256,471309..471355,
                     471405..471428,471482..471502,471557..471738,
                     471792..471921,471975..472028,472095..472113,
                     472169..472270,472323..472471))
                     /locus_tag="CNJ01610"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513613.1"
                     /db_xref="GeneID:3254053"
                     /translation="MSLGSEFQGFKQWKSLEERGISSEVLETLTDESRECLERLANYD
                     SHSVHDFGIVKQAAVLVVLFQREADDKLHVLLTTRAKTLRRHPSQTALPGGKVDPEDR
                     DATHTARREAFEEVNLPLEHPSIHNLTVLEPVMTILPLNAHMKNHIIVIPTVCFLSDT
                     SLLEHLRPSPDEVDAIFTHPLKGCLTGTVEGKDLEGLAEKGSEWWPHKEEFHSIEDRI
                     GTTGGYRMHRFRTKRTPIKGLTSDVLIHAASVAYGSPPAFGQFAPNQPPFSSAISNVV
                     LELPCVIDQSTAASIPGEPPRVLEWGGTEAGIRIISREQYELV"
     gene            complement(473178..473280)
                     /locus_tag="CNJ01620"
                     /db_xref="GeneID:3254268"
     tRNA            complement(473178..473280)
                     /locus_tag="CNJ01620"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3254268"
     gene            473405..475198
                     /locus_tag="CNJ01625"
                     /db_xref="GeneID:36393064"
     mRNA            join(473405..473588,473652..473735,473812..473856,
                     473928..474018,474069..474089,474143..474228,
                     474284..474634,474701..475198)
                     /locus_tag="CNJ01625"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658766.1"
                     /db_xref="GeneID:36393064"
     CDS             join(473527..473588,473652..473735,473812..473856,
                     473928..474018,474069..474089,474143..474228,
                     474284..474634,474701..474899)
                     /locus_tag="CNJ01625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514446.1"
                     /db_xref="GeneID:36393064"
                     /translation="MTFLPASLEHCLPPLKPESLQCIYHLLSYSPPEIKRRLPLRRCA
                     AVAVILFVGRLGDLYVLLSTRAGNMRTFAHDTALPGGKYEPGDIDAEGTARREAYEEV
                     GLPNDRNKVRKLCILDSFLTGNSLIVTPVILLITDYTLTPLLNPAEVSLLFSMPLASF
                     LHSRPSKIPSFQYSIFHRLASIPPGTIESIPPPPPIAYAEDEGHVSWKEGKFYGYRDV
                     KWGEGMVRMHRFLTGRESNGVKPVYGLTAAILIKTATVAYNRFSDFPVMAPGQRSMEE
                     RIEFEIRHVQSPLRRALEAEELCNEWREDGEMKAKL"
     gene            complement(474985..479961)
                     /locus_tag="CNJ01630"
                     /db_xref="GeneID:3254368"
     mRNA            complement(join(474985..475264,475321..475708,
                     475760..475786,475841..476225,476278..477044,
                     477097..477914,477965..478305,478358..478718,
                     478767..478885,478936..479014,479072..479961))
                     /locus_tag="CNJ01630"
                     /product="DNA repair protein RAD5, putative"
                     /transcript_id="XM_567340.2"
                     /db_xref="GeneID:3254368"
     CDS             complement(join(475235..475264,475321..475708,
                     475760..475786,475841..476225,476278..477044,
                     477097..477914,477965..478305,478358..478718,
                     478767..478885,478936..479014,479072..479836))
                     /locus_tag="CNJ01630"
                     /codon_start=1
                     /product="DNA repair protein RAD5, putative"
                     /protein_id="XP_567340.1"
                     /db_xref="GeneID:3254368"
                     /translation="MASINGTSSSPVASTANGKGSQPHTSNNTSMQPPSLRSQASIDL
                     TGDDSSGEEVVETPRLGESSIIRSPEASGTMFSFAQNAQAPQSDSPSASLHAPSSSRL
                     PFTIDQRPSAFNSDGIAYARSGTQSPSVSASFGTMPAGQNLAGFGQYASQPSVSGWTP
                     GGSSSHHVNGDDSTSAFYANGTDASSAIDLTSRNIPSPPSIDEKKPLCIGSLRSNALM
                     LYPCPAVVVGAQPPPGSKERYDLVVYRGVEFLKVKLKYRAAGTLSRKDDPTSVLQRDT
                     IQVLTPSLTTYVGDLDSRVAVHLANLMSRGLCRLEGFVPRLHPDAPQFQVRVDVLVFT
                     LPSNVQYIANFLVGYSLFLLDPVPPYDPSRHSDHPSYQNGHGSGEAAMQLLAYAQRRA
                     MGAPGNAGSEFVFSDKEREKATQVEVQRKQVDEVFKSLDNGTELEQSDPGPLIKTDLF
                     PHQRKALTFFLAREQDSSCLKQCKKAAKKALRKKRGHTADAEAEEEKTKGKEKKRDEE
                     DGGNSLWEPVKDDRGKVRSWKNKITGEDFRGKKGKPAESKGALLADDMGLGKTLSVVS
                     LIAATRSSAREYARTKLESTISTNEASDEESDIKAGDFKTKIFGMPSIDEQIAADTAN
                     KKRKRDDDLFKNLSARRSRITTRSKATLLITPMSTIANWEDQIKEHWNGPVEIVGGAS
                     GMMPPKKIERKWKPPKGKGQESSEDDDLENFDLLRVYIYHGPSRRPDPKFISEFDVVI
                     TSYNTLANEFSKQNGAYDTETNTPGETANNSGDEGAENKKVADSEIKPAEVAALMKSG
                     KKGKGKARSGDQTSPLQAIDWFRVVLDEAHYIKTASTVASQAACYLEADRRIALSGTP
                     IQNKIEDVWALFKFLRISPVDDKDVFTSYVSSPCKYGEQIGIARLQLVMRCCTLRRTK
                     ESTDEDGSKILNLPPRSERQMWLTLRDDERKIYDERANKAKDKFGELKANNEVSKMYV
                     NMLQEVLRLRQICNHVDLAMEGPVEEDYDGTIMDYEVAVQGIERNGLTQPRAVAVVCS
                     MKEGEGATCTSCGLDFGDWFPWVGLGGVEEEKEKPKVKKMPTKPLLTKCLHLYCLVCF
                     KAQIYPEYSKRMKGTLARSCHCCNTMIRLPSDVIEVIPPDSADASEQAVAEQAPPKRA
                     ARKKYIRPPGEKLNLSTKMQFLHDELLRFSKKNPHSAHYDPFSLEQDDVEEMDAEGKP
                     VVTKSIVFSQWTTMLDRIADMLDETNIRYARLDGTMTRDERSKAIDALKFKKNVEVLL
                     VSTRAGGVGLNLTVASRCYLVDPYWNPSVESQAIDRIHRMGQTRPVVAIKLMIKDSIE
                     EKLDKIQKKKAELAQLSLKNMSRKELMAQKSEELASLFN"
     gene            complement(480041..481589)
                     /locus_tag="CNJ01640"
                     /db_xref="GeneID:3254297"
     mRNA            complement(join(480041..480836,480886..481067,
                     481119..481228,481289..481334,481405..481589))
                     /locus_tag="CNJ01640"
                     /product="L-ornithine transporter, putative"
                     /transcript_id="XM_024657959.1"
                     /db_xref="GeneID:3254297"
     CDS             complement(join(480167..480836,480886..481067,
                     481119..481228,481289..481334,481405..481455))
                     /locus_tag="CNJ01640"
                     /codon_start=1
                     /product="L-ornithine transporter, putative"
                     /protein_id="XP_024513614.1"
                     /db_xref="GeneID:3254297"
                     /translation="MADEVQTNAMEDVLFGSAAGMVAKLFEHPFDLIKVRLQSQPTDQ
                     ALKFTGPLDCFKQTSAKEGWRGLYRGISAPIVGAACENATLFLAYNKCKEGIYLLRPD
                     GKGKDREFNMKETALAAAGAGSIASFILTPIELIKCRMQVQMLAREGAFGAAPVTVPA
                     PGIHPFATTPNPSVPHVAPQLRAAAPLGPIALIIDTVRQSGIRGLWLGQTGTLLRETG
                     GSAAWFGSYEWAARWFMARHQITIGRERKATKSDLTAVELMAAGALAGVSYNVVLFPA
                     DSVKSSMQTSAELNPDKPPPGFWPTAKKIWKSRGIRGMYAGCGLTVLRSAPSSAMIFY
                     IYTRLESEFGGFLNQDIA"
     gene            complement(481713..484922)
                     /locus_tag="CNJ01650"
                     /db_xref="GeneID:3254073"
     mRNA            complement(join(481713..482374,482428..482552,
                     482608..482748,482797..483388,483442..484330,
                     484427..484922))
                     /locus_tag="CNJ01650"
                     /product="Extracellular elastinolytic metalloproteinase
                     precursor, putative"
                     /transcript_id="XM_567342.2"
                     /db_xref="GeneID:3254073"
     CDS             complement(join(481911..482374,482428..482552,
                     482608..482748,482797..483388,483442..484330,
                     484427..484711))
                     /locus_tag="CNJ01650"
                     /codon_start=1
                     /product="Extracellular elastinolytic metalloproteinase
                     precursor, putative"
                     /protein_id="XP_567342.1"
                     /db_xref="GeneID:3254073"
                     /translation="MRSSALIALLPLLATLVTARPHHHEHKHSASRTRKSLSFGPAHS
                     HASFEVLDDAVHAIEPRGLIGEPIDVNRVAQTFLGSQLGAQEGEGFYIREDSYTDART
                     GVTHIFARQLLNGLEVSDGDINLNIDRDGRIISWGNSFHPGSAPSLSDIHSSSSGETE
                     KVCATLHQQLDEHKAHLAELKGETGVWGLVKSAAQVVLGSSLPQGEVDHHEIKKVHKS
                     MRHIENHLHAVCRQSAASTQSMLSPVEALVSLLPRLSPIDDLEDISPLDLTCTPHHTL
                     KPKPAFAEPPTEVISGAALSKAGVVSDVSARLMYTQVSEGAPRLVWKYEVEMKDSWYE
                     AYVDVLSGELIRVVDWASDFDIDELREKIEMMKGGKQKPLPSPPKTIKPYSYQVFPWG
                     INDPVSGNLSVVTEPWDTVASPLGWHTFPTSANPWDVTIPGQTTNHNYTVFNTTVGNN
                     AYAHENWEGRNNFLLNSRPINDSHIFVYDYGEPEGLAPKEYVDMVVTQLFYTANMYHD
                     LLYRLGFDEISGNFQAYNFRLGGKGGDPVVCNAQDGSGYNNANFLTPPDGQAPRMRMY
                     IWDTATPYRDGDLEAGIVIHEYSHGLSTRLTGGPANSGCLGYGEAGGMGEGWGDAIAT
                     LVRQVEEHKNFENGTDVFSMGAWAANTDRGIRNYKYSTNFTINPSTYKTLDKPGYWGV
                     HAIGEVWAEFLFVLSQRLVEKYGFGTTLFPPTDTSKPNDYYTRTSEESIDAGGRSLPL
                     VPKHGNTLAIQLIVDAMKLQPCRPSFFDARNAIIQADQILTGGENACLIWEAFAERGL
                     GEDAAVVGQTPWGGGVRSDGFRVPKKVCGSKKA"
     gene            485328..486909
                     /locus_tag="CNJ01660"
                     /db_xref="GeneID:3254061"
     mRNA            join(485328..485920,485968..486171,486236..486442,
                     486495..486909)
                     /locus_tag="CNJ01660"
                     /product="expressed protein"
                     /transcript_id="XM_567343.2"
                     /db_xref="GeneID:3254061"
     CDS             join(485495..485920,485968..486171,486236..486442,
                     486495..486794)
                     /locus_tag="CNJ01660"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567343.1"
                     /db_xref="GeneID:3254061"
                     /translation="MTTTIPSSNSDTSPYTSITIPATKAPKHEDLVEAVLDSVDNITT
                     DFIDNSSLTSTDVKNDPILSSIAQKQVQETVKNIPKGGFTAKPAPNSTYKGNAGPRMT
                     KTAALRLGLKWEDVKPKREITEKSEEGKGTPGHKRTGLDIKVPSLAAPSVTPRSTRTS
                     QLRTGVQLTPQSIKKDPQTMAVANKSREMEERERRRKSIARPTSLAPPSITPRQNKSS
                     MLRTGIKSPQSVSSVSSTTQSMSLAGHSEEVNGKGGDKGVKSKLPRKSEMMPLKSLGT
                     PSITPRLNKAALLRAPHSSHSSISYSPSPSPFKTRGHSPISSTSSNPRSSFAASGVTN
                     RTSTRSATSKEVPASPGVGPAATKSSLLRAAQGAKVPKVVSSGV"
     gene            487993..492251
                     /locus_tag="CNJ01670"
                     /db_xref="GeneID:3254085"
     mRNA            join(487993..488114,488282..488516,488577..488864,
                     488923..489809,489868..489983,490095..490357,
                     490404..490490,490543..490666,490721..491520,
                     491580..491745,491802..492251)
                     /locus_tag="CNJ01670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567344.1"
                     /db_xref="GeneID:3254085"
     CDS             join(488302..488516,488577..488864,488923..489809,
                     489868..489983,490095..490357,490404..490490,
                     490543..490666,490721..491520,491580..491745,
                     491802..491918)
                     /locus_tag="CNJ01670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567344.1"
                     /db_xref="GeneID:3254085"
                     /translation="MTSAIFTLPPTRRTLSGSSDSDTSPWSLRSEIESALKGTDVPII
                     PGVREEDNEWSFKRSVPTVVLYDETGLRLYDKITAEAPEYYLFNDELNLLKVHGKEIA
                     QCMGFSRSHKNNKGPFHGTEYPPEKRWKPARWGDEAVGKWNHGVNGEEGLGGDWQRGW
                     DIVELGAGALRKTAHLLTALTSSLPDPPSNASTLPPPITYHPLDLSYPELNRVLGEMH
                     EAIGDKLDGKVACVGLHGDYEAGLQFIRDGKLAQMRKSFNNKSESFAEEPFVNSTASS
                     VPQAIPIANQTYQEGSPTLSPLSTHLVTPRDAPSPLPAMYDPRIVHGGSSPSSYSSEP
                     SEEHMPVSKETSHPRSAAREAPVPGIGPGPTQADRPLHFIFLGSSLGNFERPSAAPFL
                     KSLPLRAGDTLLLGLDGRPALGKEGSKKVEVAYNDPAGHTKRFEEHGWDIVKQELGAK
                     GNAEFVGRYNEELGRHEAYFRSKERQTIHLPTYDQDITIEEGELLNIEWSYKYSIKEA
                     MDLFTAADLRVINSWKAPNSEYRLWLLERPSVRFIAPASNDIASDRLSALNMFNSANG
                     GELLKVKGLPKWEEWIALWKLWDHITLDMIPKELLHQKPIDLRHICLFYLGHIPTFLD
                     IHLTRMTTGRHTEPGYFKDIFERGIDPDVDDPTKCHDHSEVPASEEDWPNLTQILDFR
                     DRVRQRLLGIYSDLASGKMPLNRRVGRVLFMGFEHEAMHAETLLYMLAQSPLTRAPTT
                     VKEPQWELLKEQWAAAKAENRVLIVKGGEILMGHDDAEKDDEKCQTGESWADHEFGWD
                     NEHPRVSQQVKTFKIDSLPISNSDYLSFLSSTGALDNLKCETAPASWVNTSQTDTPEW
                     KIRTFYGPVGFDVGGSWPLMASKLELDGFAKWKGGRLPTEAELRKLWESEEGPRVNGA
                     VNNVGVKNWHPVPPTNTYIDNAGNVIHGHNGGVWEWTDTPFDGYEGFLTSQLYPGYSS
                     DFFDGKHFVVLGGSYATIPQIAGRKSFRNWYQSNYKYSFVGGRVAYDA"
     gene            complement(492090..494778)
                     /locus_tag="CNJ01680"
                     /db_xref="GeneID:3254121"
     mRNA            complement(join(492090..492317,492376..492401,
                     492467..492526,492580..493454,493501..493906,
                     493955..494033,494088..494196,494251..494357,
                     494446..494533,494646..494778))
                     /locus_tag="CNJ01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_567345.1"
                     /db_xref="GeneID:3254121"
     CDS             complement(join(492270..492317,492376..492401,
                     492467..492526,492580..493454,493501..493906,
                     493955..494033,494088..494196,494251..494357,
                     494446..494533,494646..494722))
                     /locus_tag="CNJ01680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567345.1"
                     /db_xref="GeneID:3254121"
                     /translation="MQAIKLGKKYPDLKQDEIFDLINKFKQIDVDDKGSLDKATVISA
                     LQANGEADYDSARETLKNVNIDASGRVELEDWVQLHSLLKAAKSQPLLEHNKGNISVR
                     GTAGTNAQHTINEDERRSFTDHVNTVLAADKDVGHLLPIPTDTMQLFDECRDGLILCK
                     LINDAVPETIDERVLNKPTVKAGKARPLNAFQMTENNNIVITSSKGIGCSVVNIGPQD
                     LIEGREHLILGLIWQIIRRGLLSKIDIKIHPELYRLLEDEETLEEFLRLPPDQILLRW
                     FNYHLKAAGWHRRVENFTKDVSDGENYTILLNQLKPDQCSRSPLQISDLHKRAEEVLQ
                     NADRIGCRRFLTPNSLVNGNPKLNLAFVANLFNTWPGLDPLEETEAPPPIEDFDAEGE
                     REARVFTLWLNSLDVEPGVYNLFEDLKDGTVLLQGFDKVIPGSVIWRRVSKPREGQEL
                     SRFKAVENTNYSVDLAKANGMHIVGIQGSDIVDGTRTLVLGLVWQLMRLSINQTLASI
                     SKDGKGVTDQDIIKWANETVKKGGKTSTMRSFKDPSLSNAVFFLDLLNGVKPGIVDYS
                     LVTQGADEEEKRMNAKLAISIARKMGALIFLVPEDIVDVRPRLILTFVGALWSASLNQ
                     "
     gene            495130..495966
                     /locus_tag="CNJ01690"
                     /db_xref="GeneID:3254083"
     mRNA            join(495130..495377,495446..495557,495612..495966)
                     /locus_tag="CNJ01690"
                     /product="metal ion transporter, putative"
                     /transcript_id="XM_567346.2"
                     /db_xref="GeneID:3254083"
     CDS             join(495296..495377,495446..495557,495612..495765)
                     /locus_tag="CNJ01690"
                     /codon_start=1
                     /product="metal ion transporter, putative"
                     /protein_id="XP_567346.1"
                     /db_xref="GeneID:3254083"
                     /translation="MSFGRPGFADVFKPSPPARGSFPLDHDGECKAFMISYLKCMKEN
                     ANDNGKCRLFSKQYLECRMDKGLMARDDMANLGLGDVVDPSALPPASTQTTTAPLSNP
                     PHVPQPPSSEHRI"
     gene            complement(495963..499579)
                     /locus_tag="CNJ01700"
                     /db_xref="GeneID:3254117"
     mRNA            complement(join(495963..496339,496392..496485,
                     496536..496586,496636..497151,497193..497309,
                     497356..498047,498085..498186,498232..498661,
                     498705..498818,498865..498917,498966..499079,
                     499130..499193,499234..499579))
                     /locus_tag="CNJ01700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657960.1"
                     /db_xref="GeneID:3254117"
     CDS             complement(join(496019..496339,496392..496485,
                     496536..496586,496636..497151,497193..497309,
                     497356..498047,498085..498186,498232..498661,
                     498705..498818,498865..498917,498966..499079,
                     499130..499193,499234..499484))
                     /locus_tag="CNJ01700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513615.1"
                     /db_xref="GeneID:3254117"
                     /translation="MSYVLSPSTLSPVSHANTPATPSLSPSPSPNTQHLLRPSSSGLL
                     IPTDRTQDVLETKWLGMLGRLRIEREVILKGYALYSLRSWFLSRTHFAHTIVTHTGKP
                     NDQISAYFLVPSPELSESEGDEEIANAIQFLSSETRSQPRRTELGFLLVTSPSAFGQD
                     VNPVPGGDFRVAKSYIVVNTGLRRLGCGGRAVLGLEPPIAALRRKFHDLYRVPVPVHS
                     GPMFVRNSSPSTSPTRRPSISISSHSIHSTHPHVSPPSSIRSPVANGHDINSDPFTYL
                     VIELVKLIQAALALWGMFQDVGEDMHGRLIGPGMEVDGLFCDETKNAISRWRREMGME
                     HEESLKIEKETSGGCIDPKTLSSLLSSITSIHYQLDALDVERLPKDPFSSIGRTLKTW
                     LSYQENVKSGTDSPFFSVPSIRALSQHYLSDRLHKGDHLRVQRLLTGVAQTASHLSAN
                     LKGGGGEETSLRWREHHLRHRLDEQELEDPGMVMIIPDDEIGSIAPPDAITTHLEAYI
                     KCILKSKEKEWDVMGARRIAELWNGSVADSVEGRRKRRGTLTLGMGRSGIREKERSVL
                     RKRTTSRDDTMREEEGDLKGTIKEFSERAGQALRGGMGIMSRKGTAYETSDSETGGPS
                     PGSLRTTLMRKKHGPVPTVIEPPAEDEDHLEPSSVSPSTSTRHFSAQLAPSPFSIPSK
                     PNLLSNTSRTLSRAPSARPPTIIIPSGNESDVWSRVSGYPGKSPGEERSDLDLGQNHV
                     KNNRAGNVGGRGMSNAVSRPASERAIAWRNKGRSTVMLRSSSDGADVALDETGMEWEV
                     QNPHGTGKREEEAVKPVVRRHSFNDLDDYKGARMLSPQHLQIDVEMCSVVLELREKER
                     QLVQKVKDVKALEEAVYTAASQLAQASRARHAHLETLKSQAEILCASLQALKTEEDPE
                     EQLPYDRFHYYLSEETHRAELLDDLGRLKEMWENVRKEGDERRRTVERKDIKKSWWFW
                     "
     gene            complement(499829..499931)
                     /locus_tag="CNJ01710"
                     /db_xref="GeneID:3254049"
     tRNA            complement(499829..499931)
                     /locus_tag="CNJ01710"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:3254049"
     gene            complement(500077..503000)
                     /locus_tag="CNJ01720"
                     /db_xref="GeneID:3254246"
     mRNA            complement(join(500077..500320,500378..501809,
                     501859..501995,502047..502658,502887..503000))
                     /locus_tag="CNJ01720"
                     /product="endosome protein, putative"
                     /transcript_id="XM_567432.1"
                     /db_xref="GeneID:3254246"
     CDS             complement(join(500200..500320,500378..501809,
                     501859..501995,502047..502354))
                     /locus_tag="CNJ01720"
                     /codon_start=1
                     /product="endosome protein, putative"
                     /protein_id="XP_567432.1"
                     /db_xref="GeneID:3254246"
                     /translation="MVNPISTRSLHLYKSVNPITKVTKLLYQFQTTAHSRNHLVKMDQ
                     DPWHPDLPNPTRSENDNGGGVSTLLLVFIPVLVVVLTVLVGMVVFLIVVLYVRRKRGI
                     RLLEDGGPLDLSKGDGVVGEGGVEGVESRWLETVDPEVREAYNRAKDWQSQYPPTSIP
                     TDITLSQFLSIQEKGVSAWAFEPDYEDNLSLYVQSRTEITFLADGPGMPAREGGGNNV
                     MANLPLPKLNEVYYWEVKMYDKPVNTEVAIGLATKPYPSFRLPGWNKYSVAYFASDGF
                     KSHNYPFTSASYGPALAEGDVLGVGYRPRTGTVFFTRNGRKLEDAYTGLQRLNLFPTV
                     GANGPCTLHVNLGQAGFVFIEANVKKWGLAPMTGTLAPPPAYGSERGSILLESGYGTP
                     GAAVAGGAGRPNRHSGMGALLEAARNRGTSGPGPQTQRTRRHKHRDHRVLPTDPHVSS
                     PLRPMGSEADSSSAGATPSSPSPAPGFSSYVSPTDRPSSQTRVPPFVISSSSSSASGS
                     VDEGDIVDGEDESATTPLDAELDREQSPIEHNPPTPNLLDISMHSIRGQYFPSQFTSP
                     QDPPVSHSVPSPAPGPSRSNSEFPPPPGYAPLDPHVYANGLPADLPEDMVNQAIAAMS
                     EAEVQQAQTEALPQTQGGQSIEESGERSQGQRVLGWIFGRS"
     gene            complement(503211..505058)
                     /locus_tag="CNJ01730"
                     /db_xref="GeneID:3254260"
     mRNA            complement(join(503211..503648,503695..503846,
                     503894..504518,504573..504830,504883..505058))
                     /locus_tag="CNJ01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_567348.2"
                     /db_xref="GeneID:3254260"
     CDS             complement(join(503297..503648,503695..503846,
                     503894..504518,504573..504830,504883..505004))
                     /locus_tag="CNJ01730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567348.1"
                     /db_xref="GeneID:3254260"
                     /translation="MFRASSRHTTNTNSSPEVKLSKRNSTANGVPSARYSFRLNFYER
                     PPALDITLEEFETCAISRLRVLSHIESLSHRSLPYAQVASGIATYAKTHLPLSSNTAR
                     NVNLDDERRRDEIGHWVLRLAFCRSPDLRQRFVRSELALFKSRFETDDKNERAAFLRS
                     LSFNYDTVGEDEKKFLKAELQQMLPKGSKEDAISETWFKVPWYTVPDLVGARRVLVKG
                     GLAFVPQSLQLSLVLQVFADRLEKALEFTAKNLPRLDEDERLGPVIDHLASSFLSGIG
                     ASDYQPSDELGDGMTVTADTIDDVARKHFPPCMRHLYEKLKKDHHLKHWGRLQLTLFL
                     KGLGLPLDQAILFWRRSYGTSMTDDKFNKEYRYNIRHSYGQEGRRANYPPKNCQQILT
                     QDQPGTQDAHGCPFRHFSPENLTTFLTNTYPDHFSRTSPEMRDILDSVKASHYHVACT
                     RVFEVTRGVKKGEGLGNGESVSHPNKWADRSRELEKEVLDGIKKKEEAMDVD"
     gene            505213..506957
                     /locus_tag="CNJ01740"
                     /db_xref="GeneID:3254145"
     mRNA            join(505213..505401,505449..505559,505604..506171,
                     506220..506364,506416..506651,506709..506957)
                     /locus_tag="CNJ01740"
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase 48 kda subunit precursor, putative"
                     /transcript_id="XM_567349.2"
                     /db_xref="GeneID:3254145"
     CDS             join(505254..505401,505449..505559,505604..506171,
                     506220..506364,506416..506651,506709..506907)
                     /locus_tag="CNJ01740"
                     /codon_start=1
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase 48 kda subunit precursor, putative"
                     /protein_id="XP_567349.1"
                     /db_xref="GeneID:3254145"
                     /translation="MRTSSMLFMPFVAFFGLVSARSATGDRVLVVLESAVTKDDYSQF
                     WNSLQQRGFELTFKEPESKDADLVKFGEAQYDHLIMFAPTAKNFSPSISPKAILDSQF
                     KGLNALYILSPQLPEVQREHLREYDLEFIPSDLVLIDSFSHPSGESASTVLLPPTECA
                     VSNGAVLSDTTLTGGPIAYPSGTVHSAGLNPYLIDVLHAPKKSYIGQDKILNADEIER
                     EKAVDGKKSKDALQTGKKASLVSALQTRDNARAGFVGSGEVFSDKYWGQTVETIDGKK
                     VETGNAAFVTDFTKWVFQETGVIKVVSTTHFREGETEPREMYTKKDDITYSLTLAQHV
                     TNGNGTSSWGPFYADDIQMDFTMLDPHIRTAMIEDKSSSSADATTYKARFIAPDRHGV
                     FKFAVEYWRPGWSYIRTSSTASVVPLRHDEYPRFITGAWPYYIAAISTSVTFLAFVAI
                     WLSLGEVDKDRKGKKKAE"
     gene            complement(507008..508694)
                     /locus_tag="CNJ01750"
                     /db_xref="GeneID:3254162"
     mRNA            complement(join(507008..507531,507580..507662,
                     507727..508104,508158..508536,508592..508694))
                     /locus_tag="CNJ01750"
                     /product="mannose-6-phosphate isomerase, putative"
                     /transcript_id="XM_567350.1"
                     /db_xref="GeneID:3254162"
     CDS             complement(join(507062..507531,507580..507662,
                     507727..508104,508158..508536,508592..508652))
                     /locus_tag="CNJ01750"
                     /codon_start=1
                     /product="mannose-6-phosphate isomerase, putative"
                     /protein_id="XP_567350.1"
                     /db_xref="GeneID:3254162"
                     /translation="MSSGNVPKIERLSCVPNDYPWGEVGNDSLAARLASKNGAVSFDL
                     KPEQAYAELWMGTHPNNPAHLFSSPDTLLSTHLKKNPSLLGAANRFSPPFTGAKGSGA
                     EGQEEGHVPFLFKVLTCKQALPLQIHPDKALAKKLHEENPKQFGDINHKPEIAVCLSD
                     RFLGFASFRPYDKIASLLKSVQEISLLPSLLQKSIKSFISAPSAETLQPTWEGFIKLG
                     DNEESVKKFSDRVLSQGLKAFDSVDIEDEDKNRLVRAVELGKKYNPGDAGLFSSLLFL
                     NLIELKKDQGMYVGADGPHAWLEGEIVELMAISDNVLNVGFTSDDSKDDPSLVAKAVT
                     CTPKAIKDLLLDASKYSKSQNGRTTVYSTPFEEFSIMKIAGDEILSPLDGAGVAVVLE
                     GEWTVEDQEGTKRGGEGTDGEGGEGTIWFIGSATETKWTAKGGKGQIWIAFYDKTAKK
                     DDVGKK"
     gene            complement(509145..511541)
                     /locus_tag="CNJ01760"
                     /db_xref="GeneID:3254370"
     mRNA            complement(join(509145..509744,509794..510093,
                     510135..510608,510657..510869,510933..511116,
                     511162..511344,511396..511541))
                     /locus_tag="CNJ01760"
                     /product="poly(A)+ mRNA-nucleus export-related protein,
                     putative"
                     /transcript_id="XM_567351.2"
                     /db_xref="GeneID:3254370"
     CDS             complement(join(509256..509744,509794..510093,
                     510135..510608,510657..510869,510933..511116,
                     511162..511344,511396..511499))
                     /locus_tag="CNJ01760"
                     /codon_start=1
                     /product="poly(A)+ mRNA-nucleus export-related protein,
                     putative"
                     /protein_id="XP_567351.1"
                     /db_xref="GeneID:3254370"
                     /translation="MRFGVVSSDSDSDSDIVSVDYSFSSDEESLDGFQWISTDPNSSL
                     GRDIRAALDSSDEEVLGSEDEVEILGLSGRSVNGGKNGGKARTQSPWNAFSTPQSSKN
                     KRKSEISSSLWRHSPLARSLTGSKVPSSKATLEEVLKEEPDVFETWVKRTEEEAWRDG
                     QYRAAKQQSHVRSIATNARAKIVSIQESQLSQEAEEIRRLLEGLALRHDKQEEELRKA
                     FKEREESLWKDIDEVIQSVEKREAEAAAKAARIAQAEAKRRKEEEEARIAEKDRVARE
                     QKAEIERHTKELALKEQQAKAAMEAKERKLEEEKRAKEEKEKASKRIVDKREQAGAMW
                     RAYTEKQNWMKSEVIEKVKADRPTMTNLNKGKRMIIRWLGQALNTRESVVKITTDIHD
                     LLIQQLPSPPSAASPIQFTPDVPKPYAYLLSHVSKVLITQAQSEITSKPTSAFPLAKV
                     VVGLMLRGHAALGDVLFARFVKKCPWVVPFYPAPQTNQSREAYEKSTGRGTDESQHEY
                     ISRMSSICTLFFAILQTPLTPLIPTLPSAPTPEELDKLVPKPMRLTYAWTWLALALRD
                     PMPASPPIAALLTTWIEIALAEVIRIYGKGQTDKLRESLEREGIQGGEIKGDGGMSRD
                     KLGFVLDKWRSGEDMAMKGRDWVA"
     gene            511781..513834
                     /locus_tag="CNJ01770"
                     /db_xref="GeneID:3254334"
     mRNA            join(511781..512227,512275..513008,513064..513267,
                     513321..513505,513555..513834)
                     /locus_tag="CNJ01770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567352.1"
                     /db_xref="GeneID:3254334"
     CDS             join(511792..512227,512275..513008,513064..513267,
                     513321..513505,513555..513807)
                     /locus_tag="CNJ01770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567352.1"
                     /db_xref="GeneID:3254334"
                     /translation="MASVFHSHASSYASEQLQFQLSALSTLPISFPPSTQLHVQQSTT
                     PKPHLQSALSELSSSKPISKERLQQILEGLASAKDQEGYAADQLSEIDELVEVEVMGR
                     AVTVLWKEVLDAFIDGALNLERERVWWDVVLNSPRGVSVYLIQTMPHRLWNAIPPRAQ
                     LSFPNLKAFKFPSKELLFKPLHSTTSAALTSITSPWTLTRREILSTRSELTRARDNAA
                     HRIGVLASQGPQWNMEAKEGVQATGDVASETQRVYSLLCSVLDVPLPKPRKSRSTTPP
                     QSIPTANTLLSLLTTRLSQSEANISSTLSVHARPGRLTRLWFPFLFLPPTLYFTVSII
                     GRNKEWLQEQIRNGKETIKGFFVQWVWEPLEGIGKTLRGGGEGLGVAPSTVQSDQASL
                     ERMVMDLGKDYYHLSGPQLQALGDKVKNGDMEEVLRVYEREMQSPLKNALMGSLIRTL
                     LIQVQKTKTDLSLSLLSLDHLLRSQQLTFAFVGLAPSLLILYGFGGWLQGVWKGEKRG
                     KSRRRAYFHSLRSIERLLITSPEAEMTHRDRGLLIVSVSSLRSWATVLGASKREAFLD
                     DLRMVENPVLKREDKLRVIERIWRCWGVDGRGKAYSG"
     gene            514366..516433
                     /locus_tag="CNJ01775"
                     /db_xref="GeneID:36393065"
     mRNA            join(514366..514585,514656..514743,514823..514917,
                     514969..515544,515596..515656,515710..515819,
                     515877..516433)
                     /locus_tag="CNJ01775"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658767.1"
                     /db_xref="GeneID:36393065"
     CDS             join(514477..514585,514656..514743,514823..514917,
                     514969..515544,515596..515656,515710..515819,
                     515877..516280)
                     /locus_tag="CNJ01775"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514447.1"
                     /db_xref="GeneID:36393065"
                     /translation="MSPSLFTITQARWGLDLFVGVLSGVAVASSAPSAAGGAEMYSGR
                     PGDIRGLIVLMGSTGLVGVAALRMAHILLSRPWRLYLDRLEFTLVSMLWICWTSATMA
                     FSAFTLQQGVCSPTLPEFLLPTCPLLTFDLTLLHLLSTSTLALLLVIISSTLSPSYFE
                     SLSLSEGQTVGKGSRGYIMWEMALGSVPNSPTRVNQSLPPDIGQTTPESLVSYGTLSP
                     TTPRNSTWSYAQGMADAEPTMPSSSASEPWQSPPKKKDRYAEGRVWTYLPLFLCSLGV
                     ACASMIGLGIGDSNLSEIFMFVISVLSMIFTILCLKSTASADDIKRQAGYSRQVRAFE
                     VATAAIFFLLWPLAAVLFTLFPDIPYRPCSNPASSAAPSPREDADPEDSAIQCYASWT
                     IITLAWTASWIILKRIMGLIFPMPEVKSLVSEQRSGDREEAALLGQNKGKKAATVDAE
                     PVDRPRYGWGRVVAGEAFELGEDEEDEEAY"
     gene            complement(515760..518265)
                     /locus_tag="CNJ01780"
                     /db_xref="GeneID:3254031"
     mRNA            complement(join(515760..517598,517648..517880,
                     517936..518265))
                     /locus_tag="CNJ01780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567353.2"
                     /db_xref="GeneID:3254031"
     CDS             complement(join(516464..517598,517648..517880,
                     517936..518178))
                     /locus_tag="CNJ01780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567353.1"
                     /db_xref="GeneID:3254031"
                     /translation="MHSSVLLYFPLLPLLPALAIRSGPHQLRDLYAYPKYQVQFLNDL
                     PVSTSDAKRIKEVGVGSEIEWLDMKPGDRSLEDGTKRERLELIPMSFVPAGHEEDPSP
                     YEYLCLMPSNNSTASQMARIDQLEEVEDELDPVQGWKALAHLDGKCLYSKQGWFTYAY
                     CHDSYIRQFRAAANPHTHPTQGYVPQEDPKYEGYTLGRPYPVSKFKGSRVKAKGGKPG
                     SPAKAEDRSTAVETTANAPHTQSSPSVSFGLGASSRYLVQRWSDGTRCDKTGRPREIE
                     VQVHCSMTSGDMIYMIKEVAICQYVIIIHSPHLCGLPGFKAHDAEVEPANVMCRQVVD
                     DEEWAKWENEVRDGTAGANEPQPQEIEEGKQTRRLEQSSFSKWPGKGQPQFRFGLAAA
                     RERPAGDEVSHEQSGVDETGETGDQASESIPADIIFGLDMDEDMKSMLRRAVGLLAKE
                     ARSEKRDNGDEEEADGDEVVLISWDEDENGRPVLLEADILLKDEDGEIKLEMGASEKD
                     MLKKVLRDYMLKANHEEEEQRKRVVDEL"
     gene            518436..519761
                     /locus_tag="CNJ01790"
                     /db_xref="GeneID:3254130"
     mRNA            join(518436..518645,518701..518737,518785..518872,
                     518918..519001,519054..519127,519175..519222,
                     519269..519349,519395..519761)
                     /locus_tag="CNJ01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657961.1"
                     /db_xref="GeneID:3254130"
     CDS             join(518517..518645,518701..518737,518785..518872,
                     518918..519001,519054..519127,519175..519222,
                     519269..519349,519395..519735)
                     /locus_tag="CNJ01790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513616.1"
                     /db_xref="GeneID:3254130"
                     /translation="MSTKLRVGWHREHFLSPLLQFVEKDKGETVELIECPGGTGEMQV
                     KLKNGEIDLCIALTDALIAGLANGQTSYKIVGRYIASPLRWAIVTGKNSQYNSVDDLK
                     GTTFGISRLGSGSQVMASVLSLQQKWSEEEQPKFKVNGQFKPLRDSVNSGETSVFLWE
                     WFTTKPYVDSGEVRFIGSVYTPWPCWHIAASPSVPSSTIKPFLASLQPYVQHFNSPEA
                     RTSEDIEFVHNFFGHKKEDVAEWLQSVEWEQRLAEVKEDVVKGTLAVLRKAGVIPEGA
                     ENMKLEDIVNTEVATIV"
     gene            complement(519720..520773)
                     /locus_tag="CNJ01800"
                     /db_xref="GeneID:3254159"
     mRNA            complement(join(519720..519953,520003..520376,
                     520426..520491,520551..520773))
                     /locus_tag="CNJ01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657962.1"
                     /db_xref="GeneID:3254159"
     CDS             complement(join(519765..519953,520003..520376,
                     520426..520491,520551..520620))
                     /locus_tag="CNJ01800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513617.1"
                     /db_xref="GeneID:3254159"
                     /translation="MSPAKPAWLPILEQQLKENPKCLAYAFSTLSQEGTPKVRHVIHR
                     GFTPSSLLLTTTDTRMDKPAHLSHSSTIELAWWLSSTNVQFRITGQAYTIPLTMSLSD
                     KEFNRVIDGLKVTGTEESQKEWWEGKRNELWQGVNGRLRAGFGRPSPGKRLEEVEDSS
                     KWPETIPAKSDDPEGQKLVETAYNHFAIVAIRPEAVEFLELQPIPNRRTQWRWTKNPD
                     IEDSGSWEEVKVAP"
     gene            520893..524007
                     /locus_tag="CNJ01810"
                     /pseudo
                     /db_xref="GeneID:3254195"
     gene            526670..528168
                     /locus_tag="CNJ01820"
                     /db_xref="GeneID:3254254"
     mRNA            join(526670..526760,526812..527897,527946..528168)
                     /locus_tag="CNJ01820"
                     /product="expressed protein"
                     /transcript_id="XM_567433.2"
                     /db_xref="GeneID:3254254"
     CDS             join(526713..526760,526812..527897,527946..528044)
                     /locus_tag="CNJ01820"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567433.1"
                     /db_xref="GeneID:3254254"
                     /translation="MHFHLQLEQQAGRGTMSGRPRRAAAAPSRHPVPADAVDFKDADP
                     EFLALSLKQRRSIDRAFEKGVRTTKGDDKRKRRKIANGKAVDVSDAEDGGIVDESGGE
                     ALMEEGGGRVPFSQDTDGGFVAEDDGGGFVMDDHAGGFVPDNDQGGFLPDDDAGGFVT
                     DNGYQDRVVSEPLKISKHHSSSHYSPQTATRLVPLYLLPTLLTSLGLPSDEDVLQVFR
                     ASAMGWDESSDKHSLDKEDAVGVELKDFRAVCAALMDPDDGEERENVELGSDDGDDDE
                     DAFQPSDAESVLTSLSQSSYGGTPSKSCSKKAGNKSRKTWAKGKGTIEGQINLSSNQR
                     AMVKDIWDMLKPSEKQKKFGADILGRNEVKELVRKLGEMWSDEEVTDMVTLFSSQHEG
                     RGLTFEDFGRVMLRAGLV"
     gene            complement(528099..529776)
                     /locus_tag="CNJ01830"
                     /db_xref="GeneID:3254182"
     mRNA            complement(join(528099..528777,528824..528981,
                     529032..529160,529209..529309,529359..529404,
                     529454..529503,529560..529776))
                     /locus_tag="CNJ01830"
                     /product="expressed protein"
                     /transcript_id="XM_567356.1"
                     /db_xref="GeneID:3254182"
     CDS             complement(join(528270..528777,528824..528981,
                     529032..529160,529209..529309,529359..529404,
                     529454..529503,529560..529614))
                     /locus_tag="CNJ01830"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567356.1"
                     /db_xref="GeneID:3254182"
                     /translation="MSTLAMGKGLIDPRYCCCAVPLVNAGIYTVLGEQAVLGAAIGIV
                     VFATPDIVGASFPTFGGDIFAVICFIVAAFQPIGFIGVLREKTSTFKMYTLLNALGIL
                     AALICSAALIITSALRHDTAVTDCEYKFFSDAGNSSSTANETLASEGQALCSAFAWAD
                     VGIMGGLWVILLIVQGYFVYLTRVYSASQVSDHKLYHSVYSENPEAFTMSVLRSSRYN
                     PGSVYNTMPGPDADAWDARPSMDSVRDVPALHGGYPDDSQPLHYEDNYGKPQNYPPDY
                     ELHPLAGQQGGQYAFATPGGGYVDHPAETRTRQEEGAPMANQYSGDQGLGYTGVGTGL
                     RRPEEMQNHPGVHY"
     gene            533286..535561
                     /locus_tag="CNJ01840"
                     /db_xref="GeneID:3254093"
     mRNA            join(533286..533882,533933..534087,534169..534356,
                     534405..534512,534570..534779,534831..534889,
                     534946..534983,535035..535114,535165..535561)
                     /locus_tag="CNJ01840"
                     /product="lactonohydrolase, putative"
                     /transcript_id="XM_567357.2"
                     /db_xref="GeneID:3254093"
     CDS             join(533499..533882,533933..534087,534169..534356,
                     534405..534512,534570..534779,534831..534889,
                     534946..534983,535035..535114,535165..535376)
                     /locus_tag="CNJ01840"
                     /codon_start=1
                     /product="lactonohydrolase, putative"
                     /protein_id="XP_567357.1"
                     /db_xref="GeneID:3254093"
                     /translation="MATNLDSRATTTSREMSVNTAGLQERGMEGKTLPAPLGSPVKYI
                     PSAKVFSWKSKLVYVGFTMGALATLAYTASHILPSSSVAQASHLNTFKRRSPPSEPPK
                     NAQVINPKDFAVLTTVLPSYEFNGSSLFVPPGTTEESLKAKPFHIYDYSFYDVIGPDP
                     TLTLIADSGSDPLFHEAVVWYKEQDEVFFVQNAGAKSAGTGLNKSAVVEKISLAQAAA
                     VQKGERNQTEVIVVNSTVEVVNPNGGTAYRGKIVFAGEGQGANVPPAFYMLDPKEPYP
                     TTVILNNFFGRQFNSLNDVSVNPRNKELYFTDVIYGYLQDFRPPPGLPNQIYRFNMDT
                     GVVRVVADGLNMPNGLTFSPDGRHAYVSDTGIFSGFWGTNYTYPATIYRWDVQDDGSW
                     ENQKVFAYVHVGAADGLHTDSKGNVYAGVGDGVHVFSPDGLLIGKIYLGETSANFNFA
                     GHGRMVICAETHLYYVTLGASGWDPEA"
     gene            536783..543098
                     /locus_tag="CNJ01850"
                     /db_xref="GeneID:3254204"
     mRNA            join(536783..536932,537079..538113,538160..539221,
                     539271..541965,542025..542055,542112..542259,
                     542308..542386,542440..542639,542697..543098)
                     /locus_tag="CNJ01850"
                     /product="map kinase kinase kinase mkh1, putative"
                     /transcript_id="XM_024657963.1"
                     /db_xref="GeneID:3254204"
     CDS             join(537184..538113,538160..539221,539271..541965,
                     542025..542055,542112..542259,542308..542386,
                     542440..542639,542697..542927)
                     /locus_tag="CNJ01850"
                     /codon_start=1
                     /product="map kinase kinase kinase mkh1, putative"
                     /protein_id="XP_024513618.1"
                     /db_xref="GeneID:3254204"
                     /translation="MSHHPQLSVSTGSAGAGPSTPTLPRRPQGARRRGVMPGLFIANP
                     DNSDEENSPPKAGSQRSSSGVSPISVSSSSGRGGPSSVSIPQPASPSHSIKERGSLPY
                     PSIPAPQSSPLPSISAFPSPQPLIPTPSPAPIAYGHTPEISSGPPQPPPQPQRHLQRA
                     FTTATPENAPRLLPEPRSSSTGTTSFHQQVNNSPSRALPSLPSPITRQSTMPSPVSQS
                     PSTSHGQPYSAPPAYHPHDPTRVASPDDVMSPATGSEHGSIMSAGIGHRNRSASVQGQ
                     QVRLQVTTDNEAFHLVDITGINTAEGIREKVFSKLRIRDEDYPTLSMYRTEIGEPADE
                     TPILPAALLNICRTLGDSRASLKFLVKQTDVPPSSAASVIPPVSQTDYHPFRAASDPR
                     RAGVPPITTDLPNPVLYRVSSRHSKEGSVSSASGEVLNRGELSASDWSDLGHEAEDWS
                     GPGLSRSTRKSVLQNAGVRLSTSTGGSRSPVTEHSASLGTSSPALPTPPIPPHSTSLQ
                     AGEPSIHSSPSSRPSSRHYEFNELSLPPQFDHFKPSNAISVFPRPGTPISDSYQNENA
                     FAGPSRPVMNQEQGSQGLGLTLDDDIDPETRALIEQFQREEQEAQKKEEERRRQLEAD
                     EELAKREQQSERELWEMMQQMQKEQRQREQAQIAEDEARARQVEEEQRQEEEQRQALE
                     AARTAWEAEQREQRDQREQREQQESRFHTFEKDRRQRQQFFQNRARMGAPLDDSATWE
                     STWMVGPSAEGSLSSRRPSEGRMPMVQTSAPRTSQTQSPALPPRQSSQPIYQPSQSQY
                     LPDFAYSHRRPSGFPNTSYAETSHAQERLHDPRLQQATGRAPAPGQRGGTSNTPRPES
                     QRLRHPFSYAAHEPSNERLQAPALSTARSVDNLRMTNGPLGMTSRQSQVYGPPRTSIT
                     PAPGFAEHRNIQPASATATSYRSPSSDRARDGRYPEPLHSSSRVATPMAPAIIDTGLV
                     PFPSPHPNSAASSNSWRGHTPQFNSLPRSARGPTFDITRPNTVHYDRSPPPPTSPETA
                     IPPRRPSTYYDEFHPPDTARTIVEDGATIRRPSSPFPWGDRARSGNASTPYRTASPVP
                     VDQPRTSETNTFDDTDSQLPYAHNASPQSSWLSVSRAGAHRSDSDTLSVAGTVSSEAT
                     VRPGKGMGEDNDTNSGDTAKAGQWDRHLKEMIAKMGPGGGEGTVRPRKEEEEDEATLF
                     ITPPVRAPETSSSRTNAIRPSPSKPNLIVNTASLSQQAYDQVNPVLSASTPSDSATES
                     EGTGEGDGEIEGSNIKRGKSFARPRDPNQWNFRPEPEQLYENLDRVFPQIDLDRPIVQ
                     GAESTPSTPGIESPSRVEIIGGLPLPAGAAPGRQGGPQAGSGPLGRAPQATGPSSAPT
                     GAFNRSKFNKAENRRSIRVVADHKRRTLQRQVSRHEDLPPEYDVGAEEVNSAMDDQVV
                     DPRSEEQRKKDNRRSSSMWDHKLVEVTRFARAQANREADIPESPASDGKPGTVNWVKG
                     ELIGKGSYGRVYIALNVTTGDMMAVKQVELPATEIERHDSRQQGMVKALRDEIELLKG
                     LEHKNIVAYLGYETSPEYLSIFLEYVPGGTIASIYRTPNQARFEPQLVRFFTEQILEG
                     LAYLHSKNIWHRDLKGDNILVDAQGICKISDFGISKQTADAYDSFGQATNMKGSVFWM
                     APEVIHSYSERSYSGKVDIWSLGCVVLEMWSGKRPWGDMEQFAAMFELFNKRSRPPLP
                     PDINLSSVALDFLNEKCLATDPRNRPMARDLLQHEFIKNRDLTWTFKDSKIGKAVAKR
                     GAKRPQA"
     gene            545309..547772
                     /locus_tag="CNJ01860"
                     /db_xref="GeneID:3254299"
     mRNA            join(545309..545961,546021..546116,546169..547772)
                     /locus_tag="CNJ01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_567359.1"
                     /db_xref="GeneID:3254299"
     CDS             join(545737..545961,546021..546116,546169..547509)
                     /locus_tag="CNJ01860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567359.1"
                     /db_xref="GeneID:3254299"
                     /translation="MSSLASLPSFRPQESAPESLPPAASSCRISRLPSLPSIPHAGPS
                     RSAQRYLYFGVRQGFLSGVYTDWQEAEKQIANHPEPALKTFSTRLAAEAYVSGWNGAG
                     RHSLPPSTPRPLREHLAMSFPGSVNVQAPASQRRQSYHARLLASSPTEFGSLAPDTSL
                     STLRPGAISRSSYRSSVVHISSPLRQQVDDDSDDTSGEEPEAKLRSLRKAASYMGAGG
                     LLSPPQSPEKKTKRLGDSVIERERPVQRRALTDSRTWSSKIHGESPAQSGNRPLSPPT
                     SPTGPAHTRRPSDYSKSRLWADSVPQVEAAKPESPSQPDFADPTIPKFSRSGLRKSGV
                     VMPVAAKRSSSSLSLKPRGTLFSSSNDSSSSITSSSSNGSDQTKRRLSHSRQPSSCRL
                     SKSQFSSQDRLATLAETSKQELQLNDEDHNAIPPLSPPRPAFMRRVSSASSIGSNDSF
                     SSMGSMTSGSSAHTSSLESCEPITEEAELDVRIQESKDNESIPEHALIISGTCTKSDG
                     DASVDSGSMKHIKTRKNKNGGVLKRLAKVLGLEKKSVEAGRRGSM"
     gene            548234..549686
                     /locus_tag="CNJ01870"
                     /db_xref="GeneID:3254232"
     mRNA            join(548234..548445,548508..548726,548788..548913,
                     548975..549251,549301..549686)
                     /locus_tag="CNJ01870"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_567360.1"
                     /db_xref="GeneID:3254232"
     CDS             join(548250..548445,548508..548726,548788..548913,
                     548975..549251,549301..549433)
                     /locus_tag="CNJ01870"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_567360.1"
                     /db_xref="GeneID:3254232"
                     /translation="MPFRTFIPGLSLRLRPQVRLQSPRSTKSYTTVEAHIPHGHAHHA
                     HRAQRVPYKKPSALRKWGVRFALAIAFPTTYILGAAFPPQLVLLIFPRFSPPPPHKDS
                     ARGKAHTNDVEGCMQGLQLVEMMRKEIQGGAEWYETRPYDKYDPQKVHNSLTAGTLRG
                     PGKLAIPPILFAKKDESEAIAIIHLGRALCGHDGIVHGGLLATVMDETLGRNALLNLP
                     SRIGVTANLNINYRSPCMADQFVVVRTKVVELKGRKCVAEAKMETLSGETVADAKALF
                     IEPKWAQFLASSGVTEAMGRPIPQPENAPGLMDGQVEKIV"
     gene            complement(549599..551680)
                     /locus_tag="CNJ01880"
                     /db_xref="GeneID:3254178"
     mRNA            complement(join(549599..549971,550035..550959,
                     551009..551120,551175..551208,551285..551431,
                     551487..551680))
                     /locus_tag="CNJ01880"
                     /product="ammonium transporter, putative"
                     /transcript_id="XM_567361.1"
                     /db_xref="GeneID:3254178"
     CDS             complement(join(549796..549971,550035..550959,
                     551009..551120,551175..551208,551285..551431,
                     551487..551583))
                     /locus_tag="CNJ01880"
                     /codon_start=1
                     /product="ammonium transporter, putative"
                     /protein_id="XP_567361.1"
                     /db_xref="GeneID:3254178"
                     /translation="MVNVTYTDSSSDMIYTADDGTQYLYNLGDMSFVIAAMALVWIMV
                     PGVGLFYSGLLRRKNALSMIFLSMAGVAVGSFQWFFWGYSLAFSDTGSKYIGDLRYFG
                     LKGVLAEPSAGSDRIPALLFCVYQCMFCLITGVLAIGGFAERSRIGPVMVFLFCWLTL
                     VYCPLACWTWNPNGWSFVMGGLDFAGGTPVHISSGTASLAIALYLGKRRGYGTERLAY
                     KPHNTAFVVIGTVFLWFGWFGFNGGSALSANLRAVQACIVTNLSASVGGLVWMFLDYR
                     LERKWSAVGFCSGAISGLVGITPAAGYVGSPAALAIGAITAIACNFATKLKFLIGVDE
                     TLDVFASHGIGGMVGCFLTGLFAQGSVAGFDGITDIPGGWVSHYWIQAGYQMADLTAG
                     FAYTFVMTTIICWLLHFIPGLRLRASEEAEIIGIDDAYLGEFAYDYVGTDPELRLHRI
                     DSKPQFTSGDVIAEVSASNGHESSTTEKVDPHATGNAAAGGGRVDV"
     gene            549888..551882
                     /locus_tag="CNJ01885"
                     /db_xref="GeneID:36393066"
     mRNA            join(549888..549982,550040..550968,551028..551199,
                     551271..551882)
                     /locus_tag="CNJ01885"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658768.1"
                     /db_xref="GeneID:36393066"
     CDS             join(550219..550968,551028..551150)
                     /locus_tag="CNJ01885"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514448.1"
                     /db_xref="GeneID:36393066"
                     /translation="MADPATGDIGDTVKAGHRTLGEETGKEATDHAANPVRSKDIESL
                     INANEKLELGGKVTGDGGNRTDGKSSWGTDVASSRGDTDQTRNSTGAEANSGPFAFKP
                     VVQEHPDQTTDRGRKVGDDTSLNSPQVGRKSGTTIEAEPTEPEENGADNNESSVVGLV
                     GESFSAVASTLAEVQGDSQRGSTRRDVNGGPTSKVETAHDKRPAVGVPCPASERAVDE
                     GEPAEEEDHNGTDTRPFSETTNGEDTSDKLQFTQKRRAGIRSEPAEGSARTPFRPKYR
                     KSPMYLIHRQQSSL"
     gene            552651..557478
                     /locus_tag="CNJ01890"
                     /db_xref="GeneID:3254273"
     mRNA            join(552651..553668,553708..554005,554055..554687,
                     554729..554778,554817..555068,555123..555257,
                     555316..555360,555416..555486,555544..555829,
                     555897..556008,556079..556167,556231..556345,
                     556396..556501,556549..556966,557016..557478)
                     /locus_tag="CNJ01890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657964.1"
                     /db_xref="GeneID:3254273"
     CDS             join(553036..553668,553708..554005,554055..554687,
                     554729..554778,554817..555068,555123..555257,
                     555316..555360,555416..555486,555544..555829,
                     555897..556008,556079..556167,556231..556345,
                     556396..556501,556549..556966,557016..557378)
                     /locus_tag="CNJ01890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513619.1"
                     /db_xref="GeneID:3254273"
                     /translation="MTLGGSLGRSSSHKNKKIHRPSPFPPTPYLHRGDTNQPTLYHPL
                     ALDRQERGRKALDISLDHQVIDISADHIISLPPGSMQSQTFLSHPPAASRNSSFTSIT
                     SPPSPKYPASILPDDSITSTHAYARGSVRSTMMKGRIATTDTPAPGIMEETEEQDELR
                     GLRSESKLGLGALGFNVSSVSVGSRNKTDEMLGFDANAKLASLYLVSGLGKSTAEWSL
                     ADTFRGVQPLEDSLGLFWRPDMLGSCFSGDKRHNRSATQGGEDHRSRKDSKSSMFSSG
                     GLSKDLKGKHVADAGPGGAQKLVAKTLKFAHPRDVEIVNSVLAPPATFHAFTFTIPRH
                     DTLAAAAARARERLESTVSGPVDFNRFADASSSTATVNKAVASAPELSFYGVTLTVWT
                     HADKNRAVQLKAMKSRSDRIELGAQNSLNAMNPVSPSYHRAGQRKASTTPDKKGTRRS
                     LGHVLRNQSEADTTIGSETETGMSDSDMEGPTDRRRGWMDRLSVVESVPEDVKAVFDE
                     QIDVFWMPYAITLVSRYPIYDTLQDYLGLSWARFSKNARVHMSQVSRLLNTTIPPRPG
                     GAFRLPIGISSDDQVILKGCMPGGLIDFDKGLVKVDFQIWPLFQALDLDHIIICAEVA
                     LSNSGRIIFCSKHPAMLNIAVSSLKYLVELGGWNGVAVPVIHARDATFIIEDPGPFII
                     GLSSECRYVVAPPAEVVIVDLDSNSLSCRSPLANVISPRARREKAKQKLLAALGPTYP
                     ADRSIPMEFKVSYPKGAFRPLNKITWSTVERPNFLGERLREPGWWKFESVMSVFDKIL
                     AHKHKKPSLIQRLTRSGVGRAQAQLTVGEQLAKAMMRRRALHYVEARDDLEIKVAKIN
                     RRLLKLIQEGEHWKSQFETFEKYADKLTNEANELKIKIERERREAKRLSSIANEQTQV
                     NLELEEKLENTETARAEAMRQLSDMHQSIQELEREREEIINSIEMQIGGALDHYLPQR
                     PPSPSISSPSSRPGTPGDALASPTTGNSHGSLSEDAACRKSKERPMTADSQQSFKSGM
                     SGMTGLSVLGHARGERRRRESVVDTLRTGGDGRAYTGALDIAQRVANIHAKLEMALGV
                     VARQNASGEGEGETSADMTLTNPPHDTISTDGALVTSEPTPGEESDDGTEKGSRTGSC
                     LLVRDGSDSDLGSWGSTAAPGDDDGEEKVKEWVEDDGLNKRLSGLSTTIHFGKAM"
     mRNA            join(554043..554687,554729..554778,554817..555068,
                     555123..555257,555316..555360,555416..555486,
                     555544..555829,555897..556008,556079..556167,
                     556231..556345,556396..556501,556549..556966,
                     557016..557478)
                     /locus_tag="CNJ01890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658769.1"
                     /db_xref="GeneID:3254273"
     CDS             join(554336..554687,554729..554778,554817..555068,
                     555123..555257,555316..555360,555416..555486,
                     555544..555829,555897..556008,556079..556167,
                     556231..556345,556396..556501,556549..556966,
                     557016..557378)
                     /locus_tag="CNJ01890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514449.1"
                     /db_xref="GeneID:3254273"
                     /translation="MKSRSDRIELGAQNSLNAMNPVSPSYHRAGQRKASTTPDKKGTR
                     RSLGHVLRNQSEADTTIGSETETGMSDSDMEGPTDRRRGWMDRLSVVESVPEDVKAVF
                     DEQIDVFWMPYAITLVSRYPIYDTLQDYLGLSWARFSKNARVHMSQVSRLLNTTIPPR
                     PGGAFRLPIGISSDDQVILKGCMPGGLIDFDKGLVKVDFQIWPLFQALDLDHIIICAE
                     VALSNSGRIIFCSKHPAMLNIAVSSLKYLVELGGWNGVAVPVIHARDATFIIEDPGPF
                     IIGLSSECRYVVAPPAEVVIVDLDSNSLSCRSPLANVISPRARREKAKQKLLAALGPT
                     YPADRSIPMEFKVSYPKGAFRPLNKITWSTVERPNFLGERLREPGWWKFESVMSVFDK
                     ILAHKHKKPSLIQRLTRSGVGRAQAQLTVGEQLAKAMMRRRALHYVEARDDLEIKVAK
                     INRRLLKLIQEGEHWKSQFETFEKYADKLTNEANELKIKIERERREAKRLSSIANEQT
                     QVNLELEEKLENTETARAEAMRQLSDMHQSIQELEREREEIINSIEMQIGGALDHYLP
                     QRPPSPSISSPSSRPGTPGDALASPTTGNSHGSLSEDAACRKSKERPMTADSQQSFKS
                     GMSGMTGLSVLGHARGERRRRESVVDTLRTGGDGRAYTGALDIAQRVANIHAKLEMAL
                     GVVARQNASGEGEGETSADMTLTNPPHDTISTDGALVTSEPTPGEESDDGTEKGSRTG
                     SCLLVRDGSDSDLGSWGSTAAPGDDDGEEKVKEWVEDDGLNKRLSGLSTTIHFGKAM"
     gene            557570..559525
                     /locus_tag="CNJ01900"
                     /db_xref="GeneID:3254160"
     mRNA            join(557570..557873,558246..558292,558337..558456,
                     558506..558862,558916..559151,559213..559525)
                     /locus_tag="CNJ01900"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657965.1"
                     /db_xref="GeneID:3254160"
     CDS             join(557576..557873,558246..558292,558337..558456,
                     558506..558862,558916..559151,559213..559378)
                     /locus_tag="CNJ01900"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513620.1"
                     /db_xref="GeneID:3254160"
                     /translation="MRGEVEKKGGLAGSFLSLPVYSLQSIVSSYIPPFSMSISTPNKR
                     STPPELQPLVSRTTGGTTPTSSSSFSSFRDKMVRALSPNRDSGGEVRGGRRPSWGATM
                     SLAEERGRQPGHVVSTGRGGAGNLVAHAIPDDDFVPGAERGRELSPHPNANEHVTRSG
                     RGGAGNIRPSSHSRTREDIKQEAEEDALQEQLIADARGRQAEQAFSTGRGGVGNISRS
                     RSRSKARTPRGESSTRRETSALGLGRRTTRDAVTTGRGGFGNISEEKEKNSIELEKEA
                     ARDQYEANVLAKYTTNEAAHPHAYATGKGGAGNVVTPAAHSVEPDVAALSLEDREERE
                     AHAKVHANETGQWVPSGRGGAGNMHHRTNDNSHSPAQDERGRDAHKGGVLGNVLRSFS
                     RAAGRDKSSEGRAKD"
     gene            complement(559520..560877)
                     /locus_tag="CNJ01910"
                     /db_xref="GeneID:3254155"
     mRNA            complement(join(559520..560165,560233..560326,
                     560384..560407,560476..560553,560619..560877))
                     /locus_tag="CNJ01910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657966.1"
                     /db_xref="GeneID:3254155"
     CDS             complement(join(559672..560165,560233..560326,
                     560384..560407,560476..560553,560619..560720))
                     /locus_tag="CNJ01910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513644.1"
                     /db_xref="GeneID:3254155"
                     /translation="MLHSTLVTCFLSAATKLDSLVFFSSQRPARISKMGPPPRMLFKI
                     TVLGDGGVGKTAITVQFTMSSFVETYDPTIEDCYRKQWVVDEQPCLLEVLDTAGQEEY
                     TALRDQWIREGEGFLIVYSITSRPTFERVERIVERVLRVKDESGLPLPSPSSNDPYGS
                     NRSTPTAAGGGGGGGMWAARVPIVIVGNKKDMFHSREVSTDEGASLARRLGCEFFEAS
                     AKTNSNVEAAFKCLVKKIKSAKQGGVAVQAERIGGRKKKQKCVVL"
     gene            complement(560982..562325)
                     /locus_tag="CNJ01920"
                     /db_xref="GeneID:3254193"
     mRNA            complement(join(560982..561215,561272..561372,
                     561426..562113,562185..562325))
                     /locus_tag="CNJ01920"
                     /product="Ras2, putative"
                     /transcript_id="XM_567364.1"
                     /db_xref="GeneID:3254193"
     CDS             complement(join(561031..561215,561272..561372,
                     561426..562113,562185..562302))
                     /locus_tag="CNJ01920"
                     /codon_start=1
                     /product="Ras2, putative"
                     /protein_id="XP_567364.1"
                     /db_xref="GeneID:3254193"
                     /translation="MAARPTVTVWSATGEASGSLPLPAVFTAPIRLDVVQQVHKSIAK
                     NRRQAYAVAENAGHQTSAESWGTGRAVARIPRVGGGGTQRSGQAAFGNMCRGGRMFAP
                     TKTWRKWHVKVNQNQRRYAVASALAASALPSLVLARGHRIEQIQEVPLVLSSSVESTE
                     KTKAAVELLKTVAAYPDISKVSNSRKIRAGKGKMRNRRYRQRRGPLVVYAKDEGIVRA
                     FKNVPGVETCPVESLNLLQLAPGGHVGRFIIWTESAIAALDSVYEKKSGFNLPTAKIS
                     TSDVTRLINSDEIQSVVRPAGQAVQKRPFTQKKNPLRNKAVLFRLNPYAKTLRRQELL
                     ASQRKAKGSVKKSAPGSAGKEFLEILHAA"
     gene            562540..565510
                     /locus_tag="CNJ01930"
                     /db_xref="GeneID:3254335"
     mRNA            join(562540..562893,562962..563364,563417..563685,
                     563753..564521,564581..564961,565027..565070,
                     565129..565510)
                     /locus_tag="CNJ01930"
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase, putative"
                     /transcript_id="XM_567365.2"
                     /db_xref="GeneID:3254335"
     CDS             join(562564..562893,562962..563364,563417..563685,
                     563753..564521,564581..564961,565027..565070,
                     565129..565356)
                     /locus_tag="CNJ01930"
                     /codon_start=1
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase, putative"
                     /protein_id="XP_567365.1"
                     /db_xref="GeneID:3254335"
                     /translation="MHRGIPSPPATRRHTAIQHTPWENRVPPSAYGSARPHSAFLEAT
                     PHDDAELPLFKDTNMELKRRFDEKQPVHLEQPVVDDDQGKWEKGYGAGPGIGGRRGLP
                     PRQRIPGWKGIVQEHEEWVWAGVYTLLSMITRFWRIGAANYVVWDEAHFGKFGTHYIK
                     RDFYFDVHPPLGKMLVGLAGLLSGYQGNFEFKSGVAYPEDVPYTAMRVMLASFGVALV
                     PLAWFTSGELGWSRWTRHWVTICVLCDIGWLCISRFILLDSMLLFFTFTTTLGLVKFR
                     NQRHAPFSDDWWIWLVFTGWSIGCVCSVKWVGMFITALVGLYTIEDLWEKFGDLSMPI
                     RTYITHWVARITCLIILPFIVYASCFKIHFLILNRSGPGDAQMSSLFQAHLRGNDFAE
                     SPLEIAYGSTVTLKNYGYGGGLLHSHVQTLPVGSLQQQVTCYHYKDENNNWQIVPPWG
                     ADPVDPDGPIRFLKDGDEIRLVHTQTGRNMHSHAIAAPVTKESWEVSGYGNLTIGDEN
                     DLWIVEVVDDTHTSKKNNEDGRIHSLTTRMRLKHRQLNCYLRAANAVLPQWGFKQVEV
                     SCTKENNPKDLHTYWNVESHWNDRLPAGNAKLYKSPFWRDFVHLNVAMWTSNNALVPD
                     PDKEDILASQPFDWPFLHLGLRMCGWGDHQIKFYLLGTPIIWWFSTISLAIGLGLAAW
                     YVARMQRGYKEWKAGEWDHWLWAGKVAFGGWALHFFPFLIMGRVTYLHHYLPTLYFAV
                     LMAGHILDHFFFASSTRSHTKKLIWFAVWAGVVILSFWWFKDLALGISGNVNNHWGWG
                     WRSSWNIYN"
     gene            complement(565465..566551)
                     /locus_tag="CNJ01940"
                     /db_xref="GeneID:3254250"
     mRNA            complement(join(565465..565951,566015..566159,
                     566217..566551))
                     /locus_tag="CNJ01940"
                     /product="dihydrofolate reductase, putative"
                     /transcript_id="XM_567366.2"
                     /db_xref="GeneID:3254250"
     CDS             complement(join(565537..565951,566015..566159,
                     566217..566433))
                     /locus_tag="CNJ01940"
                     /codon_start=1
                     /product="dihydrofolate reductase, putative"
                     /protein_id="XP_567366.1"
                     /db_xref="GeneID:3254250"
                     /translation="MFPPGTTCKSNSTPSQHRCMRPLLNALRTMQTTAKSSTPSITAV
                     VAATAENGIGLNGGLPWRLPGEMKYFARVTTGETPSSDPSEQNVVIMGRKTWESIPSR
                     FRPLKNRRNVVISGKGVDLGTAENSTVYTDIPSALSALRSTTESGHSPRIFLIGGATL
                     YTSSLLPSSVPSLNSSTSTSPLPFSRPLIDRILLTRILSPFECDAYLEDFAAHTKPDG
                     SKVWKKASIKEFREWIGWDIEEQVEEKGVKYIFEMWVLNQ"
     gene            566722..567788
                     /locus_tag="CNJ01950"
                     /db_xref="GeneID:3254269"
     mRNA            join(566722..566732,566776..566878,566949..566991,
                     567045..567085,567141..567350,567421..567589,
                     567639..567788)
                     /locus_tag="CNJ01950"
                     /product="arp2/3 complex 21 kda subunit (p21-arc),
                     putative"
                     /transcript_id="XM_567367.2"
                     /db_xref="GeneID:3254269"
     CDS             join(566727..566732,566776..566878,566949..566991,
                     567045..567085,567141..567350,567421..567589,
                     567639..567666)
                     /locus_tag="CNJ01950"
                     /codon_start=1
                     /product="arp2/3 complex 21 kda subunit (p21-arc),
                     putative"
                     /protein_id="XP_567367.2"
                     /db_xref="GeneID:3254269"
                     /translation="MPAYHSAFNQDTSVRQVGNTAILPITTKIRGPAPLSSDPTQPDI
                     IDESLDLFRANCLFRNFEIKGPADRLLIYLILFISDCLTKLAPTAGKPSPSYQEATKV
                     LQTLSVDNFALPGDAGFPLNSLYHPPASRVDADHLRSYLTQTRCELALRLCDRLYPQE
                     QVIGPDGQPTGQLGPRATKPSKWWMSFQKRRFMGRSLGV"
     gene            568843..570342
                     /locus_tag="CNJ01960"
                     /db_xref="GeneID:3254341"
     mRNA            join(568843..569208,569263..569359,569414..569543,
                     569602..570342)
                     /locus_tag="CNJ01960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567368.2"
                     /db_xref="GeneID:3254341"
     CDS             join(568935..569208,569263..569359,569414..569543,
                     569602..570270)
                     /locus_tag="CNJ01960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567368.1"
                     /db_xref="GeneID:3254341"
                     /translation="MTSDSDHTHAAVKQRQQRQPRQQRNRSRSSISADPEEFLPSRPP
                     SPPGPSANAPPPSERVTHLRLSAHYAVLVLASMLGCVARIGLNGLCTYDGQIIYALAW
                     SQGIGSGVMGLALAKKNEMTILYPPLYTFLTTGIAGCITTFSSWMLEGYLSFSNFNHY
                     NRKGLHDTVDGVAYSLSTFAIALSCLRFGEHFGSALPKLPYFNTLSRVTPPEEKSSSP
                     SLLPHTPILDILTILTAFLAYLIALLLYFLAPHSWRHDVVFPLLMSPPGAILRFSLSN
                     INIRHPFINRFPLGTFISNMVATLLIAGTFAAQRRPNVVNAGSVRCNALYAIQQGFCG
                     CLSTVSTFVVEARAVEGWRWKWLYVGASVILGHVFVLAVVGGTGWNEGYVDACTG"
     gene            complement(570334..574329)
                     /locus_tag="CNJ01970"
                     /db_xref="GeneID:3254097"
     mRNA            complement(join(570334..570472,570529..570604,
                     570685..570787,570852..570974,571029..571353,
                     571405..571490,571545..571659,571713..571885,
                     571944..572123,572195..572312,572374..573337,
                     573383..573497,573557..573587,573637..573691,
                     573740..573759,573815..573845,573906..574329))
                     /locus_tag="CNJ01970"
                     /product="expressed protein"
                     /transcript_id="XM_024657967.1"
                     /db_xref="GeneID:3254097"
     CDS             complement(join(570409..570472,570529..570604,
                     570685..570787,570852..570974,571029..571353,
                     571405..571490,571545..571659,571713..571885,
                     571944..572123,572195..572312,572374..573337,
                     573383..573497,573557..573587,573637..573691,
                     573740..573759,573815..573845,573906..574224))
                     /locus_tag="CNJ01970"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513621.1"
                     /db_xref="GeneID:3254097"
                     /translation="MQQPKKTSDWQDQGAANTQIFPSSSGWRPESLQEDGWATSSNTK
                     ILQTEHMSQVPPGSDLSYDVTERRSSDGSPLYSVYPSGNQGEMHDQTSAAGMASEIGS
                     FQRSDIVNNPRSMQTSQEFDPGIEPSKASLTTEATLKRGMACKFCRRRKLRCSAERPK
                     CSSCIKYKQECEYRTEEKPFSKVHPAQSQTARRMPPFSHQNLSHGFRPVHNTQSMGSI
                     AGDTPHHPQQQRIMSAPSDHLVNQPWQSFAPRQPVVDFNYPVQIPNYSFPTPQMMPQN
                     YSSPFDPNLPFPTYPQQRYMPEDPVRDSTSSSTQFPLVYLPQQPTVNPVVSSDLTVPI
                     SQRENLSREVPTPAISRDSQFTAQSTYTFPTVPALPPINAPSTAYPQTGPTLLPNDIA
                     KQSQSSVSPEANDKSSSSAPTSVSSMLGLPPELHDNIDSVDNLSDRLGEFLFGPGENT
                     ATNQNISSKEASEWQKKRRTGKGQTAQWIAGGKTLGEAPDRNSLLLNSAEFDGLKDEH
                     RNLLLDCFLAHVRLFFEMSIPRFRYRMTFMDKRRPSPALLNAMYLWATRLSQAPNSAS
                     MEERFFTEACRHLDAAAANSDRLIDAIRAAMLLSAYAYTNNRHHEGWLVAGIAVRLVL
                     STGIHRIPSLTFRAAPPTNPLLRTRSYLLPPPEDAIELAERVHAFWCVYSIERCGALA
                     TGFPSSISDDDILTPFGRPFDDISSQNVTSGDDITVRDLYRNGPIPVSERDSWYIRWV
                     KAVTILERASKLAFLEPEEDSDYSRAWAEYLCLLSTPGTQSASSPPVYLNQPKYRNPK
                     DYNECLFALNRLKKNLGVDGMSLLERKKMADVEGAELVFGTKLIILHHHFIATDMLLH
                     DINSADADNNVAMQAARQSVDLFRSLPQIPAQEIDAEVILVWCMVAKCLIKELERFSR
                     LGDVISCKTVSDDVDVIINELYRAGEVMDMSRTQAKAMEEMKKMALASQHV"
     gene            complement(575182..578284)
                     /locus_tag="CNJ01980"
                     /db_xref="GeneID:36393067"
     mRNA            complement(join(575182..577599,577661..577794,
                     577842..578132,578248..578284))
                     /locus_tag="CNJ01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657968.1"
                     /db_xref="GeneID:36393067"
     CDS             complement(join(575291..577599,577661..577794,
                     577842..577972))
                     /locus_tag="CNJ01980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513622.1"
                     /db_xref="GeneID:36393067"
                     /translation="MGVRGLQTFVRENRGSLCRSVLLPERDPQGSQRGSIPLIVDAWG
                     VIFKLYLDSLPWASGGEYLRFYQITKQLITAWRKVGLEPTFVFDGAAPIEKHPTILKR
                     MTESLSTPKLFYATSVSSRSEPSFGRGYSTKPLLPPFASHAFIFALHRLGVATHHVPS
                     GEADSACVTMAERIGGYVLGQDTDFLILVGKSERVAGYVPLDMLSWIEGEVSEEEAQD
                     DKLGQSPTKTFRPAYGRRKKSHTPRQSSLLPPPNYHHATLVMTVIPPQTLRQRLRLPA
                     NYMALFASLVGNDYTPPEALQRFYEPSLDVCQRIEKAARVLREQLFSPSANSRRNVNP
                     GDFVVELVRRVVKKLCIWQYDTEPDLLRAVNSIIEAALQYTSPHGGECCPIYPFCGEL
                     DPLGCQTPYNRANIPGGSNSGGGDRSHSQKALEAYAAAQRKGSLLFITHGWLYPNRIY
                     LRGALEDPTMASPRTLEGSRGVRLASYVIAEEGLGGFRFVDEPLPGVKNGITPAEMQE
                     DTELRGLLGVGSSPESAETDLAPQGAQSVDELEVMKDPPRVMVEYVRQGSAGKIVPYT
                     LDLPPKKDSSESTPVCLRPLADRLQAYLGPMQSDTPAIRLLPSSLQPLVAIIRHCVIE
                     MARLTEKNGRATNPAWRRHEAYAVLKAGVGTFAQWRRELDSEEMVGLRRKKLSPVSPE
                     DEANEWPTLERRHAHLIAQLSNAMMDSTSLSESLLLLSTQVPYFTPIQMESLPQPLIG
                     DPVADFGPTHLSPFLFFSGINIHSLLNQAEPPTHLKWKWTPEEDKTLHMCWHALIDEL
                     EDGVILGLNSSQASGAEFLAQTRTAVGRESAKRSKKKAAKKHAQGKAAGMFDLLGDMT
                     I"
     gene            complement(578534..580114)
                     /locus_tag="CNJ01990"
                     /db_xref="GeneID:3254039"
     mRNA            complement(join(578534..578725,578782..578881,
                     578931..579030,579084..579194,579253..579394,
                     579449..579604,579666..580114))
                     /locus_tag="CNJ01990"
                     /product="nucleolar essential protein 1, putative"
                     /transcript_id="XM_567372.2"
                     /db_xref="GeneID:3254039"
     CDS             complement(join(578702..578725,578782..578881,
                     578931..579030,579084..579194,579253..579394,
                     579449..579604,579666..580037))
                     /locus_tag="CNJ01990"
                     /codon_start=1
                     /product="nucleolar essential protein 1, putative"
                     /protein_id="XP_567372.1"
                     /db_xref="GeneID:3254039"
                     /translation="MSDTPSSDTPPKRRAADTTAVPPQKSSKMSATAPPFNPTRPLTK
                     KPAASFHDIAQEFKPKVKTEEVEDAMEVDKEAEGSARVTKPLPGGKRNVQRADFVPVQ
                     ASVPKSTEDKENTRRLIVVLSQACLEAYKISSGSAGKSSAKEAKYALLNCDDHQGILA
                     KTGRDIADARPDITHQCLLTLLDSPLNKAGLLQVYIHTAKGVLIEVNPSVRIPRTFKR
                     FSGLMVQLLHKLSIRGVNGSEKLLRVIKNPITDHLPTNCIKLTLSADAPTVRLSKYLN
                     TLPESHSVCVFVGAMARGADNFADQFVDQKVSISDYSLSASVACGKFCCAMEEIWDIV
                     "
     gene            complement(580247..581719)
                     /locus_tag="CNJ02000"
                     /db_xref="GeneID:3254252"
     mRNA            complement(join(580247..580469,580525..580741,
                     580803..580811,580876..580946,580997..581009,
                     581069..581136,581197..581199,581287..581304,
                     581363..581388,581449..581489,581571..581719))
                     /locus_tag="CNJ02000"
                     /product="GTPase, putative"
                     /transcript_id="XM_024657969.1"
                     /db_xref="GeneID:3254252"
     CDS             complement(join(580357..580469,580525..580741,
                     580803..580811,580876..580946,580997..581009,
                     581069..581136,581197..581199,581287..581304,
                     581363..581381))
                     /locus_tag="CNJ02000"
                     /codon_start=1
                     /product="GTPase, putative"
                     /protein_id="XP_024513623.1"
                     /db_xref="GeneID:3254252"
                     /translation="MSSQTSENRLSVSAAFLTQSVKLSESTSIKFEIWDTAGQERYKS
                     LAPIYFRNSNAAVIVYDITQPPETSFEKAKSWVRELQRQADPSIVIMLVGNKTDMESQ
                     RKTSREIGEQYAKEEGLLFAEASAKTGEGVEELFMEIAKKLPLAPPPPRGQVAGGKGV
                     QVSGQEDSATPSACTC"
     gene            582068..584795
                     /locus_tag="CNJ02010"
                     /db_xref="GeneID:3254088"
     mRNA            join(582068..582638,582931..583136,583202..583267,
                     583317..583385,583438..583550,583601..583738,
                     583793..583953,584003..584127,584184..584612,
                     584680..584795)
                     /locus_tag="CNJ02010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567374.2"
                     /db_xref="GeneID:3254088"
     CDS             join(582437..582638,582931..583136,583202..583267,
                     583317..583385,583438..583550,583601..583738,
                     583793..583953,584003..584127,584184..584612,
                     584680..584694)
                     /locus_tag="CNJ02010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567374.1"
                     /db_xref="GeneID:3254088"
                     /translation="MSGLPPPSSSLPPPPRFDYGREDGYQGRPYDGPKDRAYDRDRDN
                     WERDSRRDHQHRGPGGPRSRTPEGRGVRRLYDRENRSIEERIQQERPCRTLFVRNVQY
                     DADPESLRLQFESFGQIKNFYEMVSKRGMIFISYFDSRAAQRARDAMHGTLVNRRPID
                     VHYSLPRSEEVTGACTAEKNQGTILVLLHPPRTLDINEIGRIAAQYGDIKDVVPGRVP
                     SEIIVEYFDSRGAALFQQQMDRQPLLGGELELRFIWDKLDNNVPPPPAAVAKASRPST
                     DYDDRARGPPPRRDDAYNDSRGGRFGPRGGARERSPDYRDRRGSYETGYGGRPSGPSP
                     GRYHDAPPAPASVSEDRLEQALRVQQLLNKIGNVNVPPVAATPPTAPPAPSYYRSPPV
                     MPPSTTPYPPHGASYASYPPYPTPTPNAYGSKPPYVAPPFPPYPPPAAGGSVPPEGMG
                     PLPGRQHPAGYGAPPPLPPFPPAGPTAQAIQPAATAPQGQQPVKDVGSLLAMLQGKQ"
     gene            585503..587911
                     /locus_tag="CNJ02020"
                     /db_xref="GeneID:3254048"
     mRNA            join(585503..586046,586115..586257,586312..586477,
                     586544..586620,586683..586825,586875..586962,
                     587026..587090,587145..587422,587473..587595,
                     587652..587911)
                     /locus_tag="CNJ02020"
                     /product="expressed protein"
                     /transcript_id="XM_567434.2"
                     /db_xref="GeneID:3254048"
     CDS             join(585975..586046,586115..586257,586312..586477,
                     586544..586620,586683..586825,586875..586962,
                     587026..587090,587145..587422,587473..587595,
                     587652..587867)
                     /locus_tag="CNJ02020"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567434.1"
                     /db_xref="GeneID:3254048"
                     /translation="MTSDQAYLNLLLWQTLSSNPNYLLWCSVLGLVFQCILLGILISQ
                     ARRYLEVYSLTDPIPLVLVVVAGLSAVIAALAVTCIQVHRLISEFDDYPAVAAVDNAN
                     NLAIFGIAGALGGAGLVQGICKVWKISGTARFYVCAPLALGMLASWGMVLAALVHGAS
                     IPDITVANLDYVGIWMKKQAILYKGWAGLLAGTYLTTWCSRNFFLVRQWKQFGEQKGL
                     SRMLLWMVAESMLPVSIVALVFLIHLCLYTPSLANIGRTIMQCLPALSLISILNPLTY
                     RHRLQSIIDTQSNVGLKPSDAGGCGGSGLITNRLTGISSAFKSFSYKERPEDEEEISV
                     RVTVDTYTFENVSSTPSTHDFSNGYKELSPVASPTPTLLPDSSSAVLAPIVPFDPREF
                     VGQLPQGDSQSARTFVAPSFKSAVPSGKSIARTKSQKSSKKPKGGPILDPAGWPELLG
                     RMEGMS"
     gene            589637..594546
                     /locus_tag="CNJ02030"
                     /db_xref="GeneID:3254123"
     mRNA            join(589637..589946,590115..591167,591217..591458,
                     591522..591626,591681..591957,592012..592082,
                     592134..592375,592426..592552,592606..592744,
                     592799..592869,592924..593013,593079..593147,
                     593203..593244,593299..593403,593450..593775,
                     593828..594192,594246..594546)
                     /locus_tag="CNJ02030"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_024657970.1"
                     /db_xref="GeneID:3254123"
     CDS             join(590126..591167,591217..591458,591522..591626,
                     591681..591957,592012..592082,592134..592375,
                     592426..592552,592606..592744,592799..592869,
                     592924..593013,593079..593147,593203..593244,
                     593299..593403,593450..593775,593828..594192,
                     594246..594298)
                     /locus_tag="CNJ02030"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_024513624.1"
                     /db_xref="GeneID:3254123"
                     /translation="MQPPAGREDDEHRHPLPLPHSSSSSSSHPRSSYPFLHHLPPPIP
                     STNSPLTHFPASPNYRDPPAQSPSGGHTDPQSWASQPILDRPGSRSRTSWGASPRDPT
                     QTRLPPLSLGQMEFSHRSAPPTPWEAPSPGSYAMSNARGVPNTPYGGASIYRESPSRH
                     QPPLATPLSSNNSFSYVPPFPGDDSSPHQNVNRLESTANNLQPRSPPPPPSRGTSRGK
                     HTNSTEDTDRDGQTQKKKKRRVALSCAECAKRKQRCNRETPCQHCVARRVPELCVPYT
                     RPSSPPEKKGSGNKKDFTKVKTENEATAEKPRPSMLPTISVRVARLEAIVNAVVNRIP
                     EVGGTKALKDWRINHAPATSPPPFGADDDDDEESVRPQTSGDRELDRPGSTSSTRSRR
                     DDNSAEWGAEGEGEGDDGGVDGLDRATSGRNPLPQSMMHPSQPVSRGLDYHGTPAESL
                     QRLFEDSGLNPHKVSELLKDLPERSLADKLVDWFFEKFNFVRYPIDDHAFKRAFETVY
                     VDGNSPPAVLALPLVFIVLAISARIAPEAVIDTEERKRALSLRMYWSSKSAAIIASAV
                     KAENIQLVETRICSGLYLVLMHERRLAEGWSEFRLALTIGQAIGLHRDGKTLGLDPYV
                     TEYRRRLWSYLVHADATYSCLLGRPTSIDSACVDTLPPSNLNLVDLLENKLAKPRPIT
                     EPTFGTYLLLRRRLGDIVAKITHHFQRLTGQTQYRDVEALDAELKQFVADLPPTFTML
                     NHDKSYDSKLWYLPIHRYYIQTEILHFTIILHRPWLLRRLKSSRYNLSRIACFDAAIT
                     DYKIRQAFKIECPDFFETLLGSSFREFNAAMIAGISMIIDPRAAHSSDMRMIVQSFME
                     QHPHDPKADDFSQKEAAIIYTLHRRAQEMEERRTRRNAPRWSADNTSSQRPAPRSTGT
                     RSAMHSPPHPAPESKDKQATSEPSRSVPLLPSPSGSVQAYFKGSYYGQNSGPTPPGLG
                     TSPEEDHPQRLLDHWLMSNTSFGPGADSTMNQFNIGLYSMPVPTMVNDRGSDSASHGA
                     GPHPSPHQYPPAGYQHGHPPQPIQVPEQMPWMDPSLIPVTPASALQAPAVISGMSGGV
                     VGGDGNNTQYWNALIDGIVGGLPNYDPNFTTVG"
     gene            complement(594521..595556)
                     /locus_tag="CNJ02035"
                     /db_xref="GeneID:36393068"
     mRNA            complement(join(594521..594707,594777..595005,
                     595065..595556))
                     /locus_tag="CNJ02035"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658770.1"
                     /db_xref="GeneID:36393068"
     CDS             complement(join(594653..594707,594777..595005,
                     595065..595503))
                     /locus_tag="CNJ02035"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514450.1"
                     /db_xref="GeneID:36393068"
                     /translation="MPRKIPIQSILPQINSHISTRHIASCARLRRQRQLDYLAPFRRP
                     ANPPYSPLNDKLRNVLQTHGHPAASPAGDVPYETASTAPVATSLQEVPAHEEASRVVD
                     PLPAMKDASAAKEEHAKEKMKARTKEMIVQGIAVPPKPIPPGEEECCMSGCVNCVYIT
                     YSEDLQGYIEALDAAREALEAARIPRTEWPDEIAKQGRGEDIKGEEVRKTEDAMDPSM
                     NAFFALENKLKKKQAPESNAAS"
     gene            595663..597152
                     /locus_tag="CNJ02040"
                     /db_xref="GeneID:3254339"
     mRNA            join(595663..596338,596392..596690,596753..596894,
                     596954..597152)
                     /locus_tag="CNJ02040"
                     /product="homoserine dehydrogenase, putative"
                     /transcript_id="XM_567376.1"
                     /db_xref="GeneID:3254339"
     CDS             join(595700..596338,596392..596690,596753..596894,
                     596954..597001)
                     /locus_tag="CNJ02040"
                     /codon_start=1
                     /product="homoserine dehydrogenase, putative"
                     /protein_id="XP_567376.1"
                     /db_xref="GeneID:3254339"
                     /translation="MLSASILRPIPVALLGLGGVGKAVLSQLLSPPLSAQFQLVLIAN
                     SRLSLSLPLPAAPITPANFQSILEKHGAPLDVTSVISVLSTHPDAPGIFIDCTGSDAI
                     PAMYPQILSMGVHIVTPNKKGLSSSEALYKAIAEKSFPNTPSLLYGESTVGAGLPIIQ
                     TLKDLVATGDEIEKIEGVFSGTLSYIFNEFSKPGGGDVKFSEVVKVAKEKGYTEPDPR
                     DDLSGIDVARKLSILARLVPTVPALPEGYASIPTQSLVPDVLSDASTKEEYLERLEEG
                     DEFFANLREEAKKEGQVVRYVGVIDIKSGKVEAKLDKYPADHALATGLKGSDNIVSFT
                     TKRYSPRPLIIQGAGAGADVTAMGVTSDMVKIYERLAVSRI"
     gene            complement(597127..598811)
                     /locus_tag="CNJ02050"
                     /db_xref="GeneID:3254078"
     mRNA            complement(join(597127..597317,597377..597628,
                     597687..597962,598025..598126,598182..598214,
                     598267..598394,598448..598539,598587..598811))
                     /locus_tag="CNJ02050"
                     /product="S-adenosylmethionine-dependent
                     methyltransferase, putative"
                     /transcript_id="XM_567377.2"
                     /db_xref="GeneID:3254078"
     CDS             complement(join(597246..597317,597377..597628,
                     597687..597962,598025..598126,598182..598214,
                     598267..598394,598448..598539,598587..598792))
                     /locus_tag="CNJ02050"
                     /codon_start=1
                     /product="S-adenosylmethionine-dependent
                     methyltransferase, putative"
                     /protein_id="XP_567377.2"
                     /db_xref="GeneID:3254078"
                     /translation="MLIRAPSYIFNSKTRTIYSAAMELQQHQQEQARKTVADKWLKPH
                     GPPVGATFGARVLKDEDDVFNHNAWDHVTLPEDFKERAEKVMELHRSSPVAEEKRDEY
                     NDKPAHYWDKFYSQHEDGFFKDRGWLRLEFPELVACSEADAGPKTVLEVGCGAGNTVF
                     PLLMRNENPELNVYATDYSATAVKVVKANKMYPKAEHGLGTMHASVWDITSTPPPPLV
                     SSSSTSTSPEDQLSSLSIEEQPTYSLPEGITPGSVDVISVIFVLSALHPREWKQAIHN
                     LYTALKPGGLLLIRDYGRHDLAQLRIKKNRLLDPETPNLYIRGDGTRVYFFEKEELEG
                     MVLQPPEGRVEGRAKNMFEIQQLGEDRRLLVNRKERLTMYRIWMQVKAKKLT"
     gene            599003..600805
                     /locus_tag="CNJ02060"
                     /db_xref="GeneID:3254107"
     mRNA            join(599003..599103,599229..599276,599392..599605,
                     599659..599951,600009..600191,600248..600334,
                     600391..600589,600653..600805)
                     /locus_tag="CNJ02060"
                     /product="isocitrate dehydrogenase (NAD+), putative"
                     /transcript_id="XM_567378.1"
                     /db_xref="GeneID:3254107"
     CDS             join(599044..599103,599229..599276,599392..599605,
                     599659..599951,600009..600191,600248..600334,
                     600391..600589,600653..600705)
                     /locus_tag="CNJ02060"
                     /codon_start=1
                     /product="isocitrate dehydrogenase (NAD+), putative"
                     /protein_id="XP_567378.1"
                     /db_xref="GeneID:3254107"
                     /translation="MLANSIRSSVAGSLRNASAKRVPVARTMATLVDEKRLPSKFGGK
                     YTVTLIPGDGIGQEVADSVKEVFDALKVPVQWEQYNVSGETTGGEALFQEAMDSLKRN
                     KVGLKGILYTPVDQSGHNSWNVAMRQQLDIYASVVVCKSLPGLATRHSNVDFAIIREN
                     TEGEYSGLEHQSFPGVVESLKVSTRAKAERIARFAFDFALKNNRKKVTCVHKANIMKL
                     GDGLFLNTCKRVAEQEYGHTGIKFESMIVDNTAMQLVSKPQQFDVMVMPNLYGAISTN
                     IGSALVGGPGITPGCNFGREYALFEPGCRHVGKDIMGTNKANPIALMLSATMMLRHLG
                     LESQANLIAGATYDLVKEGKIRTADIGGNATTTDVTKALINRLL"
     gene            601580..602562
                     /locus_tag="CNJ02065"
                     /db_xref="GeneID:36393069"
     mRNA            join(601580..602001,602065..602155,602225..602562)
                     /locus_tag="CNJ02065"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658771.1"
                     /db_xref="GeneID:36393069"
     CDS             join(601702..602001,602065..602155,602225..602427)
                     /locus_tag="CNJ02065"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514451.1"
                     /db_xref="GeneID:36393069"
                     /translation="MSSLNPPHPSINLGRYELIKCDPLEPLPLYIKLYIAENAATPRS
                     SIQSLLPSVHCILRLFGHHLIAGRLRANDIYHSHQIICMADLYGPYIPDPNDGYIDNV
                     RYVGEGIERLNSHEDFSQVVACIQRFFAEETSPPQCPYVTLYLLEEGQKCMQISDPDG
                     CGFHYLYTLLVMNCLPQPCTMYEDDRIEVWRGLGQPV"
     gene            complement(601806..603536)
                     /locus_tag="CNJ02070"
                     /pseudo
                     /db_xref="GeneID:3254115"
     gene            603677..606547
                     /locus_tag="CNJ02080"
                     /db_xref="GeneID:3254045"
     mRNA            join(603677..604761,604818..605034,605084..605147,
                     605199..605648,605700..606206,606260..606547)
                     /locus_tag="CNJ02080"
                     /product="vesicle fusion-related protein, putative"
                     /transcript_id="XM_567379.2"
                     /db_xref="GeneID:3254045"
     CDS             join(603721..604761,604818..605034,605084..605147,
                     605199..605648,605700..606206,606260..606377)
                     /locus_tag="CNJ02080"
                     /codon_start=1
                     /product="vesicle fusion-related protein, putative"
                     /protein_id="XP_567379.2"
                     /db_xref="GeneID:3254045"
                     /translation="MTTPPQQPELPGRRFGSFGGSRPSAPPQRPSSSASNTSTSPVPT
                     PSPNLMPPPPQRTRSASSTSSNQANNAAAFDITQAADKAHQWLSNWAPRGEGRGREFL
                     INGLNGVASVASTVSSGLNARHEKDRDAHRSLSFLGPSTSSSVSPATSPEGRFHVSTS
                     PPGPTHTQSTPQFGVTQQESLVSNGSRKILPPANLARLGHSATTNSTPTISSGPSAVH
                     QQRPATLHSGSTTSLPSANHRSSIHGPSHLGPNSPTHRRTSSSHSNHRPFTFANGSHG
                     MSRKSSSMSKSSSMTGISAGPYMRNAGIPYKVGFQPQGVRRDRTEEYMEARRAVEADR
                     EIEEGRLSRRWAKLVDLHFNPTVSQPAAPTLARSSSSNFSLSSLGQDRRRSLLSIEGA
                     LDAMKPKDIFKGFKAGSGPGGDEGRKRAAEQAIVKWEDDSEVRKCRICASSFSLSNRK
                     HHCRLCGRIVCSLPPTPPALLAVQIQLFAPADPSATSTQTQAGLPSGTRREKCSLLLV
                     ADWKTGRGEEVEEGFVGWMRMEDGEGSGEGQAIQRRRRSQPEDRIGAVNSDDASTRNI
                     PLPQQPKEVQVKGMRVCRECWAVVSRKQKMQDRQRVTGFARLYQALRTLQIEIENLTA
                     DFEEQLSELVSSADPIEPPDELLILHRQLIALFTQYEQLSKRINGLPCQENGSQASVQ
                     SAIARSAAVFMTKEMVKLQAIQSLQKRSAEAKKKGLVISETTLGQLEKEGMASDAGSD
                     VVEDVAIMLQPLLEQEAQLESYIADATAQRKYEDGKALQSALKEIRAEIERITEKVSG
                     "
     gene            609237..612155
                     /locus_tag="CNJ02090"
                     /db_xref="GeneID:3254247"
     mRNA            join(609237..609568,609619..609646,609710..609854,
                     609923..610437,610491..610550,610599..610726,
                     610783..610897,610964..611077,611143..611170,
                     611228..611326,611384..611806,611864..612155)
                     /locus_tag="CNJ02090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657971.1"
                     /db_xref="GeneID:3254247"
     CDS             join(609272..609568,609619..609646,609710..609854,
                     609923..610437,610491..610550,610599..610726,
                     610783..610897,610964..611077,611143..611170,
                     611228..611326,611384..611806,611864..612059)
                     /locus_tag="CNJ02090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513625.1"
                     /db_xref="GeneID:3254247"
                     /translation="MPQLIPDYPGHKPPRWRCLRSFLPVIVLILLFSFFLSSYSLLSH
                     SKSPAAKQQIGWQSWDVVDMTSQTEVEGNEDDENETGNSNGTETTFIPSIPLDNWDPL
                     AMHSTGLTEIAVKSCYFPPEIFPSFCAPETTPELDKTKGKWVIVEKDLNVRSGLWYLN
                     LYYRRTRRLDAKLITDIKVLSHPPENEEQLYEDGWVLASGDLHSGVWPKQTEMRLWYK
                     LGYQGSDDWKMESKRREEDDDSAMDGVAESSETESSGDQDEGSSSSGEVQEIDEGSKT
                     TGSYGDFINEIDVLYGDDDPFFGFERVQGGPVLKEEKGKWETVDITVRRGNPRPPRAT
                     VPTFHSDGTLKIMQIADLHYSVGTGECRDTDIEGCVGDANTAAWLAEALDAENPDLVV
                     FSGDQLNGQRTSYDARSVLAKFAKPVIEREIPWCAVFGNHDSEIYADRDYQMKTLENM
                     PYSLSRAGPKSVDGVGNYYIKLHSSDASNMHIFTLYFLDSHAYQKRTLPWVKPDYDYL
                     KTSQIDWYRNVSSSIKPIERPFKPDGADDLSGIWSRRSQASRLPRDGSQTLAKPNAMM
                     WFHIPLPEAYNDPDQSLMGELDVGVQMDVAGSSKHNSGFFYNAIKTTYDREEAEGYFS
                     KKTAEVKVLSHGHCHNTDRCRRVDGIWMCFDGGSSFSGYGQLGFDRRVRLYRISEYGE
                     KVETYKRLTSGEIIDEQVLVGDGAAEGVGQDQI"
     gene            613191..615944
                     /locus_tag="CNJ02100"
                     /db_xref="GeneID:3254303"
     mRNA            join(613191..613654,613714..614039,614092..614442,
                     614494..614508,614564..614601,614658..614675,
                     614731..614789,614842..614866,614936..614952,
                     615000..615046,615097..615188,615241..615324,
                     615371..615417,615477..615944)
                     /locus_tag="CNJ02100"
                     /product="monosaccharide transporter, putative"
                     /transcript_id="XM_024657972.1"
                     /db_xref="GeneID:3254303"
     CDS             join(613531..613654,613714..614039,614092..614442,
                     614494..614508,614564..614601,614658..614675,
                     614731..614789,614842..614866,614936..614952,
                     615000..615046,615097..615188,615241..615324,
                     615371..615417,615477..615781)
                     /locus_tag="CNJ02100"
                     /codon_start=1
                     /product="monosaccharide transporter, putative"
                     /protein_id="XP_024513626.1"
                     /db_xref="GeneID:3254303"
                     /translation="MPYLGLRGKKLLTAISVTAGVGFCLFGIDNAALGGVISSDPFNR
                     RFNLDPTGQGAVTGSYEIGCFFGALFFAFFGEKVARRIVLLIGCVPLLIGTVLQVATY
                     STAQLVAGRVVAGLAMGAITSTLPIWQNETSPPALRGTLICASLSMLIVGQLIAYWAA
                     YGLLDKYDNDMVYRVMFSLQGMAAVIMGALLFFMPESPRFLLAHSRPDEAREVLSALA
                     DIPKNDPVITEQMEEIVRAIETERASARNWGDLMKRGKNAQGEKRRMFTAVVIQVCQA
                     FSGSTVISYYVTTIFQEAIGMSPHTSTLLSGYLQIFFLICSFATWWLIEHAGRRRLFI
                     LTAFAMAVVMFIMGGLIKIDTKPTGIGAAVMVFAYQAFFTWGWMAGVWVYSSEICPLS
                     WRSKGMGLAVALQWLFDFVLLMVTPVGIANIGYGMFMLFGAFNLCFIPFVYFYCPETA
                     GVPLESIDAFFVPGVDPIKESEKLRKEIRDARKGEEEVLAMEEAIIGEEPILDEGETK
                     YVGETEK"
     gene            618702..621179
                     /locus_tag="CNJ02110"
                     /db_xref="GeneID:3254064"
     mRNA            join(618702..618796,618850..618992,619050..619375,
                     619424..619774,619829..619881,619939..619956,
                     620016..620074,620131..620138,620195..620228,
                     620281..620327,620386..620477,620529..620612,
                     620666..620712,620764..621179)
                     /locus_tag="CNJ02110"
                     /product="monosaccharide transporter, putative"
                     /transcript_id="XM_024657973.1"
                     /db_xref="GeneID:3254064"
     CDS             join(618869..618992,619050..619375,619424..619774,
                     619829..619881,619939..619956,620016..620074,
                     620131..620138,620195..620228,620281..620327,
                     620386..620477,620529..620612,620666..620712,
                     620764..621059)
                     /locus_tag="CNJ02110"
                     /codon_start=1
                     /product="monosaccharide transporter, putative"
                     /protein_id="XP_024513627.1"
                     /db_xref="GeneID:3254064"
                     /translation="MPYLGLRGNALLFAISATAGMGFCLFGIEDSSLGGVISSDPFQN
                     RFHLDATGQGVVTGCFEIGCFFGGLVFAFFGERYARRIVLFIATIPLLVGTVLQVATY
                     STGQLAAGRVVAGLGFGAITSTLPIWQNETSPPGMRGMLICASLSMLIVGQLIAYWAA
                     YGLLQVYDDDRVYRIVFSLQGMACVIMALMLIFMPESPRYLLAHGRQDEARQVISALL
                     DLPEDNPMVISQIEEITQAIELEMASARNWKDLFKSAHDAQGEKRRMLTAVVIQVCQP
                     FSGSTIISYYLTTIFQEAVGLTPHTSALLSGYLQVWFIYGFKSTWYLIEHAGRRNLFL
                     ITAFFMSVVMFIMGGLLKMDTKPTGIGAAAMIFAYQGFYTWGWMAGVWAYSSEICPLS
                     WRSKGMGLAVALQWLFDFVLLMVTPIGITNIGYGMFMLFGVFNLCFIPIVYFLCPETA
                     GVTLEHIDEFYGPGKNPVKESSRIRKEMKEARKRRNAELERQGVAVTVMSEGKGEVTE
                     VEKV"
     gene            complement(621208..621873)
                     /locus_tag="CNJ02120"
                     /db_xref="GeneID:3254135"
     mRNA            complement(join(621208..621286,621336..621437,
                     621494..621673,621742..621873))
                     /locus_tag="CNJ02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_567383.2"
                     /db_xref="GeneID:3254135"
     CDS             complement(join(621252..621286,621336..621437,
                     621494..621673,621742..621748))
                     /locus_tag="CNJ02120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567383.1"
                     /db_xref="GeneID:3254135"
                     /translation="MPKIVHIVLWKLKRPSALTSTSTEEVLAKAKEAINALKNVPGPE
                     SVHLGPPLLDARAKGFDYGLYSIFSSAEALQTYAVSEAHVKVVTENVRPNVDDVFAYD
                     FVLEE"
     gene            complement(622056..625881)
                     /locus_tag="CNJ02130"
                     /db_xref="GeneID:3254089"
     mRNA            complement(join(622056..622617,622670..622992,
                     623043..625627,625673..625881))
                     /locus_tag="CNJ02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_567384.2"
                     /db_xref="GeneID:3254089"
     CDS             complement(join(622194..622617,622670..622992,
                     623043..625627,625673..625829))
                     /locus_tag="CNJ02130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567384.2"
                     /db_xref="GeneID:3254089"
                     /translation="MHPYGKLPQPQGTSNATSPPPPAATPASGPPPNPLRPSYGLVTD
                     RDRDRERQTLGNPYSYPSPLQRPDPPSSSSSSHSHQQRHQHHHHHHHHHPSGASSAGS
                     TPRDERTNPYAPPPPGAGTARKPDMLGVGLGAGLGRLSGGYGLFGNSPFREQEMRDRE
                     RQERIQRERERDLKPPAPTSPTRRASISTTPGNSYPRPSLPPSPTNTMRGGLPASNTV
                     TGKPSISPQLPPASAGSASASRPSLPLPNFSSLGSRSLPSPFERDTRERSTSGSAHPS
                     PAVPSTQEVPPSVGGHARSLSNSSAREIPGLSGNDRSPPKPSAPSTARSLYAGGPPPL
                     SGSQGNRDREVQRSPVTRAPTAASPREPSRDNISPPVAASSAKPPPSQAPSAGGPPSG
                     APTSGRAPYTSSYAYPSNPAYAGSFGGFGLSSFGGYGAFGGPRWDHEREREAREARER
                     VEREGKRDEEDKRKKETERQREKEREEREREKWKAAREQDQRERERRSSLSTPSAAPG
                     SGAAGARQPDPYRRNTGSFEGKPSSGYTRHIEVLNHPDPSAQPAATSQNAANSGYERE
                     TSVIQQVAPTREPRPYGYKPEPVTRETPPVQPPIREPAVSQMPRESLSTTANREPRPE
                     REYYQTIPPSAPVVPPIPVTAPVQPPREKRSRMDTVVEDAQVAHQAQQAQRRSSQAKS
                     KRRKLEEDKMTQAHHGMSHSHASYGNHHAHGRHSPVMDKRDFASIVQLPQKRVEVSSA
                     PVEAWLKGLPSLSRVIGTVDYTGKPFTLAKTGLVKPENEGGVIVVRIGGGFLGRGWRV
                     RGEPGWDDAGTKQVGNVVCGAEDPKRACWGTDVYTDDSDLGLILVHAGWIRWSALPSL
                     QSPQDRKKDEQEFINVTVRLVPKLVRYTGTERNGFKTRGWGNGHDGSSVVVERVERVK
                     IDRKYLASRKRKARISEWAHQRALVCPIPPSKQEDEEVKETILLTTTVPTESLILSAI
                     NVGGKDVAVSGAFKYSPDMLKGWLDVPIEGDELDKSLWEYKLILEGSSETYQISMNKE
                     STYKYPLINLTQLLPSDTTPKEIFASHPASGIYLLDDGFAAQLQGEKGVLFKVEKFRW
                     EKLKEGEVGAWAIEEEEAVPAVEEIVDDVPVEEAKEPAPHGDEEMAVDTPEVNGTNGI
                     NGHVRMKEEQMDVDGY"
     gene            626101..627601
                     /locus_tag="CNJ02140"
                     /db_xref="GeneID:3254333"
     mRNA            join(626101..626254,626320..626591,626653..626806,
                     626859..626904,626962..627148,627199..627259,
                     627321..627601)
                     /locus_tag="CNJ02140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567385.2"
                     /db_xref="GeneID:3254333"
     CDS             join(626246..626254,626320..626591,626653..626806,
                     626859..626904,626962..627148,627199..627259,
                     627321..627437)
                     /locus_tag="CNJ02140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567385.1"
                     /db_xref="GeneID:3254333"
                     /translation="MTTSANHSIMVHPTTPTISHVTIANPHPGDNAPHTMYRTPSHFS
                     GDGGPGVIYPEGMRLSRALTPGGNPVDTSQPALPNYHRALGDPAPVGLIPLSSGTLLI
                     SLYNVQTRGITTPNIILGLALGFSGIVQTIAGILEWASGNTFAAVALTSYGGFWFSFA
                     VLYIPQFEVTASYASDISMLANGIGLYLVMWGILTFLFLLASLRSSVALISLFLMLDL
                     SFWLTAAGYLSQNEKILKAGGGFGIAAAFCGFYVALASLLSGHTSFFLVPTGDLRPGS
                     SHKRT"
     gene            627845..635202
                     /locus_tag="CNJ02150"
                     /db_xref="GeneID:3254036"
     mRNA            join(627845..628039,628092..628653,628710..630987,
                     631051..633560,633615..634243,634296..635202)
                     /locus_tag="CNJ02150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567444.2"
                     /db_xref="GeneID:3254036"
     CDS             join(628114..628653,628710..630987,631051..633560,
                     633615..634243,634296..635055)
                     /locus_tag="CNJ02150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567444.1"
                     /db_xref="GeneID:3254036"
                     /translation="MVRTVQEPLPTTPQRLTGYSQPLQQNNASPWPGKPRTVLQERTD
                     NVMFLPPKSQSNKGKTQAFKAIPKLVSRPSQSPMRPKVSKFLANSPQRVGVPESFSSP
                     KSNPPLSSGTGVPSRAPPRPSMPMPVYGVDETLLIDMSLPGDSTLGGFETTDESEGEN
                     VTKRFGGFKGLMTPDNSQKVGRAESPSLSRTIKKVAVSRPSQKAPIRLPTPPASQPLP
                     IETSPSQPSTLRAPRVRARPSPTSPRHISVAPAEILGNSPSGFNAQSAAEPSPNPRSK
                     KKSRISNEIEEGLGRKSVAVTIPMRRMSASLDIGNVQKNMPRETHKSLGKGKGRASSS
                     RTPSATLSQSTSSTRRVSGGSNSSSQSRSKTPAAPRTKVIPATAPARRRLSKAPSTSR
                     KEPVKRRASTGMALTQTTPKNGKGRARKNRTTMTQEMFESKSVILDDPIHGSPGDDPL
                     LLKGVPAEEMEWDGEDTRNGLISGLGLQMESRNVVEEPVSAHRAGPSTAPSPSTIAKT
                     TQCAPPEQSPLLPTLYNRFENGEIDVGQYDDWGNDFGGGWSDDDSVAGEDTFLHVKER
                     QYTGEPNLAVIGENVTESPFIPRKRSTELMQEERELSMNIMKKEGEGEANVEGHVTLE
                     AEEGAWDEGLTVRQEAHADIEPGVSQLEEGQNRTDGEADVTIEAESDAWDNVPACQDD
                     KVESSNQRAHVEPCNAVIEIRSSDLSSSPQVNATRLPSPKRLATPRQKSPVLTASLSP
                     VSPFRHVQPTQLEKSPAVRNAEEQSARDESRQISVAGLSPAPTGRFSAASSPPAHLKQ
                     CSPIPNSPTYSRRSSLAPPPPVQLSYYVHPARSPSQPFSRAGSLRPLSILPTSAISKG
                     STQEAPELSEPEIEAVQHVSSLSPPGRSPRRSLSRESFQSPALRHSISPHYTLDERSV
                     TRSPLILIKHRGEGETAPPTEFEHNHRSVSQEPTTAQNEDGEEKDDIIVRAERMVARL
                     SMPLSPPTLPLLREETPALVIQAASPENSPASQPFITSSQISSSSVDAHRFTSLSPVP
                     ILVKSRISPLSSPEGIVAPQPQPTPALQMTPQDHEYTGTSPLVSPISDASLQHTPIPQ
                     FKLYPGETPLVDASYREPTLGFRRGTPHPKKELASPATDCSPFGPQTSAPQSRLSLQR
                     GISADTHSDSSLQQKGSLLLPTSPQAGSPNQSHFQEFIPARRSPNLSPSITMKKNSQT
                     SSSSSSPARVLNFPQSELKGIVNHIQASKIMDSPLEDVHLEPVAVVTQQKDVMGVEVL
                     TKTSIIQETASAVHAQTLVEDNHVENEVGPDGLIECSTNSVVTGDVELETPFGPTPES
                     AHANQLAMTLDPGGILEERDSVGGSARLSDEHGDDEQNIGNDSGLTEMTDKTAEGDSA
                     AWDISAASLNESVERSNELEGIEKTCERQKEDNEQDAGTVYLENNVPKSDMSEKDGEE
                     DDQTMEETLSENEQYQASGQENDQEETNDEDEGGELSEAQDKIIICVVSKEAVKVEPG
                     LEDDAQERQQTVSEIPDQRHTPAIPPPLHSSEAAREPSMQSRRTPAPSRLISGSVSNP
                     CQKTHQRHTPTAPRPHKQVVTKLSAPAPSTPYVPPSAPATPSDTLYPSLNNLDSPLSI
                     GTSFITSTPLHQNSSNPTAISNERSVFGIAGENTPQCIPTLEKMFAKKTVGHSKLSQQ
                     VIPSSSPSRGDPNEMESVQVDEKAEDPAKEKDEHEPHKSDAECDTSGSSQDNEMSNSV
                     QIKKPRRSLHEELAAVARDENEGDNSFKSVVEVSSLDPKAAARAAAILKLNHSYIEHG
                     VLSRQSPDVSDTSNLSHSSLLNKRDLLHEAELEIVSQRRSRSRSMSRAMSLSRDLEVL
                     RETRGEREMSVATFTTEDYPVPGGYVKTPIKRPHSPLPHIYHHSRASLAHMNTPGTAK
                     GKAKERANSWGVSEWKRLEKMYRSEKEAWIKEREMKTLPGGLVSWAKRATFGSNPRAE
                     AKPWDAQRVVDKFLEGEGSKADNVEWDKELVLLRVQAIERRLNRIQNKDTSLSTIIDT
                     PAQKKARKNLDAIDISSKTAHTPFPMLRCGPPVEEPPSTIKRMLGFVWGGGANKADRM
                     SDVKMKGKGLMKEFEATYEKDNAAMQMKEVARSEGVPPSLTVASQSAPARAGVITRSI
                     STPNFAAAASLPSTSRSSSALASTSFSYISDSSSSRLYPPLEPSLSQRSSAIAKLFPQ
                     AQMRIAVPPPPKEPIKLPNTVSGLQRSRTGSVKDLAKAFEEKSFELQK"
     gene            complement(635161..636426)
                     /locus_tag="CNJ02160"
                     /db_xref="GeneID:3254141"
     mRNA            complement(join(635161..635375,635428..635766,
                     635820..636085,636133..636426))
                     /locus_tag="CNJ02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_567386.2"
                     /db_xref="GeneID:3254141"
     CDS             complement(join(635249..635375,635428..635766,
                     635820..636085,636133..636261))
                     /locus_tag="CNJ02160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567386.1"
                     /db_xref="GeneID:3254141"
                     /translation="MSTNTASPPVDVASLSVKSNDPRDQQLVIRQMTPDIITFSVPFT
                     RSGFLPIGGRSTAIRLSRPSKPIVTQNAIQPHPQSAPSDVVFVYASHPLTAATKEALN
                     TLGEVKWLVTPDGEHGMYIQEYVDHFPGAQAIGVERYKEQKPGIQWAGLFGQNVDGET
                     KKYGFEPEISLHQVSAHVNHELTAIHHPSGTLLEGDMLFNLPPTEQYSRAGGLPTLFK
                     FFGSGGSLSPGGKVHASMASGVTKNKDLLKKELAPINAAKWDRIIPCHGEVIETDGKV
                     QWNKVWGKFS"
     gene            636734..638038
                     /locus_tag="CNJ02170"
                     /db_xref="GeneID:3254094"
     mRNA            join(636734..636901,636949..637112,637162..638038)
                     /locus_tag="CNJ02170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657974.1"
                     /db_xref="GeneID:3254094"
     CDS             join(636765..636901,636949..637112,637162..637955)
                     /locus_tag="CNJ02170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513645.1"
                     /db_xref="GeneID:3254094"
                     /translation="MYISPTSIRDISQGIAKALGSTVERSLEMEVQAADPHNSPPVIF
                     CRWDFCGQTFVTYIEWETHFAVEHIAYEKAQDLSGRKRRQRSDGHWEIVENEFSLRHH
                     LPIDLNPTQGTGDTTMTSHTLSLPVPPPFDTDLPMSMPTHVILPPRSSPEVDNHDNAN
                     QSHEDEFLVPAADHDAQIAQLHFQHKNSQGTNDSQNSALMTGASSDPRLRDTPSPPGA
                     VSLFMSPLSRAQSPFPLAQVAPTQISPSHPSYVLVPESSGPDIAEKDSSRSFRRTFTG
                     SFQGNPNEPSSSAESRQGHPPSGQPTKTPTSSAESAHNQLASSSPNRRISLTFGSAKV
                     LDNADQREVAAVQDKGMGKGGVKFGFGQSK"
     gene            complement(637972..639368)
                     /locus_tag="CNJ02180"
                     /db_xref="GeneID:3254229"
     mRNA            complement(join(637972..638865,638913..639368))
                     /locus_tag="CNJ02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_567387.2"
                     /db_xref="GeneID:3254229"
     CDS             complement(join(638086..638865,638913..639323))
                     /locus_tag="CNJ02180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567387.1"
                     /db_xref="GeneID:3254229"
                     /translation="MGGNAFDTAARRLSQEDHDALTTLMITRLSPFFKGIAVPRYVAA
                     KKSHGDIDILCGYESEILVGEEEFDPEIDGENAKVKPLKNSKAVTGEWVDEIRQFIAK
                     LMEVMEAKAWRRRGSDINFRIPCTILDNQVAEEHEFYQVDLVLIPPEKLAFVTFMTSY
                     SSTSILLGRILRYYSHSLTIHLTHFIFRHTAYFGIQPIDITLTDDPEVFCSWFGTDYQ
                     KWLIQGKSWKFDWQFWQWLTDVPDESPAGTAFRRLARKIQRDGDKAVKRAKGKRDTFA
                     DKFYVWFMTRSKWAPTEEDENTSTPDEEKEHSEHPPKPTPAELSMINIDKPFPMDKGA
                     EEVLDFWGKRAEYDALFEQRKFMATPIAESQRLKMEKKMRTKALLDAQEEMIKKNFGE
                     LSIK"
     gene            639486..639601
                     /locus_tag="CNJ02190"
                     /db_xref="GeneID:3254075"
     tRNA            639486..639601
                     /locus_tag="CNJ02190"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:3254075"
     gene            complement(639743..644266)
                     /locus_tag="CNJ02200"
                     /db_xref="GeneID:3254295"
     mRNA            complement(join(639743..640028,640078..640155,
                     640206..640411,640458..640900,640948..641967,
                     642014..642327,642373..643093,643141..643338,
                     643390..643485,643535..643703,643765..644266))
                     /locus_tag="CNJ02200"
                     /product="phosphatidylserine decarboxylase, putative"
                     /transcript_id="XM_567388.1"
                     /db_xref="GeneID:3254295"
     CDS             complement(join(639892..640028,640078..640155,
                     640206..640411,640458..640900,640948..641967,
                     642014..642327,642373..643093,643141..643338,
                     643390..643485,643535..643703,643765..644177))
                     /locus_tag="CNJ02200"
                     /codon_start=1
                     /product="phosphatidylserine decarboxylase, putative"
                     /protein_id="XP_567388.1"
                     /db_xref="GeneID:3254295"
                     /translation="MPSPPTDVNAALDIAGHPDRSTRSQPRLRRLASKPLKLAASTFK
                     PRSSRAPSPFLPDDPSSTTISTAASSASGGWKKGTRHQHISHQTAAGLTPAQVASAAR
                     GPRKPLEGEEPAAWLRVRVVKAEGLVAKDRSGTSDPFLSLLMPPCTRYSTPVVKKTLD
                     PVFPADTCTFDFPIYLSLAGVVGGRGLEGVLWDKDLMRKEYMGEIAIPVDKWFPDGHA
                     HLWHDNLPLLTQRILSTRRKHKVSGTTTFQIGFVPPKNTTSTEESLRTIRLVYAALMD
                     HGSLSRGSIGVLGVPAHKGIGTVKMRTQPVEPSRLAKLQGAASAVAGSLTGGHKMVNL
                     QGSEVHPEDEDDEPDDEEELLSDDGISSSSSNDEFEDALEEEEVMILTDSPSTNEPAD
                     IPLGQQVPGLSITPSDAPVDDKTPKTAGYLGPQGRRKAHSRQASLPIGQLEAQPMVKS
                     SSADSAVSSAGTSTTGLVTPGGKARRPLFRRGKSRADSGTEQKPVEKKKSRGFEFDAK
                     QGKEVLGIVILEIKGATDLPKLKNALRVSFDMDPFVVISFGKKVFRTRVIRHSLNPIW
                     DEKLLFHVRRHEAGYLAQFAVLDWDKVSGNDMIGSCVLPVSELIADAPKPDPQTGLYD
                     KEVDGKHEMKEFTLSISTDKDRAWEAKHSPKLTVRAKYEPYDALRQRFWRQYITQYDA
                     DDTGALSYTELTAMLDSLGSTLTRHTLEGYFSICGKEADKDELTMEEVIKCLEGEVAK
                     SRFEKAKVGSDDSTTDASTPSVAPQPAQDGLGFVGPQGNISSPVDPDELAESIRQSKP
                     RNQKGADGDESAGNQTVVGGPGSVVSSIKMPPGVPSVKVERTTSFDGGTVPAPGQPGA
                     DGNFTPQSSSDADLDETDSTPFDDRERVINIKTCPLCHRPRLGKKSEQDIVTHLAICA
                     SADWSRVDRIVTANYVTSSQAQRKFLSKIMNKMAIGSYALGANSANTIVQDRITGQLQ
                     EEKMAVYVRMGIRVLYKGAKGSMNGARARKLLKSLSIKQGLKYDSPSSAVDIPGFIAF
                     HNLDINEILDPLDSFKTFNEFFYRKLKPDARPIEEPGNDDRLVSCADCRLMAFETVNE
                     ATQLWIKGREFTIGRLLGPNYKDVIDRYEGGALAIFRLAPQDYHRFHSPVKGKIGKMT
                     MIDGEYYTVNPQAIRSPLDVYGENVRKVVPIHSENFGLVMTVWVGAMMVGSILTSVNE
                     GQEVERGDELGYFAFGGSTIVCIFEKDALQWDDDLLQNGRASIETLVRMGMGLGRSVQ
                     KP"
     gene            646328..648696
                     /locus_tag="CNJ02210"
                     /db_xref="GeneID:3254152"
     mRNA            join(646328..646711,646830..647234,647286..647318,
                     647371..647641,647694..647816,647866..647984,
                     648035..648131,648187..648276,648329..648376,
                     648432..648696)
                     /locus_tag="CNJ02210"
                     /product="spermine transporter, putative"
                     /transcript_id="XM_567516.1"
                     /db_xref="GeneID:3254152"
     CDS             join(646440..646711,646830..647234,647286..647318,
                     647371..647641,647694..647816,647866..647984,
                     648035..648131,648187..648276,648329..648376,
                     648432..648560)
                     /locus_tag="CNJ02210"
                     /codon_start=1
                     /product="spermine transporter, putative"
                     /protein_id="XP_567516.1"
                     /db_xref="GeneID:3254152"
                     /translation="MLEPVEAEFANPPIFSNQQEEILHEEEIEEPNAISNAGKQVTSG
                     SDDSTLHGQQSSEKVNEKDVEKGTDERIIVHFDEGEGPKQWSKRRKWWATTTASILCL
                     AVALGSAMPTGDLPGTAETLHVSDEVIYISISLFVAGFGIGPLIFAPLSEVVGRRPIY
                     AVSMLFYFLFTLPSCLAKNIATMLAGRMIAGLASSAPFTNVGGTISDVWAVEERGFPM
                     AVFSSTLFMGPCLGPLFGGWIAEKTGQWRWIYWVLFILCGACVILCIFTPETLAPVLL
                     RKKAARLNKENNTTVYVSEHDLHRPPFKETIKVALTRPLVFMFQEVIIIFFTVYLSFI
                     YALLYSTFFAFPIAFEEIRGWSMGMTGVSFVSIIIGIAIANLCMPIQERLYKKHCEKH
                     GVVPEGRLYPMMLGALTLPVSMFILAFTSYPGIIWVGPCVGGIIFGFSMVIIYISGNT
                     YIVDSYSNYAASAISAKNMTRSLIGASVPLWITQLLHNLKFQYGMLFLALFSVVIAPI
                     PFVFYVKGGAVRRRSKRATA"
     gene            648962..651013
                     /locus_tag="CNJ02220"
                     /db_xref="GeneID:3254357"
     mRNA            join(648962..649095,649148..649458,649514..650001,
                     650060..650384,650438..651013)
                     /locus_tag="CNJ02220"
                     /product="adenine nucleotide transporter, putative"
                     /transcript_id="XM_567517.2"
                     /db_xref="GeneID:3254357"
     CDS             join(649016..649095,649148..649458,649514..650001,
                     650060..650384,650438..650541)
                     /locus_tag="CNJ02220"
                     /codon_start=1
                     /product="adenine nucleotide transporter, putative"
                     /protein_id="XP_567517.1"
                     /db_xref="GeneID:3254357"
                     /translation="MAPAHHPTLTPFGSALAGALGSVFANSLVYPIDVAKTRLQAIDD
                     PLEDIESDSESGEVFAEKTEEEQKRHVEGKARRRQKREQVIKLKKLLGKKLQRWGMLT
                     MLIRIVHMEGISGVFHGYGATMIGTFSQQFTYFFFHTFLRKTYLARLTASSKRASLST
                     STELLLGALAGALAQIFTIPVSVIATRQQLWDPPARPKILPGEKETEWNDKSPSLTET
                     AREIIAESGWTGLWTGLKPGLVLTVNPAITYGVFERLKSWRLAAKGAKKLDVWESFWI
                     GVGSKTLATVVTYPYIFAKVRLQAKVVVSPPPLSEEIKKGEAPTYASIASASPTEGST
                     VIVEQPSSIESEPSTELEQTHRHKHTHSPSQHYRSAIPLLKAVYTEKGFKGLYQGLGA
                     QILKAVLCQGILFVSKDQFESYAWLLIVFFARLRTRLSAKARV"
     gene            complement(650634..653743)
                     /locus_tag="CNJ02230"
                     /db_xref="GeneID:3254086"
     mRNA            complement(join(650634..651319,651369..651721,
                     651768..651859,651909..652037,652097..652314,
                     652364..652509,652559..652670,652721..652819,
                     652870..652895,652939..652997,653076..653221,
                     653425..653743))
                     /locus_tag="CNJ02230"
                     /product="calcineurin A catalytic subunit, putative"
                     /transcript_id="XM_024657975.1"
                     /db_xref="GeneID:3254086"
     CDS             complement(join(650918..651319,651369..651721,
                     651768..651859,651909..652037,652097..652314,
                     652364..652509,652559..652670,652721..652819,
                     652870..652895,652939..652997,653076..653221,
                     653425..653568))
                     /locus_tag="CNJ02230"
                     /codon_start=1
                     /product="calcineurin A catalytic subunit, putative"
                     /protein_id="XP_024513672.1"
                     /db_xref="GeneID:3254086"
                     /translation="MASPATQTANAIAAINNRSNLVIPEIDFTQHQLENGEIVSTTER
                     VIKDVQAPAMYVPTDDQFWSTTDKTKPDIAFLKNHFYREGRLTEEQALYILEKGGELL
                     RSEPNLLEVDAPITVCGDIHGQYYDLMKLFEVGGNPADTRYLFLGDYVDRGYFSIECV
                     LYLWSLKMWYPDTLFLLRGNHECRHLTDYFTFKLECKHKYSETVYNACMESFCNLPLA
                     AVMNKQFLCIHGGLSPELHTLDDLRSINRFREPPTQGLMCDILWADPLEDFGSEKTNE
                     NFLHNHVRGCSYFFTYNAACQFLERNNLLSVIRAHEAQDAGYRMYRKTKTTGFPSVMT
                     IFSAPNYLDVYSNKAAVLKYESNVMNIRQFNCTPHPYWLPNFMDVFTWSLPFVGEKIT
                     DMLIAILNCCTKEELEEEEEEFPLHAPEPTDAESAAERRQIIKNKILAVGRMSRVFSL
                     LREESERVSELKSISGSNALPAGMLASGAEGIKEAIQGFEDARKSDIENERLPPDIID
                     PDEDKPASPSASPIMPATPEEIPSEIPYDSPITGTPRTPISGAIAFGSPGSPGTPTSP
                     SIGGPPLTAWRPGHGRRTSLGTTKTSPSTRRRSLENTMHLIRDVVGGKDAQGDGQLER
                     LAEVISSPTKGGQGERE"
     gene            653856..655879
                     /locus_tag="CNJ02240"
                     /db_xref="GeneID:3254292"
     mRNA            join(653856..654337,654391..654538,654591..655178,
                     655240..655879)
                     /locus_tag="CNJ02240"
                     /product="signal recognition particle protein, putative"
                     /transcript_id="XM_024657976.1"
                     /db_xref="GeneID:3254292"
     CDS             join(653916..654337,654391..654538,654591..655088)
                     /locus_tag="CNJ02240"
                     /codon_start=1
                     /product="signal recognition particle protein, putative"
                     /protein_id="XP_024513673.1"
                     /db_xref="GeneID:3254292"
                     /translation="MPTVEDYFDDDTDLPLPSSSRPTLPNTGTRGALLEEITSDDEGD
                     MDFSKLAEQGRGIFGENSKAPAPSAPSFSASDKGKLAVRDGDQNVVGGGPTINPNTPM
                     GGLMGDMMKLQAAEEERLEKLKGKFGNVNIGADPSIYKGWNVVYPLYFDAKVSINSGR
                     RVPRTSAVWWPIATQIAEACKSLGLPSVLEPERCHPADWENPGRVKVQFVKDGRFINP
                     IIKNRTQLYKHISDQIRQRNPSIVFDPAATASRRPQPFSSVSASKPSKKSKTKAKLPP
                     KAPRPIVKLPTRPPLPPAPVPNPDDRLPFNSPLIPMGVIIAAIKREKAEEKEKKKIGG
                     GESAGEPKAPKMKKIVVRGKR"
     gene            complement(655563..657326)
                     /locus_tag="CNJ02250"
                     /db_xref="GeneID:3254238"
     mRNA            complement(join(655563..656079,656134..656216,
                     656276..657326))
                     /locus_tag="CNJ02250"
                     /product="regulatory protein cys-3, putative"
                     /transcript_id="XM_567520.2"
                     /db_xref="GeneID:3254238"
     CDS             complement(join(655871..656079,656134..656216,
                     656276..656859))
                     /locus_tag="CNJ02250"
                     /codon_start=1
                     /product="regulatory protein cys-3, putative"
                     /protein_id="XP_567520.1"
                     /db_xref="GeneID:3254238"
                     /translation="MFPDLPEHLQALNTIPGDTPPSSGMNPEQEEAFWGFLHADELFR
                     NFGSVPSPQDEEKKQQQAAQNQMSAPAAPAPTPATVATPVSSASKDDKHSGPTLESFL
                     AAYMGHSSTTAQQQTAAQTISNYLMPLPAPYTNPASNAHHQSTILPATSVTTQDGVSS
                     ASTVSAHEDSPTDDKPSGAKKLKQMGANPNDLEEDKRRRNTEASARFRAKKKEREQAL
                     ERRAKELEAQVASLAAENSSLQNENRLLKAIVLNGSNPSAAALAGVIGAGHDTQGQDA
                     LQAALAALGKRKRDE"
     gene            658506..659414
                     /locus_tag="CNJ02260"
                     /db_xref="GeneID:3254337"
     mRNA            join(658506..658572,658784..658891,658943..659146,
                     659200..659414)
                     /locus_tag="CNJ02260"
                     /product="ribosomal protein, putative"
                     /transcript_id="XM_567521.2"
                     /db_xref="GeneID:3254337"
     CDS             join(658567..658572,658784..658891,658943..659146,
                     659200..659301)
                     /locus_tag="CNJ02260"
                     /codon_start=1
                     /product="ribosomal protein, putative"
                     /protein_id="XP_567521.1"
                     /db_xref="GeneID:3254337"
                     /translation="MVQSTFKRFVEVGRVVLVNEGPSAGKLAVIVEIIDHNRALIDGP
                     TTSVSRQAFPYRNLILTPYTIASLPRGVGAGPLKKAIEKAGVSEKWEQSGWAKKLAAR
                     QVRKNATDFDRFQIQLAKRARRDVVRKAYVKEKKASA"
     gene            660239..662516
                     /locus_tag="CNJ02270"
                     /db_xref="GeneID:3254248"
     mRNA            join(660239..660477,660533..660682,660756..660848,
                     660902..661020,661075..661167,661224..661352,
                     661406..661521,661578..661812,661861..661952,
                     662006..662082,662131..662190,662245..662516)
                     /locus_tag="CNJ02270"
                     /product="phenylalanine-tRNA ligase, putative"
                     /transcript_id="XM_567522.2"
                     /db_xref="GeneID:3254248"
     CDS             join(660310..660477,660533..660682,660756..660848,
                     660902..661020,661075..661167,661224..661352,
                     661406..661521,661578..661812,661861..661952,
                     662006..662082,662131..662190,662245..662445)
                     /locus_tag="CNJ02270"
                     /codon_start=1
                     /product="phenylalanine-tRNA ligase, putative"
                     /protein_id="XP_567522.1"
                     /db_xref="GeneID:3254248"
                     /translation="MPVPTPEALQHVILQNLEASGSIPDSRELAYNGRLLQSAEEQGV
                     VRAVLDSLASKEMVEYKQITTTTYGLTEEGEGITQNGSHEYRVWEVLPVKGQGEPIGI
                     PELKKRLGDETTKVGQMRAFKNKWIAKDGAGFVRAAEAPVDEAAVQMKEIKESGLVAG
                     GEAVVKELQKRKLIQPKKYIHYSISKGPQFSTEVKQLETDLTVEMLQSGAWKDASFKQ
                     YNFAAAGQPTDGGALHPLLKVREEFRTIFFDMGFTEMPTNRFVESAFWNFDAMFVPQQ
                     HPAREMQDTFYVKDPAKALKPDADYYERIRKIHEEGGYGSIGYRAPFSQEESEKLLLR
                     THTTAITTDMLYRLANQPGGFKPAKMFSIDRVFRNETADATHLAEFHQVEGLVADYDI
                     TLGHLLAFMQEFFSKTGNHKLRFKPAYNPYTEPSMEVFSYHEGLGKWIEIANSGIFRP
                     EMLEPMGLPKGVRVLGWGMSLERPTMIKYKIQDIRTLVGHKTDLDQVKKRAAVRLEKG
                     DD"
     gene            662798..665247
                     /locus_tag="CNJ02280"
                     /db_xref="GeneID:3254231"
     mRNA            join(662798..663216,663274..663551,663600..663627,
                     663689..663700,663757..663766,663817..663965,
                     664021..664140,664201..664244,664305..664442,
                     664498..664641,664698..664803,664861..664982,
                     665048..665247)
                     /locus_tag="CNJ02280"
                     /product="expressed protein"
                     /transcript_id="XM_567523.2"
                     /db_xref="GeneID:3254231"
     CDS             join(662907..663216,663274..663551,663600..663627,
                     663689..663700,663757..663766,663817..663965,
                     664021..664140,664201..664244,664305..664442,
                     664498..664641,664698..664803,664861..664982,
                     665048..665140)
                     /locus_tag="CNJ02280"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567523.2"
                     /db_xref="GeneID:3254231"
                     /translation="MISLSRRSILRTLLITSPLIFIGLFVSLKPSEPVEDESAASKAR
                     SETLVSQKHGNWWKGIHRGANWSPLDWAKNPMLKEEALDGDKDGWVNFDEELKWTKYE
                     GGVAGFQVFSNLYLTGGAFTAITPFPPDDPSSSSLTNDEEEPTVEFESPFPDTKFIIS
                     SDKRGIAAGPDRWKMEKPETARLEFGQMGYKLGGATFIINDKPGIEGYLVFFKHFATE
                     TFLGAARVLASTYSTDTPHQAPLPKRIWFPRCGVSPSWRDGRGENYWFLSRALPSASI
                     EDATQFTDRSLSGITIQFEKVVIIDRWAAHSIGGDNGKWGKMNVLIPTVFAQPNFFDP
                     YRQNVAKSLGITGTSIETSLPVVVYVDHQIGTPRLHPEDHMGLIDALKSLTPLAEVHV
                     VKLNGMSKFKRIELLNRACIIISLHVDELIHAMWMPTIPGRSTVIELFEQGGFRRDFE
                     LMATSLGHQYVAIQYDRILLEEEWRTGGPSIGEEAKKGEVRVNPEVVIRAVEDILTKD
                     DENAEIVGI"
     gene            complement(665221..667206)
                     /locus_tag="CNJ02290"
                     /db_xref="GeneID:3254329"
     mRNA            complement(join(665221..665738,665788..666224,
                     666275..666643,666700..666773,666822..667206))
                     /locus_tag="CNJ02290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567524.2"
                     /db_xref="GeneID:3254329"
     CDS             complement(join(665264..665738,665788..666224,
                     666275..666643,666700..666773,666822..667107))
                     /locus_tag="CNJ02290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567524.1"
                     /db_xref="GeneID:3254329"
                     /translation="MPDPFFQSQKKRKRNNRSGPSAPRQQKHQDNDENLSSDAEGDNG
                     PVDIDLMDFREGREDVAMSDEEYIDENETAAEKRVRLAKGYLARVRDEVEAANADQDY
                     DAADIDRELIASRLQKDVAEASGRIHLFITPHLTSSTFHFIPTSSHLPTSAALTPYYI
                     FISTKRGSIIRHSTSTLRRAGQNFGHAQGGGNGHNGEILCLAASEDGKWLVSGGRDKV
                     MGVWDVSEREPKWVTGLKGHKDAVTSIALSPLNNPSYHILSASLSRHLALHSLSTLSV
                     IDTFFGHQDSIPSVSSLKPTLAVTAGSRDRSCRWWKVEEEVQLVFRAGGKTRKDLKGL
                     MPAERKERLGGGWTEGVEPEKEKDSKGKGKEFMEGSVDCVCMLDDQHFVSGGDSGSLL
                     LWHTGKKKPIFTQAFAHGFTPITAENPISAPRWITSIAALRGTNLFASGSWDGQIKLW
                     AMNQELKSFSYVDVEIPAKGFVNSLQLSSLPYETISHASLPESGEKESTNAKSEIVLV
                     AAVGQEPRLGRWMRDKLVKNGVLVARLELDRKGKAMMI"
     gene            667419..672464
                     /locus_tag="CNJ02300"
                     /db_xref="GeneID:3254267"
     mRNA            join(667419..667734,667780..667899,667944..668055,
                     668107..668400,668448..671688,671744..671838,
                     671893..672010,672062..672147,672199..672464)
                     /locus_tag="CNJ02300"
                     /product="structural molecule, putative"
                     /transcript_id="XM_024657977.1"
                     /db_xref="GeneID:3254267"
     CDS             join(667514..667734,667780..667899,667944..668055,
                     668107..668400,668448..671688,671744..671838,
                     671893..672010,672062..672147,672199..672234)
                     /locus_tag="CNJ02300"
                     /codon_start=1
                     /product="structural molecule, putative"
                     /protein_id="XP_024513674.1"
                     /db_xref="GeneID:3254267"
                     /translation="MKLKDISRTATFAWDNTSSSAPLLATGAVAGALDESFSNESQLE
                     IWQPDFGDVSNVKLGGEGKPALGSITVSSRFNQLAWSAPSTTHMKGVLAAGMETGEVN
                     VFDPSKIVTGASADEARIFKSEKHTGPVRGLDFNSIQKNLMLTGSVNAEIYIYDLNSP
                     NNAPIPPGPTSTKLNEITALQWNPTVSRVFAASSSSGFTSVWDLKAGKEIVSLQYGGG
                     AAKGMETVGGVAGLQMGKRRGMSDVCWHPEQATRLITASEDDESPIIMLWDLRNTRAP
                     EKILSGHHKGVLSVSWCKQDADLLLSCGKDNRTLCWNPQTGEIIGELPTSNDWSFQTS
                     WCPRNPDLLATASFDGHIGIHSLQTTSIPSQSTEKLSEAATADDVFGALGNEQPQDET
                     VNVLSLKQAPKWLRRPVSATFGFGGLLATTSNLPGASGKHQSGVVHLRTVTTEQDVLN
                     RAKALDQTDGQQEKLAKFCSERAKDDDEAWKALQALFKANSRQELVQLLGFSQEEVAK
                     KVQDAIKKFPNAIKAAGDATPVIAPLEEESVKTPTAEKPEAIEDVSTTSDAGVESHDD
                     KSEKSETKKSENGLFDDETAPGTPAAAAAADFFSSMASGALRNPQLDSIVSHKSEAAE
                     SSVAATVGSRASSVRDEIVNKENTFQIYPEGESDIDKLVTQALVMGDFKSAVDVCLAF
                     DRFADALLLAVRGGPDLLQSTQNAYFAQQTTSRPFLRVFQSIVTEDLLDIVQNADLSE
                     WKVAFVVLCTFAKDTDFGNLAEQIGQRLQYRWRVLSASDSSEAKASAKIARQDATLCY
                     LAAKKLEKVVSIWVDEMAEEEEAVSATRYTSHAQALQSFIEKVSVFKAATGYVDEDLL
                     TPTESAAAAEAGARTYKLAGLYDRYYEYADLLATQGLVDIAAKYVKMTPVDYKGSEQV
                     GELDKARQRILSAAGGNVGTKMAQTTGKVQSTAGSSIARGYAPAQQASAYASSQPAYA
                     LQQPTTYAASTAPAYQAPPAASGPYQPASTSTAYAPPQPTPSYGDSNPYAPATVYQPS
                     SGYPPNGYRPSDPQPQGYGAPQPSFGQTQAMPPPPRVGQTNAPISSPPLIPGSQQRGI
                     SGWNDAPTFAPKRPQSAAKDVKKASAILSPFPNSADPLAAAGAGLNTAGAAPPPGRSP
                     QPGVIPPPPKNARPPSIAAKVQPPPTVQQQQQFHQHAQHQQQQRQQQLTSPPAAAGPP
                     PSAFSRPPPPGARAGPPPGAFAGPPPQRALSPLGPGRLSSPPGSQIRPPSAVQRPPSQ
                     PGQVQSLDGGITGMGGPPPPGSRMAGPPPGRSATPQQQQRQQIIPPATSPSQTKIQSP
                     SSEQVKPRHPAGDRSHIPEASKPIYEILSGELTKVKQSNIPPHVKRIVDDTERRLNIL
                     FDGLNNETVPKQAVDMMNEISKAIAARDLNAALAMHVELLTTASGDMTSWAPGVKQII
                     RLGA"
     gene            complement(673517..676900)
                     /locus_tag="CNJ02310"
                     /db_xref="GeneID:3254351"
     mRNA            complement(join(673517..674748,674796..675917,
                     675976..676900))
                     /locus_tag="CNJ02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_567526.2"
                     /db_xref="GeneID:3254351"
     CDS             complement(join(673628..674748,674796..675917,
                     675976..676795))
                     /locus_tag="CNJ02310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567526.1"
                     /db_xref="GeneID:3254351"
                     /translation="MPTSLYNTQFDQEEQDLIFAPSDVSPTDALFPPELTALFSDNQF
                     PLDNPSNNFGGNHQHRGSLSSNEDSLPFLSPTNPQSMSSTSPRLSLSPSTGEPSFHLT
                     SHYSYDQSSHSPHSHSSASPLSSSGTDDVFLARSFEGVSGGELDMFLLSEPINDYPVN
                     SDGFGGQKPGQSLFLPGRTEGFNGMGDEWIQDLFKDPLQENGLDNINQQPQPQPDGLD
                     FDPILAGLQQRPQQQPLQQQKQQFGQTIQPQMVKQEPLIKQDSWSNGQNLSNSQHGFT
                     FTHPPFAPRNQAQDIKPASIPRTASVRRPTASKSETITAAAPAPTIGKHNKTERRYRQ
                     KVQAAQADLRDAIPALRLLYGTSTPEQLATTDIRAPDGTVDGLGEVTRPNASAKATIL
                     IGARVYIELLQKRSAKLQRMVNELEKFRGAVEGEAGLAAWKEDFGRREAEIDRVEAEQ
                     LAAKLKEEEDESEGEDDDDDEEPSKKRKRTAAPKAKPKTAAKTKITPQSTAAAGARVF
                     AAFAMSFSFVPSASTVFRSNPQPQALATDKVLGYATNQQILASVPLIIAEHTSRLLAR
                     SLPSALVPLPTTLLEWTWRLVVAVVLAVVMRPIISKLTTKSDEKARPGTVKGVLKDVV
                     GIVSRKKAQKTEWERFAAGVVGRANNVSTLAKWHTILHLNVTASSPYSLALLALLQPE
                     CSLLRSPQQLWLTAQSRVDGTTPPALVTVLGLPLHEALLCLSSLPPTSAPLSALAEQI
                     TLIHVHDLYTRLFIHLVEASTASPLSTTSLKSLLSALESHNLGANLKASAFDKEIKSV
                     MQGTQKGSVVHALGLVLIGLWGIFTGPSSSAQASLAGALAADQVSGATHGLNSVSALL
                     ELLYPGCAPVSQAPAFVNPLSPNAQKVDALALSIIEYLSLLLTASRSTEATNMDREGR
                     KEESLGVQRKVVKLRGVLNKTGWVGVESQLDADDFEEVYDQPEEFTLGDEADKRDFRP
                     HQLESERIHYERAKERLVDILARIGRRAAGRANGRDEDSGLEGDLDEL"
     gene            complement(677021..679289)
                     /locus_tag="CNJ02320"
                     /db_xref="GeneID:3254127"
     mRNA            complement(join(677021..677254,677305..677767,
                     677819..677874,677926..678056,678115..678203,
                     678255..678407,678454..678505,678552..678688,
                     678740..678884,678932..678995,679056..679106,
                     679155..679167,679213..679289))
                     /locus_tag="CNJ02320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567445.2"
                     /db_xref="GeneID:3254127"
     CDS             complement(join(677144..677254,677305..677767,
                     677819..677874,677926..678056,678115..678203,
                     678255..678407,678454..678505,678552..678688,
                     678740..678884,678932..678995,679056..679106,
                     679155..679167,679213..679223))
                     /locus_tag="CNJ02320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567445.1"
                     /db_xref="GeneID:3254127"
                     /translation="MSNLYATEPATNGKVIIDTTAGEIEVELWGKECPKAVRNFLALT
                     MEGYYDGVIFHRVVPGFIIQSGDPTGTGMGGESFYGEPFEDEIHGRLKFNRRGLLGMA
                     NNGSRNSNTSQFFITLDAAPELTNKHTMFGKIVGNTIFNVLNIGNLDTDKEERPLIPP
                     KIRRIHIIENPFDDIVPRITAEEKKAQQKAKLEAKKDMEQRERRAKAKKNTGLLSFGD
                     SEEIPEEEVTVKKKSMTRQDLVDPSEAEHTKSKTSKMTETFVNIPPSLKDLGKSRENE
                     ASEEKKAVDLKNIRAQHEREKAGGSAARQAEIKRMEEDLRRLKKRSGSVSDSESDSSS
                     RARRKGPSYLEQELAKYASKRGRAAMKAGNKRGRRDEEEDVLTEMRKFSKRVMQAGDE
                     PEEEQAEEIEEGEAKEEGTGIGAAMAEEEGGIEVDDDVGWLTHKLKFQVDDKELTRRA
                     EDEYAVIDPRAKARDLLGKPDKKKLKGNPNRRTVRNSGRNR"
     gene            679457..681688
                     /locus_tag="CNJ02330"
                     /db_xref="GeneID:3254122"
     mRNA            join(679457..679761,679913..680159,680218..680499,
                     680550..680905,680965..681688)
                     /locus_tag="CNJ02330"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /transcript_id="XM_567527.1"
                     /db_xref="GeneID:3254122"
     CDS             join(679492..679761,679913..680159,680218..680499,
                     680550..680905,680965..680970)
                     /locus_tag="CNJ02330"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /protein_id="XP_567527.1"
                     /db_xref="GeneID:3254122"
                     /translation="MSQGLTRRRAGASPAVGASSSAQLESPTFPSGSTVPRPGSSVEG
                     AASGAYEGRAKIAYDPRDFENSDEKESVPRLTLMEEVLLLGLKDKAGYLSFWNDNISY
                     ALRGCILIELALRGRIAMVRDPARRRLALSDRLIEVIDDRQTGETILDEALKMMKSSE
                     KYGAGAWVDLMSGETWNVMKIGYQLKQVRERLAKGLVDKGVLRTEKRNFLLFDMATHP
                     IADMNAKDDVMRRVLSLLTARTAAVPPQALHKQAVKYRHMRAVVLVCAAYASSVLENA
                     LQRLSYDSREAAFARCDDILAEFCTWPFGQTTASSSGPVAIGSASARRREGGSGGAGK
                     ESVQELVREVRKEMASTTSGAGAGGGQEDQEELCFEVIATVLEIFGRMDSLL"
     gene            complement(682378..684407)
                     /locus_tag="CNJ02335"
                     /db_xref="GeneID:36393070"
     mRNA            complement(join(682378..683632,683688..684107,
                     684171..684407))
                     /locus_tag="CNJ02335"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658772.1"
                     /db_xref="GeneID:36393070"
     CDS             complement(join(682663..683632,683688..683830))
                     /locus_tag="CNJ02335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514452.1"
                     /db_xref="GeneID:36393070"
                     /translation="MSKDNVSAQSLEETSSQGQFKARQSFSSSSEGTRRQRISMACLY
                     CRHRKIRCCGGSPCRNCQRSKRECDYAPVPEEVNRITREKKALGKASKIANELLSPAT
                     TSSPYYVSRPTYHGPPVRPAPYVRKRSSSMPDEAMPWGAPIAYDPPQWIYSQPNFYFA
                     PPQYPSLASTFPPYPLSAEQPLVPAPVSTSQLGVQFESHQVQPLHSQVLDTPSPASSS
                     MSSFAALTRASSSDDEHVSGTWLTPGLSTPLYLRPVSSSGSLSPSVIRTGSRPGTLST
                     VHQSSTPPTPTSMAIPSPHVIPTPFYPYPPTQSTTSTTQSVQADKNGQSFMINGSAGM
                     MVKDPLLGLGLVESKDMCLGHGIGEDYYSPPLYHQE"
     gene            complement(686567..689498)
                     /locus_tag="CNJ02340"
                     /db_xref="GeneID:3254364"
     mRNA            complement(join(686567..686789,686861..687087,
                     687127..687292,687332..687593,687631..687779,
                     687824..687973,688009..688731,688768..689243,
                     689315..689498))
                     /locus_tag="CNJ02340"
                     /product="viral life cycle-related protein, putative"
                     /transcript_id="XM_567528.1"
                     /db_xref="GeneID:3254364"
     CDS             complement(join(686658..686789,686861..687087,
                     687127..687292,687332..687593,687631..687779,
                     687824..687973,688009..688731,688768..689243,
                     689315..689336))
                     /locus_tag="CNJ02340"
                     /codon_start=1
                     /product="viral life cycle-related protein, putative"
                     /protein_id="XP_567528.1"
                     /db_xref="GeneID:3254364"
                     /translation="MTIRGLDNYLKERKLVQSCPISTLANTRLGIDATHYLNHLLTDP
                     NSREPLVAATGGLPLAIISKIENDLRALERHAIKPVFVFPGLPLASRPSPKGSDIKAE
                     RENQIKNEAWALYDEGQAYAAVDKLVQFNNGNFVDQRDLLRSIMRLFRHRYVEFVVAP
                     YLGIAQLAYLLQHPKGYIHAIYSSSECLMWPVERVITSSDWSNNFQFVEKVRVLNDLN
                     LTSEQFLDFGILAGSSLSRTIPLPQSEFSIKNIADLVRHHKSGISVCQNVRQEPPYKA
                     QFYTESFWKARLAVKFSLVLTTEGACVPLPTVITPQQQAFTVQDVPGDLEEIFSPRIP
                     DELYFHICRGLVSAQVVGWLTSGMIIEQQPLLETGEYRRFIKDVITEGPTSPRCTTIA
                     LLADMLHPDWSKRRINVHYYFDPPYAPVRGAFVPFTDALTQSLIGRCSDWMVPMINLE
                     MELRRQNSSTIDLKLCIGALASEELVHRTFKPKGDRVLDKKDEVVANSLWRFLEVRGF
                     VQQNHAHSLIGKALYAAYTVSRVNDRFQEPIYLILELLRAGVLHGGKWGGPEAAPLLG
                     GPSFGDEDEQNSVRLIMRCISILPLVSRNQQWVGPLSQELLAFNAFVRGLSKSLRQLF
                     EAVSVHLLLSGDGRRNRDDYSDIMLSLPFQTDVNTGFGILAKSYLDATSYHNQLEPIT
                     EEMIGTERAETAKRQAILFIEENFSSVKAPVQELERGFRFWDAVMVAIRCLAEEQGPN
                     PKLAQTVVGRDVIEQFERADKWLKPMRP"
     gene            complement(689626..691536)
                     /locus_tag="CNJ02350"
                     /db_xref="GeneID:3254222"
     mRNA            complement(join(689626..689997,690049..690275,
                     690351..690548,690601..690666,690718..690808,
                     690861..690940,690995..691135,691184..691235,
                     691284..691366,691417..691536))
                     /locus_tag="CNJ02350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567446.2"
                     /db_xref="GeneID:3254222"
     CDS             complement(join(689868..689997,690049..690275,
                     690351..690548,690601..690666,690718..690808,
                     690861..690940,690995..691135,691184..691235,
                     691284..691366,691417..691464))
                     /locus_tag="CNJ02350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567446.1"
                     /db_xref="GeneID:3254222"
                     /translation="MASTARKTFEINNNVQVVDPSAAIFQYSREEEKLLDDEAPWRTD
                     PHYFHTVKISAVALIKMVTHARSGGIYEIMGIMYGKVRDGTFWIMDVAALPVQGTETR
                     VNAGNEAMEYMVNFQTANAEAGKGELLRGWYHSHPGYGCWLSGIDVNTQLNNQKFNDP
                     YLAVVIDPNRTVSAGKVEIGAFRTYPEGYTPPATGNSQYQSIPMDKIEDFGVHANAYY
                     PLKVEIYKSKLDEKMLDLLWNKYWVATLSSNSLVSNLEYSTSQVQDLNAKLRAASQSI
                     SNSSSKLKLKPTQPTTKGKETTEGSDKKLKKGEKEFSGVEEEETPLNKVTQESSRITS
                     EAENGIISQLLKEKLFNTPLTQSVDDKSAQATVQGRY"
     gene            691659..692259
                     /locus_tag="CNJ02360"
                     /db_xref="GeneID:3254190"
     mRNA            join(691659..691956,692019..692259)
                     /locus_tag="CNJ02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_567529.2"
                     /db_xref="GeneID:3254190"
     CDS             join(691724..691956,692019..692055)
                     /locus_tag="CNJ02360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567529.1"
                     /db_xref="GeneID:3254190"
                     /translation="MAFSSFAEGESEPWATPIATSVPEPTVESALEKEKVIKDILSLR
                     DGLRGLMVRLSEVEEENDKLAKENETLSLYVENLTRNSVVAAGNK"
     gene            694057..695333
                     /locus_tag="CNJ02365"
                     /db_xref="GeneID:36393071"
     mRNA            join(694057..694950,695034..695333)
                     /locus_tag="CNJ02365"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658773.1"
                     /db_xref="GeneID:36393071"
     CDS             join(694433..694950,695034..695217)
                     /locus_tag="CNJ02365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514453.1"
                     /db_xref="GeneID:36393071"
                     /translation="MSLSSYPSRHTVSRAVRHPLSPTSPSRTHHQLHTDTARAQPTST
                     YGSSAQCRASTKDPLETDPMLPSLPAAHICSAILVPCTNPIGTMTQRDQGVGVNQADQ
                     PTTESPAPPAPPPKTPSSPLPFSKRLFHALVHKPTLSRTWEKKTFVDEQKSAPAIIGG
                     GGGSLERGDDLDGLASALSARSRPVSLYASPAEIAAFKPLPLMMDERDVQGHTQMTQV
                     GMSGIAPKDMGSVRA"
     gene            complement(695352..697523)
                     /locus_tag="CNJ02370"
                     /db_xref="GeneID:3254098"
     mRNA            complement(join(695352..695566,695633..695772,
                     695870..696010,696083..696767,696835..697245,
                     697323..697360,697409..697523))
                     /locus_tag="CNJ02370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567530.2"
                     /db_xref="GeneID:3254098"
     CDS             complement(join(695465..695566,695633..695772,
                     695870..696010,696083..696767,696835..697245,
                     697323..697360,697409..697454))
                     /locus_tag="CNJ02370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567530.1"
                     /db_xref="GeneID:3254098"
                     /translation="MPPKASAAGQHTTKQDSASLKRVREGSLEPAQAESSAALATKKN
                     RVASTSSARGPADAAEELTEQEGEGDGEEEADAAADTAEQNVGEVRKQVEKMSYEEAQ
                     SKTKGDGDGSNNGNDDGADDSWEKIEKEEAESSLKRKALDRNDTSFTVVEKDVAAKRQ
                     KDTPSPDGGEQPAQPPRKPQTSFSAFASSASPFASLKTASPAPALQGAAPAPAHGDNT
                     PAIAPAVPREEEKKKKQSTFGDFAKSSPFTSGKSTPGLPTPAEDEAGSSASASTPAPA
                     PAPALAPAPAPMTKKPQTTFSSFSSSSSPFTSSKPSPSPFASASAPIKGSAFGTYSNN
                     SAAFGTGTKPATGAGAGAAAGVENVEQGKKGASFGDILKESKGDVEVEKEGKVAMQEQ
                     DVTTGEEDEDTVFQARSKLFVNEKGWKERGVGLLKLNVRRSDGSGARLVMRADGVLRL
                     LLNSKLYKGLNPTVEGKTVLMTLPNVGEKEMAIICLRMSNVKVAEELADFIHEHIPLD
                     SANVSKSPQLDV"
     gene            697574..698704
                     /locus_tag="CNJ02380"
                     /db_xref="GeneID:3254369"
     mRNA            join(697574..697692,697738..697849,697909..697986,
                     698048..698079,698130..698210,698264..698403,
                     698456..698492,698544..698557,698607..698704)
                     /locus_tag="CNJ02380"
                     /product="hydrogen-transporting ATPase, putative"
                     /transcript_id="XM_024657978.1"
                     /db_xref="GeneID:3254369"
     CDS             join(697617..697692,697738..697849,697909..697986,
                     698048..698079,698130..698210,698264..698403,
                     698456..698492,698544..698557,698607..698633)
                     /locus_tag="CNJ02380"
                     /codon_start=1
                     /product="hydrogen-transporting ATPase, putative"
                     /protein_id="XP_024513675.1"
                     /db_xref="GeneID:3254369"
                     /translation="MAFLPRLLISSTSLATVVGLYLLFTGQGEAFNVGNFLAESSPYA
                     WALVGVGLCIGLSVSGAAWGIFVTGASILGGGVRAPRIRTKNLISIIFCEVVAIYGVI
                     MAIVFSSKINGDVPNIYTANNYYTGFALFWGGLAVGVCNLLCGVSVGITGSTAAVADA
                     ADPQLFVKILIVEIFGSVLGLFGLIVGLLISGKAEEFA"
     gene            complement(698656..699182)
                     /locus_tag="CNJ02390"
                     /db_xref="GeneID:3254164"
     mRNA            complement(join(698656..698768,698814..698896,
                     698940..699001,699045..699182))
                     /locus_tag="CNJ02390"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_567437.2"
                     /db_xref="GeneID:3254164"
     CDS             complement(join(698676..698768,698814..698896,
                     698940..699001,699045..699103))
                     /locus_tag="CNJ02390"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_567437.2"
                     /db_xref="GeneID:3254164"
                     /translation="MVAHMSLDSVEEVIEGTGALYLKGVDRHNEWTVSAFIPTGVKFI
                     LLHDVKNDDGIRLFFIDLWEAYVKILLNPFFTTNTPIKSPAFEARVKSIAKRHL"
     gene            699337..705474
                     /locus_tag="CNJ02400"
                     /db_xref="GeneID:3254236"
     mRNA            join(699337..699432,699471..700575,700641..700791,
                     700841..703391,703448..703507,703573..703715,
                     703794..703961,704046..704198,704263..704389,
                     704462..704760,704827..705474)
                     /locus_tag="CNJ02400"
                     /product="cytokinesis protein sepa (fh1/2 protein),
                     putative"
                     /transcript_id="XM_024657979.1"
                     /db_xref="GeneID:3254236"
     CDS             join(699473..700575,700641..700791,700841..703391,
                     703448..703507,703573..703715,703794..703961,
                     704046..704198,704263..704389,704462..704760,
                     704827..705402)
                     /locus_tag="CNJ02400"
                     /codon_start=1
                     /product="cytokinesis protein sepa (fh1/2 protein),
                     putative"
                     /protein_id="XP_024513676.1"
                     /db_xref="GeneID:3254236"
                     /translation="MASIFGKKHRTSASSAPHAGPGLAASVPYSQLASGPPPVAGPSG
                     SRSDASRLVSAPSTNPTLTDDGTPGRVSRTPTSNTPTTPRRRTEGSERERHGEGSRRS
                     NASYATDTGRSPSHEYQEMLWRATSESGHHTPIYEAMTSSKSSAFTSPHPARTPGTPS
                     HEFGMRPHPYVAGYGKNPETSSIRSMSSVNSTYDPNNPMSDTGRYPKFETQTVPGANG
                     KSTPTQSTTSLPLPSPLPNRSGEYARPPDHEIEFWYQQILQKTDLDPSRSYMSSPNPS
                     LSRASVSSLGSNSAARSAANLPMDSKWTIVQQYWKSREQQQKHHEAPKALGRKTARGG
                     KGSVEYFLSHALSRTLTPAILFSLEISLRTETLDWIQNFMDHQGQAALVNCLTPLTYT
                     EGSCPPPTDIDEGLMHCLSRSIGKHRIGCADALAKPLMIEKIIPFLTCPNINCRLWAA
                     QILTVLCQVTDPATGDKPGLQIVYSAFAHMQKKVNENVTDLKAKVGRFNLWLSQLAEV
                     LARQGLMGSNVRAHAQVKGLDVIEYCRTMVLLIVSLPTSNDRKTRSSIRNQLDLAVLP
                     IIIQNLRQLHDPEINMQLDIYEENERNDRANMVDQERGTLLKSLKTPEQIIPLLLERT
                     KGSQSSRYLIDILRHFLLIDSDGDEQARYFQLLDELISTIVMGSSPDLHYEFRDAFGK
                     SIAHLFGKLVEHHRVDEAMAEVKELRVVNQRLLIEKQELDEEISAGNDGLVGKLKAQV
                     ADLEQRLNRSRVAMEAAVDEKKGMRRDNEQRMRELRLYLQMLYSIILAAGIDIADALE
                     SLGFRNAEEMESLLSELGGMEHDEKMWGAEKRKARQFALDKLQNKKVLDGKGSVDVES
                     DGGVDDDGGEEDEAAQVMEAEKIALGGNARGQRKSVRKKPPKVVRPRELRALSQSQFE
                     DAEGEQEQLNVDNRVKEGYDSVSPIRAHFHQSKRRGATPHQQRLGDGLAPPVGEKSVF
                     RSIKKPPPFAPRFVPELSSRPINRSTSAPAQLVDLDLPQLGQDEEEEEGTDRMAKKRE
                     SLGAELLARGKGGRQGMGADEGESELSTVMEGEEGKLSSQRESVTEAPKGETTPLPHP
                     PPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPPLTTLHHPSGPSGAHDLSGV
                     LAGIKGGVSLKKTLGPSIPPPPPPPALPPPSIHTPARAPLGSVSSLLYGANDSRKDVG
                     MIASKKMKQLQWEKVSKAQLGKTVWSKNEEARLEEEVAEKLKMFNVWDKIEDQFKAKE
                     VMYDAIKKRKEQEIISVLAPDHRKRIEILMSGPFTKGFKEDPEGLANAIGDFNADLCV
                     EAFLNELQSVLPSDDDRGKLLTHSADDPKEFSKLHIADRLMVRLIQLPHLNERVKGML
                     YRVRFPQNIELLEKSLTLLIEACDALMNAKQFQALLSIILTMGNYINGTNYAGGAFGF
                     KITSINRLVDTKSGGGQNLLHFLESTVSTHFKSVEPFLAELEIPSAAARVNYSDLQST
                     SKQMLDDIYRISESLTTQFDTDKSSYTRQMNAFVSSAAERVRNVRDGIIAADMKLKEV
                     QTFYGEGDGAGVGRGMQSQDFFGIFRTFTSSYKFCQAQNRARAEEQAALEDRARRRAE
                     RKAMGITPQPTGMSSVSSQGDFEDVITKLRTQGTPRIPRERPKRAAAPPASPLSESID
                     FSALLSGMGMDMDAGDGEGVAGEGGGAGGEGDYEALMAQRLLSTTFKSSFESLWGGTE
                     VAEEKEESKGNVKEEEQGEKESENAEKGEEDEDEVRCSATGSLVEELDIT"
     gene            706157..707762
                     /locus_tag="CNJ02410"
                     /db_xref="GeneID:3254365"
     mRNA            join(706157..706714,706790..706898,706962..707051,
                     707125..707208,707289..707762)
                     /locus_tag="CNJ02410"
                     /product="expressed protein"
                     /transcript_id="XM_567533.2"
                     /db_xref="GeneID:3254365"
     CDS             join(706616..706714,706790..706898,706962..707051,
                     707125..707208,707289..707386)
                     /locus_tag="CNJ02410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567533.1"
                     /db_xref="GeneID:3254365"
                     /translation="MSAADPHLSSTHPLAASDPPKLEISHDSITFPKVHVKALIISGQ
                     SHVFSFGPETTVGRVKELIWSSWPKEWTDPAQPPSPNYLRLLYSGRILQDDSTLSSNN
                     LPLTTSSDIPTVIHISVRSFSIKDDEAKKPSAIARSLSRRSHPATEEEVSGCRCVIM"
     gene            complement(707827..708747)
                     /locus_tag="CNJ02420"
                     /db_xref="GeneID:3254060"
     mRNA            complement(join(707827..708111,708223..708328,
                     708432..708747))
                     /locus_tag="CNJ02420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567534.2"
                     /db_xref="GeneID:3254060"
     CDS             complement(join(707936..708111,708223..708328,
                     708432..708635))
                     /locus_tag="CNJ02420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567534.1"
                     /db_xref="GeneID:3254060"
                     /translation="MRTPLPALLVRIALRPVHLSRTAILPSPVNNNKSVITRTMSAAA
                     STSTSRGRSPTRVPGPVETTIQQKIIEAFNPVLLRVYNDSHKHSHHAAMRAQGGGSGE
                     THFAIHLVSESFKGKTAIARHRMVNALLKPEFDERGLHALSLRLKTPEEWEKEGGGEM
                     R"
     gene            complement(708934..710853)
                     /locus_tag="CNJ02430"
                     /db_xref="GeneID:3254302"
     mRNA            complement(join(708934..709432,709503..709646,
                     709717..709897,709972..710175,710232..710328,
                     710383..710495,710553..710853))
                     /locus_tag="CNJ02430"
                     /product="transporter, putative"
                     /transcript_id="XM_567535.2"
                     /db_xref="GeneID:3254302"
     CDS             complement(join(709045..709432,709503..709646,
                     709717..709897,709972..710175,710232..710328,
                     710383..710495,710553..710787))
                     /locus_tag="CNJ02430"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_567535.1"
                     /db_xref="GeneID:3254302"
                     /translation="MSDAQAYFIEQPTEAGPKMIDLIEKQAPGDNPAVGDQELTAAPP
                     TSFPQGPPPPPDGGFHAWATVAGSFLAMFVQFGLANSFGVFQSYYEENQLSNLSSSKI
                     SWIGGLQQFLLFFGGLFTGRIFDAHGAHILLLPGSLILTTSLMLTSLCYDYYQFILCQ
                     GIFFGIGSSLVFHSGIAVPAQWFAKRRALAMGIAVSGSGLGGTLWPIALNRMFNDIGF
                     GWTLRTVGFISLFLLTLSNLLIRTRLPRRNPVPWNAYLQHLKDIPFVLFAFSVAFVFF
                     GLFTPFFYVTTNAARVGTSSAITFYCLSFINAGSTIGRLLAGAGDYIGRMNLAIFSSL
                     VSGILLLAFWIPLSTAPAIIGFSVVYGFFAGLFISLIPACIGQISHHHEVGLRLGLAW
                     GIASVFALFGPPISGALISNYGGGAKGYEMAGVFSGVVVLAGTVFAAGSRFCLNREVF
                     AVM"
     gene            711009..713156
                     /locus_tag="CNJ02435"
                     /db_xref="GeneID:36393072"
     mRNA            join(711009..711303,711359..712099,712148..713156)
                     /locus_tag="CNJ02435"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658774.1"
                     /db_xref="GeneID:36393072"
     CDS             join(711080..711303,711359..712099,712148..713105)
                     /locus_tag="CNJ02435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514454.1"
                     /db_xref="GeneID:36393072"
                     /translation="MYGPRKRSISTALPTPTDSVGDDLCIPPKRRIRPIIVCLRCKQQ
                     KLKCDLEKPCGACKRALLGNECVYNPFPSETEQTKRRDVEHRRDGSSGNESTNVLENR
                     VKQLEKQVSDLLAQPSHSQSPSIQSHSSPNATADDCWRSLLSSLPPLPGCEEFLEHFA
                     QFDIMFGTTHMPSFRRRALDVLSRLPGHVDIREGSLLCGVFAALAIGARYTKKIPGKI
                     EIPPETQHVDFDDLYNRVMLFIESKSGIDHICLDYVHALHLQVIRYLYDKGTSVAQSW
                     IWMGKVLHAALYLQLEREPTELDPKIDPFEAEMRRREWWQIVISDGLLANNLGVKSMV
                     SSIETTVRLPETMPDDSLDGSSRSFSADVMPERSFISAKIRFIPTLSKINELRRKYDN
                     EPPVVKLDECLQELDSYTDSLEPHLRVDRVPGINEPPWVYPRACVISMGTDYLALQLL
                     RPVMRSECPGIRTYASVNALLRARNLIITSKSYINHLLFRWSDGHALNLWTFGVKVFN
                     SGVVMAFSLLSSHDAEHEYTIPRDERLGHLDTAIGALGMMTSEEVEGGLNFRALQGLR
                     ALRARAVADDQHQDQVDDEAVTDPYTERDVTMPDRPGRVVDQGTEKYDVDNQDWIFPP
                     DLNWSDWESFESMLWQ"
     gene            713257..715027
                     /locus_tag="CNJ02440"
                     /db_xref="GeneID:3254366"
     mRNA            join(713257..713415,713475..713493,713552..713697,
                     713763..714343,714400..714449,714520..715027)
                     /locus_tag="CNJ02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657980.1"
                     /db_xref="GeneID:3254366"
     CDS             join(713284..713415,713475..713493,713552..713697,
                     713763..713984)
                     /locus_tag="CNJ02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513677.1"
                     /db_xref="GeneID:3254366"
                     /translation="MPPILSEEESALDPYVVLGIGAGATTKEAERAFRKKSLKYHPDK
                     NPAPEAAVIFHQLSLSLGIFQDQAKRNYVDNQLEIDRKKKQRYAEMDKKRKAMVDALV
                     AREEEAKKQKVEQVKRWQQQVQADEEAIKDAGRRMLEEAQKRAAAIAAAATAARAARA
                     PEAAARKPTGGV"
     gene            complement(715075..717191)
                     /locus_tag="CNJ02450"
                     /db_xref="GeneID:3254342"
     mRNA            complement(join(715075..715566,715618..715692,
                     715754..715901,715957..716710,716769..717191))
                     /locus_tag="CNJ02450"
                     /product="expressed protein"
                     /transcript_id="XM_024657981.1"
                     /db_xref="GeneID:3254342"
     CDS             complement(join(715627..715692,715754..715901,
                     715957..716399))
                     /locus_tag="CNJ02450"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513678.1"
                     /db_xref="GeneID:3254342"
                     /translation="MVTFAQGGEATAAVDMVASIPVNIKKELRFSCLLKPYLVLLDAA
                     VQKGRKTWETLVENASVTQDLPPAWRLKVMEIDERSPFSRHDGSLVGEYNSAGVCLGL
                     PKRIDRPVYSHPDMRDDARRKVLFGDSTHDVRKKTDGDVCSKYFDTWLADVGRTGGIA
                     GMWCPHGICLGYHIMLTAEGRNDFFSMLRCFRKTAPKIVIYDYACHLGPLHYPRSDLL
                     "
     gene            complement(717266..718588)
                     /locus_tag="CNJ02455"
                     /db_xref="GeneID:36393073"
     mRNA            complement(join(717266..718171,718246..718377,
                     718447..718588))
                     /locus_tag="CNJ02455"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658775.1"
                     /db_xref="GeneID:36393073"
     CDS             complement(join(717300..718171,718246..718377,
                     718447..718474))
                     /locus_tag="CNJ02455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514455.1"
                     /db_xref="GeneID:36393073"
                     /translation="MSHMFTPESDSHNSSGDTRTDHMSSSKTLVSEQESLSFQLSHSH
                     QSASAAFCQSAASSSSAAIRPSDSLSGPSMFNHTPLPINSCSDDSQPLANKRNSSMLT
                     QNPKISKASSWRSFFPNRSPSSLDSPIPTLPTKNTSKESNASKRRKLFLNAPSAPSSI
                     PPPRKIPIKSTISKASLSFLNAPSTPSSIPPPRKIPIKSTISKASLSFLNAPSTPSSI
                     PPPSKIPIKSTISKASLSFLTNKPEAKRPQKQKRQRSSAAPSGNTSALVAKCLPKETS
                     EKMPFLKPSTRQRPGRYDPHVEKQHGTHAEERSTKTPQTGSHAHASASSPSSNSNLSS
                     FAPPSSTSH"
     gene            718748..720250
                     /locus_tag="CNJ02460"
                     /db_xref="GeneID:3254172"
     mRNA            join(718748..718917,718977..718995,719054..719199,
                     719266..720250)
                     /locus_tag="CNJ02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657982.1"
                     /db_xref="GeneID:3254172"
     CDS             join(718786..718917,718977..718995,719054..719199,
                     719266..720174)
                     /locus_tag="CNJ02460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513679.1"
                     /db_xref="GeneID:3254172"
                     /translation="MPPILSEEESALDPYVVLGIGAGATTKEAERAFRKKSLKYHPDK
                     NPDPGAAVIFHQLSLSLGIFQDQAKRNYVDNQLETDRKKKERYAEMDKKRKAMVDALV
                     AREEEAKKQKVEQVKRRQQQADEETVKDAGRRLLEEAQKRAAAAAAAAATATAQAPKA
                     PETATSEPTGGIKDKPTITPEDLTILLTLPASSTITSSDLQTRLTTSYGPIAHLILPP
                     VPLSQQAAESKDGKKKKPKSRKAIVEFASGNWGGCYACWMDHETGRGMEGVKAKFGSG
                     EVPAWVAWAAETQKPGRRPSPAASGGDQQINNANGYAPPKTSFTIPTTTSTPASPPSF
                     TSAPDFFAASDGEVSMADLLAKHAQKKSAKSEEDRRRQEFESMTLSRMRMMEREKLEA
                     GIRRQEEEE"
     gene            complement(720341..723168)
                     /locus_tag="CNJ02470"
                     /db_xref="GeneID:3254153"
     mRNA            complement(join(720341..720595,720677..720783,
                     720885..721023,721106..721204,721281..722755,
                     722803..722823,722871..722895,722942..722981,
                     723026..723168))
                     /locus_tag="CNJ02470"
                     /product="poly(A)-specific ribonuclease, putative"
                     /transcript_id="XM_567539.2"
                     /db_xref="GeneID:3254153"
     CDS             complement(join(720553..720595,720677..720783,
                     720885..721023,721106..721204,721281..722755,
                     722803..722823,722871..722895,722942..722981,
                     723026..723131))
                     /locus_tag="CNJ02470"
                     /codon_start=1
                     /product="poly(A)-specific ribonuclease, putative"
                     /protein_id="XP_567539.1"
                     /db_xref="GeneID:3254153"
                     /translation="MLPPPKSAAVQIVRPPSPSSEKAKEKEKKHSPEKRETAQRICRN
                     VMIYGYCKYQDQGCIYYHPPAGADPSTPQNSSPVAHAPTPSAPTPLAGTPAREKPTLS
                     IEHLAAPVFVPKGLDSSPRASTPSVPTPSAPTPPVWPSLPSTGLLPRQDVQVSAQPSH
                     AQLSATASPMAYDDPSHIALSAAHAHAQAQALTHGILDPHAHAPPVDQSMYLPPRQPL
                     DYNLYAAPLPSIGGNPLYPTHPHAFFVSDDLRRAIQAKQEAVYAGANGASAPGLPQEL
                     GVYHSLIPLPLPAPTAQCPPTQSQPSKVYGLPSPVYRATSEVDGNTYCLRRVEGFKLV
                     NQLAFASMDTWRRMRHPNIVGLKEAFTTKTFGDNSLIMVYDYHPLSTTLYDEYLSPNP
                     PEPSPASALANQPPKRRSSPPERILWSYVTQIANALKAIHSSGLAVRNLDASKILLTG
                     KNRIRLNGCGVWDVLAFDNKTPVQAFQQEDLLSFGKLIISLTCDFFQPTLPFSLPLEH
                     ISRHYSSDLSNLILYLISKPAQGQIKSIDEVVKMMGPRILNELDAVQSYADVLENELG
                     AEVENGRIVRLLTKLGFINERAEFELDPRWSDTGDRYILKLFRDYVFHSVGVDGKPIL
                     DLSHVLVCLNKLDAGLDERVMLVSRDDQSCLVVSYREIKHCIEAAFNELKNAGNNHRV
                     HR"
     gene            complement(723221..724722)
                     /locus_tag="CNJ02480"
                     /db_xref="GeneID:3254354"
     mRNA            complement(join(723221..723401,723456..723536,
                     723592..723636,723689..723904,723971..724163,
                     724216..724442,724502..724722))
                     /locus_tag="CNJ02480"
                     /product="deoxyhypusine synthase, putative"
                     /transcript_id="XM_024657983.1"
                     /db_xref="GeneID:3254354"
     CDS             complement(join(723309..723401,723456..723536,
                     723592..723636,723689..723904,723971..724163,
                     724216..724442,724502..724684))
                     /locus_tag="CNJ02480"
                     /codon_start=1
                     /product="deoxyhypusine synthase, putative"
                     /protein_id="XP_024513647.1"
                     /db_xref="GeneID:3254354"
                     /translation="MSADPHQNVIFPSEEIPEDAIDVKGPDFNKPIDLEALLKSYETI
                     GFQATGLARAIRVVDEMRKRRTDPDEPLTLFIGYTSNLISSGLREILKFLAQHKLVDC
                     FVTTAGGVEEDFIKCLGKTILGDFHLDGAGLRKKGLNRIGNLLVPNSNYCAFEDWVVP
                     ILDKMVEEQEEQGVKWSPSSVIRRLGKEINNEDSVYYWCYKNDIPVFCPALTDGSLGD
                     MLYFHTYKSSPLQLNIDIVADIRRLNDMSVKSKKAGMIILGGGVCKHQIANAMLFRNG
                     ADYAVYINTGQEYDGSDSGARPDEAVSWGKIRAGAESVKVYADATLVFPLVVAATFGR
                     AHWAEQGEKAA"
     gene            724819..726342
                     /locus_tag="CNJ02490"
                     /db_xref="GeneID:3254213"
     mRNA            join(724819..725017,725102..725126,725217..725258,
                     725356..725400,725459..725461,725618..725750,
                     725880..725912,725994..726115,726245..726342)
                     /locus_tag="CNJ02490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567540.2"
                     /db_xref="GeneID:3254213"
     CDS             join(724924..725017,725102..725126,725217..725258,
                     725356..725400,725459..725461,725618..725750,
                     725880..725912,725994..726115,726245..726287)
                     /locus_tag="CNJ02490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567540.1"
                     /db_xref="GeneID:3254213"
                     /translation="MSSIDPPAGHTRPIVFFDISIGDTPAGRIKMELFDDITPKTAEN
                     FRQLCTGEHRINSVPQGYKKATFHRVIPQFMVQGGDFVRGDGTGSFSIYGAQFEDENF
                     KVKHTGPGLLSMANSGPNTNGCQFFITTAPAEFLDGKHCVFGRVIDGLLTVRKIENVP
                     TGANNRPKLQVRIAECGEM"
     gene            complement(726374..728861)
                     /locus_tag="CNJ02500"
                     /db_xref="GeneID:3254215"
     mRNA            complement(join(726374..726532,726581..726874,
                     726937..727358,727419..727939,727992..728178,
                     728227..728861))
                     /locus_tag="CNJ02500"
                     /product="mitotic spindle checkpoint-related protein,
                     putative"
                     /transcript_id="XM_024657984.1"
                     /db_xref="GeneID:3254215"
     CDS             complement(join(726497..726532,726581..726874,
                     726937..727358,727419..727939,727992..728178,
                     728227..728818))
                     /locus_tag="CNJ02500"
                     /codon_start=1
                     /product="mitotic spindle checkpoint-related protein,
                     putative"
                     /protein_id="XP_024513680.1"
                     /db_xref="GeneID:3254215"
                     /translation="MPVTPAPTLGKRSSADADLHTPSSRKHLSTLTSTVTSLERTNHI
                     LQQRESRLAAQIEEQRLEIERLKNERYELFEAKVEERRKGEEAEQRWAEDRLVLTGEV
                     ALLRERNLALTNSLEELRSRHTILSTRHTSLAQSSENEISLLQARTAELEKERNSLKA
                     WENKAKSLSVELEEERARKGIEDRERKTDDALQKEVKRQSVNLAAVWRENEALKSEVH
                     TLRHEKKSIDGVERAAKEVERALHEEIRVLQEQLERARRDMDSLTQTLPDPASTEPSE
                     IATLRARLSTLSNLHSQTTTSLVQRDSTIRDLRARLADLAGSSKDAVGEMSRRATEAE
                     RELRWAKEGRESAERREGLVREELEAMRRQFAAASGTFGGPSDPERVKELESLVQSYK
                     TTLEEIHRDSRDAEERIAKGMGLVKSQDLDKAQEKISQLEEEIADLSSSVSYLTSSNT
                     ALNAEVANLMQRVVSGEFNPAYERCLELRNNPAQKIWGIRKQELEDLKAENGELLERL
                     AELDGLLAESQAGAGASASASASVGAGGGGAPAHERMVPRSSYDRLKTEKEELEKAHA
                     KRLQRLKEIFTHKSKEFLEAVYSLLGWRIKFDESGSDIRLTSMYAPKGKNGLTIKFTS
                     SEGHFGTMQMSGMMARSLEESRQFWVVERQSIPGFLAQVTTEMFEKTTIGRAAGYVGL
                     G"
     gene            729009..731570
                     /locus_tag="CNJ02510"
                     /db_xref="GeneID:3254349"
     mRNA            join(729009..729217,729259..729534,729600..729732,
                     729794..729943,730007..730168,730219..731570)
                     /locus_tag="CNJ02510"
                     /product="signal transduction-related protein, putative"
                     /transcript_id="XM_567542.2"
                     /db_xref="GeneID:3254349"
     CDS             join(729048..729217,729259..729534,729600..729732,
                     729794..729943,730007..730168,730219..730452)
                     /locus_tag="CNJ02510"
                     /codon_start=1
                     /product="signal transduction-related protein, putative"
                     /protein_id="XP_567542.1"
                     /db_xref="GeneID:3254349"
                     /translation="MSHLPPITSATAKLPEQRTNNPPYSVQTGRNVHSITIGPWSIVS
                     TKKPILNGKEIEAKPAQSAEKSLNLPLPEMTFGNNSLSLVYNPTTASPLDSTAASRYI
                     AVSTEARVNLSFKTLDALAGVATGEGWEDRVGGGVLVSMAEKWGKNKSWATTESTSLP
                     AAGVFDVPVPSKPVKPHDWTYSTCYAGSVAGPSTFEPSSTHSLPLSLLARQDPVLDQI
                     LYYEDVPLYEDELHDNGESILNARIRVMPHSFFILARLFVRVDNVLFRIYDVRIYHAF
                     GSDEIIREVSGMEAGYNTVKQFLEKPSDLSPLTDPNWVYSVMTQLSNLPVRAPAHRRS
                     SSSSSRHGKPWPGLGKKVEVLKLPKAGVDEIGEGLDKVQL"
     gene            complement(730514..732014)
                     /locus_tag="CNJ02520"
                     /db_xref="GeneID:3254105"
     mRNA            complement(join(730514..731512,731646..731785,
                     731855..732014))
                     /locus_tag="CNJ02520"
                     /product="homocysteine S-methyltransferase, putative"
                     /transcript_id="XM_567543.2"
                     /db_xref="GeneID:3254105"
     CDS             complement(join(730543..731512,731646..731785,
                     731855..731890))
                     /locus_tag="CNJ02520"
                     /codon_start=1
                     /product="homocysteine S-methyltransferase, putative"
                     /protein_id="XP_567543.1"
                     /db_xref="GeneID:3254105"
                     /translation="MSSNILVLDGGMGTTLESLGVDISSPLWGSEALRTNPDVIRKVH
                     EGYVQGGADLVETATYQLTPQNLCDHLHCPREEAECILCSGVKLVASCIASCSSRNEE
                     HNTKSKGGNKSKVVLSFGPYGSTLQPGQEYGGIYPPPFGPSTSTNAFPPDSNDEEEAA
                     IQALAYHHLDKLEAISHDGAAWREVEWIAFETIPVLHEVRGIRRAMAILRGKLSALYA
                     DGDNIDLWWEKKFWITSPFPMGQHPQLLPDGSHASIPQVIHSLFSGPDPIPNGIGINC
                     TNPSYLHFLSSSFTSHLPFEFFGKVEMVIYPDGGQMYDTTTRAWVVAPQSPENAEKWA
                     EVVGDVAKGVRGAEREGKGVWKGVVVGGCCKSSFDEIRALRRFVDSQ"
     gene            732142..732858
                     /locus_tag="CNJ02530"
                     /db_xref="GeneID:3254183"
     mRNA            join(732142..732269,732337..732468,732525..732858)
                     /locus_tag="CNJ02530"
                     /product="expressed protein"
                     /transcript_id="XM_567544.2"
                     /db_xref="GeneID:3254183"
     CDS             join(732177..732269,732337..732468,732525..732785)
                     /locus_tag="CNJ02530"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567544.1"
                     /db_xref="GeneID:3254183"
                     /translation="MSSPATSSKDPLELESLDGDSLFAALTGVEKAIPELLMQLKPIL
                     AQLSGPTEDGDEERRGMEAREGVEQYMSLLDKIQFVLRQTVYYLRETRSSPNTLRAPP
                     VNLIPTPFASTIPSSPGEGLDGYATGPAELGLYASRIEAKVLKDMEEALGSLRSELGQ
                     Q"
     gene            complement(732864..734204)
                     /locus_tag="CNJ02540"
                     /db_xref="GeneID:3254210"
     mRNA            complement(join(732864..733126,733180..733331,
                     733384..733498,733548..733593,733897..733907,
                     733987..734204))
                     /locus_tag="CNJ02540"
                     /product="DNA binding protein, putative"
                     /transcript_id="XM_567545.2"
                     /db_xref="GeneID:3254210"
     CDS             complement(join(733038..733126,733180..733331,
                     733384..733498,733548..733593,733897..733907,
                     733987..733990))
                     /locus_tag="CNJ02540"
                     /codon_start=1
                     /product="DNA binding protein, putative"
                     /protein_id="XP_567545.1"
                     /db_xref="GeneID:3254210"
                     /translation="MARTKQTARKSTGGKAPRKQLATKAARKQAPSQVSGGVKKPHRY
                     RPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEASEAY
                     LVSLFEDTNLAAIHAKRVTIQPKDLQLARRLRGERS"
     gene            complement(735611..737453)
                     /locus_tag="CNJ02550"
                     /db_xref="GeneID:3254322"
     mRNA            complement(join(735611..737127,737184..737290,
                     737366..737453))
                     /locus_tag="CNJ02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_567546.2"
                     /db_xref="GeneID:3254322"
     gene            735671..736958
                     /locus_tag="CNJ02553"
                     /db_xref="GeneID:36393074"
     mRNA            join(735671..736098,736171..736645,736697..736765,
                     736822..736958)
                     /locus_tag="CNJ02553"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658777.1"
                     /db_xref="GeneID:36393074"
     CDS             join(735782..736098,736171..736645,736697..736765,
                     736822..736953)
                     /locus_tag="CNJ02553"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514456.1"
                     /db_xref="GeneID:36393074"
                     /translation="MSLLAPGTRCSSCTLVDFLPLLCPSCDLPFCPNHIYIHQPCSSL
                     GSTSSHGVAVGKLDRGKKTCEKEGCERETIESVAGVSGRDEEEGIIAREVRCEGCGGA
                     FCTSHRAQTSHSCPAPLIHNARHDAFLVRRSQAEDLIAKNFTGHRDRTERKMPTQRDV
                     VKKPRIEEERLPPSLQPAQTTSTISQELTQGEAKVEKKIKSKAEKLWDIHLRKVRSTA
                     TRLGGGANIPDTEKVFFEWGVDLTGAKVKVWKGKWDIKLERAWIGEDTPIGKVMDLII
                     AQSKTSRTTDTKFSLVQLYPTSDGLPSTTSLSPSQPAKAVTQGAALILVRGEMV"
     CDS             complement(join(737087..737127,737184..737290,
                     737366..737388))
                     /locus_tag="CNJ02550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567546.1"
                     /db_xref="GeneID:3254322"
                     /translation="MAPKAKARRILVKLVSTALTGSFYTTSRVRVGEKLAKIKYDPIA
                     KKHVLFTEAKIK"
     gene            737584..740801
                     /locus_tag="CNJ02555"
                     /db_xref="GeneID:36393075"
     mRNA            join(737584..738095,738149..738220,738271..739711,
                     739788..739878,739926..739996,740052..740311,
                     740404..740801)
                     /locus_tag="CNJ02555"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658778.1"
                     /db_xref="GeneID:36393075"
     CDS             join(737904..738095,738149..738220,738271..739698)
                     /locus_tag="CNJ02555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514457.1"
                     /db_xref="GeneID:36393075"
                     /translation="MRASHFSTLFIKSVFKTSSSSPASSSSPLKLTASHYTLSTIISD
                     VKKMKKASVVVVLQLDGEENDEKETFLGEFESKVAACEPLEQDKAYEKISVPVESINS
                     VQVSTCTSTNIKTSFESIQGKTSASTSTETSLPVSKLNDLDHDPFGTSPVKVQVVRSY
                     NYLGVSDKLRSFPPVRPNSIQANEDVKEVMKAFMDHYKPKHASETSEATVSPVTIVSH
                     NNAARTASRDIDSVSTTTYVPYTEDDDTAAFTVIPAGTPTHGHEKSDSIDFIFTMYLR
                     MSDDELSFRDRSTTFSPLFDEAGITSSVQHDSTAEEGFAVITTPEANEISPETSTASE
                     DHASSNNGSFTTSHDSTIEDSPAYSLPAFMTFTSIDTAPLGLSLPIPTFPEESYYASS
                     SAMSIRDIIVTPNHSIDSADHFTIRKALTDNKNASSKDAFVVVPSALFENNERKYSLP
                     SIQRFRTAQQSIRNYRHTEKVPPRFTAARQRYGRNSSNGGKERSDKEPQDTIETPALN
                     AKPRLSLASSLERDFKPVRQSSKSYKVNRMTPVKSSQASDLPRRFVLADRFSLGF"
     gene            complement(740559..744870)
                     /locus_tag="CNJ02560"
                     /db_xref="GeneID:3254233"
     mRNA            complement(join(740559..740839,740894..741289,
                     741348..742599,742657..744093,744143..744395,
                     744444..744631,744773..744870))
                     /locus_tag="CNJ02560"
                     /product="signal transducer, putative"
                     /transcript_id="XM_567547.2"
                     /db_xref="GeneID:3254233"
     CDS             complement(join(740700..740839,740894..741289,
                     741348..742599,742657..744093,744143..744373))
                     /locus_tag="CNJ02560"
                     /codon_start=1
                     /product="signal transducer, putative"
                     /protein_id="XP_567547.1"
                     /db_xref="GeneID:3254233"
                     /translation="MSASPLPPHLNPPSAYPHISPKSHSRASPTNSPKTGNSPRSSPR
                     GSTGMLDFEGVIRLHGGDLKKALESVVSERNNLLSQNTQLWKLIEKQRSQCAQFASDN
                     DRLRQDRERANSRLIAAGLEPVGPLKKLNSSSSVTGLGIRADVPQIKRNHSDREDVPV
                     IAENKEEGMGLASPAEVQPTGLLPSAIPDRRLRRGSDIGHPPDSSSSMPFADSPQSTS
                     HSIHSLPTPFHSAEPSPQLATSARMAGREDGCVIPPPSSRALAASVAASSPLTQCSEG
                     PRIPQPTTREPSIESLEKLPSPTPVSVSVPLKSPSQSIRSETMSPTFSISETTLVSSS
                     TLDNALRPSIDSSISIPLTRDTTLRQSIDQPPQTKRQQSYSAEPPRLPTSSTRPLSPS
                     LLPHARITIPSSTVFPNASGHEVLCFIVEITVRPPNAQPITWNVAKLFSAFIDLDAKI
                     KVTANKSRKEWKQIAAPLPESKSWKDFAPSKIDQRKTALEAYLQSLLVAPISDKSDLC
                     HFLSTDPVRAKRSDARKEGYLTKKGKNFGGWKTRYFVLNGPVMEYYESRGGNYLGSIV
                     ITNAQIGRQNRPVDSSDERHLRHAFLIIEAGKKGTSHRHILCAESDMERDRWIDILVK
                     HVDPETMSSPQPLPTATVSVAASALVPAVTPARTPVPQPSAVPAITTATNQNQAVPGL
                     RRKPSQLRKQSKDVVVTSSRPLSSMSKDSKFSDAPSPTIYNNKESHLPPLNQPLVAYS
                     STQSFIPQVVQSPIEESAFSQQLPPRKPPGPVQNHRQPWGSNSSVVQGVSPSSEAPPQ
                     FSDPTPRANKRQSVLPGRPSVSLPSHSFLNTPSTLSLGATSPIVEKERDRKAKSRGFW
                     GFGRSTEKATKPVFGVPLTDSIAVANIAGLPAIVFRCIEYLEAKKAEDEEGIYRLSGS
                     SAVIKGLKEKFDDQGDIKLLAADEHWDPHAIAGLLKTFLRDLPTSLLTRELHARFLAV
                     MDFVESSERIAELAHLVSELPLPNYALLRALVAHLILIVQNSALNKMTLRNIGIVFSP
                     TLGIPAGIFSEMITHFGTIFDDEVETLDTRAEEDTGPGSVQFENADETVKRKRNSLCQ
                     AGEVDALSGLSGRTLNASNEDSQSVSSSNDLASEYHSSDINHSNTTSIPVAGYQGEAP
                     IRSRG"
     gene            complement(745116..745195)
                     /locus_tag="CNJ02570"
                     /db_xref="GeneID:3254257"
     tRNA            complement(745116..745195)
                     /locus_tag="CNJ02570"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:3254257"
     gene            745320..747911
                     /locus_tag="CNJ02580"
                     /db_xref="GeneID:3254288"
     mRNA            join(745320..745453,745508..745526,745586..745693,
                     745751..745931,745986..746565,746620..747014,
                     747084..747609,747671..747911)
                     /locus_tag="CNJ02580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567548.1"
                     /db_xref="GeneID:3254288"
     CDS             join(745363..745453,745508..745526,745586..745693,
                     745751..745931,745986..746565,746620..747014,
                     747084..747482)
                     /locus_tag="CNJ02580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567548.1"
                     /db_xref="GeneID:3254288"
                     /translation="MSFDYIRKLVSGNKARFIDPEAAVNLDLVYVTDRIIIMGYPATG
                     VAALYRNKRRDVLRFITSRHGEKWWIWNLCPLYENAYSPESMHNRVSRYPFPDHHPPP
                     LPLLPLAVREMTAWLEGDEERIAIIHCKAGKGRSGTLLCSYLLSLSELPPPPELDRSY
                     SYKELARRLAQREKQKAHSQEQSASPSDVDAEDKEGWVFIGGGKEAATLQVDDDPSVE
                     RGGTLTPARSERIQVGPVVKGNDHEDDNDTASSFSSTTTISRPSPPPSERIELQSTPP
                     YDPIDIGDERPAGQKGQEDRADGRVDEVFKLHSSRRMKPTSTGRGVSIPSQRRWCRYI
                     HLLFNNQAPPSYLSLTPRHLRLLSVTLLLTPPSGWQKPLASLLVGSGGTGQGKAWASV
                     ARYDDDYVKELQNRGGTGEGVRGEITWGGVAGDGRFDAHKMFRSFGKMVPADVNKDVV
                     AVLPKDHQNYVIHHLAPNHSHLTLDRSREFRLKFHLGNLPLGWTWLIPAFHLPEPSSS
                     NSEGGEGAVKRVHTLSFPRSQVDFPLGPGAALHQVLIRLEEVTEDRMGEDDEVPARLM
                     NDEEEEREGIENDSKEDKVREEGE"
     gene            complement(748436..750590)
                     /locus_tag="CNJ02590"
                     /db_xref="GeneID:3254090"
     mRNA            complement(join(748436..749480,749533..749705,
                     749774..749841,749904..750590))
                     /locus_tag="CNJ02590"
                     /product="MFS transporter, putative"
                     /transcript_id="XM_567549.2"
                     /db_xref="GeneID:3254090"
     CDS             complement(join(748588..749480,749533..749705,
                     749774..749841,749904..750308))
                     /locus_tag="CNJ02590"
                     /codon_start=1
                     /product="MFS transporter, putative"
                     /protein_id="XP_567549.1"
                     /db_xref="GeneID:3254090"
                     /translation="MMSQLDNHHIAPTATNIINPPAGGLELSQSRADSISKAYAEHTE
                     DVEKVSEVPDVNTKADQFGSNTEYSKEERTLLRKLDWHIMPIVFCMYFMNKLDQNAIA
                     NARLNSFEKDLGLTGNQFNICVSVLYAGYTLIQIPSNMLMATKKIRPSLWMACWMMAW
                     AIVSASTAAVQNFSGAFAVRFLLGFAEAPFYPGAIYMLSLFYTRREIATRISILYSAN
                     IIATACAGLISAATFATLEGVHGLAGWRWLFIILGVVTFGISIVAIWLLPDHPLTTRW
                     LSPEERELAHSRMERDTVGLEESRGTLIGLKQAAADPKLWLLTLLQTLHLAACGFNSF
                     FPTVVKTLGYSTTITLVITCPPYLVAGGFSIALAWSSGRRNERSIHITFGMVVALVGF
                     IMAASSLNTAVRFISLFFFATGAYSANSIIIGWVAATCGQTPEKKAGALSIMNCIAMA
                     SFIYTPYLYPASDSPRYLMAMSANAAFVTGVIICTWTMRLWLQQVNKKLRSGDATARL
                     LYAY"
     gene            750840..752070
                     /locus_tag="CNJ02600"
                     /db_xref="GeneID:3254101"
     mRNA            join(750840..751012,751074..751536,751587..752070)
                     /locus_tag="CNJ02600"
                     /product="dihydrodipicolinate synthase DapA, putative"
                     /transcript_id="XM_567550.2"
                     /db_xref="GeneID:3254101"
     CDS             join(750920..751012,751074..751536,751587..752014)
                     /locus_tag="CNJ02600"
                     /codon_start=1
                     /product="dihydrodipicolinate synthase DapA, putative"
                     /protein_id="XP_567550.2"
                     /db_xref="GeneID:3254101"
                     /translation="MTANGFSDNVSKFSNPRGRVGFDMSGITPAPVTPFNEDGSVDYE
                     AIQRIGSWLASVEGVKGLVVLGHAGEGTFLTSEEQVKVIKAFVKSVNNEIPIIAGITR
                     EGNYVAGLEAKRAREAGAAAGLLYPSHGWLRFGYQTGAPQVRYKEVYEASGLPLILFQ
                     YPDNTKATYDLKTQLDILAQPGVFAMKNGVRNMRRWDREIPVIRKARPDIYILTCHDE
                     YLLHTTFDVDGMLVGYGSIAPELLFELLKAGKAHDYKKARAIHDQLLPVTAAVYHRGS
                     HMEGTVALKHALVARGILKHATIRGTLLPLPEGADKEIYDAISAAKIAKVQ"
     gene            complement(752448..756429)
                     /locus_tag="CNJ02610"
                     /db_xref="GeneID:3254338"
     mRNA            complement(join(752448..752747,752805..755970,
                     756124..756429))
                     /locus_tag="CNJ02610"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_024657985.1"
                     /db_xref="GeneID:3254338"
     CDS             complement(753211..755904)
                     /locus_tag="CNJ02610"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_024513681.1"
                     /db_xref="GeneID:3254338"
                     /translation="MQPPQKKLKRRVPDTQRQRVSVSCDRCKVRKIRCIRISGGNDPC
                     AACAQLSLNCESTLPRKQRVYASYDQLQLRYRALDTLIKRLYPGENVESVDDICELAR
                     KQGLDLSGFEDEGEDLDPLPKLSDRESSGTTSASKEGSSLFDSVQNLRIPEGGLIPAP
                     RGGYHYVGPASSYQFANTIRHLVKKSSAYTLAFDRVGYRRQQRANEFTSSDRTTALEA
                     RIPGHPVMVGENEASPMSESIGSCPSDVGPVPSPQDRTTPRSIPHSITRRTIDIMPPR
                     QLADKLVLAFFDRVHLNFNLFHRGSFQVRYESIWSSRNEAGLEDLEPGWLCVLCMVFV
                     LGAQALERDGLREATVIQSRYLAIVIREGMQRLVLTATQSNVQALALLSLYQHNAGER
                     NTAWMLVGHAAHMAVALGMQRDGENANFDFIERNTRRIIWWTLYLFEQNLSFILGRPS
                     ATSTPDVSASLPDEAVKDGADSPPGYLEQAVKLGDISTKIKRFTAAISSDFDKPNRLT
                     ATTDIANQLDELLLQWDRSLPPHLRYTAQFATAKHRRTVRLLHATYNHLRSVLGRPYL
                     LCKINHDLDNSQSPLHVNSSSGLASAITALSQTSLSAARSCMEALLSLASAASLEGEV
                     WYDYYYVHHASLILSLPFLVDFNDQHVASDRAIISATLNLAQKSRLAPTYRILINVSI
                     QFAKIVGIGPDDDPSRPASPRLGASAIRPDLSSSGKSMVFPEGFTDENNHTDWNLGPS
                     SVTPENSGGNRSFDSRANYHMSGMSHEAGPGTGSSTVQWPTQLPHHTNPTASDPWSLL
                     PMLNSTPSSQPLSLEQLLGMQPSTLFNDSATQQPVADLGFSDMYNFGFGLPAQNDGIG
                     PYWPGGVGEEGGSGGLGDMPWDFFAGGDWAGGGHETGREGR"
     gene            757899..760576
                     /locus_tag="CNJ02620"
                     /db_xref="GeneID:3254331"
     mRNA            join(757899..758249,758306..759266,759319..759413,
                     759467..760576)
                     /locus_tag="CNJ02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657986.1"
                     /db_xref="GeneID:3254331"
     CDS             join(758221..758249,758306..759266,759319..759413,
                     759467..760016)
                     /locus_tag="CNJ02620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513682.1"
                     /db_xref="GeneID:3254331"
                     /translation="MSTAKVEGFSIPGNSHMSPRPIHRPFSDGSMTVDTDLLASLMSG
                     GSHQSADRGQFNLPPSSFSFSQSLPVRHHSFDYSLPSPLSTSINIAGHMRNSISGGTG
                     ANSGGVFNSVKFGNEHPEPPVSLPPAMDGIEQGSHQRPRSQSSSHSVGKAPSSRSRQA
                     RKSMTDVRPPRSSLQRGRSQGPTRPMGLGVSLDTHVEGEMTDSISPPDFGANGAFGLA
                     IASGRDSFNNDTSSWASGSVPSMVPGSLGSFDTDEVLVDSPITPVKPLMQLSDENYKK
                     QRRRECHNLVEKRRREHINAKIEELGTLLPEKYNQIDEPAEEEDEDGKTSAKKKKSKR
                     GGNTSAKSQKDAAHCKGRILSQSVNYIRDLKQVTETQASRISQLEQLLMNLGVNTADE
                     NANVNQGFPQQHSLFWLNNNGLNNFPDSGEHNLQAMRPSPEPERSFSFDVVNTQPWSE
                     SHDSGGSPNPVNGMHTQENKDMFIPFQPSPTSTNSSHPPNMSDFRRPSHSGSSDMEMD
                     PLSPLGGAEEKGRDKLRQDSQIELQMGMSGLFNTKF"
     gene            760764..763875
                     /locus_tag="CNJ02630"
                     /db_xref="GeneID:3254325"
     mRNA            join(760764..761192,761275..761388,761447..761557,
                     761610..761719,761781..761943,762003..763574,
                     763633..763875)
                     /locus_tag="CNJ02630"
                     /product="cell cycle arrest in response to
                     pheromone-related protein, putative"
                     /transcript_id="XM_567553.2"
                     /db_xref="GeneID:3254325"
     CDS             join(761001..761192,761275..761388,761447..761557,
                     761610..761719,761781..761943,762003..763574,
                     763633..763704)
                     /locus_tag="CNJ02630"
                     /codon_start=1
                     /product="cell cycle arrest in response to
                     pheromone-related protein, putative"
                     /protein_id="XP_567553.1"
                     /db_xref="GeneID:3254325"
                     /translation="MQHQYLSHPLGPLSQQGQAMNHSTGLNSGGGGEVPWGAPFPSLH
                     LWPIQDTFQMKMIHLPEGQRIKIGRQTNNKTVPGERNAYFDSKVLSRLHAEIWEQGGK
                     IFIRDVRSSNGTFINGERLSPEGVESDPVEIKNEDQIDFGIDIVSDDNRTIVHHRVAA
                     KAYCVFNEEDAARSARELATYQSHDNTRMRRMGGDMHPGANPLAQMGPAMMSGGGKVG
                     SLSFEHVLSKLQAELHASKETGAELQNLATTFTGIQDTLSGGVSPSQNGSAEQYIPPQ
                     FRSATAEAQAALAGPHGQEAAAFIALQAQLTETQSSLSGHLDKIRYLETQLKEHESLK
                     AEVQLMREQMEESKREMDMVLAGYRGRQLGRRGELEGDDDEDDEDDARSVATLMDDED
                     SENRVRERRRAHRAKKTEKGEHERPPTPEPIQEGEINEEDQNKAAIDQASKDLEAIPA
                     HVNGSLTNREKEMLEQNNQLVSQINTLSTEISEALSLSQALQSQHAEAMSAIKLLTDR
                     ISSLESGMSNKISEEVSKAEEKWESWRIKFEESWKQEREGWEKERERLKSVVREWEEA
                     SRRAYEEEEERQENERLSEAEYEDEDEAEDDERDEEEEDDGEADGNEGLVEWNGSNDP
                     LTMPSKGKLRRRRPSHKTVLAVRALKAVADGDSSLDTPKLSLAGGGPIVSGRVKKLKL
                     KSKRLGELSRNESNQTIKPPQPREGGQKQRGDEEENHSSESGRESGDTLKEKEVGKEV
                     KRDGMKRREPKVVQPQTVVGVLVVAIVVGAFWYKHKE"
     gene            complement(763819..764985)
                     /locus_tag="CNJ02640"
                     /db_xref="GeneID:3254065"
     mRNA            complement(join(763819..763954,764010..764396,
                     764469..764574,764637..764715,764795..764985))
                     /locus_tag="CNJ02640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567554.2"
                     /db_xref="GeneID:3254065"
     CDS             complement(join(763856..763954,764010..764396,
                     764469..764574,764637..764715,764795..764930))
                     /locus_tag="CNJ02640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567554.1"
                     /db_xref="GeneID:3254065"
                     /translation="MSTFDRRRIPAPEISIPPVYEPLPNDAQAGPSTRTDRTDQESRP
                     IFLKTGLISQAHGSGYIEAGGVKIACSVYGPRPKPPPYSPQGTLNLEVKFAPFASDPR
                     RAPLRDTEPLPLSNLLTQLLLPTLHLHLLPKSSIDVYLLVLESDTLTNVLSAGLTVAS
                     AAVADAGIEMAGLGVGGVVASVGGDEKQGRRRVVIDPSLEEEKESDVKVMVGTMPALG
                     KVTNIWLTGEAEVDDACNMIEQVIEASKETHSVLAEALVEGAGERGIAAA"
     gene            765550..767069
                     /locus_tag="CNJ02650"
                     /db_xref="GeneID:3254033"
     mRNA            join(765550..765652,765959..765962,766019..766079,
                     766184..766277,766331..766532,766593..766737,
                     766794..766883,766938..767069)
                     /locus_tag="CNJ02650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657987.1"
                     /db_xref="GeneID:3254033"
     CDS             join(765650..765652,765959..765962,766019..766079,
                     766184..766277,766331..766532,766593..766737,
                     766794..766883,766938..766956)
                     /locus_tag="CNJ02650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513646.1"
                     /db_xref="GeneID:3254033"
                     /translation="MPPPKAKHSKMVTLLHYRLKVTLNDGRSLVGQMLAYDKHMNFVL
                     AECEEFRTVKGKKAKASSNEPAPTTQQKRTLGLVILRGETIVSVSVEGPPPVQKEEPS
                     LIPGPGKGMAAGRGMPLGAGAPGAMAARPMAYARPPPGFPAGVPGLPPGMPPGFPPAG
                     GLPPGMPPAGMPPGFRPPGFPGAPAGMPPGFPPAGQMPPGFRPPQ"
     gene            767298..771542
                     /locus_tag="CNJ02660"
                     /db_xref="GeneID:3254245"
     mRNA            join(767298..767691,767792..768110,768164..768204,
                     768254..768317,768366..768390,768444..769021,
                     769072..769217,769276..769404,769467..769528,
                     769598..769716,769783..769859,769911..769963,
                     770012..770075,770128..770464,770516..771542)
                     /locus_tag="CNJ02660"
                     /product="transcriptional regulatory protein, putative"
                     /transcript_id="XM_567555.2"
                     /db_xref="GeneID:3254245"
     CDS             join(767920..768110,768164..768204,768254..768317,
                     768366..768390,768444..769021,769072..769217,
                     769276..769404,769467..769528,769598..769716,
                     769783..769859,769911..769963,770012..770075,
                     770128..770464,770516..771413)
                     /locus_tag="CNJ02660"
                     /codon_start=1
                     /product="transcriptional regulatory protein, putative"
                     /protein_id="XP_567555.1"
                     /db_xref="GeneID:3254245"
                     /translation="MISADIPPGEGSTSILPSSESMHPPALPIKRTSAAEPGKAGGKA
                     GKGDKEKSGRQSFSCAECRRLKLKCSREWPCTSCEKRGCAQICPNGEMRTGKGKRLIL
                     ADTAELHERISLLEVALSQSHAKNSSTPHPLLESPYLFSPREPRSYGRNNSKTSTGFG
                     NEPGAEDELLQGAFGTLTIGQEGQATFVGSFAGSEYLREGEGSGDELTGSETGPGVLG
                     GGNARGHNATEQRRQALATPPSTAEGRWSGNEEYSNLPGLGLHSSLFARGEIKLDKLR
                     DELPDYDREGRALVTSYWENVNWQYQPIPRAMFENDHILNAYDTESSPNAHKLACVFL
                     VMALGSMFDLNRPPFHPRGEQLFMLGRACISVVGIEQASPATVQAMHLMGTYILNDKR
                     GNGGEVFWPILGTAVKIAQSLGLHRDGEHYGLSQYEVEERRQVWWEIVSYDRLQALCF
                     GRPCSTSYKWSDTKIPEVPELIGDETGFHRAKYGLMHLMERVIDVQTQVDPVSLTVVS
                     QLDSDLREYKKNLPELLLPNVAIVDLPLDPNVHPHLVIHRFGIRLQIAQMRLLLNRPL
                     FARALKDAPDDPSHSKFGSSFVALFENAQEIVHLVKALVIYHPSLVARWWFFWFHAFS
                     SAVCLAAIAIRAPQCAFASPSFHAMSIVCDISAAAREGCRAKKGLPILLRLRKRAHEA
                     LIAASRTKNKVVADGSGEEDDLSHLVGSAKLRRVQAPLRGPSASSSNGTGVAVGIGRT
                     GGVDGTPSPNSGGSIATASTLVDNGFYDAAVPAFAGDQTTPLTASSYPASSYPLMTSS
                     SWESEVPLSGYIPNHLISISGTGPGAGTNRNTWLNASNSSPSTNISVSPEYDGQVGVD
                     MDMSMALGMNMGMAMGGGLGMPGKHFQGDEGGGQMRHQDGMGGQNAEMGGQDGDMFGF
                     NFEAFVNQMGGAV"
     gene            772145..775532
                     /locus_tag="CNJ02670"
                     /db_xref="GeneID:3254241"
     mRNA            join(772145..772269,772508..772569,773350..774030,
                     774079..774139,774187..774382,774433..775532)
                     /locus_tag="CNJ02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_567556.1"
                     /db_xref="GeneID:3254241"
     CDS             join(773382..774030,774079..774139,774187..774382,
                     774433..775236)
                     /locus_tag="CNJ02670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567556.1"
                     /db_xref="GeneID:3254241"
                     /translation="MYTVVSPSTAPLSVKSSTYSHRTLSPIPASQTTIMSGAYPSGDL
                     IPNGTKINVDPRDGTNVALALDLDAHQSSADLVVDDEMPPVVNELKDAAAIPIDPALR
                     FEGEEEQDEFMREVVIGQKRKTEEELEEEKDGEEMDGQEADDANQQENGASREETQDE
                     AVGEVVLGFEALEGSEGGQPESENAMEEADVVEKGDKPQTAKRAPRKRRKWLKKGEVD
                     PDDPVAVARQQARHRLIDDAIASLNQQEKDLLDGSHPQLLWLWQELERRKDAQYLWAE
                     AREQADEGELLKMCDHWKKFARFNFHVRLEEIADEITHANRQKMARLTAERIALRRNP
                     DALPNLRAGRGGGGWAIADKHLLSTGEQTLEPIEIDGQIRQRRAIARDIQSLSQTDIQ
                     SDLLKMGLQRPSAPRSPSPPPRRPSPVYPMYNDGRSQSNKRPSQTSAWQQPKEHYQQP
                     PPPPLPSSSQVVSGIWDRPNSMYHPSMPLPPPQPTAYDARAARDYEAGMRRDRMNPPP
                     SSSAPYASRTESTPRYHFWQPSSGPSPKTNGAPPMSYFSSYPRSTAPTGPPPGIGLPP
                     PRL"
     gene            775712..778121
                     /locus_tag="CNJ02680"
                     /db_xref="GeneID:3254264"
     mRNA            join(775712..777247,777302..777507,777579..777697,
                     777761..778121)
                     /locus_tag="CNJ02680"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_567557.2"
                     /db_xref="GeneID:3254264"
     CDS             join(775730..777247,777302..777507,777579..777697,
                     777761..778026)
                     /locus_tag="CNJ02680"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_567557.1"
                     /db_xref="GeneID:3254264"
                     /translation="MLSLLITGGQPITTRAFQRSVHGALGRSVAAIHRPLLARPLTNR
                     ATSNGVLAALKTSNSAHQRGLQTEKRSRNAIHLGLRLPIVKRSLHSSRISRNTLKPNI
                     PPIPPTRLFNLHRRLRRLRNFLILLSLLSILYYTYPPFRHTAIAVIRCARVMKAVSID
                     VWDYKQVFAAEERLRATGRELTDEEIEMKRKTRRACHKRSAERLLEALKKNSGIYVKL
                     GQHVAAVQVLPKEWTETMRPLQDQCFPTPVQRTDEMLRDDLGMGIDDIFTDFEPNPIG
                     VASLAQVHRAVDKRTGRAVAVKVQHADLQEFAAVDMATVNFAIHFVKYIFPDFEFSWL
                     GEEMNEMLPLEMDFRHEAANSARCMGDFLHLKGKTSLYLPEVFWAERRCMVMEFIDGG
                     RVDDLMYLKKHKIDRNQVSQELARIFSQMVYINGYFHADPHHGNLLIRPKASGSTSPF
                     NFDVCLLDHGQYFDVPDDLRVNYAHFWLSLIKSTSKKTIAERRHYARLVGNIDDDMYP
                     ILESAITGQINMADESNTHDSANDPRPTSLLDSKTFDKDQIRKLRTAMLEREGLIASI
                     FELLRIVPRRMLMILKLSDLQRSLDQSLVTTHGQSRVFVIVARYCAKAVWQADYANFR
                     KSLSTQGFSLNLFKSFISSFFDYAYWNTTLGLVELGLDARARSIKIALWFDGLVKGGL
                     KAAEAEMAGLSLNGAIPATV"
     gene            complement(778087..779096)
                     /locus_tag="CNJ02690"
                     /db_xref="GeneID:3254330"
     mRNA            complement(join(778087..778483,778632..779096))
                     /locus_tag="CNJ02690"
                     /product="mitochondrial import receptor subunit tom22,
                     putative"
                     /transcript_id="XM_567558.2"
                     /db_xref="GeneID:3254330"
     CDS             complement(join(778427..778483,778632..779024))
                     /locus_tag="CNJ02690"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit tom22,
                     putative"
                     /protein_id="XP_567558.1"
                     /db_xref="GeneID:3254330"
                     /translation="MVVVVEEVRDEAAEEVVLQEGENESDFETDSEVSSTISDDDDFN
                     PADESFYDRLTALKDIVPPQTRSGLYNKYKSTTGWAWWGIQSAGSLAWLVSTSALLVG
                     LPLALAIEDEARVVAQEKEMQMQSAGQQQMLGAPQGQQPQGVLPPGF"
     gene            779229..780689
                     /locus_tag="CNJ02700"
                     /db_xref="GeneID:3254103"
     mRNA            join(779229..779442,779499..779552,779612..779888,
                     779947..780334,780407..780689)
                     /locus_tag="CNJ02700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657988.1"
                     /db_xref="GeneID:3254103"
     CDS             join(779236..779442,779499..779552,779612..779888,
                     779947..780323)
                     /locus_tag="CNJ02700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513683.1"
                     /db_xref="GeneID:3254103"
                     /translation="MSANSLVTTITHNIPYFLRAPAEALIGEECYGTLVYDFNITDSE
                     CLKYALSKGLGFGIVVGGSIVKIPQITKIVSGQSARGLSLSAYALETVAYAINLAYNS
                     RNAFPFSTYGETFFLAIQNVIITLLIIHLAPQKGAVIGARPLSSKRNTNGRKVLTGAV
                     ITAATGFFLWSETLCPLSLLSILQAATLPLSLISKAPQIMTNYKYHSTGNLSAFAVFN
                     NFLGCVARVFTTKQEVDDPLIFWGFASAAVLNAVLAVQMIMYWRDNEEKEEVRRHNAS
                     EKGLPDVLEKAGGILEGDTGKRLSRKLD"
     gene            complement(780420..783148)
                     /locus_tag="CNJ02710"
                     /db_xref="GeneID:3254081"
     mRNA            complement(join(780420..780574,780638..780662,
                     780721..780843,780912..780967,781022..781046,
                     781100..781118,781178..781278,781339..782047,
                     782100..782151,782189..782279,782331..782352,
                     782407..782589,782649..782758,782816..783148))
                     /locus_tag="CNJ02710"
                     /product="membrane protein, putative"
                     /transcript_id="XM_567560.2"
                     /db_xref="GeneID:3254081"
     CDS             complement(join(780532..780574,780638..780662,
                     780721..780843,780912..780967,781022..781046,
                     781100..781118,781178..781278,781339..782047,
                     782100..782151,782189..782279,782331..782352,
                     782407..782589,782649..782758,782816..782849))
                     /locus_tag="CNJ02710"
                     /codon_start=1
                     /product="membrane protein, putative"
                     /protein_id="XP_567560.1"
                     /db_xref="GeneID:3254081"
                     /translation="MTSATGAIIYKAFAPTIKMMICITIGFVLTKKGIFAPANAKGVS
                     ILSLNVGLPALVFGSMISAFTSENIKAFGSLILIAILYMILGFICAWFVREFFFVPPD
                     FRYGILVMGTISNWGNLPTAVVQTLAKSAPFDPDTDVELGIAYIAVFILAMNVCLFPM
                     GLHKMCAWDFRQENLIKPRPPPVKERWGKRLRAIKGVFRKDKTAKKEDGVDDEKIEEV
                     TNGLPSPKTEIYTSKTSTDYDERGEEPSEMIQRARFISGADVVRKKSRASSFHSMMET
                     TRPIPPTAPLDASGIAEPCHAPSTTNPDQLLPVCSRQIEAYQYHHPVTPAPSVHKPSW
                     SQRLLKLAREFVMPLTVAIIMGIICSVIPPIKALFVTVDGWSGTRIPYAPDGNPPLSF
                     ITDTATFLGGMTIPAGLILLGASFGRLKMPKKWSDMPIGAIIAMMAFKMIIIPVFGVF
                     VVQAFRDDTGLYPKDDKMRTFVSILLAGTPAAVNQLVITQLYNPEGTADTLSSFLALQ
                     YVLMPILSTILAAVALYITEQV"
     gene            complement(783605..785644)
                     /locus_tag="CNJ02720"
                     /db_xref="GeneID:3254286"
     mRNA            complement(join(783605..784426,784474..784606,
                     784658..785152,785191..785644))
                     /locus_tag="CNJ02720"
                     /product="expressed protein"
                     /transcript_id="XM_567561.2"
                     /db_xref="GeneID:3254286"
     CDS             complement(join(783743..784426,784474..784606,
                     784658..785152,785191..785540))
                     /locus_tag="CNJ02720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567561.1"
                     /db_xref="GeneID:3254286"
                     /translation="MPPIVDLFSASSKPMPMVDSLPSQPLQFAATLRPIDLNAPSAAT
                     AKLPRPRRREEFIPKVFPTPPYTHSRHPSTASIQDNFNDLSLANKSATVGTDEWMQQK
                     VDKCLDDASGNLEITGLGLTTLSTKIADLRDLVTLPSTFSPSPRQSYQYPSPLRSVVR
                     QDEDLIRPVSTPTNASSMSRAISAPASSFAFNNLQSPRASTFTRARVIPATPEAAEHD
                     ENVSEVSTTAARDGALMASPVMGSATGKMVVSRRVSMGRTKSSFARLNTIMNAQVFLG
                     NNRLTCLPSALFEVSNITVLSLRGNNLKSIPAAIGALHNLKELNIGNNSITDLPWTIL
                     DLSLGLFTADPNPFLKQEADESWGPLVRHFDSPVRSLKDLCLSVLISPQKPNDLPPLL
                     DKYYWDPPRRGIPHPLLDASAMHELIPNIDEADLERVLQLLRSCSNHHLYSKRHNPSQ
                     SPETVDPFPRSHRASPSDDASTNPYYLACPSSRHLEVDGSSTLAPRRHLFVHPAEERI
                     QWTNVAGHRLPVRWMGCSPGCLALEYLGEEEDWEFDGGGDEEITL"
     gene            complement(785857..787429)
                     /locus_tag="CNJ02730"
                     /db_xref="GeneID:3254139"
     mRNA            complement(join(785857..785987,786050..786363,
                     786404..786497,786543..786619,786841..786910,
                     786967..787020,787062..787114,787169..787243,
                     787302..787327,787381..787429))
                     /locus_tag="CNJ02730"
                     /product="mRNA binding protein, putative"
                     /transcript_id="XM_567562.1"
                     /db_xref="GeneID:3254139"
     CDS             complement(join(785963..785987,786050..786363,
                     786404..786497,786543..786619,786841..786910,
                     786967..787020,787062..787114,787169..787243,
                     787302..787327,787381..787417))
                     /locus_tag="CNJ02730"
                     /codon_start=1
                     /product="mRNA binding protein, putative"
                     /protein_id="XP_567562.1"
                     /db_xref="GeneID:3254139"
                     /translation="MTSKVYLGRLPPGLQKADVEEHFKGFRIQDVRLMGTFGFVEFDS
                     PRDAEDAVHEFNGKPLLGESIVVEPTRESRRRDPYEQPRPRPSRRGVRINVSGFSSET
                     SWQDLKDYGRLGGNTIIYADVDKRNPGHGVIEYRNMEEAQEAIRRLAGVDINGAPVTL
                     EIAPADPEFDREFDRRPPPRDYDDRRAPRDYYDRPPPRDYHDRPPRRYDDRRGPRDYD
                     DRRAPRDRDYYEDRRAPRDYDRREDRYPPRDRSPRRDYPTRDDDRRRDDVPPPVGP"
     gene            787699..789621
                     /locus_tag="CNJ02740"
                     /db_xref="GeneID:3254067"
     mRNA            join(787699..787987,788036..788142,788210..788268,
                     788330..788362,788427..788799,788837..788883,
                     788924..789042,789104..789393,789446..789621)
                     /locus_tag="CNJ02740"
                     /product="vacuole protein, putative"
                     /transcript_id="XM_567563.2"
                     /db_xref="GeneID:3254067"
     CDS             join(787797..787987,788036..788142,788210..788268,
                     788330..788362,788427..788799,788837..788883,
                     788924..789042,789104..789393,789446..789561)
                     /locus_tag="CNJ02740"
                     /codon_start=1
                     /product="vacuole protein, putative"
                     /protein_id="XP_567563.2"
                     /db_xref="GeneID:3254067"
                     /translation="MVQTATEGGPFQSIPISNHAASSTMTENKPSKSPVSKTRLSSCS
                     RSRNGPETPDPLIQRKAALVVVFALSIWSFYVIVGRMCTPMIRNRSDSGLGRSVGAGA
                     LVGFVILWLLFLWSYIKMIATPPGYARDKVSKSSPPDPANYPQPYPINPNAIHPHPDQ
                     DQGPDPSTWAPTMNLATQTVGDWQPNASPAPFMGQAPPPEVKDKPKKGVKDWREVQRP
                     VPHVEYVPRWCRFCEIVKPDRTHHCRHCGTCVMQFDHHCLWIGQCVGWANHKFFIIFN
                     LWTALYCFYIMILLIIAEARSNSMDGQMIALIIVAAIFGLFAVTMLFTHIQLILSGRT
                     TVESFAARDQRERENAILQTEYGYFWHNLEKRKVRKKWKEEWGGSPVDGRWRYGTRMD
                     RWKQEMGIAPLGWILPIGSPQGNGLYFKSNPKFGPYGEWLKKEDWPAELLSV"
     gene            790074..792801
                     /locus_tag="CNJ02745"
                     /db_xref="GeneID:36393076"
     mRNA            join(790074..790170,790230..790286,790340..790459,
                     790512..790683,790734..790792,790847..791016,
                     791072..791302,791356..791388,791438..791551,
                     791608..791664,791721..791973,792023..792129,
                     792172..792302,792368..792801)
                     /locus_tag="CNJ02745"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658779.1"
                     /db_xref="GeneID:36393076"
     CDS             join(790140..790170,790230..790286,790340..790459,
                     790512..790683,790734..790792,790847..791016,
                     791072..791302,791356..791388,791438..791551,
                     791608..791664,791721..791973,792023..792129,
                     792172..792302,792368..792560)
                     /locus_tag="CNJ02745"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514458.1"
                     /db_xref="GeneID:36393076"
                     /translation="MPDENRTLMEDSADLGLSQDEFVRMLGDHPSLRRSVTRSECHSH
                     IAARLPLSCGSEEHEGQVSESNRRAIAISFTLCSMQSALQPVPNECLPWWQLSEPPVK
                     KPSRIMSVWSNTPPGESDRQALCLGAIHRSPQDWNSYNTFLSDATQLCHVLQGQQEIA
                     QARELYANATMEKIALLKYLKKKDQDRLQRELKLEEYIEHQSTELQATSRELKTASCK
                     MQLAIDQYELLSTALDQSIQSLATGRERLWENVQENIQYETTLAGQLFTKELHQLQDM
                     LSKKLTAQLGMITDQYGVALNAQAEAADSLVKSLQYQMQNYLSDLTTQQTAQMSTLQH
                     SWEILTYQTSRLVGDLQNLETGAKALQGVLEQSHDIAISTKISQELAATWLQAGVEQA
                     ERISTSLNETEGRMDLVLTSLEARQQQLDQSWRWSPSLFASPALISLGQGKSDFAAIS
                     CRGLLVVLDICWQVICYMVSATACLFVVSRAGMKKLFAPVLDQAVGDRLQDKERDIKV
                     EKPTGFSLSFPHTPERLPSYHSVYGSHISPTACPRHLPGDDHPIAGRARTIADEWVER
                     GRRSCTAPL"
     gene            793010..796619
                     /locus_tag="CNJ02750"
                     /db_xref="GeneID:3254320"
     mRNA            join(793010..793144,793197..793246,793303..793395,
                     793448..793464,793516..793599,793646..793759,
                     793809..793880,793931..794007,794082..794099,
                     794152..794256,794308..795251,795291..795516,
                     795565..795595,795646..795722,795783..796081,
                     796137..796152,796204..796308,796355..796425,
                     796481..796619)
                     /locus_tag="CNJ02750"
                     /product="MMS2, putative"
                     /transcript_id="XM_567564.1"
                     /db_xref="GeneID:3254320"
     CDS             join(793124..793144,793197..793246,793303..793395,
                     793448..793464,793516..793599,793646..793759,
                     793809..793880,793931..794007,794082..794099,
                     794152..794256,794308..795251,795291..795516,
                     795565..795595,795646..795722,795783..796081,
                     796137..796152,796204..796308,796355..796425,
                     796481..796493)
                     /locus_tag="CNJ02750"
                     /codon_start=1
                     /product="MMS2, putative"
                     /protein_id="XP_567564.1"
                     /db_xref="GeneID:3254320"
                     /translation="MADDPSRAVQDDSTATAILRQKRSPNRLVVDESPSDDNSVAILH
                     PNTMEALGLFRGDTIIVRGKRRRDTVLICLSQDDIEEGKVAMNKVARGNCAIKLGDLV
                     HVSAANDIKYGKRIHVLPFADSIEGLSGNLFDVYLRPYFLEAYRPVRKGDVFQVRGGM
                     RTVDFKVVEVDPSPYCIVASETVIHTEGDPLDREAEEATLNDVGYDDLGGCRKQLAQI
                     RELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVANETGAFFFLINGPEI
                     MSKMAGESESNLRKAFEEAEKNSPSIIFIDELDSIAPKREKANGEVERRVVSQLLTLM
                     DGLKARSNVVVMAATNRPNSIDPALRRFGRFDREVDIGIPDPTGRLEILRIHTKNMKL
                     SDDVDLEQIAADTHGYVGADMASLCSEAAMQQIREKMDLIDLDEDTIDAEVLDSLGVT
                     MENFRFALGVNNPSALRETVVEIPTTTWNDIGGLDKVKRELQETVQFPVEHPEKFLKY
                     GMSPSKGVLFYGPPGTGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFD
                     KARAAAPCVMFFDELDSIAKSRGNSAGDGGGSSDRVLNQILTEMDGMNAKKNVFIIGA
                     TNRPDQIDSALLRPGRLDQLIYIPLPDEESRLSILKATLRKSPIDPRVDLDFLAKNTA
                     GFSGADLTEICQRAAKLAIRASIDADIRKERERNEKAEAAGQDVELIDEENEEDEVPA
                     ITVEHFEEAMRYARRSVSDADIRRYEMFSTTLQQSRSFGSNFKFPESGQTDNAAAGAT
                     FQNEADDDDLYA"
     gene            complement(796585..797977)
                     /locus_tag="CNJ02760"
                     /db_xref="GeneID:3254347"
     mRNA            complement(join(796585..796931,796997..797054,
                     797116..797264,797327..797396,797464..797504,
                     797603..797780,797855..797977))
                     /locus_tag="CNJ02760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657989.1"
                     /db_xref="GeneID:3254347"
     CDS             complement(join(796665..796931,796997..797054,
                     797116..797264,797327..797396,797464..797504,
                     797603..797764))
                     /locus_tag="CNJ02760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513684.1"
                     /db_xref="GeneID:3254347"
                     /translation="MARPTIPAEFSKLPFEQLPFSSQVPVRSWATLQNIKPWPIEYSL
                     VFVVDRQNSQVLLGLKRRGMGVGLYNGFGGKPEPGESMLGCAVRELHEESGLVVNRFD
                     LHYKGILLTSRPDPGTQQEKSLLRIHIYACTSWSGDPETTEEMEPKWINISDLPLEKM
                     WPEARKYVPALMQSILQDRSNTEMLLARVDYEYLTSVQAPTSLPPLLGLSIKFENEDG
                     DDLPMERLSGWWMAFTTARMLSSVTGDSGI"
     gene            798071..799961
                     /locus_tag="CNJ02765"
                     /db_xref="GeneID:36393077"
     mRNA            join(798071..798325,798377..798410,798467..798505,
                     798564..798597,798672..798744,798809..798866,
                     798936..799065,799183..799276,799357..799737,
                     799794..799961)
                     /locus_tag="CNJ02765"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658780.1"
                     /db_xref="GeneID:36393077"
     CDS             join(798246..798325,798377..798410,798467..798505,
                     798564..798597,798672..798744,798809..798866,
                     798936..799065,799183..799276,799357..799606)
                     /locus_tag="CNJ02765"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514459.1"
                     /db_xref="GeneID:36393077"
                     /translation="MADFSAAFNSVPPVTRTILIGLGAVTFPCLLGLTSPASVALLWR
                     RVTQGYEIWRPLTCFFFGGGGFPLLYDFFLIYRNSSSMEKDTYLSNTAEYAWLHVVMA
                     IFILIFNMFVGLPFLFRPLLHAQTYVWCRVNPTVKVSIFGLLTIPTSLYPVALIVLDL
                     LTGGPLKAISGVMGLLAGHLWWFLSTYLPLYAPSHLRRQNPLATPSFFKSWFINNSSN
                     RRTFQSVGTSMQAQTSFATSSSRSEAAQEARHRWGGGQRLGGSTL"
     gene            800455..802373
                     /locus_tag="CNJ02770"
                     /db_xref="GeneID:3254189"
     mRNA            join(800455..801332,801389..801442,801491..801590,
                     801690..802373)
                     /locus_tag="CNJ02770"
                     /product="expressed protein"
                     /transcript_id="XM_567439.1"
                     /db_xref="GeneID:3254189"
     CDS             join(800793..801332,801389..801442,801491..801590,
                     801690..802162)
                     /locus_tag="CNJ02770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567439.1"
                     /db_xref="GeneID:3254189"
                     /translation="MMAAMALRATPSTPNILATEGNSIPTSSSSSFLSCHNSDLVSQT
                     TGSIAGSSSNRWNISHGLVGLFGQQDDTLNTASSVTTDMAVIAPASDLPLPPLHPVHQ
                     ISTNLHAHQSQTSLQASNGTNVSQLPEHKSAGEQPKVYCHSGSTTLHGNYSDDCFQCM
                     WSDSQQICHARMGTYNIFIKHLHLHIFKTIKKKAKDNNCSYKCQWFTCQAWEFNTPSA
                     LINHVRQNHLGIVARAPKFLLCQLPLSQPLPCPPICQSLDIPQYFLTAHPVQKSPFST
                     VYKNTQEIPILPDWDDTAPFLPVHNEPQPGYFLGFSGSIFPMSKLMGGQDWHERDSNG
                     HLITCKTSPGDPLIQVKKKIKGKLNKPKLTVSADIVAAYNKAARRRREKKTGMF"
     gene            805329..812711
                     /locus_tag="CNJ02780"
                     /pseudo
                     /db_xref="GeneID:3254170"
     gene            815197..826650
                     /locus_tag="CNJ02790"
                     /pseudo
                     /db_xref="GeneID:3254346"
     gene            840945..846488
                     /locus_tag="CNJ02800"
                     /pseudo
                     /db_xref="GeneID:3254192"
     gene            853329..860540
                     /locus_tag="CNJ02810"
                     /pseudo
                     /db_xref="GeneID:3254224"
     gene            862518..864290
                     /locus_tag="CNJ02820"
                     /pseudo
                     /db_xref="GeneID:3254205"
     gene            complement(864295..867339)
                     /locus_tag="CNJ02830"
                     /pseudo
                     /db_xref="GeneID:3254313"
     gene            complement(868686..874910)
                     /locus_tag="CNJ02840"
                     /pseudo
                     /db_xref="GeneID:3254167"
     gene            complement(875190..876755)
                     /locus_tag="CNJ02850"
                     /pseudo
                     /db_xref="GeneID:3254131"
     gene            complement(876761..881627)
                     /locus_tag="CNJ02860"
                     /pseudo
                     /db_xref="GeneID:36393078"
     gene            882157..884510
                     /locus_tag="CNJ02870"
                     /db_xref="GeneID:3254113"
     mRNA            join(882157..883109,883160..883369,883421..883608,
                     883658..884510)
                     /locus_tag="CNJ02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_567566.2"
                     /db_xref="GeneID:3254113"
     mRNA            join(882157..883109,883160..883369,883421..883608,
                     883667..884510)
                     /locus_tag="CNJ02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_567567.2"
                     /db_xref="GeneID:3254113"
     CDS             join(882405..883109,883160..883369,883421..883608,
                     883658..884177)
                     /locus_tag="CNJ02870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567566.1"
                     /db_xref="GeneID:3254113"
                     /translation="MKLAPNAVAAAAYLALCTSVVARVDFTRRGPDGALLTGPRYVFH
                     ARQDDSTDFVANATDVSATSFAEETPAANSAITAADSTITADSTIIAADSAITAASST
                     ITAANSTITSNSTSYDNSTDVGAGFNGADEEDCEEEDGSSLTASGSYSAVTSASTAAV
                     SPEEEEEDCEEEDEDEDGADSASASGASAAIAAATSVQAGSSSANPVVASQAASTTVL
                     GAVQAADATGSSESCDGASTVYATVTVTQTVTAGSDATSIAAATLAAAVTPASSANQA
                     SSTSAAADDGSNTTTGSSSSTDGDDDDEYPECEEDDEYEDNTSAAVASSPTTSAAAST
                     STGGSSAVTSGQDDEEEEDCEDYEEEEDDAVSSATFSQSSTAIYSATATDPAVAVQTD
                     SASDLTANASSSASESLSASETALPSLAQLMANTTATATDSISADATTFESTAQETAS
                     YSSFSESASVSEVIAPSAVSDYDSAAASESSSIYSSAAQESASPTPAVSSADDEQVAS
                     SSVSADDETPVTVTAEDASATAFRKRRITYWG"
     CDS             join(882405..883109,883160..883369,883421..883608,
                     883667..884177)
                     /locus_tag="CNJ02870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567567.1"
                     /db_xref="GeneID:3254113"
                     /translation="MKLAPNAVAAAAYLALCTSVVARVDFTRRGPDGALLTGPRYVFH
                     ARQDDSTDFVANATDVSATSFAEETPAANSAITAADSTITADSTIIAADSAITAASST
                     ITAANSTITSNSTSYDNSTDVGAGFNGADEEDCEEEDGSSLTASGSYSAVTSASTAAV
                     SPEEEEEDCEEEDEDEDGADSASASGASAAIAAATSVQAGSSSANPVVASQAASTTVL
                     GAVQAADATGSSESCDGASTVYATVTVTQTVTAGSDATSIAAATLAAAVTPASSANQA
                     SSTSAAADDGSNTTTGSSSSTDGDDDDEYPECEEDDEYEDNTSAAVASSPTTSAAAST
                     STGGSSAVTSGQDDEEEEDCEDYEEEEDDAVSSAQSSTAIYSATATDPAVAVQTDSAS
                     DLTANASSSASESLSASETALPSLAQLMANTTATATDSISADATTFESTAQETASYSS
                     FSESASVSEVIAPSAVSDYDSAAASESSSIYSSAAQESASPTPAVSSADDEQVASSSV
                     SADDETPVTVTAEDASATAFRKRRITYWG"
     gene            885180..886960
                     /locus_tag="CNJ02880"
                     /db_xref="GeneID:3254218"
     mRNA            join(885180..885612,885671..885715,885778..885805,
                     885882..885900,885972..886054,886141..886211,
                     886265..886303,886354..886405,886486..886611,
                     886690..886960)
                     /locus_tag="CNJ02880"
                     /product="Rho small monomeric GTPase, putative"
                     /transcript_id="XM_024657990.1"
                     /db_xref="GeneID:3254218"
     CDS             join(885598..885612,885671..885715,885778..885805,
                     885882..885900,885972..886054,886141..886211,
                     886265..886303,886354..886405,886486..886611,
                     886690..886829)
                     /locus_tag="CNJ02880"
                     /codon_start=1
                     /product="Rho small monomeric GTPase, putative"
                     /protein_id="XP_024513685.1"
                     /db_xref="GeneID:3254218"
                     /translation="MAPKPLNRKLVVLGDGACGKTSLLTVFTKGYFPTTYEPTVFENY
                     VEMIQVDDQVVELSLWDTAGQEDFDRLRSLSYADTHVVMICFSVDSPVSLENTESKWI
                     HEVNQFCPGVKVILIALKCDLREDPGVKERLGRRSLHPVTYDEGLATARAIRASRYLE
                     CSAKHNRGVQEAVYEAARVAVGSRARGGGSGGRRGDGWKEKCIIL"
     gene            887209..890418
                     /locus_tag="CNJ02890"
                     /db_xref="GeneID:3254180"
     mRNA            join(887209..887930,887982..888579,888625..888732,
                     888796..889330,889381..889444,889503..889618,
                     889668..889934,890015..890418)
                     /locus_tag="CNJ02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_567569.1"
                     /db_xref="GeneID:3254180"
     CDS             join(887254..887930,887982..888579,888625..888732,
                     888796..889330,889381..889444,889503..889618,
                     889668..889934,890015..890244)
                     /locus_tag="CNJ02890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567569.1"
                     /db_xref="GeneID:3254180"
                     /translation="MPPTALPPLRPPAQPYDSYSSSLSPSSPRFHPASAPHGRRAPSP
                     SRLESLLDAPHAPARSPSRKIRSALSRHIRPHLTPRTLTPLLLWTLALWLVHHFLFPF
                     SSPLAALSRPKAEQHFLSTTFPPPPQRLGDDRLDSVDPRWRAFHPLPPPEPPFPRLRP
                     TRFLPPQCLEQWFADGETLCGAKEMGEEETLDATWLWVNGSDHRWRDSMAEWREKENV
                     NSPERHFREQNELVHSMRSVLDALPGHLRTFHLILADYPFNYPEDLDLVPPSIIPDLE
                     VAASKGGQGRRHPRELARAPASVSNLTERLTPESISPSLARHLQSEWRILQTPTWLDF
                     SRRDPSDPSHPFHPYSVSKAGEMRQHYAEASYPTLRYASHWEVFHIPSVDRDGREELM
                     GEREWRENEWKKKALPSFNSMAIESRIGWLPGLADAIIALNDDFFLLRPHAVSDFHSP
                     LYGSVIRFEHSYNQQVKPDVEKNHINDPGEMGGLYHANALLSRRFPHRLRPYFAHVPK
                     VITRGLHHEASLMFQEALTLSSTRKFREMKIGEGDVQMQWLLTSLRVERWREALLWTW
                     VVANMGTLSGSHDRWDSDTRSAIKHLFGFTEDDDDVVKIEVHRGERWTLEPGRMQKVF
                     HQAGWEAPKATEFLFSSMDGIMPPLLRSGEDPSQNDRCIIDLNRCFGVFWTRQEDVLS
                     ADMMKRLTFQYPECGDCMIMALVTASGTLGLNAFFPPKETTITAPELGPGDAYPKYLP
                     PPHLPLTPTWHEADYSLSNILSTTALPGEQVDIRQYCMRLLSRYLYLDAKSVSHFHMM
                     KSAEHAKRVFKMIQDNPKVSILGMNDDIESDYDEVKRLMNEWFEMRWPRKAVWERDWD
                     PVKDRYHD"
     gene            complement(890373..892240)
                     /locus_tag="CNJ02900"
                     /db_xref="GeneID:3254277"
     mRNA            complement(join(890373..890659,890714..890961,
                     891016..891145,891198..891400,891465..891622,
                     891688..892240))
                     /locus_tag="CNJ02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_567570.2"
                     /db_xref="GeneID:3254277"
     CDS             complement(join(890640..890659,890714..890961,
                     891016..891145,891198..891400,891465..891622,
                     891688..892134))
                     /locus_tag="CNJ02900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567570.1"
                     /db_xref="GeneID:3254277"
                     /translation="MFANSLPLITALLPLLTLTTQAAAAHSNQPPHLRHRRVLHHRRD
                     IENKHPHVAMAQLPPRSNAGHADAKKLIKKSVKKRGQTCRTRGSSYSTSASYGDAAAV
                     QTLSSSSDGEPASSSAAWSDDSSSSSYVAAATPVAATLSNEQAWAPQVTSSSDDWSES
                     TTADSWSSSATSSSAWTQPTTSSGSDSSSGSSSSGLLTITDATCGYSNSDSDSPNGSE
                     DWLNCGLDGAGWTPPTVTVDELIAAELTTDGVFSPCADYVDLFNQYAEQYGLKGIMLA
                     SFAMQESTCNPSATGGNGEAGLMQLASENCSGAPNGDCYDVDFNIQRAAELFSGLISS
                     NGGNVLLAIGSYNGWYSGLTYAAGTAAASLGQCSAQNNLDYIHQFCNGWMQNKSGYTL
                     GTYFNLASC"
     gene            complement(892960..900280)
                     /locus_tag="CNJ02910"
                     /db_xref="GeneID:3254345"
     mRNA            complement(join(892960..893511,893565..893681,
                     893736..894046,894104..896337,896384..897456,
                     897505..897790,897838..899430,899485..899890,
                     899939..900068,900122..900280))
                     /locus_tag="CNJ02910"
                     /product="glutamate synthase (NADH), putative"
                     /transcript_id="XM_024657991.1"
                     /db_xref="GeneID:3254345"
     CDS             complement(join(893227..893511,893565..893681,
                     893736..894046,894104..896337,896384..897456,
                     897505..897790,897838..899430,899485..899890,
                     899939..900041))
                     /locus_tag="CNJ02910"
                     /codon_start=1
                     /product="glutamate synthase (NADH), putative"
                     /protein_id="XP_024513686.1"
                     /db_xref="GeneID:3254345"
                     /translation="MCGVGFICHIKGHAAHKIVSDARNILCNMTHRGATGADARDGDG
                     AGVMTGIPHDFFVREASFCFDAKLPGEGHYAVGNVFFSTDDYAQQQGTFESIAKSLGL
                     RVLGWREVPTDNSILGPASKSKEPKILQPFVVLEEHYGPGQDSQDGNFDERKFERELY
                     ILRKQATHKIGLKNGFYVCSLTTSNIVYKGQLSPIQVYNYYHDLNHALYASHFALVHS
                     RFSTNTFPSWDRAQPMRWAAHNGEINTVRGNKNWMRAREGNLRSDRFGDDLELLYPIV
                     ESGGSDSAAFDNVLELLVVNGVMTLPEAVMMLIPEAWQNNDLMEPEKKAFYAWAGSLM
                     EPWDGPALFTFSDGRYCGANLDRNGLRPCRFVVTSDDIMVCASEVGTITIEPEKIIQK
                     GRLKPGRMLLVDTKEGRIVDDRELKLTTAKRQPFAAWVESQVLRLPEVVRRVQRFENI
                     DVSLDEVPLSTDPKLLAFGYTIEQLNMLMLPMVHEGHEALGSMGNDAALACMSTTPRT
                     VYDYFRQLFAQVTNPPIDPIRESIVMSLETMVGNEGNLLEIKPSQLHRLHLKSPILTI
                     QEMNSVKHMKLANSGWPSITIDITFDKREGLPGYRNALDRVRQEVINAVDAGFKSVIL
                     SDRATSPDRVPLSAILAVGGAHHFLVKERKRSKVALMVETGEAREVHHMCVLIGYGAD
                     AICPWLIMEMIYKVGREGLVKESQSVEKLVANYMKATDEGILKVLSKMGVSTLASYKG
                     AQLFEILGLHEEVVGDCFVGTASRVQGATYELLAMDAFEFHERAWPTRDAVMVPGMPE
                     SGEYHYRQGSEMRVNDPVSIAQLQDAVRQKNQAAYDTYSKNSRESIKRGTLRGLLEFN
                     FENATPVPIEQVEPWNEIVRRCVTGAMSYGSISMEAHTALALAMNRLGGKSNTGEGGE
                     DAERSIPIPGPGAELNGQPFTHAMELKPVWDSRRSAIKQVASGRFGVTSNYLADSDEL
                     QIKMAQGAKPGEGGELPGHKVSASIGRTRHSTPGVTLVSPPPHHDIYSIEDLKQLIYD
                     LKAANPRARVSVKLVSEVGVGIVASGVVKAKADHITISGHDGGTGAAKWTSIKYAGLP
                     WELGLAETHQTLVLNNLRGRVTVQTDGQIRTGRDIAIATLLGAEEWGFATTPLIAMGC
                     IMMKACHKNTCPVGIATQDPALRAKFAGQPEQVINFFYYVIEELRQIMAKLGFRTINE
                     MVGRADMLTVDDSLRTPKTAHLDLSHILKPAQLLRNDVATYRVRAQDHKLYVRLDNKF
                     IDEAEPALQKGLPVTIDCDVVNTDRALGTTLSYHVSKRYGEEGLPRDTIHINMKGSAG
                     QSLGAFLAPGITIELEGDANDYVGKGLSGGRLVVYPPKSSPFKAEENIIIGNVCFFGA
                     TSGQAFVRGIAAERFAVRNSGATLVVEGTGDHGCEYMTGGRVVVLGLTGRNFAAGMSG
                     GIAYVLDMAHSFAPKVNMSTIELGPVSDPQEVAELRSLIEDHRHYTGSEIADRVLRNF
                     HHLLPMFVRVMPLDYKRVIEQEAQRAAEEKKRQSVIDLIPSQTASQVDLVATGYDPVL
                     PRDANALTVSTSALISPEGSPKHKPQEPQIVDVEDAMVDETATKERLAKVDKVRGFMK
                     YKRLNEAYRPPRKRVKDWKEISTRLKPSELKYQSARCMDCGIPFCQSDTGCPIANVIP
                     KWNTMIFEGRWLDALNRLLKTNNFPEFTGRVCPAPCESACVLGINEAPVGIKSIECAI
                     IDKGFEMGWMTPNPPEHRTGKRVAVIGSGPAGLAAADQLNKAGHIVTVYERQDRVGGL
                     LMYGIPNMKLDKGVVQRRVDLMAAEGVTFITNAHVGVDSQYDPLNIKAENDAVIVATG
                     ATWPRDLKLPHREVDGIHFAMDFLTPNTKVKAFGDDAPGFISAQGKDVIVIGGGDTGN
                     DCIGTSMRHGAKSIVNFELLPEPPKSRAPDNPWPMFNRSFRTDYGHAEVQAHFGHDPR
                     KYCMATKKFVLDDEGKLKGLDTVQVEWTKQNGQWKMEEAVGSEKFYPAQLVLLALGFL
                     GPQQECLKALGVETDPRTNIKTAPNSYSTNVPGVFAAGDCHRGQSLVVWGIREGRQAA
                     AEVDTFLMGSTHLAWQGGIEKRQYVVPSISKPLHGLDEKAGDIETSSQGVDLESASVT
                     ASA"
     gene            complement(902115..903484)
                     /locus_tag="CNJ02915"
                     /db_xref="GeneID:36393079"
     mRNA            complement(join(902115..902475,902550..902625,
                     902678..902769,902835..902888,902948..903099,
                     903203..903484))
                     /locus_tag="CNJ02915"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658781.1"
                     /db_xref="GeneID:36393079"
     CDS             complement(join(902357..902475,902550..902625,
                     902678..902769,902835..902888,902948..903099,
                     903203..903330))
                     /locus_tag="CNJ02915"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514460.1"
                     /db_xref="GeneID:36393079"
                     /translation="MASQPVTFPSQPRREMAPTPLRSHKSASGFEYPAMWSFPPFFTL
                     QPNPQTLAHQLQLWRRLVLDWSRHERVFEMNTDSTGKDVLEVFENRTINRRLLPPSLK
                     TLMGEMVKNGEAAANPPKQDSQYLIYWRKPEEWGDIIYHWVMDNGLNSSIMTFYEITD
                     GDLSHTTEFHELPISILRKALETLVKRGRAQIIEGKDEIGEGVRFL"
     gene            complement(903633..907987)
                     /locus_tag="CNJ02920"
                     /db_xref="GeneID:3254251"
     mRNA            complement(join(903633..905176,905816..906291,
                     906345..906935,906982..907393,907645..907987))
                     /locus_tag="CNJ02920"
                     /product="gata factor srep, putative"
                     /transcript_id="XM_024657992.1"
                     /db_xref="GeneID:3254251"
     CDS             complement(join(903782..905176,905816..906291,
                     906345..906935,906982..907387))
                     /locus_tag="CNJ02920"
                     /codon_start=1
                     /product="gata factor srep, putative"
                     /protein_id="XP_024513687.1"
                     /db_xref="GeneID:3254251"
                     /translation="MPETHTSAPQDNEHEPSIGSRFENRFGPGWRVGFDNSNERGGVD
                     EDAAEDSPPPRRESLDTSDKEVEAAEMETPNVERDELESDYGEPVQQQGHVDSEEELD
                     QKELIRRAAARRRHQNKKEEQGSDGQPSAKKRKPLAPANASPLPSPPPSTAVTASAHP
                     SAGTCPGDGRCNGAGGKAGCEGCPTYNNSIASGLVSASNSHAASHPPNVSEGIERPVR
                     NIYDREHRPYGFDRFMENSMGNGLAPRALPRQSPDQRQAHPSPVTTQPLMHPTSEKGT
                     PTRFSPDSDVETPAAPGGNGSGLAATPVGMSCRNCGTSTTPLWRRDEEGRPQCNACGL
                     YHKLHGVPRPVAMKKTVIKRRKRVPAVGSTSTGGRGTNAELPSPASTPVSVPTVTAPP
                     PHVAPPLDDKAHRTSPPFGHRASQPHSEHRINHSLGPEAYGLAGRYGKPSTPAGMNLP
                     SSASTSSLNLPERKKPWWQEGREGRDREKEEKDREAREREGLAAEALLTMAPAANGGP
                     SPEKRAEKSSGAGSVPASQSRRTSIDVDMADSEPRGIKRKNEEESRDIRDPRASMSLG
                     LHSMDRDRNRSKDRTFSHSPLISTDPRSVQPSNSHLPSSRLGQPPTSSASPYPATTQQ
                     GAPNRYSVYGPTTRDPLAGSSPYSFNASRYSNLHMRRDLSPSVGGATSKPNVLSPPRR
                     ASPAPAPDPRERFYPSPSAAASAGSAPASVNAAMAGYGHYSMSRRELQEHREQLKEGK
                     RWLEAMMAKTDKMLHMVENKMALTVEMSSGPSVAGPGDRPSLSSNASPVPPPGAVHKM
                     SDDWEFEERERQRQKEIQRLEQEREMDRAEREKRERERERERPGSYEDVRGRPRDKSE
                     AERNRDILLASRRVSAVSPNPATRAAAASRESAASSNGSAPQQGEKSHGGTNGVSGGK
                     REGSQWDGEPVMSGVPLPRREQQNGIGSRLGRGLWSFDVRS"
     gene            909953..910034
                     /locus_tag="CNJ02930"
                     /db_xref="GeneID:3254035"
     tRNA            909953..910034
                     /locus_tag="CNJ02930"
                     /product="tRNA-His"
                     /db_xref="GeneID:3254035"
     gene            complement(911993..914909)
                     /locus_tag="CNJ02935"
                     /db_xref="GeneID:36393080"
     mRNA            complement(join(911993..913750,913808..913898,
                     913951..914204,914264..914909))
                     /locus_tag="CNJ02935"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658782.1"
                     /db_xref="GeneID:36393080"
     CDS             complement(join(912114..913750,913808..913898,
                     913951..914204,914264..914744))
                     /locus_tag="CNJ02935"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514461.1"
                     /db_xref="GeneID:36393080"
                     /translation="MSSNPPILSIPPQLSSPASHIRHYLSSIRPHAAEHARAGITHFQ
                     RALEAGSSKTLSSKGSEGKEPIMFGKRRDSNDQDSDWVTTRQEIMERRNNTRKDINKA
                     PVLISNDRSQLKTIQSNIFKMPLAAVKEINGFPSKERPQRSTKENGDETKDAETESAQ
                     RRLERKLRRRERAAIGKPKLPTPLRSTIKSKRKIKASSIDGSKEESEGSLVLGKGKKK
                     GKKYRTMPEIVKTYQAKNVQALGGRITAKPVQKQGFLGHGKASLPIRLPSEKARMAPP
                     RVFSEDQFLGSHGASLDPTMDKEVWSQWKIRAPQPGPTLRSQSKGKQPQQQLITSPRL
                     VPSRSLPSQRSPTRASSIRSIMPSNHRQEVGSGSRFSNGRLPPPGRTNSSSWHTEITE
                     ERSYKKQQHSTGLDKKTIVSIQSEGKVIPDQAIISIHSDPKLKPTPTVDEGEPTAFVG
                     SISDTAPFLGGSNGLASTRGVPWKESTPSFGRPNHVGDLSFCQTRVQGVDNSQAIGCF
                     RRSQNNFPLVSFLSNGANPNTERFHDPRQFQFSSAPVFQSMDNSMGVRRVPTENELQL
                     HSDTLQQQTESLTGQQPYHIQTADDMAFHADGPSVSTMSQLPVSISFQMPRYNQSQAA
                     RRNNSPCEDDGNKDSESLRFHSFFQQQANKENLQAPLGAYQEKQRISLSKYHSAYHTH
                     QANFMPLHEWQPQAMPSYEPPIPLYQDSMDDDSRVFQAPFHWAFNPVELQRQTNIRSK
                     RPQPVPSTINNNLDLNVLNASHGEPVNTVDDHYLSFDQFDQSSFVEQGMWQERPNGGV
                     EEQVGVTEEDWHRLWGQRAYRR"
     gene            915298..917971
                     /locus_tag="CNJ02940"
                     /db_xref="GeneID:3254109"
     mRNA            join(915298..915527,915630..915784,915840..916156,
                     916210..916294,916347..916448,916508..916759,
                     916815..916947,917028..917095,917165..917388,
                     917470..917971)
                     /locus_tag="CNJ02940"
                     /product="histone deacetylase, putative"
                     /transcript_id="XM_567573.1"
                     /db_xref="GeneID:3254109"
     CDS             join(915359..915527,915630..915784,915840..916156,
                     916210..916294,916347..916448,916508..916759,
                     916815..916947,917028..917095,917165..917388,
                     917470..917755)
                     /locus_tag="CNJ02940"
                     /codon_start=1
                     /product="histone deacetylase, putative"
                     /protein_id="XP_567573.1"
                     /db_xref="GeneID:3254109"
                     /translation="MSQPDLSQYSLSEEVPLPPAQEIRPGDTYQIDSEEYDSDQERDN
                     LSDGEYDKLVEEAENGYTDEEMDQYTRQLKENGIVNFLRSYLTLTEDGEMRSLRKLLL
                     GFGLVPPLSLRSPEIPDIQLLPFAKVALSRILRRRERLRDISSLDDAVSLLAKSKKII
                     VLSGAGISTSCGIPDFRSSTGLYAQLQEEGKYELDDPQQMFDIRYFREKPEVFYSFAK
                     QIYPSNFVPSPCHRWIKMLEDRGVLLRNYTQNIDTLESLAGVERVLQCHGSFKTASCL
                     RCKQRVPGRTIEPYIMSQQIPYCGTCREICAAEREARRAYREKLKKLKARTKGKGKAD
                     EWDDGDDDDDDESADEWGGGEPGIIKPDITFFGQALDSEFDECLFKDREEVDLLVVIG
                     TSLKVAPVSEVLTHIPHSVPQIFINLTPVYHVQPDVSLLGDADSIVTYLSSRLGWPIP
                     PPTVLPTPPSAVGEGKSEDTAPAGQKDEIKVERATHVVIPPEEAQWLTVDEERHFHLL
                     RRKGDPAIQAETTVVPPVVPSSPKPEHSPQPRPQYTDDSAKQPSSPPPVPMHVGEAEE
                     GYVSDEEDEADEPPRKRSKVVDSLLGNASW"
     gene            complement(918075..920513)
                     /locus_tag="CNJ02950"
                     /db_xref="GeneID:3254050"
     mRNA            complement(join(918075..919504,919553..919645,
                     919704..919908,919961..920051,920100..920155,
                     920206..920513))
                     /locus_tag="CNJ02950"
                     /product="vacuole protein, putative"
                     /transcript_id="XM_567574.2"
                     /db_xref="GeneID:3254050"
     CDS             complement(join(918285..919504,919553..919645,
                     919704..919908,919961..920051,920100..920155,
                     920206..920253))
                     /locus_tag="CNJ02950"
                     /codon_start=1
                     /product="vacuole protein, putative"
                     /protein_id="XP_567574.1"
                     /db_xref="GeneID:3254050"
                     /translation="MCCEADWKREVVPDHKFDFINVKEFHKGDIWTRIKYILRYVFLL
                     KSVAVYALDIFTAVTMVSSDHWTNAITSKCDSDCVVDVQFKIAKWVFVGCIIFSFLLL
                     GYETYKAKKVIDSRDISYAFTNLLANDYYSFRSYDNFCLFCQIESSSKKKDDLAFFIF
                     FTFKGWKRLLLADGPRQSINAILLYSFAAANNFQTSDIPAYWDNSLVTALLLFSMIFT
                     VLVFAGSLLLLIVAAVTYIPLLCYIQGNLKEYVCHKIDKRIAELIKKKQRQRIARAAA
                     IDKKRAMAGGVAGASMGRRTSKDGSDLDDYGYGRTPQPTLPQVSLDDDDYQDDIKLRA
                     KIKAEKAGMNFPSSTPGPNEYPPAPPAMGGEYGVYQDYGSSTNLVGNAAPLGISYPPS
                     VVTPGPSGGPVPSHSNSMSSLPSLPSYSSVNVNAEIRQQQAPPPLPHSSSLRSINRYN
                     PGGQGQPSGRLSPYDRHDQYDSYDSYTQDYFSHPLTVQPPLPSASQPQPQLYSTSSSS
                     TSQPYTVSSYQLPSQPRVGNEQGSMMAGGYQGYIPSPTPGYTTRDQYLYDTGSSAYGG
                     YGGR"
     gene            complement(920666..923314)
                     /locus_tag="CNJ02960"
                     /db_xref="GeneID:3254244"
     mRNA            complement(join(920666..920798,920896..921015,
                     921060..921315,921382..921995,922051..923022,
                     923102..923314))
                     /locus_tag="CNJ02960"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657993.1"
                     /db_xref="GeneID:3254244"
     CDS             complement(join(920686..920798,920896..921015,
                     921060..921315,921382..921995,922051..923022,
                     923102..923243))
                     /locus_tag="CNJ02960"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513688.1"
                     /db_xref="GeneID:3254244"
                     /translation="MSKLPGVKHKVIGLVSGGKDSCFNLMHCVANGHEIVALATLTPE
                     PGIDELDSHLYQSVGTHLLPLLAESMSLPLYTKVIRGKAISQGAEYGSRLRLGAGTGQ
                     KGDETEDLTCLLSDVLEAHPEATALSSGAILSTYQRLRIEHVCGRLGLTSLSFLWQSE
                     QSRLLDRMLGSGVEAVIMKVAGVGLGVGVVGKQLGQIRPLLAKLEAQYGSHPAGEGGE
                     YETLTLSTPLFSHRLKLVKTETVVTDPEPYTVAYLKVEEAVLEPKEGWVKPTVEELRG
                     MLGLDEEGEEQVGVEGLDEEGKERLEELGEREMEDVRKEGGGVELVEWSAGGVGVGGG
                     EVQFVKKKRWFTASVQGVSLSSEDVGQELEKCFKAISSKLQSENLSLPLHSTHITLLL
                     SSMSLFLPANEKYKTYFGTSPPSRATVAVPLSSGRVRVEVIGFDDTPLPTPSSSDGEG
                     RGSIGNRSALHVQGLSYWAPANIGPYSQAVLVASRLHLAGQIPLIPASLTLPLAPALP
                     KSPYPHQATLALQHVGRIVQALKSRNATGGGWEGWVEGAVGWWAKSGDGESGEGVQVT
                     RDAWRIWTRRNGGERAPIAFVQAKELPKGALVEYQVNLHTGRRDYTTQAAKEDEGDDE
                     EELEPVYESGKGQGVWWESCHTSGKVQRGSRGLVFVKNVDAFASLSQHRESDRKLGCL
                     LSKAVSIRVYHLAHLDPARLSSVVPSLGGVCTLVPVFSVHDRDGESVQVALEVFGE"
     gene            924333..927480
                     /locus_tag="CNJ02970"
                     /db_xref="GeneID:3254104"
     mRNA            join(924333..924800,924871..925072,925131..925206,
                     925255..925310,925375..925489,925553..925636,
                     925713..925921,925989..925999,926053..926155,
                     926261..926401,926495..926685,926807..926933,
                     927020..927480)
                     /locus_tag="CNJ02970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567576.2"
                     /db_xref="GeneID:3254104"
     CDS             join(924413..924800,924871..925072,925131..925206,
                     925255..925310,925375..925489,925553..925636,
                     925713..925921,925989..925999,926053..926155,
                     926261..926401,926495..926685,926807..926933,
                     927020..927239)
                     /locus_tag="CNJ02970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567576.1"
                     /db_xref="GeneID:3254104"
                     /translation="MRWFNIFPLLLPFVADASPLQPPRQATSSAGSVAQSASIAALSA
                     ESSVPAAASSAVQSSANSAASASNTPSTSGGHETILSRHNNVENAAPPTVSIYPDTSD
                     GKPITLTGTRMPDVGQDVYLGIPFARPPVGDLRFSPPQSYIYNSSTFQATTPPPACMQ
                     DNSTNNLTISEDCLYLNVYAPAGSNATNNWLPVMVWVYGGSFTGGSNNMYPGTAILNY
                     AQHTDKPFIYVALNYRLGAFGWGTGSGFAENHAANLGLKDIIKGLTWVQENIWAFGGN
                     PEKVTVFGESAGAISISLLFLNQSTTLFSGAIMESGAQSTVPLGPTNTTWESAYVSLL
                     DVTNCTTPSEKNVTQFQCLKEMPAQNLLKGQLTVQSQAQFSAGFIFGPTIDGKLIPGS
                     PHTLISEGHFAKKPFITGNNKDEGTNFVPTTINSTLYGLGIIALGEPVDPTKETLEKV
                     LALYPNVPSLGSPFDTGNETFGLDPSFKQFAAIYGDAQFQAPRRFFLRESNKHGNTQT
                     WTYLFEQYTPGAPPYLGSHHGSEVIYVLGGARPGLSGKTGSSANYTEADARLSDTIMN
                     YWLNFAYYHNPNGECGCRDPYSNETYWPRHDVTSYSKNMLSLKSGNVTVIEDNYRETQ
                     ISFFTENANAKQFNAR"
     gene            complement(927522..930818)
                     /locus_tag="CNJ02980"
                     /db_xref="GeneID:3254360"
     mRNA            complement(join(927522..928486,928546..930121,
                     930188..930327,930393..930818))
                     /locus_tag="CNJ02980"
                     /product="expressed protein"
                     /transcript_id="XM_024657994.1"
                     /db_xref="GeneID:3254360"
     CDS             complement(join(927779..928486,928546..930121,
                     930188..930327,930393..930590))
                     /locus_tag="CNJ02980"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513689.1"
                     /db_xref="GeneID:3254360"
                     /translation="MSSLSNISDNVPTQIPITEQTSLSGTDTSLNNVPCITLERPQKG
                     LDGQKSDDNEARAESKGAQGGESLGNALSTDYSQHKPGVHHDSTGRVKAQDANTAPKH
                     DTHLAKENSFPTLHPAPFNPSPFQHHTNPFVFVPPLPYLGALGQIALPPSGSYPQRPL
                     TAGGSSELMWNHQFNNGHPYQDQGHSHFEGPDSLKRPYSAPSEGNLKRANKKMRGVDE
                     ASGGYSSGADRVHGYLAREFDPSILKEHPENGAEHITKSNYFHPALGKAKGTQTSARN
                     NIQDPSDIAVPAVAKIPANDGISTATTCRPNRHSFNTWFQYMPSGHILANKHTTPHGP
                     NDSGSIAKAVIAGRSFDIRHPPVLRSTANSHIAMPTSDDSYTANSSDYAGMSLVTPSI
                     RNLIYQPDPSMHLNKDTGSGSPSQAYGYPPLYTQHLPPWLNTPGSTQQFAFGSRLGTS
                     PTPGQDVLDNELFNAKERPQTVPASSNLMPFGSSSSTNLPSAFDRRMSFPFISQPPIS
                     PYLDADAQQLPLLLRSLDTSVATTTTISATAPASVLEDNDDGHPLSSRTIHPTSWITD
                     DLYQFTSQGQKKTDLTRNPEKKTKAETSTFCSCPVMHAPKAGEIGGGKYHMCSTRVSA
                     KRAKVQGHTMCSYCIGRDGHVEEYVSDRMTAGNPDKLCLLYIMYREAKDKNSSKPGDN
                     NRWQKFWELHRGELVNEAQAEALLKKYKDNPVKHGEGTDTSGSSAEPEFPPDRSTVSS
                     LHPSSASTARTTTTTTTLSSVMPFKSTHYIVDENNKLGQQTLVGDNYIGGLVEEYNVD
                     VDEPARVEKTLGGHSLLKGDMEEYEGLSREGRFSLTPDSLYSPGGDDTSSDEGWGADD
                     SLFEPRYGGSLLICEQL"
     gene            complement(930857..932476)
                     /locus_tag="CNJ02985"
                     /db_xref="GeneID:36393081"
     mRNA            complement(join(930857..931316,931374..931500,
                     931643..931772,931835..931933,931981..932476))
                     /locus_tag="CNJ02985"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658783.1"
                     /db_xref="GeneID:36393081"
     mRNA            complement(join(931343..931500,931643..931772,
                     931835..931933,931981..932476))
                     /locus_tag="CNJ02985"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658784.1"
                     /db_xref="GeneID:36393081"
     CDS             complement(join(931455..931500,931643..931772,
                     931835..931933,931981..932257))
                     /locus_tag="CNJ02985"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514462.1"
                     /db_xref="GeneID:36393081"
                     /translation="MVYSTREGGYVKRGAEWSTGQEDEVPRGAMASGGGLDGGKGKVW
                     YLVSSPIGCFGDPTHTRAGHGERRAWVKQVVIETFSKDQGWSNYAQHYGTYNSSYSWF
                     EVSLLRGDKEVPGSRHIVQHNVHAGQYCKYHTNTLTIEHPALQLAQQGDRIVLWVRAL
                     YPGWSNWIREGAITVFSAPFPQA"
     CDS             complement(join(931455..931500,931643..931772,
                     931835..931933,931981..932257))
                     /locus_tag="CNJ02985"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514463.1"
                     /db_xref="GeneID:36393081"
                     /translation="MVYSTREGGYVKRGAEWSTGQEDEVPRGAMASGGGLDGGKGKVW
                     YLVSSPIGCFGDPTHTRAGHGERRAWVKQVVIETFSKDQGWSNYAQHYGTYNSSYSWF
                     EVSLLRGDKEVPGSRHIVQHNVHAGQYCKYHTNTLTIEHPALQLAQQGDRIVLWVRAL
                     YPGWSNWIREGAITVFSAPFPQA"
     gene            932592..934331
                     /locus_tag="CNJ02990"
                     /db_xref="GeneID:3254249"
     mRNA            join(932592..932689,932737..932766,932838..933017,
                     933067..933151,933212..933218,933273..933350,
                     933400..933457,933512..933821,933903..934331)
                     /locus_tag="CNJ02990"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_567578.2"
                     /db_xref="GeneID:3254249"
     CDS             join(932659..932689,932737..932766,932838..933017,
                     933067..933151,933212..933218,933273..933350,
                     933400..933457,933512..933821,933903..934143)
                     /locus_tag="CNJ02990"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_567578.1"
                     /db_xref="GeneID:3254249"
                     /translation="MSDSAGLYDISKPRFDLGTYGGRLAYFYSTTSPLTLLASSAKLQ
                     QAQRDVTRFESQIKENGKAGTWVTREQKAAYDHAKQLVNSSIHPDTGRPVPLPFRMSA
                     FVPTNLIICAGMLMPNPSLKSIIFWQWANQTLNVAVNFSNANKSIEMTPQEIGTAYVA
                     ATFTSVVLAVSLTRLVPRLRVSPTTKDLLAKLVPFASVASAGVVNISCIRWKEMRDGV
                     EVFKVTHDPVEGYEQKQDLGKSAKAGQMAVMQSAASRVLTNIPILIIPPMVMTLLTNK
                     GAFSGPRGKLASSLTQLTLIGLSLGVFLPPAIAYFPQRASTSPAKLENRFKAYEGPIY
                     FNKGL"
     gene            complement(934323..936199)
                     /locus_tag="CNJ03000"
                     /db_xref="GeneID:3254056"
     mRNA            complement(join(934323..934580,934672..935430,
                     935496..935951,936001..936199))
                     /locus_tag="CNJ03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_567579.1"
                     /db_xref="GeneID:3254056"
     CDS             complement(join(934476..934580,934672..935430,
                     935496..935951,936001..936174))
                     /locus_tag="CNJ03000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567579.1"
                     /db_xref="GeneID:3254056"
                     /translation="MCHESPTSQFMGGMVTTLGTVFIFYHIWAYDKGKCLFFTRRSAF
                     RWVIVWMFILSMILFEVWNVILIYVKYKEWYMEVSTTETHTEIVPVPFTLWSDSRQQL
                     VRNAYQLLAIAWVLVLSIHSEETLYWAYLIGAIRGKDTGTWYKSPHFKIWVFVCLLCA
                     GVMPGVANIETDDLTKMEDNIFLAGSISAFILFIGSVWLLIVFPRFIKESRRQGANQD
                     VLARLQYFKELNIVRTLFRFLYCVAIFTLAIDGRTASKHVNSHPFWLDLFYICGLFSV
                     FASNSLSLMILLPRNMAHEAGYVPANQVFVRQTRRCLPLHNIPHTGGKAQLFGTSTVN
                     SSAGGKFAPYSSSSSSPSSEGVKQGTRLDRMVYSSSPLRDNGSRRGSKPWDVLGERLN
                     LDATDIEDIEVGIAMDADPRRVQREREEEERKVGETSKLSQMTTDSDKPFARTKGERL
                     LTEGEMVNEPTSLLDHFRSPADFANPPRPRDLNILIVTDTVEVEEKS"
     gene            934591..936914
                     /locus_tag="CNJ03005"
                     /db_xref="GeneID:36393082"
     mRNA            join(934591..935443,935521..935804,935854..936273,
                     936320..936914)
                     /locus_tag="CNJ03005"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658785.1"
                     /db_xref="GeneID:36393082"
     CDS             join(935179..935443,935521..935804,935854..935925)
                     /locus_tag="CNJ03005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514464.1"
                     /db_xref="GeneID:36393082"
                     /translation="MCHVSRKEDHERERVGRKDGKKTADVKQVKPEWVRVDVLGCRAA
                     VNGEGEDGDTVQESEEGADDVEFFKVLEAGEYILIGTLASLNFSHNEEPDTADKEDEG
                     GDGSSEEDVILHLCQVVGLDIGYTRHNTGAKQTNKDPDLEMRTFVPGPGVFPSDSSNQ
                     ICPIECFFRVDGEDKNPCDGKELGTGTISVWVSVVETSIYHSLYLT"
     gene            complement(937943..938025)
                     /locus_tag="CNJ03010"
                     /db_xref="GeneID:3254219"
     tRNA            complement(937943..938025)
                     /locus_tag="CNJ03010"
                     /product="tRNA-Met"
                     /db_xref="GeneID:3254219"
     gene            complement(938407..940359)
                     /locus_tag="CNJ03020"
                     /db_xref="GeneID:3254220"
     mRNA            complement(join(938407..938588,938640..938805,
                     938874..938973,939032..939149,939220..939521,
                     939590..939813,939857..939901,939951..940359))
                     /locus_tag="CNJ03020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567580.2"
                     /db_xref="GeneID:3254220"
     CDS             complement(join(938487..938588,938640..938805,
                     938874..938973,939032..939149,939220..939521,
                     939590..939813,939857..939901,939951..940051))
                     /locus_tag="CNJ03020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567580.1"
                     /db_xref="GeneID:3254220"
                     /translation="MLTLIAIALSVTIALRAGATVYPLVESWHGKGFFDGFTFPVETY
                     DNTTNGDTFWATPANTSLLYTTSTGATILKVDNRTFVPYPEKRYAPRLLSKSAYDLGT
                     VWVMDAVHLPYGCSVWPAFWTQGPSWPAGGEIDIIEGINLQATNMIALHTSGASSCTI
                     PTTSPSPFSGTVSYPNCDNSQNYGSGCTVYDRNTNSYGREFAEAGGGVYVAEFAKDGI
                     RVWFMTRSAIPTAIQVNATQIDTSTLGTPVAEYPSSSCDIANLFGPQTLTINIALCGD
                     YAGLPSELQRTCPALVGDATCYTTYVINDGSTTYAQAYFEINYVNVYSSNPSSVTTIS
                     PSGPTSTSTLTSTSTTASTSAAGTREGGATKAERQLLLVAVGSLVSLFLFW"
     gene            940656..944011
                     /locus_tag="CNJ03030"
                     /db_xref="GeneID:3254305"
     mRNA            join(940656..940763,940809..941596,941642..944011)
                     /locus_tag="CNJ03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_567581.2"
                     /db_xref="GeneID:3254305"
     CDS             join(940855..941596,941642..943830)
                     /locus_tag="CNJ03030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567581.1"
                     /db_xref="GeneID:3254305"
                     /translation="MTPPSHWQTISPQTRPLTLTVLDLTPLALTVSLSLTPSASISLH
                     HSHPSQSHHAHGTHGHPHTPVSHGHIAQVPNQKNRKRHRKRGHPNQIFATSTHGEPSE
                     DDEHEQEESDSNSHQDSAVSFKDLLRHGVLVYVNGQQSNNLFANVMDDEDEETEWEDE
                     TEASPHGEEMEESMEQGITRRRPRKARFGASAAEAAGKATGKKKDEKPHSKGDKDRAV
                     LVIYGLMPAQEYEIELRVVGMGGQETEALASTSVLIPAPPTATVCPRSRANSLRSRSC
                     PRSRSNSLTAPQAPEAAPDAPPSPTHAEAIVPTPILNAVDTQAAQLRHLIATAHTEKE
                     LLQTQIKEARRTAQRGEAALKAEIETVKKGIEKAGGMDLRAKQKALALQEQVKQGWAG
                     AEAAEKEMKAVEQGLADLEKRLEQVKEEVEEVKKEFKEVKEEEEKAKESDKKTRSDED
                     KKLAEMISKIEKLKTKKAKKEAEGAELERRLEELEKEMEEAQKRNEEEKANRSRTMSY
                     YAAGYGQQYHDPHDPTPFGPVGAPPPPVTGSSTSQNNSRTLTTHPSLTNLSGPYAAGP
                     AYRPKGAPGYTPRFPSGGARPSPTLPSPTQTTGFYPSAPHPVPPVNASPGFRPPKVAP
                     ALGTSTTRPGVNAAALPFHPPNYNPQPGWTASSNNNPPAANPTPPGAHNTPPAEHTTA
                     LMPPSLQHRIYLPNPRARPFQAPSATSSPAPIPPTIAPSSAPSTNPSNPAVATAVAAT
                     SSSPSSSSPSSPAFPPLPPSSSASANKSTSASVSQQGSSLASIVTRAVLAPTSALAQK
                     SSPTGGIGLGSGVSAGPIDVVGRTASPSGSVTGAGGIPGRRTSTPPIAHGHGMGAHPG
                     YDGRPGAGAGSGPGIGGLMKRGSYTGDFPPLSPTWSGPGPIGGNGAPGTATGLNDGVD
                     RGHGMQSSGSGTVTPGLTMREGMPPRLGGNVRSGNEKSGSGNGAWGREGIVTDAILKK
                     RDEQ"
     gene            complement(944008..946137)
                     /locus_tag="CNJ03040"
                     /db_xref="GeneID:3254038"
     mRNA            complement(join(944008..944552,944728..944827,
                     944879..944996,945045..945240,945302..945398,
                     945449..945672,945721..945765,945823..946137))
                     /locus_tag="CNJ03040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567582.1"
                     /db_xref="GeneID:3254038"
     CDS             complement(join(944276..944552,944728..944827,
                     944879..944996,945045..945240,945302..945398,
                     945449..945672,945721..945765,945823..945923))
                     /locus_tag="CNJ03040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567582.1"
                     /db_xref="GeneID:3254038"
                     /translation="MLKLALATAATIASIQVSATTYPLSDSFSGTSFFDGFRFPAETY
                     DNTTNGDVFWATADNTSLLYVNDNDRVIIKVDNESDVVYLQKRYAPKLLSQKTWDIGT
                     VWVMDAVHMPYGCSVWPAFWTQGPNWPAGGEIDISEGINLRTNNMVALHTTGGTCTIS
                     NSSSMSGSITYDNCDISQNSDSGCTVNDTNTDSYGAGFAAAGGGVFVAEWATDGIRVW
                     FLTRDAVPDSLSVSASSIDTSTLGEPVALYSSETCDVQNLFGPQTLTIDITLCGDFAG
                     NADLLAQTCGALVGDNTCYTTYVVNNQTSNLAQAYYEINYINVYSSNSSSNASATSTA
                     SAGVSTSATSGSGSTASANASASGSSSGAGRVEAVLGGLLGALLFGLAMIL"
     gene            complement(947312..948715)
                     /locus_tag="CNJ03050"
                     /db_xref="GeneID:3254142"
     mRNA            complement(join(947312..947421,947474..948041,
                     948097..948153,948207..948715))
                     /locus_tag="CNJ03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_567441.2"
                     /db_xref="GeneID:3254142"
     CDS             complement(947480..947818)
                     /locus_tag="CNJ03050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567441.1"
                     /db_xref="GeneID:3254142"
                     /translation="MNLNELIDWATALDNRLRARSADRSNFKPDPSKVHQPKARSLPH
                     SLPRASPLQPCHTVSPVIFLHSYKFQLFSFSPSYPPGPAARGKPRGRGVGSISVGREG
                     YRGSRRGFGF"
     gene            complement(948905..951220)
                     /locus_tag="CNJ03060"
                     /pseudo
                     /db_xref="GeneID:3254196"
     gene            949496..950903
                     /locus_tag="CNJ03070"
                     /db_xref="GeneID:3254310"
     mRNA            join(949496..950496,950559..950623,950696..950747,
                     950806..950903)
                     /locus_tag="CNJ03070"
                     /product="expressed protein"
                     /transcript_id="XM_024657995.1"
                     /db_xref="GeneID:3254310"
     CDS             949613..950482
                     /locus_tag="CNJ03070"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513690.1"
                     /db_xref="GeneID:3254310"
                     /translation="MPETPYIPLTTLAPIHEVHHLILREINPLHLLTLSKSIFNYLLP
                     KLYHTLPIDSTNVKQILYGVTSPGGYKAQALSHVKRLEIGMNGRGDPLRAALHDLFEL
                     SSLPRPLFSRLEHIHFGHSLWEPYDGPGGMFEALLPSYIPPCHISFDLCLFPTEQVWS
                     NRDDNLSRLRRLTNFLLVFFHEKSASHITFRVFHPSDCGKNSRPYREVDWDVQGESKV
                     SADLYMLREWVVPRLLGRSEEDLREELENFFENGMEDRFKFLYDDTIAWDWKKKYVVS
                     VREEKLEGQEISE"
     gene            951567..954310
                     /locus_tag="CNJ03080"
                     /db_xref="GeneID:3254221"
     mRNA            join(951567..951787,951847..951895,951946..952574,
                     952624..952638,952689..952790,952893..952943,
                     952993..953191,953243..954310)
                     /locus_tag="CNJ03080"
                     /product="expressed protein"
                     /transcript_id="XM_024657996.1"
                     /db_xref="GeneID:3254221"
     CDS             join(951640..951787,951847..951895,951946..952574,
                     952624..952638,952689..952790,952893..952943,
                     952993..953191,953243..953774)
                     /locus_tag="CNJ03080"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513691.1"
                     /db_xref="GeneID:3254221"
                     /translation="MAAKSSSEETTLTRSIVEDRSSARTSGLDRIRQRKAHSRSRKGC
                     LVCRQRHKRCDENFVDGSCDRCRRSGFQCVQRPGEERLKYVNLLAGKASDSETPSAGP
                     STETASTTAIPYSPPRDVTVSSTDLSEFISSLFQPFDTNQGSDRNNLENGVPPTTIPT
                     WPTTSASTLSQLPLSTGESIGPGPKFLFPGEVLPASLSLNDPQNTVDNQPPPRVSVTG
                     QDWLSGALADDMDLYAACLIGQLRFAATSKEGEKHLPVEEPPSTTSYGSSILDIVEGY
                     RRYQGTWLPKESELADPHSFRNPPYGLGGVREDNSLNVNPSQFSLADALASVCDLQVY
                     NFTVAGCAASYGPLLIGESIVKAVFGPQPIIIDLNGAYTDQAGLVTFAQADIGHCICT
                     KQRRPLFTLMPYDSNKVTNSEMFLGVPSRAHHFLSDICMLSVEDHVDPSKLAELEQSL
                     KASFDDPLIPVIWSRAAMITLYQRLHNVGPLHPTIRAMSWDILLDLPPQPCRKSEIFP
                     LFLAGAAAILETQRAAVRQRWVKAPEKGFEEGLSFLEDLWAHVDKTGHTVSWLDYLEE
                     KGGALAFF"
     gene            complement(954272..960233)
                     /locus_tag="CNJ03090"
                     /db_xref="GeneID:3254194"
     mRNA            complement(join(954272..954512,954574..954676,
                     954734..954823,954875..955078,955136..955332,
                     955381..955660,955716..955927,955978..956131,
                     956185..956521,956572..956746,956803..956926,
                     956988..957226,957281..957374,957424..958363,
                     958409..959000,959047..959621,959671..959837,
                     959894..960233))
                     /locus_tag="CNJ03090"
                     /product="Glycogen debranching enzyme, putative"
                     /transcript_id="XM_567389.1"
                     /db_xref="GeneID:3254194"
     CDS             complement(join(954415..954512,954574..954676,
                     954734..954823,954875..955078,955136..955332,
                     955381..955660,955716..955927,955978..956131,
                     956185..956521,956572..956746,956803..956926,
                     956988..957226,957281..957374,957424..958363,
                     958409..959000,959047..959621,959671..959837,
                     959894..960094))
                     /locus_tag="CNJ03090"
                     /codon_start=1
                     /product="Glycogen debranching enzyme, putative"
                     /protein_id="XP_567389.1"
                     /db_xref="GeneID:3254194"
                     /translation="MTILDSLKPSNIEIPKPKAVLQGDGKKTPKTPQDEAISFFSREG
                     DGEPVQVWELSLEDDGGPSPEKSYIRLPPPFKPYVLRFTLQPGTDVTRNGVLKSDFPM
                     DGGAFKRDDWKERKLPSNLSKPIEVDLPISAPGAFCYFIEYDSPDSTGRVQGRKGYFN
                     VDPIITLPARTPFFPPDTPITSGPLKDESSGAILPKDKQLSLDGLIIISVLAKWMGKT
                     TEWEPFFAEASRRGYNMLHWAPLQQKGMSGSPYSIQNQLVFDIDLLKDSKAKDGGVKE
                     VEEVLKFAKEKYGLGGVTDVVLNHTAYDSPWLQEHPEAGYSPYNTPHLAPALEFEDAL
                     LGLTSRLSSVGLPTNLKSESDLQALIPHIKSSIDDAKLWEYYIFDVQGSERAVADSLL
                     NSKPEAPKPWEGSSLQGKSLNELAEIVKSSDIITSYRAYSSRYCTSVPPAVAAGFIQA
                     AYPGDSAENQASRWGKILDVLNVDLYKECNEDIQAGIDGVVGRLRYTRLEEGGPKLGE
                     LTEERAILERYFTRIPKNDITKKHPENALAVANNGWMWAADPLNNFAEYPSKAYLRRQ
                     VIVWDDCVKLRYGSQASDNPWLWQHMISYAELLAGMFDGFRLDNCHSTPLPLGKAIID
                     AGRRVNPNLYVMAELFTGSQEMDLKFVRELGINSLVREAYNGNTVKNFADLLWRFGLG
                     KPVGSMDVACLTSSGEVHLSLSSSKSSTRPALVTPLQGSVPHAVFYDLTHDNQSPRDK
                     RTAEDALSTGALVTFCAAALGSNKGFDDLYPKLLDLVTDNRKYEVISKEKEKSSGIGN
                     VKRVLNALHVEMMEGGYSEGYVHEDGEYLMIHRIHPVTHKGYMLVAHTAYPGFKGRGW
                     VKPIRLGRTSISYIFGASIKTRFEEWEDDPSTHRGIPSTLTEIGPPEITKGIENGEEY
                     QEVVVPEDFAPGSIMVFATQMSDISGDLDAFCKEGAIDAMSQLDLVDLNVILHRADGE
                     EQDATGGDGTYTIPNYGAITFCGLEGWMHPLREITKKNDLGHPLCQHLREGTWAFDYV
                     VNRLNKQTFDLPRLEAPAKWFASRFDQIKATAPSFMRPKYFSLVIHEAYKAARRAVVE
                     QCSEFVSSGHSLTHNLALCSVQMYGLVKSASLDPGRAVPSLAAGLPHFAAGWARCWGR
                     DVFISLRGLFLTTGNYPAARAHILSFGSTLKHGLIPNLLDSTRNPRYNCRDGPWWFIQ
                     NIQDYTHMAPNGLTILSDKVKRRFPADDTWVAWDSPRAYEYESSVAELIQEILQRHAE
                     GIEFREYNAGPNLDMDMRDEGFNQKIWVDWETGIIFGGNRYNCGTWMDKMGSSEKAGN
                     KGLPATPRDGAPIEITGLLKSALTWLDKLSKGGKFPFKGVNASVKGKKRLVTYKEWSD
                     LIQASFEKHYYVPSDPAEDDKYVINKGLVNRRGIYKDVFGTPKDREWSDYQLRCNFTL
                     PMVVAPELFTPSKAIGALSIADAVLRAPLGMKTLDPSDSQYRGDYDNSNDGTDQAIAK
                     GWNYHQGPEWGFPLGWFLMAYLKFDRLAGEGKSNPTKTMHYISNILRNLARHIESDPW
                     RGLPELTNSNGSFCYDSCNTQAWSASTILDVLEEMHKIGKN"
     gene            complement(960457..961827)
                     /locus_tag="CNJ03095"
                     /db_xref="GeneID:36393083"
     mRNA            complement(960457..961827)
                     /locus_tag="CNJ03095"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658786.1"
                     /db_xref="GeneID:36393083"
     CDS             complement(960808..961656)
                     /locus_tag="CNJ03095"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514465.1"
                     /db_xref="GeneID:36393083"
                     /translation="MTVTPPPPHSVVLLQAPAGNFARLFPVRHIIFDQLVLEDPRQYC
                     TLSRSTYKVAIHLLPRKLTITNNNYQKVLPGLASKSGRERLALIHFEHLILATTNLEL
                     LKSLQLETDCPVFARVSQLEFVEKFPWGRLGDIHYELGTENIEDILARHIPAKVFIIN
                     IRNPITQGYGYGPALDRISMLLAAFVRARGSCSSEGPPVVFELCFRCKHRVTGWSERR
                     AKAEIRAPRMGQMDEIVLRKWVSLMIASPSEEILRESLETCTIPYTDDYPANWSMDTK
                     YRITLQ"
     gene            complement(963199..964903)
                     /locus_tag="CNJ03100"
                     /db_xref="GeneID:3254102"
     mRNA            complement(join(963199..963700,963768..963848,
                     963902..964009,964063..964463,964548..964612,
                     964719..964903))
                     /locus_tag="CNJ03100"
                     /product="expressed protein"
                     /transcript_id="XM_567442.2"
                     /db_xref="GeneID:3254102"
     mRNA            complement(join(963199..963700,963768..963848,
                     963902..964009,964063..964463,964548..964636,
                     964689..964903))
                     /locus_tag="CNJ03100"
                     /product="expressed protein"
                     /transcript_id="XM_024657997.1"
                     /db_xref="GeneID:3254102"
     CDS             complement(join(963252..963700,963768..963848,
                     963902..964009,964063..964463,964548..964612,
                     964719..964874))
                     /locus_tag="CNJ03100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567442.1"
                     /db_xref="GeneID:3254102"
                     /translation="MSEVTLKELITAASPASLFEWLNPHLDRGMKYVYPKYLLPLFFG
                     THLLVFSAVSHYARGDFEYHDENIHTPTLWHYVISIPFYLLGITPTLSALRLTCLFQA
                     LLLPTVLTIILTPTPFPTPFFLRRFVNAFCQPKEYAVAMGLNSIGVLMISRFTPGISC
                     LLGLLVLWRSVAKRRYWIGAGVAAVVGIMRAGVMVWTVFVLGWVAWEIAVTDRERKQR
                     AYSYYPYLFTLVIWWFVWRQQNIPLDWSGFGDLYPLMLLTHPMFPVLAPYSPLLLRKH
                     LRWTLLWAFATLCTYVVSDNTPSRAGATIDQCLPLIILRLFLLFIGGKPEKSAPEAEK
                     EDGDEQRARAAGRGLEAREQVKGDTSSEERRPPQTAGTAEEGHRRGQGSQQQNMGRIE
                     IGWYTLINLVAGSLLLVIDTQSNRHGH"
     CDS             complement(join(963252..963700,963768..963848,
                     963902..964009,964063..964463,964548..964636,
                     964689..964874))
                     /locus_tag="CNJ03100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513648.1"
                     /db_xref="GeneID:3254102"
                     /translation="MSEVTLKELITAASPASLFEWLNPHLDRGMKYVYPKYLLPLFFG
                     THLLVFSAVNIFHPYLYKEEIPHFNQVSHYARGDFEYHDENIHTPTLWHYVISIPFYL
                     LGITPTLSALRLTCLFQALLLPTVLTIILTPTPFPTPFFLRRFVNAFCQPKEYAVAMG
                     LNSIGVLMISRFTPGISCLLGLLVLWRSVAKRRYWIGAGVAAVVGIMRAGVMVWTVFV
                     LGWVAWEIAVTDRERKQRAYSYYPYLFTLVIWWFVWRQQNIPLDWSGFGDLYPLMLLT
                     HPMFPVLAPYSPLLLRKHLRWTLLWAFATLCTYVVSDNTPSRAGATIDQCLPLIILRL
                     FLLFIGGKPEKSAPEAEKEDGDEQRARAAGRGLEAREQVKGDTSSEERRPPQTAGTAE
                     EGHRRGQGSQQQNMGRIEIGWYTLINLVAGSLLLVIDTQSNRHGH"
     gene            complement(966390..967237)
                     /locus_tag="CNJ03110"
                     /db_xref="GeneID:3254226"
     mRNA            complement(join(966390..966494,966553..966804,
                     966864..966997,967152..967237))
                     /locus_tag="CNJ03110"
                     /product="ribosomal protein S18, putative"
                     /transcript_id="XM_567390.1"
                     /db_xref="GeneID:3254226"
     CDS             complement(join(966452..966494,966553..966804,
                     966864..966997,967152..967190))
                     /locus_tag="CNJ03110"
                     /codon_start=1
                     /product="ribosomal protein S18, putative"
                     /protein_id="XP_567390.1"
                     /db_xref="GeneID:3254226"
                     /translation="MSFAPLEAHQQFQHILRLLNTNVKGGGKIMYALTEIKGVGRRYA
                     NLVCKKADVDLNKRAGELNSDELERIVTIMQNPAQFKIPSWFLNRQRDISDGKSQHIL
                     SNVIDQRLREDLERLKKIRTHRGLRHHWGLKVRGQHTKTTGRRVGRAVAGKKK"
     gene            967504..968478
                     /locus_tag="CNJ03120"
                     /db_xref="GeneID:3254212"
     mRNA            join(967504..967546,967622..967630,967688..967693,
                     967787..967800,967857..967958,968085..968143,
                     968230..968478)
                     /locus_tag="CNJ03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657998.1"
                     /db_xref="GeneID:3254212"
     CDS             join(967545..967546,967622..967630,967688..967693,
                     967787..967800,967857..967958,968085..968143,
                     968230..968358)
                     /locus_tag="CNJ03120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513628.1"
                     /db_xref="GeneID:3254212"
                     /translation="MVNIPKTRRTYCKGKACRKHTPHKVTQYKKGKDSLSAQGKRRYD
                     RKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKTKHQLALKRCKHFELGGDKKQRGA
                     AISF"
     gene            972779..974802
                     /locus_tag="CNJ03130"
                     /db_xref="GeneID:3254128"
     mRNA            join(972779..972949,973006..974567,974631..974802)
                     /locus_tag="CNJ03130"
                     /product="expressed protein"
                     /transcript_id="XM_024657999.1"
                     /db_xref="GeneID:3254128"
     CDS             973087..974031
                     /locus_tag="CNJ03130"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513629.1"
                     /db_xref="GeneID:3254128"
                     /translation="MKESYDFSRRRLVSLAPITEVHDLVLDELAHIAPTKYLLLSRYH
                     YNRILPSLYENFTIPYHYEKALAGTKPFTATKIQALSHVKRLYIAIGPDAKWQIPEGE
                     RESLPSFRRVLTNFVRKHRPVFPQLEEISFPENLGYPPFDDSCDHNFWDIMFSSIPSS
                     CRVSIHFVKPDEEEISGNGERSKLQLLYNIASRNLSLYIHRRQDGATTLNRIITWTIK
                     GKSHPALDYHILNANLEDLSSPIHGKKDKNGTLRVAAPTTESLRNRLHDNLELWQEDM
                     YKMMFADTSEWNYKERYQVGVMLCDSASSVKSLRYEDV"
     gene            975307..976852
                     /locus_tag="CNJ03140"
                     /db_xref="GeneID:3254216"
     mRNA            join(975307..976584,976639..976711,976770..976852)
                     /locus_tag="CNJ03140"
                     /product="expressed protein"
                     /transcript_id="XM_567393.1"
                     /db_xref="GeneID:3254216"
     CDS             975351..976574
                     /locus_tag="CNJ03140"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567393.1"
                     /db_xref="GeneID:3254216"
                     /translation="MPRFLSSPAHSPRAAASQLPANEITTLNPFPADIIDIIFDHLEA
                     VIPITLACLSKSCYDKIIPKIYRNVTISKKNATKVFYGMCSDQTAELPYPYGGFLFST
                     RKAEAFKHTTRVAFQDIWAAEAIVMAAREYPTHEFGFMAKENSYPMLFPSVKYVLLGK
                     DILRSLPDTAQDVNIAEQRRWETNHVMSVDNIKKMEWIEHHGNYYVTAGEFEDLLFRM
                     VDPEIVCFDMMYVDSSKGNSYNGALVTDSLNLHPPKGRVVIHWFFYDPLDQRPLFGEL
                     EPSILISIVFHTSPPPNEPISDPEIAAAFKAFSQLSPILQAKELALAVDKLIEEILMY
                     GQLVGQDRLPGPEETQSCEIELCMPNAKMVRDIWKGTGTELSEMWVRFTTEWEKIIKF
                     KDLEDMEPCGACGRK"
     gene            complement(976836..978272)
                     /locus_tag="CNJ03150"
                     /db_xref="GeneID:3254169"
     mRNA            complement(976836..978272)
                     /locus_tag="CNJ03150"
                     /product="expressed protein"
                     /transcript_id="XM_567394.2"
                     /db_xref="GeneID:3254169"
     CDS             complement(976938..978083)
                     /locus_tag="CNJ03150"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567394.1"
                     /db_xref="GeneID:3254169"
                     /translation="MFTKKKYTFASQQIISRVNRAFNKSSADSISFDSPVDSSPPGTQ
                     ALPFAPKFFLSLYTSEGPSTQEIALFTRLYPVHRQILEEYAVLQPITALCLSRASYAV
                     CLPVVLRTITACHDRLSRFALKPDLSNLRASLSVGGLLYAEHLAIDCFSALGQLINHK
                     REFYLRGEIGPKPFARIRWVEMSLKASGCCSIWMPSSEPVSCRFWFRLLCELVQSVEG
                     GLEGLVVHLQGKEVRQEFFEHTQLLLDALQPRTAIIKLSKDDWPRSANYINLGPWPKG
                     RRLIIEFLPAPDQDSYTSHSANCVRSSQCLVLAEIIPMHVMELAKGYGQWRKVWEDGF
                     MVEYRTPQAERIRSTVGKWPYRKMSEGEVEDVEQFAYEHCNFIEIPA"
     gene            complement(978274..979648)
                     /locus_tag="CNJ03153"
                     /db_xref="GeneID:36393084"
     mRNA            complement(join(978274..979070,979137..979648))
                     /locus_tag="CNJ03153"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658788.1"
                     /db_xref="GeneID:36393084"
     CDS             complement(join(978550..979070,979137..979578))
                     /locus_tag="CNJ03153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514466.1"
                     /db_xref="GeneID:36393084"
                     /translation="MAPVIPTQEAPLPPPPVKKFYLSTPDSIQPASPRSFPHSIPATS
                     LLLSLSHPDPSTSPATAFFLSCLPDPILFLHYAAAFIHPRLSLGNGGGWRHQLVELVL
                     EDKDGLAATSGGRIAVSLNWVRNIMDEVRKGQKRVEMAVKEFKGVLLHEMVHTIQHDG
                     QGSTPGWLVESIADVCRLYAGLDPPHWRKPGQGKKKKGWEDGYDAGARFLAWLVENDG
                     GTGDGGGVNGRQEHILIPSQSSTSTSAPLAQATKYPASSQTYQQPFHPVPPSKPRLGP
                     FPDLLRLIDSRLIYEKWNDSWWEEMTGHKLDKLWEAYLAYYGEK"
     gene            complement(979815..981668)
                     /locus_tag="CNJ03155"
                     /db_xref="GeneID:36393085"
     mRNA            complement(join(979815..979904,979962..980211,
                     980273..980358,980410..981022,981074..981668))
                     /locus_tag="CNJ03155"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658789.1"
                     /db_xref="GeneID:36393085"
     CDS             complement(join(979849..979904,979962..980211,
                     980273..980358,980410..981022,981074..981556))
                     /locus_tag="CNJ03155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514467.1"
                     /db_xref="GeneID:36393085"
                     /translation="MPSHRKGKDSSSKLLPAGGLSSAAKEVPSTPTPKTTPATTTTLR
                     RTPAATPTPYKKKAPATPNNASATPKKPKKKKKNNFCAVGMILQDHQKAIHEEILRSL
                     IINLKIPRPTPTSRLSQMEVFFPVHTIGCIGTEMWRHCMMDDSDAFFGSVLHMIQDCV
                     HSYDGSLAIIPEIFWLSNAQEMFSFVSLVEKGKPHNNCLDWKIRMSILRHDLDSLVYN
                     IYQSFIRKIKRHLALMVIPAIIEAQPLPGFFTEDKSAWPITSFMKLTLGTESPPGRTY
                     TTMDIIDLFDSLWKCFEEFFVELVIVKNVFSELLDLINRVAFNDLVRRTNFCSFKRGT
                     YAQCLVYPLKDLERSPDFAGLQIQYNLQRIEEWCRSHDMTDDLHLLRHIQQATKIGLM
                     RMQSPEDAHHIFEVCSDLIPAQIYKLVKQYATNNPAIVPPGQKFFQAITVRLQPGKDF
                     QNMTIPIIDEALPFRAPPPRKIDLLSTYLPDDVEAPTVRRIMDII"
     gene            complement(981895..983550)
                     /locus_tag="CNJ03160"
                     /db_xref="GeneID:3254206"
     mRNA            complement(join(981895..982088,982142..982335,
                     982396..982508,982567..983550))
                     /locus_tag="CNJ03160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567395.1"
                     /db_xref="GeneID:3254206"
     CDS             complement(join(982160..982335,982396..982508,
                     982567..982898))
                     /locus_tag="CNJ03160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567395.1"
                     /db_xref="GeneID:3254206"
                     /translation="MFTTLVALLSIVSLAAASPLPEARSLHKRYTRVQIQSHRNGECL
                     VPEGVKWGNGFQVITKPCEQATWWDINPGSGSILLSGTNIALDAGTGTENNEIVKIWD
                     SYPGLFQQTWYLTPDNRIAITGGDQCLDQGDNGPQTYQCTTGNTNQVWYLIEGAGSGS
                     TTTLPADGSATTAVSSSDSSEPTTSTAEVSILTDSPIATATATAST"
     gene            983876..987205
                     /locus_tag="CNJ03170"
                     /db_xref="GeneID:3254147"
     mRNA            join(983876..984177,984230..987205)
                     /locus_tag="CNJ03170"
                     /product="expressed protein"
                     /transcript_id="XM_024658000.1"
                     /db_xref="GeneID:3254147"
     CDS             984230..985237
                     /locus_tag="CNJ03170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513630.1"
                     /db_xref="GeneID:3254147"
                     /translation="MSTNKILDPVSGGTASTNLSPSSFARLLPVQHLIFEQLSLVCPL
                     TALRISRFSYRITIPILYRDVTASRELFRGLKQETEDYQRTVQALAFTRVLRLTDFTS
                     MDAVYHLAFDIGEPDPETKERYPRLYQNLFPKVEKIVYNWPAVQSDYHEYIDILESSS
                     LDFVVGRGNRLRLQLGERFREVEVHLEKGRIDYWMEIEEFMFFNGPKDAVIYIDVHNP
                     TILRSIGKFMPLAWASAEKLRVVVKAEEPESDRFSSKEEYVEPLAGSLAKYASRLREG
                     DNPTDESQVGPFQRPKKVFFTFPNRKAVIEELFERIIGEKEDEEAAALEEVINEHMVF
                     E"
     gene            complement(985514..986942)
                     /locus_tag="CNJ03173"
                     /db_xref="GeneID:36393086"
     mRNA            complement(join(985514..985597,985653..986942))
                     /locus_tag="CNJ03173"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658790.1"
                     /db_xref="GeneID:36393086"
     CDS             complement(985699..986847)
                     /locus_tag="CNJ03173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514468.1"
                     /db_xref="GeneID:36393086"
                     /translation="MSSAFHDAMIFAARREPITKQHVTPPRLSQPPLPNIQLTTLAPL
                     HSVHHLIFAHLEELSPILLLRVSPSFHKKLLPKLYTRVVLNSDNAPGFFHGVADGPDG
                     RKAKSLQLVKTLVFSDPEAMESIMREVYQPPIPRGSDTFWRPRLDITYPLFPHTTNVQ
                     IGWPILRFFLTPPHDIDGFPDDAREGLAPSGGLSAMMIYAMSFSRMLEDQLPEMKKLC
                     VDLESGETYDGISVEQVFRTIAYRGRRQWIKSIQRRSPGKVFDFALLIRVHLQPQQAP
                     VYLPAKTPAPFVIRFVPHADPDKRPPVDPKVTAYAIYNLFRIHTSRDSVPAVFEVIEE
                     QDVRRELAKLIEDLGMRRNTATWDYFWKSFELREKGEEEGEWEPPAFD"
     gene            989891..991554
                     /locus_tag="CNJ03175"
                     /db_xref="GeneID:36393087"
     mRNA            join(989891..990081,990174..990645,990719..990807,
                     990886..991186,991249..991554)
                     /locus_tag="CNJ03175"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658792.1"
                     /db_xref="GeneID:36393087"
     gene            complement(990141..991240)
                     /locus_tag="CNJ03177"
                     /db_xref="GeneID:36393088"
     mRNA            complement(join(990141..990303,990392..990632,
                     990711..990792,990859..991075,991143..991240))
                     /locus_tag="CNJ03177"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658791.1"
                     /db_xref="GeneID:36393088"
     CDS             complement(join(990253..990303,990392..990632,
                     990711..990792,990859..991075))
                     /locus_tag="CNJ03177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514469.1"
                     /db_xref="GeneID:36393088"
                     /translation="MSPNQVQQPTTASSSDPRGLPMANELPKTTSATFGITRRQEGHP
                     PPYHASPSREDVPETMLVMSTTKQWVCLLAIDLFFFLLPFFFSLAWYLTDTKPLKSVA
                     MVVSLLVFSIWSFLRWPEVFSDLSQDAVTKYSASQQWSLLGRRYGWSRAMDARLRRAV
                     RRTSQMCIGGIVVIQFWWLLMLGMERAFIGKILGMV"
     CDS             join(990613..990645,990719..990807,990886..991036)
                     /locus_tag="CNJ03175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514470.1"
                     /db_xref="GeneID:36393087"
                     /translation="MKPPLPHCKCCWFGVGEIPGEGEEEGEQKEEEVNGNFRQKRHHQ
                     HCFWHILSRRRRMVWGRMAFLPSCDAKCGTGCFWELIGHGQSSGIT"
     gene            991576..992893
                     /locus_tag="CNJ03179"
                     /db_xref="GeneID:36393089"
     mRNA            join(991576..991954,992018..992185,992297..992893)
                     /locus_tag="CNJ03179"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658793.1"
                     /db_xref="GeneID:36393089"
     CDS             join(991712..991954,992018..992185,992297..992725)
                     /locus_tag="CNJ03179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514471.1"
                     /db_xref="GeneID:36393089"
                     /translation="MMSMADEPPAYTAIDNVPQPFFPSCFNKYPKALGFFRETNDLFS
                     IASKPNVYTSHPTIDYRHTSDREGKYYFTGLKYNEESMSRSDVCKAWLLSLDTLFYSE
                     MLLTEGVRNLIDVNEGAHGDSHSCSVKSRAECYRSWRILAEALTIAMHKLYLWEESHY
                     LPIRLTPYTPDQLKEWRTLETFISLHTQTQAHAQHNSQNSIHLALDEGSQGGRLPNDD
                     VNNDSDTMPSWIIEASRRVLNGFEDGLLYCEGPEHEFKLADLGLADQLPSRKLYGFNL
                     VPQ"
     gene            complement(993828..996369)
                     /locus_tag="CNJ03180"
                     /db_xref="GeneID:3254209"
     mRNA            complement(join(993828..994130,994186..994352,
                     994410..994535,994591..994848,994907..995003,
                     995066..995341,995408..995486,995535..995598,
                     995649..995774,995829..996083,996136..996369))
                     /locus_tag="CNJ03180"
                     /product="expressed protein"
                     /transcript_id="XM_567397.1"
                     /db_xref="GeneID:3254209"
     mRNA            complement(join(993828..994130,994186..994352,
                     994410..994535,994591..994848,994907..995003,
                     995066..995341,995408..995598,995649..995774,
                     995829..996083,996136..996369))
                     /locus_tag="CNJ03180"
                     /product="expressed protein"
                     /transcript_id="XM_567398.2"
                     /db_xref="GeneID:3254209"
     CDS             complement(join(993868..994130,994186..994352,
                     994410..994535,994591..994848,994907..995003,
                     995066..995341,995408..995486,995535..995598,
                     995649..995774,995829..996083,996136..996308))
                     /locus_tag="CNJ03180"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567397.1"
                     /db_xref="GeneID:3254209"
                     /translation="MPEYTFTRYLGSKEVTITEVGDPQDRINPRPLTKDELWASFEDK
                     FDPNLAKSKAKLLSNAVPTQYPPRRTTYHLLPNTVALQKQAIRSFKLRLRDRIQCNAF
                     GEDEAGVMRDFLRVQRNLDATEEKLSRDIDDQQGLRKDVNALFQEGKFEDAKFQYNQL
                     WSEILPWHIEALPEHSPLRLKLGEVEAAMFDNMAACMFKLAKADFEFHSVFQCCWTAI
                     DVREYAKVRPIYSCCRRASDMMKILYVDARNYPFEINFDRNETPPDQKYVAQMIKYFD
                     DQANALQNLNKEAWYKDIDERLKIPMPPGEVTYYFGPFSWRDSWKEKRDTPSNPAQTQ
                     PRDLTLKEMWEVWSPVPKQTHLEYNDLPPYYPESRITYELRPTGIVQEYRYLTYAKFS
                     IYEMIWRQHNEDWSRIHFQEDDKKRRQVSVEDPPLKIRLDKAEKQKDEANKKYKANEF
                     KDALMTYADAWYQLLPYHIEALPLANPLRQKLGQIEAALFANMAAVLIKASSEQQCPR
                     RRRERFRRLAFFCSWAAWYNKELATVGTVINSAKRCYSTAPSDKDSHGAIESLNNSFW
                     TPMINILGEIKARNDMLLQEVLERGLKYNTAPQVTLQQVGPRKWYETGELEDLKKERN
                     WWN"
     CDS             complement(join(993868..994130,994186..994352,
                     994410..994535,994591..994848,994907..995003,
                     995066..995341,995408..995598,995649..995774,
                     995829..996083,996136..996308))
                     /locus_tag="CNJ03180"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567398.1"
                     /db_xref="GeneID:3254209"
                     /translation="MPEYTFTRYLGSKEVTITEVGDPQDRINPRPLTKDELWASFEDK
                     FDPNLAKSKAKLLSNAVPTQYPPRRTTYHLLPNTVALQKQAIRSFKLRLRDRIQCNAF
                     GEDEAGVMRDFLRVQRNLDATEEKLSRDIDDQQGLRKDVNALFQEGKFEDAKFQYNQL
                     WSEILPWHIEALPEHSPLRLKLGEVEAAMFDNMAACMFKLAKADFEVDLIENFYTKVT
                     AMVQFHSVFQCCWTAIDVREYAKVRPIYSCCRRASDMMKILYVDARNYPFEINFDRNE
                     TPPDQKYVAQMIKYFDDQANALQNLNKEAWYKDIDERLKIPMPPGEVTYYFGPFSWRD
                     SWKEKRDTPSNPAQTQPRDLTLKEMWEVWSPVPKQTHLEYNDLPPYYPESRITYELRP
                     TGIVQEYRYLTYAKFSIYEMIWRQHNEDWSRIHFQEDDKKRRQVSVEDPPLKIRLDKA
                     EKQKDEANKKYKANEFKDALMTYADAWYQLLPYHIEALPLANPLRQKLGQIEAALFAN
                     MAAVLIKASSEQQCPRRRRERFRRLAFFCSWAAWYNKELATVGTVINSAKRCYSTAPS
                     DKDSHGAIESLNNSFWTPMINILGEIKARNDMLLQEVLERGLKYNTAPQVTLQQVGPR
                     KWYETGELEDLKKERNWWN"
     gene            999386..1003330
                     /locus_tag="CNJ03190"
                     /db_xref="GeneID:3254143"
     mRNA            join(999386..999758,999811..999821,999898..999947,
                     1000020..1000048,1000099..1000736,1000784..1000899,
                     1000945..1001121,1001166..1001602,1001652..1002003,
                     1002057..1002198,1002249..1003330)
                     /locus_tag="CNJ03190"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_567399.1"
                     /db_xref="GeneID:3254143"
     CDS             join(999436..999758,999811..999821,999898..999947,
                     1000020..1000048,1000099..1000736,1000784..1000899,
                     1000945..1001121,1001166..1001602,1001652..1002003,
                     1002057..1002198,1002249..1003156)
                     /locus_tag="CNJ03190"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_567399.1"
                     /db_xref="GeneID:3254143"
                     /translation="MSSQPPPASTAYPQLPRGAAQIPPFPQLLHIKNEPLATPSASTP
                     SSHPTDSHEIVAMSPEEDDEGHDSARGTSPPPGVKEKKKTQGTRRRVVQSCSECRRRK
                     IRCDKKFPCGPCILRNDQARCHEVGLNEKQSTNVPANSNYASTADLATIQHRLDALEA
                     SLLKNGALRKADLDHFLKTIQEAEPKKKAKSRDGEDIAVDDTEGAALTLEHLAFGRSR
                     ADGSHAIPHFATRLSSVSRPAPNNDYHLARSNVPFYNSPPGYDPSSASSSGRKTSLNI
                     SSTPDQAKRIELSWEERQQKIEQLMEVMGPMDVFDLFFRKTDLAIIALTKLLPSRHRG
                     ELLVKAYLEKVDWLHRCIHVPTFLRQCNDLHSLPPERVTQEIALPFLALYFTVCTLGL
                     QFMDASEISKHFTLEEAHTLPDTWYHASRSALWAADFLDNHTMESLQCILLLGVFLNN
                     RDRADAAWALLGAAIKMAQGLGLSRLGAEQQSVDGKPLPMWTGRWESLIQREVGRRIW
                     WNLVFLDWSLAPSYNFSCSIQPDQIKTALPANIEDEDIIDGQPLKPQPLSVRTGMSFQ
                     LARLRFAEISQRQIWQANNNNHPPYSFVLSVDGELRKAMMELPSFFQPDQNTKGPPSN
                     EPKILVRYYEKTILNLAIHSRMLRLHRPWLSRGYEDERFAYSKEQCIRAARASLRMMS
                     DGTASYLEKWWLPLFYVSVSGLVVIIDLLRTSRKDMFSSETQEKIDEVKNALNQMRRI
                     ADVSHPSRAAVRVMELLLAEVEDRRRPPGSTLGKRKSSPDGDDEESGLQRAVKKLIHQ
                     AQLEAESPSASFGSGATPQDFPVTVSPARDFNDRDRDRERPVFDAYPMPFIPVPPTIN
                     NATTPTAVQQQPHAHQIIGVGNNSPFTFPVDTTNATAFPAFDTTTTRGSFAQNQLDPT
                     VRSMLSSYFPPNNNSNGNGNGIVGSATAPQAPDDFLSRVFGFGWDGVGTTGPPAHPDE
                     AGMDILGNQGQSQTQPSGGDGQQNQAQNQQDQHQQPGQLHPPRQQPAAAQQQAQQQQQ
                     LTPEQQQAMNFAMAPNPYAYGNWTNSGWMA"
     gene            complement(1003303..1005059)
                     /locus_tag="CNJ03200"
                     /db_xref="GeneID:3254328"
     mRNA            complement(join(1003303..1003552,1003604..1003958,
                     1004011..1004658,1004705..1004849,1004895..1005059))
                     /locus_tag="CNJ03200"
                     /product="tyrosine-tRNA ligase, putative"
                     /transcript_id="XM_567400.2"
                     /db_xref="GeneID:3254328"
     CDS             complement(join(1003395..1003552,1003604..1003958,
                     1004011..1004658,1004705..1004849,1004895..1005025))
                     /locus_tag="CNJ03200"
                     /codon_start=1
                     /product="tyrosine-tRNA ligase, putative"
                     /protein_id="XP_567400.1"
                     /db_xref="GeneID:3254328"
                     /translation="MVLIRLSVSKRGAHLFHRKSSTLAPKATVLQELDERGFVAAITS
                     DKLKQHVASPTTIYSGVDPSASSLHVGNLIPLLGLLHFQARGHQSICLIGGATGSIGD
                     PSGRSTERKSLTPSELRLNIAGITSQVHRFFIRGQEYLSKRGMDLTAMSKDGGRGVKV
                     MNNYDWMRDVSLLDFLRTTGKMARVSTMLSRDSVKNRLSSDSGISYTEFTYQLLQAYD
                     FSHLHSEHGCNIQLGGSDQWGNIVAGIDLIRRGKIAEREEKGEQVKEEEEDVYGLTIP
                     LLTTSTGEKFGKSAGNAVWLDEKRTSAAEFYQFFLRTTDEDVEKYLKLFTFLPLSQIQ
                     DVMQAHQISKTERLPQKLLAAEVTELVHGPAALTRALTAAQVLYSTSTSSLTAEKVLD
                     AFRGDKRFHRVKKENLAEMGVGKMAVTYGLCGSVGETQRLVQSFALQVNDRKISDHRE
                     KIAVEDLVDGHIAIVRAGNKRQIILYVE"
     gene            complement(1005419..1006881)
                     /locus_tag="CNJ03210"
                     /db_xref="GeneID:3254184"
     mRNA            complement(join(1005419..1006763,1006814..1006881))
                     /locus_tag="CNJ03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_567401.2"
                     /db_xref="GeneID:3254184"
     CDS             complement(join(1005575..1006763,1006814..1006851))
                     /locus_tag="CNJ03210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567401.1"
                     /db_xref="GeneID:3254184"
                     /translation="MSEYDVRPSKIKLKETKTDKAEKIYRHEQRRYRKEQERISRANG
                     YAVSPPRPPREESISPPRKRPKQRPQDFEEEEDGEGEWMGGYARHAREEIEKRDWEDK
                     MRWMANEVSDPFEDWPTFGRAGPSFTHIPERWRPSSPSIPRPPGFGPFPFPPFSNRHV
                     HSTRRNPLDEVDPYGIPIPPLGHMTESEYTNFVRQGMYARRRAEEMFAAERHRREREA
                     REREREIEREKRERKEERRRHRLEREEYERHRARSSASSSPIPIPHPHTAPYGTLDDP
                     TKYFTRWESLQIGGEVESTELRFDDIPWPVFRPSARGGSSGSSESILLDTLTLENVRK
                     FMTAVASHLSTSKSSSAGGTRGDLRKTVREAIRNFHPDRFHSRVLERVREKDKEKVQQ
                     GADQVSRVLNDLVRIV"
     gene            1007045..1009645
                     /locus_tag="CNJ03220"
                     /db_xref="GeneID:3254371"
     mRNA            join(1007045..1007995,1008043..1008093,1008149..1008279,
                     1008339..1008504,1008568..1008930,1008982..1009329,
                     1009379..1009645)
                     /locus_tag="CNJ03220"
                     /product="MFS transporter, putative"
                     /transcript_id="XM_567402.2"
                     /db_xref="GeneID:3254371"
     CDS             join(1007556..1007995,1008043..1008093,1008149..1008279,
                     1008339..1008504,1008568..1008930,1008982..1009329,
                     1009379..1009571)
                     /locus_tag="CNJ03220"
                     /codon_start=1
                     /product="MFS transporter, putative"
                     /protein_id="XP_567402.1"
                     /db_xref="GeneID:3254371"
                     /translation="MGEQRYEIEKRDITAPQDSKIREDMEKGFEQTMESDVAPVKQEA
                     PPTEHELSMFEHTSTRQSTHSQRPRSTVDRMETEVGSPPDEPKSHFLDGKGNLFRATF
                     ITTACATQLLSQAGIGMVMIPLHVIGESLGTDDNGQMSWMVASYGLTVGMLLIMAGRL
                     GDLYGPKRWWIIGISVMIVTNIGTGFCKTPIEFDICRALCGIGCALSVPNALAILGRT
                     YPPGFTRNITFALLGALAPVGFWCGGAIGSIFGQLVKVGWIFWFTAMFTAIFLGVGIL
                     VLPPDEPHPNPSERHFDWLGAALLALALGLFNFPWNQAPLVGWQEPYVYIIFIISILF
                     FVAFFLWEKHIGLGALIPIEVLKKDSLLVYLCLWLGWMSFGTYLFYLTFFLHDIRGYT
                     HPLTVTAQMFPLVPGGFCAALLVPYLIKKFPGHIIFLFAMFGFMCANLFMATAPVNQV
                     YWANTFVGMLLGMFGPDLSFSTGQLIVSNSVDRNLQGIAAGIVSMITNYSQSIGLGMT
                     GTVESYVRGPGTTYDDLLKGYRAAFYFGTGMAGFAVIVVALFVRMPRAHKSSDVH"
     gene            complement(1009609..1012553)
                     /locus_tag="CNJ03230"
                     /db_xref="GeneID:3254317"
     mRNA            complement(join(1009609..1010087,1010167..1010831,
                     1010888..1011043,1011097..1011859,1011914..1012200,
                     1012262..1012352,1012409..1012553))
                     /locus_tag="CNJ03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658001.1"
                     /db_xref="GeneID:3254317"
     gene            1009731..1010806
                     /locus_tag="CNJ03235"
                     /db_xref="GeneID:36393090"
     mRNA            join(1009731..1009804,1009892..1010101,1010182..1010263,
                     1010397..1010643,1010705..1010806)
                     /locus_tag="CNJ03235"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658794.1"
                     /db_xref="GeneID:36393090"
     CDS             join(1009930..1010101,1010182..1010263,1010397..1010643,
                     1010705..1010713)
                     /locus_tag="CNJ03235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514472.1"
                     /db_xref="GeneID:36393090"
                     /translation="MTFGQQPVSPGMSSQYLLSKRARVYTPEAEDGDIEQGLTEGENG
                     DNDLTDTFAYFSFVLVDCQLAFFCLDSTNLAIISNTPSRRIFATSMTILALIWSIIRW
                     KHIYGDHARFVIENYAEPQEWSLPYFKWIRICWSRRTDMRLRGAMRYLGIGCNGVIRL
                     VAMAWFFVL"
     CDS             complement(join(1011185..1011859,1011914..1012099))
                     /locus_tag="CNJ03230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513631.1"
                     /db_xref="GeneID:3254317"
                     /translation="MEVKSTMKPDRIIIESSGSAFPATLALQIKELEPEGFKLDGVVT
                     VVDCVNFEGYEDSSPSAKLQAKYTDLILLNKHHLPNPRQFDTLLDRLNDLNDETPKLR
                     IGPAPSNPPKPEVIFGLDSKLWSVKDGERKDWGEMATREGWHGDEVEVKGVYKGKKPK
                     HEHKRVGGKGEGKECGDCQKPEVEENVGPVEPIERELLEKELSKLSYEIYRVKGIVRF
                     MSPSNPSKAFDTYILNYAFSRYTLTPAPSLDDDPALEGVSIRLTVMGERGEVARRARR
                     FGEAIGAMME"
     gene            1012690..1014335
                     /locus_tag="CNJ03240"
                     /db_xref="GeneID:3254321"
     mRNA            join(1012690..1013241,1013315..1013403,1013500..1013804,
                     1013878..1014335)
                     /locus_tag="CNJ03240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567404.2"
                     /db_xref="GeneID:3254321"
     CDS             join(1012707..1013241,1013315..1013403,1013500..1013804,
                     1013878..1014271)
                     /locus_tag="CNJ03240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567404.1"
                     /db_xref="GeneID:3254321"
                     /translation="MLRLQSLGSLPAHAEPAWTVSFNPTRSLLASCSTDRTIRLYSYI
                     IPSSSDGLPSQDDSQAVFSLAKVIETDHKRTVRSIAWSPDGRTLASGSFDSTVGVWEE
                     VIPLSDDEEEEDEGAQGVYKPAGVDSDGDGDGGKEKEWECVTTLEGHESECKSVGFSS
                     DGALLASCSRDKSVWVWEVQPDADFECIAVMMEHSQDVKSIAWHPHEEILASASYDSY
                     IHLAYDDPDSDWCIFQKLHPSLPSTPLTIPSTSPSHLIDALVPTEEEKKAEAELQVPP
                     LEEDETVWCLAWSPDGRWLASGGDNGGIRLWQRTGSQPDSAFKEILHTAAHSRSVFSL
                     SWSPPYPSAESAGSTDSTDLGMLASAGEDGKIIIWQITVPPSPSSASQEIDNEQISIR
                     PIAAQKDAHGVNDINSVAWCVREDKKGWGMLSSAGDDGSVKVWRVVRD"
     gene            complement(1014273..1015683)
                     /locus_tag="CNJ03245"
                     /db_xref="GeneID:36393091"
     mRNA            complement(1014273..1015683)
                     /locus_tag="CNJ03245"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658795.1"
                     /db_xref="GeneID:36393091"
     CDS             complement(1014356..1015474)
                     /locus_tag="CNJ03245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514473.1"
                     /db_xref="GeneID:36393091"
                     /translation="MPKVPERNPSHSPPTFSSLRSLLPRILAHLQRLQPAKCLLLSQS
                     LYEELFPAVYERVILDENNVSSFFYGFLTAPPSWEQGGRGVGGKRKRLPSFPHLPAPE
                     WQLPPITSPTHQFSRGRKSVALGYTTHITLLDPMALSILCAAHVKVLDLSPILETFHS
                     SLSSSSSYPPQITPANSWPLGNVHTLEIGWDLMYYLADSHSPYPIFDPVPICCIPLNV
                     RHLIIHLGDARCRSRATRVGAEKGGGAGDGEGWKGGVKRFLKEAIYELAGEWELDTLE
                     LVIPPREVEGVYIPVFDGEDEEEGKYPPPAKKVVINFSHLSQPGTPYEQAKRVRAYLE
                     EAGEDGFRVEFKLKNALEVRRVVGDVGVDVKGFTFVEG"
     gene            1016367..1019497
                     /locus_tag="CNJ03250"
                     /db_xref="GeneID:3254137"
     mRNA            join(1016367..1016589,1016629..1017139,1017203..1018402,
                     1018462..1018684,1018794..1019497)
                     /locus_tag="CNJ03250"
                     /product="MMS2, putative"
                     /transcript_id="XM_567405.2"
                     /db_xref="GeneID:3254137"
     CDS             join(1016392..1016589,1016629..1017139,1017203..1018402,
                     1018462..1018684,1018794..1019370)
                     /locus_tag="CNJ03250"
                     /codon_start=1
                     /product="MMS2, putative"
                     /protein_id="XP_567405.1"
                     /db_xref="GeneID:3254137"
                     /translation="MRIYLPLLLLAAPLLRAQDACAPLEDAEQILESLQPAPDAHLHS
                     KLPDLAPFGNHGWADGLGWSQDGPLSTTLRLLPRVFSAISPTRLLSQTAKTIGRKGNA
                     KMSRSRKERAEKVLELVQEAEEAGCDKVWRFRARLRMFPPRGIKQDLAAAYEAYKKHL
                     EIEPSPEAQFILGVFHSTGLGGIPIDQGKALLYYTFAAAQGYRPAAMALGYRHWAGIG
                     VKEDCGVALEHYSHAADISYRRFLDGPPGGLTLPLTPIRLSDRVGGIYGPHASWASTG
                     ANSLRPAIRASIASARGETTQEILEYYQYHSDRDSYIYTARLGRLFYHGSVHFSANGI
                     SSGAESVGAIPQSFHKARTYFLKVARVLWPSDFLPGTTDQPAGRRKLTKEQEDKVREA
                     AMISASFLGRMALRGEGQKADYQRAKMWYERAAELGDREALNGLGILYRDGLGVLVDL
                     ARAQGYFQVAAAASLPEAQVNVAKLLLNRGEYQAALPFLDSALRGGNPLEAFHLSAQI
                     HTTHGRSSKSASLPPAMCGVAVAYEKLVSERGSWNEDYLLEADEAWARGEEGKAMMGW
                     YIAAEMGYEIAQNNVAFMREGGWQFDAEREGEWVIGKGKAEEGDKEALVWWLRSAAQD
                     NVDAMVKVGDYYYSKQDYPHALAHYLSASETQQSPMAYWNLGWMYQSGQGVARDWHLA
                     KRYYDLSRETGEEAGLAVWFSLWGLYLQSWWTHFRTRGSISGLPLFEPPTPSDSKPLG
                     TWSRLKSLFTSPFQWAELEFDEDWENNLEPEGIVLGEGDIEGGGGALGEAGNGGREGR
                     EWEGETMGEMMEDLLLIGLMFGIGGLMWLRARWAAMAGNGGRVQGDAAQAQGPIGGGV
                     GFEGAEAFGAGFETPQQPERVQQDRPPEEIQRPQETEDEENERREE"
     gene            complement(1019487..1020677)
                     /locus_tag="CNJ03260"
                     /db_xref="GeneID:3254272"
     mRNA            complement(join(1019487..1019955,1020040..1020677))
                     /locus_tag="CNJ03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_567406.2"
                     /db_xref="GeneID:3254272"
     CDS             complement(join(1019676..1019955,1020040..1020308))
                     /locus_tag="CNJ03260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567406.1"
                     /db_xref="GeneID:3254272"
                     /translation="MSEKKETRRMGQKKKPQQEQQEEEQPQQEQQEEEQPQEEEQEQE
                     EEQPQEDEQEQEQEQEQEQEQEQEQPEQEQPQPQQELQQQRPSQGSRKPTLNMPPPPG
                     PKTNPKNPPRSETARDRALGPLRSHRTPLPNELSELTPEEQPGGAHKDDKHSLSINIS
                     LDLLVEVHLTARVKGDITIGLL"
     gene            complement(1021198..1027204)
                     /locus_tag="CNJ03270"
                     /db_xref="GeneID:3254223"
     mRNA            complement(join(1021198..1021414,1021467..1021663,
                     1021718..1021924,1021981..1022283,1022336..1022472,
                     1022526..1022595,1022648..1022688,1022737..1022788,
                     1022847..1022957,1023012..1024714,1024768..1025880,
                     1025920..1026541,1026583..1026755,1026807..1027204))
                     /locus_tag="CNJ03270"
                     /product="clathrin heavy chain 1, putative"
                     /transcript_id="XM_567407.1"
                     /db_xref="GeneID:3254223"
     CDS             complement(join(1021345..1021414,1021467..1021663,
                     1021718..1021924,1021981..1022283,1022336..1022472,
                     1022526..1022595,1022648..1022688,1022737..1022788,
                     1022847..1022957,1023012..1024714,1024768..1025880,
                     1025920..1026541,1026583..1026755,1026807..1027062))
                     /locus_tag="CNJ03270"
                     /codon_start=1
                     /product="clathrin heavy chain 1, putative"
                     /protein_id="XP_567407.1"
                     /db_xref="GeneID:3254223"
                     /translation="MAAPEKPIVFTEHLQLTALGVQPTSISFQTLTLESDAWICVRET
                     GDTPQVVIVNLNDAGDVVRRPITADSAIMNPRANEKILALKAGRQLQVFNLGAKAKLG
                     THLMNDDVTFWTWINNTTLGIVTEREVYHWKVMDGQTAPTKVFDRHANLTANQIINYR
                     ISHDEKWLVLVGISSNPNAGQPGENGFKIKGAMQLYSIERGVSQPIEGHAATFASIKL
                     DGAPNPTKLFAFAVRSAAGAKLHIVEIGHQAPNPPFQKKAVDVFFPPEALNDFPVSLQ
                     VSQKHGILYLVTKFGFIHLYEIETGQCIYMNRISGETIFTTAEYETLSGIIGVNRKGQ
                     VLSVSVDEQTIVPYIQQTLNNPELAIKLATRAGLPGADGMIQQQYQVYIQNGQYGEAA
                     KIAANSPRGLLRTPQTIETLKNLPAVPGTLTPILQYFGILLEKGELNKYESLELARPV
                     VQQGKKQLLEKWLKENKLESSEELGDLCRMADMNLALSVYLRANVPNKVVACFAELGQ
                     FDKIVLYSKKVGYTPDYAQLLQHLVRINPDKGAEFATQLVNDENGPLVDLDRIVDIFM
                     SQNMLQQATSILLDALKDNKPEQGPLQTRLLEMNLMSAPQVADAILGNEMFTHYDRPR
                     IANLAEKAGLVQRALEHYEDINDIKRVVVHTNLFKPEWLVDYFGRLTVEQSFACLQEM
                     LRTNLRQNLPIVVQIATKYSDLLGSVKLIELFEQFKSSDGLYYYLGSIVNLSEDPEVH
                     FKYIQAATRTGQIREVERICRESNFYNPEKVKNFLKEARLDDQLPLIIVCDRFDFVHD
                     LVLYLYQNGLTNFIEIYVQRVNSARTPQVIGGLLDVDCDETTVKNLLMSVTGTFPIDD
                     LVDEVEKRNRLKLILPWLNNKVEQGSTDHAIYNAIAKISIDSNNNPEKFLKENNLYDP
                     AIVGKYCEKRDPYLAYIAYAKGFCDDELINITNENQMYKHQARYLVKRRDVDLWTQVL
                     NPESIHRRALIDQIIATAIPECVDPDDVSVTVKAFMHMELHGPLLELLEKIIIEPSPF
                     SDNRSLQSLMFLTAIKNDKGKVMGYINKLSGYDVETIAKVATEAGLYEEAFTIYQKHD
                     MHAEAMSVLVEHMASIDRGFAYANKINEPAVWSRLGKAQLDGLRVKEAIDSYIKADDP
                     SNFEEVIEIANRAGKHDDLVRYLQMARKTAREPKIDTELAYAYAKTDRLHDMEEFLGM
                     TNVADVLQVGEKCFDDELYQAAKLLFSSISNWARLATTLIYLGENQAAVDAARKAGNT
                     QVWKQVNAACVDKKEFRLAQICGLNLVVHAEELPALLSLYERNGYFDEIISLMEAGLG
                     LERAHMGMFTELSVLYAKYRPEKLMEHLKLFWQRVNIPKVIKAAEQAHLWPELVFLYI
                     VYDEPDNASLAMMERLADWDHDQFKKVIVKVANMEIAYRAVSFYLARQPTLLPDLLAA
                     LTPRLDHSRVIKILQTEDHLPLAKPYLIATQKLNLAVINEAYNDLLIEEEDHVTLRSS
                     LETYDEYDAIKLAKRLEKHELLEFRRIAALLYRLNSLWEESISLSKADRLWRDALETA
                     AASKDIAVCEELAGYFVSIGNKDAFAAILYVCFEFVRADFVEEMSWRFGLSDYSMPYK
                     LQQQRDQATKVAALEKEVKELRTKTAEKEPDNEPSNLMGSGLGGRLMIGGPSGGPPFM
                     GNMPNGGMMAQPTGFY"
     gene            1027420..1028708
                     /locus_tag="CNJ03275"
                     /db_xref="GeneID:36393092"
     mRNA            join(1027420..1027641,1027726..1027820,1027901..1028110,
                     1028242..1028321,1028413..1028708)
                     /locus_tag="CNJ03275"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658796.1"
                     /db_xref="GeneID:36393092"
     CDS             join(1027640..1027641,1027726..1027820,1027901..1028110,
                     1028242..1028321,1028413..1028490)
                     /locus_tag="CNJ03275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514474.1"
                     /db_xref="GeneID:36393092"
                     /translation="MAEPYSPSVPPPTYSYGRPQSGNLSQDSKAREELFGQGSQGIQT
                     QVQVNDPNQQGKQGQLDPQGAKITSINTQLQETKSILQRNIESLTERGERLEHLDQRT
                     HDLSIHAQTFKTQATITRRKFWWKNMKWMIAIGLLLVIIIAGIVAGAIKGSH"
     gene            complement(1028604..1030756)
                     /locus_tag="CNJ03280"
                     /db_xref="GeneID:3254291"
     mRNA            complement(join(1028604..1029034,1029105..1030261,
                     1030319..1030756))
                     /locus_tag="CNJ03280"
                     /product="tRNA methyltransferase, putative"
                     /transcript_id="XM_567408.2"
                     /db_xref="GeneID:3254291"
     CDS             complement(join(1028762..1029034,1029105..1030261,
                     1030319..1030730))
                     /locus_tag="CNJ03280"
                     /codon_start=1
                     /product="tRNA methyltransferase, putative"
                     /protein_id="XP_567408.1"
                     /db_xref="GeneID:3254291"
                     /translation="MLKSLIPRRLISIVARTRTFTMTTSPIRSPPAKRFKQELPADFT
                     HVTEAPVNALFAEPSKPQQQPKKQTKRDRRKGRKPLPEPFSPADVMWHDVRDFLGPEY
                     VDELLAKKDGSEWEAPSELGSFVVIELTAGAFTVSGESLSLFQSGEKKWAIITPFAHP
                     GDRIRAKIYKHDRLHCLADLVEILEYSDTYRGGEGDRRVNPDAGCKYFGECGGCQLQP
                     VPYHLQLQHKLRTVQLAYERFSTLPSSLVPTILPTIGSPKQWGYRTKITPHFDAPPKW
                     AKEKLVKLQAEAASPGEEEALNAEDEARKGWECRVGFERKGKPGVMDIEECPIATPVL
                     NTQLTLSRAQVKSSIMSYKKGATILLRDALLEPEPLPTAENPWNVQEAGEEEHVAVTD
                     HKAQVYERVGPWLFSFTAGSFFQNNNSILIPLTTYVQEAIFAPNPNPNLPRPTHLVDT
                     YCGSGLFGITLSPSFIAVAGVEISSLSIEAAKRNAEMNGLKDKTTWLCGKAEDIFGGL
                     AEQGFAGRHSCVVVDPPRKGCDTPFLDQLLNFRPLTIVYVSCNVHTQARDVGYLVHES
                     NKRGQVSEGKEEGVKGWKYTVESLRGFDLFPQTAHVESVAVLRLEEQ"
     gene            1030937..1033443
                     /locus_tag="CNJ03290"
                     /db_xref="GeneID:3254074"
     mRNA            join(1030937..1031065,1031116..1031158,1031205..1031324,
                     1031377..1031651,1031714..1031839,1031918..1032088,
                     1032149..1032418,1032495..1032598,1032658..1033443)
                     /locus_tag="CNJ03290"
                     /product="ATPase, putative"
                     /transcript_id="XM_567409.2"
                     /db_xref="GeneID:3254074"
     CDS             join(1030976..1031065,1031116..1031158,1031205..1031324,
                     1031377..1031651,1031714..1031839,1031918..1032088,
                     1032149..1032418,1032495..1032598,1032658..1032676)
                     /locus_tag="CNJ03290"
                     /codon_start=1
                     /product="ATPase, putative"
                     /protein_id="XP_567409.1"
                     /db_xref="GeneID:3254074"
                     /translation="MSAEASTSQQVVAPQGMAPEKYQAINAYRDKVKEHSRLSEQLKN
                     VRLNIRTLGNDYDKTEDDIKALQSVGQIIGEVLKQLDDERFIVKASSGPRYVVSYRPT
                     LPVHKLKPTTRVSLDMTTLTIMRILPREVDPMVYNMSLEDPGSASFAGIGGLGEQVRE
                     LREVIELPLMNPELFERVGINPPKGVLLYGPPGTGKTLLARAVAATLNTNFLKVVSSA
                     IVDKYIGESARLIREMFAYAREHEPCVIFMDEIDAIGGRRFSQGTSADREIQRTLMEL
                     LNQMDGFESLGRTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQGRLEILKIHAK
                     KVNKSGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRDDRDAVVQEDFMKAVRKLNE
                     AKKHETTMDYTAI"
     gene            complement(1032724..1035283)
                     /locus_tag="CNJ03300"
                     /db_xref="GeneID:3254111"
     mRNA            complement(join(1032724..1035032,1035085..1035283))
                     /locus_tag="CNJ03300"
                     /product="expressed protein"
                     /transcript_id="XM_567443.2"
                     /db_xref="GeneID:3254111"
     CDS             complement(1032890..1034662)
                     /locus_tag="CNJ03300"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567443.1"
                     /db_xref="GeneID:3254111"
                     /translation="MPTAALRIVYSSTRRTPIKSPTYDTFVTPSPAYAASNSTPNYNV
                     PSPSAQGSIPISNVVTTPFRRPRPPLGIPESPSIILTPPDDELPVQTVKHKSHILLLH
                     TPSRPYSNLPFSSLERFLQVVILVLRLIGGALDGSVSALEVTRRLIQKVVVARRASRV
                     PKATRIEYAQKPAEHPFIPGSYPCAARVPHLATFRFGVNLADYPLILFRITDHLEPLL
                     ACRLNKLCYDRYVGLIYQCLVIKGGLVDGLLKGFARAKTEDEDGIGDRGGERKVKAMM
                     MAEKISIKDAQGMRELLQVLKERKDRHDLGQPSNNSKPLFGNVKIAHFGKQLINDIAF
                     NQSSSSSKVLPSAQAIKNYWTPFIKTFFTYIRFGSRDGPNLGNVSFCFDLTNSPDVYR
                     RHGAYDWTDTGTSCAVDMLCSAAMDSVSATKVKVMEVKIHLSFDLFAPIPIIPFPHTL
                     SLLFQPFSLPSSSSFPSPSPRIPPVSSKHQGLAFANTFVIIYDLDVSGRVGPRQYIRP
                     MWLHFCIAWNCYHLSNGSGKDGGGVMVRYVVPRRTKFDQSLETFWEEEGKERWTEERW
                     EAFKKCLITRTEGTRQREMGCGYK"
     gene            complement(1036184..1038550)
                     /locus_tag="CNJ03310"
                     /db_xref="GeneID:3254054"
     mRNA            complement(join(1036184..1036611,1036690..1037555,
                     1037631..1038550))
                     /locus_tag="CNJ03310"
                     /product="expressed protein"
                     /transcript_id="XM_567410.1"
                     /db_xref="GeneID:3254054"
     CDS             complement(join(1036456..1036611,1036690..1037555,
                     1037631..1037961))
                     /locus_tag="CNJ03310"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567410.1"
                     /db_xref="GeneID:3254054"
                     /translation="MYHPPFPTPATPGHKDPFQFAPPNLHPPPAMHLSQQSSQQQPQP
                     HTQQQSHPPRNTSNSHSTTSSRRGSQAQSSHNHYSETDSEQDDDKVERDKLEIRREKN
                     RVKQRNLRLRRANHIADLERDVANLKSDNTALQNALSVSQQHESNLQGWIHDLESVLF
                     RNGLANDVEGLRRMWSDRELKRSRPSIGGLPMNPVYPPPIQQQAPIDPLSTLARAASQ
                     LPTPSSNMYPNTQLPPTQPIANPSGDRPTLPRPSSFSRPYENPYPTPDVTWSTQMHDY
                     VHPEAALQPQEGGDLKRRRIEEWQPYGIAGRPPTQATVTAMTGRRSDTILPPIQPLTA
                     PPAEPPRPPSASNAKGQQRFQEGEKGEKVSPRLIRISDLVSPSHAGETFWGGDNERLR
                     KRDENMPPRTVVPMNSIESLQLPASQFDPDERTKTEAPSKCYTTGEGPLLTPLSETRA
                     "
     gene            1041103..1042969
                     /locus_tag="CNJ03320"
                     /db_xref="GeneID:3254063"
     mRNA            join(1041103..1041248,1041307..1041918,1041969..1042287,
                     1042341..1042414,1042466..1042577,1042628..1042969)
                     /locus_tag="CNJ03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_567411.1"
                     /db_xref="GeneID:3254063"
     CDS             join(1041136..1041248,1041307..1041918,1041969..1042287,
                     1042341..1042414,1042466..1042577,1042628..1042873)
                     /locus_tag="CNJ03320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567411.1"
                     /db_xref="GeneID:3254063"
                     /translation="MLFSGLSSPHIHDRARGILMSGMYLLAQIAAFLGWLLGSQTSRS
                     LPPLSITSQSELSCGSISHPITSGYVHLEGGNLFFSLIEAKESARNNGLVIYFEGGPG
                     GSAMDYPFLGAGPCQLTPEGGTILSPAPYPWTDHANLLILEYPIPTGWSYNTTSHIPH
                     DSSAGAAEDFDDFLQALLHHFPQFVHQPLIISSLSYGGTTAAHMASTVLRRNQNAGMF
                     STRIKKHIDQLVLGNPFGDVMTVIYQNLHHLCYTPPAILPSSSCETLESYLTPCLDRL
                     AFLTSESTSHLSTRELRREAAKYCAPPFELTWKDARVDRYDSRKPPCWPVDTCWWWND
                     SLRALMNSDEMKEIFGVPSHLTWSFLGLSSLYFYLNADNMQAAHHLLPAVIDAGTRIF
                     VYSGMNDTILPYEGSLAWMSRIPSSQLSAFRQTPITIPPSAEPSETAFRGIVHNPGGA
                     VTLYGFPDAGHMAQVDQPTVVWKILENAVKGENWNPLEGWW"
     gene            complement(1041931..1045696)
                     /locus_tag="CNJ03330"
                     /db_xref="GeneID:3254318"
     mRNA            complement(join(1041931..1042255,1042326..1044478,
                     1044564..1045535,1045610..1045696))
                     /locus_tag="CNJ03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658002.1"
                     /db_xref="GeneID:3254318"
     CDS             complement(join(1043060..1044478,1044564..1045517))
                     /locus_tag="CNJ03330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513632.1"
                     /db_xref="GeneID:3254318"
                     /translation="MAPLAKTQLKDDDSKSLPRSRSSYSCSSTSASFTTETETGTTET
                     GYPTTAVRATRSRAASHHVLGQPSLSSLAGLVAASTLARATVDGEVPENGSGSRTKRL
                     ENALANLPWAEPPPRISPLASPLASPLFLHSPLPPSPPTATCTDATTATKLYPFLTQD
                     PSSIQGTKRSSARSTWSGYSGTADLATPTVEDHVPDKDVDVYVNVGVAGESVIVNGND
                     VEKQDKKSITSGFSLNSSTSKSTKSAKSNISTKSSKRSSTITLGYILAKRWEMKKYEE
                     TNAASTRKILKGEDAEREDEGDLEMLLGRTVILEKMLKSGKRVSQHSTKSSKNSKSHN
                     KRTYKISRFSVSTRHTRTPSPQFSSSCTTTGDSPIKPHPPFFVPWLNHQTCPTRSSFS
                     NPSGDRCLVSQLPSTRSSLLPYPPSINHTSKEDDRRKHFSTPPLASSTRSSLKQQHRL
                     QLQYSRKLERMKSREDVFTELGSDEEGDNSGPGFGSYGQSHPTPHFSRNSDEATRNGL
                     GISIPKRGRENLSGVGISIREEREGVIVFPEEIDDLLVPHVTPLKKGHGHDRGFQGRK
                     TGPGRMFMTMSEGNTKTKSKADGKGLRKILGCTHSDASSPSLGQGALSEQREDHVDRG
                     FGLGLDFGLDGDVNIGKELFSTATGEWTMRLGRKSRNLKDEDEGEERGREEEREERAA
                     PRPRQSPHLGHRSPNWQARQSISSYFPTLAWDSIVHEETRAYSGNGTPGECVREGVHT
                     GSGVEQGLRRRGIWGRKWVVGVSVGVGVGVIVIITLLSGLLGNKEDVQKD"
     gene            1046470..1048977
                     /locus_tag="CNJ03340"
                     /db_xref="GeneID:3254362"
     mRNA            join(1046470..1046792,1046865..1046982,1047035..1047086,
                     1047160..1047377,1047451..1047548,1047619..1047879,
                     1047957..1048072,1048152..1048232,1048309..1048498,
                     1048566..1048977)
                     /locus_tag="CNJ03340"
                     /product="expressed protein"
                     /transcript_id="XM_567413.2"
                     /db_xref="GeneID:3254362"
     CDS             join(1046607..1046792,1046865..1046982,1047035..1047086,
                     1047160..1047377,1047451..1047548,1047619..1047879,
                     1047957..1048072,1048152..1048232,1048309..1048498,
                     1048566..1048898)
                     /locus_tag="CNJ03340"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567413.1"
                     /db_xref="GeneID:3254362"
                     /translation="MTEHRRPSPPATSVPQRHHSVKGLQRRGTYGTENHLVFHEDFQE
                     EWKPLRVRELIRPLTVRQWIEGGKIHREPISRETPRFELFFDLLFVAIIHQLADAAIE
                     EPGGRSVARFILTFWPSWSVWEEARKFANQSGTDDLLHRLWILIGMMTLIGYTANASA
                     IELEPTGEEETVDHSAVRAAVAFWLVIKLTRVIVLLYYAWKLPSFRNAHLWKAVAVLI
                     PMFFLLPLIWVTSRPAQIVLATLLIVVDVCRIDLLVLAIRGQIYEFQQRRAQGKKGLG
                     VKGWHRMPDLPQAYKVPVTNIEHAVERLGAFVVIVLGEMVMNLVYTAVKGEIGVSRQY
                     GKAALGLMVAWAINYLYMLPSEPSAEYEHALRHSWFSGICFTFFHWPLCAALILASAA
                     SGKMVANDEVEIGVHWYWGSGVGFAIIFMAILDLTHQDLAPGQARIPRVIRALLALCA
                     GLSLILFSLGTQHMPSTGVLAITVGITWFLLAFNVFGMLPKPGTVQKEELERRERQEE
                     QGRGVVVQDLDGRAELESGGGVGKQREERVEEGRLEEGGSRG"
     gene            complement(1050778..1052289)
                     /locus_tag="CNJ03350"
                     /db_xref="GeneID:3254242"
     mRNA            complement(join(1050778..1050885,1050973..1051224,
                     1051352..1051566,1051618..1051983,1052035..1052289))
                     /locus_tag="CNJ03350"
                     /product="integral membrane protein sed5, putative"
                     /transcript_id="XM_567414.1"
                     /db_xref="GeneID:3254242"
     CDS             complement(join(1050859..1050885,1050973..1051224,
                     1051352..1051566,1051618..1051983,1052035..1052269))
                     /locus_tag="CNJ03350"
                     /codon_start=1
                     /product="integral membrane protein sed5, putative"
                     /protein_id="XP_567414.1"
                     /db_xref="GeneID:3254242"
                     /translation="MAPKDRTSEFHSTLNSIKSRSALTTNRAKGKQQDREAKQPLISN
                     GPGQTGAKSEFGKMAGGIAKDINATTLKLQKLAQLAKRKTLFDDRPVEISELTYIIRQ
                     DIASLNSQIAQLQAYIKSSKGGKGGSAASGSKGKGNGGKQEEEHNSNVVMLLQSRLAN
                     MGMGFKDVLELRTQNMKASKDRTEQFMHTAQGSSVLAPAENSLLFNQPGDRKGKSRAN
                     TPTPNPSSSLSNLGSKRGEKEGQDFLALDIDGDRGESGIGMGGDYQQMQLVEQQDTYI
                     QSRSTAIESIESTIAELGNIFSQLATMVAEQRETVQRIDADTTDIAANVSGAQRELLK
                     YYASVSSNRWLMLKIFGVLIIFFLVFILVS"
     gene            1052431..1053678
                     /locus_tag="CNJ03360"
                     /db_xref="GeneID:3254076"
     mRNA            join(1052431..1052510,1052564..1052712,1052938..1053678)
                     /locus_tag="CNJ03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658003.1"
                     /db_xref="GeneID:3254076"
     CDS             join(1052480..1052510,1052564..1052712,1052938..1052994)
                     /locus_tag="CNJ03360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513633.1"
                     /db_xref="GeneID:3254076"
                     /translation="MSRASQPELKKFMDRRLFLHLQGGRQISGVLRGYDMFLNLVVDS
                     AFEELGGGQRKPCGMVVIRGNSVSAMELLDNQRV"
     gene            1056045..1059182
                     /locus_tag="CNJ03365"
                     /db_xref="GeneID:36393093"
     mRNA            join(1056045..1056777,1056837..1056911,1056972..1057360,
                     1057415..1057495,1057546..1059182)
                     /locus_tag="CNJ03365"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658798.1"
                     /db_xref="GeneID:36393093"
     CDS             join(1056592..1056777,1056837..1056911,1056972..1057360,
                     1057415..1057495,1057546..1058893)
                     /locus_tag="CNJ03365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514475.1"
                     /db_xref="GeneID:36393093"
                     /translation="MQAKQQTFFPRYSSGLNPNRLSLSKGPPHGTFQRGTVSMPASPL
                     LGTQSMGNFGNMVATWDAPYSAQEIFEFPGGLSESLSPLFPQQNPVSDTNASSQASQP
                     WLQLSKSASPQLDAFHPQPPQASSSFLGQSTFMMPTLTTTMTDSPFHLHPKDMTLSSA
                     SSLGLDGDMRCMKDSERYEGLRKETVDNGTQRKKKRAQVRVACTHCQKACKKCSNTRP
                     CERCAKYGLPDCVDSTRKPRKTGIKRGPYKRRPSKYTTNVGPDTSDANLPPTHSQPQS
                     QFKSNLLQPFQRNNSQLPNMHRPACTENGIPSYPPGPRLNSISTVDSSSSSTSLLTQA
                     LSAALTGPRWVDGRRVSLSDPSLGPLGDVGGNGEPKLSPMYPRTPAGTFPMALGVAGD
                     PFSRAVSPIRQFGIVGSKGENGGHERRRGDNGGKSGGPTDVDLPQVPSHGRPSLSITT
                     TPPFVPNTGTNTNMNGHQNRQRYNPNPIHTPSTLHSPSPLSSQPQPQSQAHAHAPPGT
                     MSSMYIPSKIRKPSLWTLIAADSRNGSPAPSPPPFDLSQPQPQSQLQVFGMRGTGTGK
                     GLTNGNGNDSPTLFNQPMEMDQDFEPWAGWGSATVRKDKDGDERRSFHGTSRGSRIWG
                     DSTSYKDARQEGTILSGEIHSHTSGRTRDGVEAGTWGAGESVEGVGLNGGMSVGYGMP
                     LEGLMGFDFK"
     gene            complement(1059027..1060852)
                     /locus_tag="CNJ03370"
                     /db_xref="GeneID:3254138"
     mRNA            complement(join(1059027..1059763,1059842..1060033,
                     1060127..1060349,1060457..1060517,1060760..1060772,
                     1060832..1060852))
                     /locus_tag="CNJ03370"
                     /product="60s ribosomal protein l11, putative"
                     /transcript_id="XM_024658004.1"
                     /db_xref="GeneID:3254138"
     CDS             complement(join(1059715..1059763,1059842..1060033,
                     1060127..1060349,1060457..1060517,1060760..1060762))
                     /locus_tag="CNJ03370"
                     /codon_start=1
                     /product="60s ribosomal protein l11, putative"
                     /protein_id="XP_024513634.1"
                     /db_xref="GeneID:3254138"
                     /translation="MAEKTAAVNPMKELRIEKLVINISVGESGDRLTRAAKVLEQLTG
                     QTPVTSKARYTIRSFQIRRNEKIAAHVTIRGPKAEEVLERALKVKEYELRRRNFSQTG
                     NFGFGIEEHIDLGIKYDPGIGIFGMDFYVVMGRPGMRVATRKHAVGKVGASHRVRPEQ
                     TVAWFKQRFDGIVSR"
     gene            1061212..1063375
                     /locus_tag="CNJ03380"
                     /db_xref="GeneID:3254208"
     mRNA            join(1061212..1061458,1061520..1061615,1061815..1062314,
                     1062429..1062878,1063067..1063375)
                     /locus_tag="CNJ03380"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_567417.1"
                     /db_xref="GeneID:3254208"
     CDS             join(1061284..1061458,1061520..1061615,1061815..1062314,
                     1062429..1062878,1063067..1063186)
                     /locus_tag="CNJ03380"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_567417.1"
                     /db_xref="GeneID:3254208"
                     /translation="MSQVVYSNEMSQVIYSNDTRYPGPPIHPPPREITGLPTNEELDA
                     YPRMFEWGELKEIVKTGTLEQLMRNKEMQYKYDVWSKSMKANFGSTEKYLTQTRLPFP
                     YTPVNSDSAAAAAAGGSQAAGEEEMKGTYDFSTSLDRPHVDHSTSSTPGTGASTPGSG
                     SVPNSGTTSGAGTPTSVGFVSLSSLNLLEAKLKKNKSKSKSDRKPKEEEEEVEEGHEP
                     EYLRYDPASGLDESKYAVLPNDWPYCVPYGVRHYCVWSRVPIAHPDLVDYDPIKWSKI
                     EQEGLGGFTGVLPFLPGPRVASSDDNDKGKSKGLPTPPTPLPSATPTHFTASSVASAL
                     ANQNPVGRSSTHPEPHVPPAEGWYPLDLTHAGPSLRRWAGVTYESEGGHEVGRMVKGL
                     WDERGWECLWFVNPPRLQSIPGFSHFHVFARRKTPEEIDAGEAVWGRLNEERNE"
     gene            complement(1064128..1066233)
                     /locus_tag="CNJ03390"
                     /db_xref="GeneID:3254156"
     mRNA            complement(join(1064128..1064574,1064813..1065387,
                     1065564..1065625,1065687..1066233))
                     /locus_tag="CNJ03390"
                     /product="expressed protein"
                     /transcript_id="XM_024658005.1"
                     /db_xref="GeneID:3254156"
     CDS             complement(join(1064816..1065387,1065564..1065625,
                     1065687..1066180))
                     /locus_tag="CNJ03390"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513635.1"
                     /db_xref="GeneID:3254156"
                     /translation="MSHELSPLFDLENTPASPISPSLASSPPSLPSSKLKRLSLVAKP
                     RTSSLDIEREIPVSAAYVRSLTPTTIPSTPTNNPRRIRHSVIGNPAGITYSPSPAGTA
                     GRPSASSMGLKNGESVHSSRGAYIQSPYGSSINVRHEGVEADRQRVSESEESQTLDPQ
                     TFMNRHADLLRLIAQKERRVHELRDELQQQESSLESLKAQWSSLVSLAAPSSAARPRP
                     ATPISPSRLRHPRTRGSLASTSTSFSTSESVTPSSSSLATIGGSSTNLHRHSSSSSRM
                     LTQPNPSDNVNGGGGLEKALSGIITHTEEYLGPEVVQGGIKFLGNLWKTVGAAAGGTV
                     PVPPIAEGEGDTRGREEKCLMNEAEEQDETKDHCKSDGSKF"
     gene            complement(1067761..1070757)
                     /locus_tag="CNJ03400"
                     /db_xref="GeneID:3254217"
     mRNA            complement(join(1067761..1068191,1068245..1068370,
                     1068426..1068560,1068624..1069033,1069089..1069223,
                     1069278..1069445,1069506..1069590,1069660..1069764,
                     1069819..1069875,1069929..1070499,1070560..1070757))
                     /locus_tag="CNJ03400"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_024658006.1"
                     /db_xref="GeneID:3254217"
     CDS             complement(join(1067910..1068191,1068245..1068370,
                     1068426..1068560,1068624..1069033,1069089..1069223,
                     1069278..1069445,1069506..1069590,1069660..1069764,
                     1069819..1069875,1069929..1070078))
                     /locus_tag="CNJ03400"
                     /codon_start=1
                     /product="hexose transport-related protein, putative"
                     /protein_id="XP_024513636.1"
                     /db_xref="GeneID:3254217"
                     /translation="MGGGAAAGGDFDALLTQNQNGGWRGLFNNGRALGLACFASIGGV
                     LYGYNQGVFGQVQVMYSFEQRYMATLDNTDTKGLLTSILELGAFLGALMAGPLADRFS
                     RKFSISAWCIVFMMGTAIQTGANSNVACIYAGRWFAGMGIGALSMLVPMFNAELAPPG
                     IRGSLVALQQLAITFGIMISYWIGYGTNYIGGTGAGQTTAAWRIPLGLQLVPALVLCV
                     GSCFLPFSPRWLMLKGREEECLTNLAMLRKSTEDAPEVQYEFRALQAERLVEREAAKE
                     RYGQEDVNFRVTMAEYKRLFTTKPLLHRLMLGAGCQTLQQWTGINAIIYYAPTIFEQI
                     GLSGAGAGGTISLLATGIVGIVQFVFTIPAVLFVDNFGRKPLLAWGEANMGISHAIIA
                     AIVAVYGDKFDTNKKAGNAAVFFIYWYIANFACTWGPLAWVVSAEVFPLDMRAKGMSV
                     SSGANWIMNFTVAMVTPHMIESIGYKTYIVFMCFCVVGFLYAIFILPELKGLSLEEVD
                     QLFHDTSGAEDRARRERIAAQIGLDKVANQIQHQEKANDSQV"
     gene            1073181..1074929
                     /locus_tag="CNJ03410"
                     /db_xref="GeneID:3254243"
     mRNA            join(1073181..1073687,1073738..1073749,1073824..1074520,
                     1074569..1074929)
                     /locus_tag="CNJ03410"
                     /product="expressed protein"
                     /transcript_id="XM_024658007.1"
                     /db_xref="GeneID:3254243"
     CDS             1073914..1074201
                     /locus_tag="CNJ03410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513637.1"
                     /db_xref="GeneID:3254243"
                     /translation="MRRARNPNQQKKKKKKKKQFIRNPFGLPPNSRSKFPNTFPFHST
                     VLPFPSIIDSVVVLLSIRSPFARFRADPFPFHPHLATFSPILGVCLVACMR"
     gene            1075382..1078181
                     /locus_tag="CNJ03420"
                     /db_xref="GeneID:3254262"
     mRNA            join(1075382..1075929,1075997..1076065,1076122..1076339,
                     1076393..1076557,1076612..1076697,1076747..1077231,
                     1077296..1077332,1077386..1077718,1077791..1078181)
                     /locus_tag="CNJ03420"
                     /product="myo-inositol transporter 1, putative"
                     /transcript_id="XM_024658008.1"
                     /db_xref="GeneID:3254262"
     CDS             join(1075795..1075929,1075997..1076065,1076122..1076339,
                     1076393..1076557,1076612..1076697,1076747..1077231,
                     1077296..1077332,1077386..1077718,1077791..1078035)
                     /locus_tag="CNJ03420"
                     /codon_start=1
                     /product="myo-inositol transporter 1, putative"
                     /protein_id="XP_024513638.1"
                     /db_xref="GeneID:3254262"
                     /translation="MSATNIEDRDNSFLENKAIDHIEEIENVKGSQEPPNLPGFGGHL
                     IDENLVRVEGEDKVTWYLCFLVAASAIAGFLFGYDTGVVGVALPLVGTDLGGSALNSS
                     QQEIITAGTTIGAIFGSAILGGWGDRLGRKMAILISDVFFTLGAVIIACSYSVPQIIV
                     GRIVLGVGVGGASVIAPLFIAETAPTAVRGRCIGINAFFIPFGQVVADAIGAGVQNLH
                     NGWRLLFALGVVPSVLQLLLFHYLPESPRILILRGDTDGARTVFQHIYPTATPEMIDY
                     KFRVAQEYVTATTALQSDTTFWERVKKVWKTGSYRRSITCVSVIQAACQLSGFNTLLY
                     YAGTLFGLLGLSNPALGGLIPASTNAVFVLIGMSLVDKVGRRGLMLFGVPIMLLGLVW
                     NIVAFYYMCKPTGGFLDTSYSYDTTNVSVVIGGIVLFVLGYGLSYSHIAWYQAEYLAL
                     EVRSMGCGVATTANWIANLVVSVSYLSELETMTPSGTYGFYLGLSVIGFVFVVFCFPE
                     AKELSIDETSILFENDWGVKRSIQMRKERRETQKRFHDAELAEAATAHIEARQQKSTS
                     VSPAELSKFMAGLKGGKRKPSVSV"
     gene            1078797..1080572
                     /locus_tag="CNJ03430"
                     /db_xref="GeneID:3254091"
     mRNA            join(1078797..1079126,1079193..1079356,1079442..1079560,
                     1079621..1079926,1080012..1080572)
                     /locus_tag="CNJ03430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658009.1"
                     /db_xref="GeneID:3254091"
     CDS             join(1079352..1079356,1079442..1079560,1079621..1079926,
                     1080012..1080040)
                     /locus_tag="CNJ03430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513639.1"
                     /db_xref="GeneID:3254091"
                     /translation="METVWTRFQPTAYVVEEVIKSGILGKPKRFFADFSMGWDIGVSA
                     DTSQMVNPALGGGSLLDMSAYPSVWTMLLVHGHPLNADKPQGGLHPSNYLPSFWSRYQ
                     FEVIGGVEGALPGNVDADLDNAGQKNLAAVLQCEEGDLVVAYPAFQFETF"
     gene            complement(<1081812..1085004)
                     /locus_tag="CNJ03440"
                     /db_xref="GeneID:3254307"
     mRNA            complement(join(<1081812..1082160,1082336..1085004))
                     /locus_tag="CNJ03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_567423.1"
                     /db_xref="GeneID:3254307"
     CDS             complement(join(1081812..1082160,1082336..1084959))
                     /locus_tag="CNJ03440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567423.1"
                     /db_xref="GeneID:3254307"
                     /translation="MTAPEEEHRGEEESSHTNPTAPAGLENAVSSTLGPSPGTLPSLL
                     PSQECANERFLFLAHLPVRSKPLPNNLVTDFMDAAERCALAYIAQPSDSTLLAFLALP
                     KVGLTQALAPEQPLRPSTFLQQFPHIPWPEQPPARRPPSNIRPDTTKQVIKLIENGRL
                     GAAERVLEEDASVAELDQGVIDQLIAKHPKGPSCPFGNAVGPTPGKAPDIDTIQKALD
                     SFKPDTAPGVSGWSVPLLKTAAKREPVKQFLQLLCAAIANNTAPGRSMLRTSRLIPLK
                     KDDGSIRPIAVGELIYRLCAKALIISHFQPDFLLPFQLGVKSIGGVEPIVRLTERVLE
                     GSAGAEFSFLASLDASNAFNRVDRAEMAAAVKTHAPTLWRTCKWAYGDSSDLVCGDKI
                     LQSSQGVRQGDPFGPLFFSITLRPTLNALSQSLGPSTQALAYLDDIYLFSNDSQVLSK
                     TTQFLADKQHIIKLNEKKCKLISFDEIRQDGFKMLGTMVGGKEKRAEFLEGRIRKEMA
                     KVGKLKDLPHQHALLLLRFCIQQNLRHLQRSLRSDDLVDLWERLDTMLWEEVKRMRMR
                     QREDTAEEEALGRSLTKLPARLGGLGLLSFKDVAPLAYRSAAEASDTLLDNLGLLSSP
                     EEPPTPVPQRTRCAELWESQQEAILHNLGDTERKRLTENASRLGRSWLSVIPYLQPLR
                     LSNVEIASGLHDRTLVGSSIPVCRFCGSDSPLGHDELCRARNPWTQRRHNAINRVIYQ
                     HLKQIQGATVEIEPHTLSGQRRNDLRVRGSSALAFTDYDLKVYSLGDRDARSTATPST
                     PNSKLAEFCLDRCVNWLDKVGQVVSKNAPKVTGGVFKPIILSTGGLMSRSTADEWKEW
                     REAMPVGGFEKMEKRIGVDALAFTDYDLKVYSLGDRDARSTATPSTPNSKLAEFCLDR
                     CVNWLDKVGQVVSKNAPKVTGGVFKPIILSTGGLMSRSTADDWKDWREAMPVGGFEKM
                     EKRIGVELVKARARTLVL"
CONTIG      join(AE017350.1:1..1085720)
//
DBGET integrated database retrieval system