GenomeNet

Database: RefSeq
Entry: NC_006681
LinkDB: NC_006681
Original site: NC_006681 
LOCUS       NC_006681             906719 bp    DNA     linear   PLN 14-AUG-2010
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 12,
            complete sequence.
ACCESSION   NC_006681
VERSION     NC_006681.1  GI:58271749
DBLINK      Project: 10698
            BioProject: PRJNA10698
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella;
            Filobasidiella/Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 906719)
  AUTHORS   Klutts,J.S., Levery,S.B. and Doering,T.L.
  TITLE     A beta-1,2-xylosyltransferase from Cryptococcus neoformans defines
            a new family of glycosyltransferases
  JOURNAL   J. Biol. Chem. 282 (24), 17890-17899 (2007)
   PUBMED   17430900
  REMARK    GeneRIF Text: Cryptococcal xylosyltransferase 1 (CXT1) encodes a
            beta-1,2 xylosyltransferase that transfers D-xylose from
            UDP-D-xylose to the reducing residue of alpha-1,3 dimannoside.
REFERENCE   2  (bases 1 to 906719)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   3  (bases 1 to 906719)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 906719)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AE017352.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..906719
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /variety="neoformans"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="12"
                     /note="MAT-alpha"
     gene            complement(298..2697)
                     /locus_tag="CNL03660"
                     /db_xref="GeneID:3254804"
     mRNA            complement(join(298..848,910..985,1038..1108,1163..1679,
                     1731..2224,2289..2484,2531..2697))
                     /locus_tag="CNL03660"
                     /product="alpha-amylase AmyA, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41547793|gb|CF693634.1,gi|41547803|gb|CF693644.1,
                     gi|41551314|gb|CF697155.1,gi|41551326|gb|CF697167.1"
                     /transcript_id="XM_567929.1"
                     /db_xref="GI:58261037"
                     /db_xref="GeneID:3254804"
     CDS             complement(join(477..848,910..985,1038..1108,1163..1679,
                     1731..2224,2289..2484,2531..2625))
                     /locus_tag="CNL03660"
                     /codon_start=1
                     /product="alpha-amylase AmyA"
                     /protein_id="XP_567929.1"
                     /db_xref="GI:58261038"
                     /db_xref="GeneID:3254804"
                     /translation="MPVLSKLISLLPLLAIAQGATSDEWRSRSIYQLITDRFAPPSDD
                     TTCPLGATNYCGGTWQTIISKLDYIQNMGFDAIWISPTALNIEGNTKYGEAYHGYWTA
                     DPTKLNPHFGQASDLKALSVAVHDRGMYLMVDIAINALAATSYSLDASALASDADGTL
                     LFKDPSDFHTRCDISWGNHTSEQVCWLVTGDDNGDVALLDLKTESDSVASVLKDWVGG
                     YVTEYGIDGFRIDASKHMSKEFQHDFCEAAGTFCMGEVAGDNTEYAGEYQSAGGIDSV
                     CGFGLMYGFVNVFTGGDKMSTLEYYINLAASSYPDPTVIGTFLDNQDLPRFNSLTSDA
                     SLVYNAIVGMFMYGGMPIVYYGLEQDISDGPTDPQNREALWNYNNYATDGVTFGRITN
                     LNNIRNRLGGVGELYNAVATVLAIQDQDIALQREEALIVLTNRGQSGTGTWAIKNTQF
                     GGSVSVIDLLSCSTSTTDSDGSLTVTWTSGQPFVFVASDVADKAGLCGSLSNSTNATT
                     VSSSSSASTSIDTATSSASISGNLAVITDGSSSPSFSATSSALSSSISWYTPTSAASS
                     VSSSELVVVVAAVSTASTAVTSSGSICRRSKKRAMSKRQL"
     gene            3147..5536
                     /locus_tag="CNL03670"
                     /db_xref="GeneID:3254792"
     mRNA            join(3147..3281,3340..3641,3710..3781,3852..4940,
                     5003..5083,5152..5162,5220..5291,5355..5536)
                     /locus_tag="CNL03670"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542733|gb|CF688574.1,gi|41542739|gb|CF688580.1"
                     /transcript_id="XM_567930.1"
                     /db_xref="GI:58261039"
                     /db_xref="GeneID:3254792"
     CDS             join(3254..3281,3340..3641,3710..3781,3852..4940,
                     5003..5083,5152..5162,5220..5291,5355..5385)
                     /locus_tag="CNL03670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567930.1"
                     /db_xref="GI:58261040"
                     /db_xref="GeneID:3254792"
                     /translation="MTSTFRQPSLFDHFHRIPNPYAQKGLEYVTPGKELRKLKRKEQK
                     ERRIEQRRAHLKKRSQLLAERATIVAKRPVWHDIPDWGDRTDCPLFKLPPEILDLCFG
                     TELDNDLSLREYIALAAVSRYFRQQFTSEVFLAIFLHVTGDCRESLDKHAEHIFSTHV
                     EDWREEKPLPKISESIYIASMPHDQWTRAEYEYHTALQKFYRSRYMVMYLRGEIHRCP
                     SGGTNKWIGNVSYTHSNTMGDKSIYYSSTVPGLKDGETYDPKDPTCLHADVLDKSIYP
                     CCSDWSMDTEIDEDEPELNKWKTIVENYHVTYESDFWNRKAEEILRRRRRKRYRRKQS
                     SRPGEPAKRVDTKLDLSSSDDSGYDTDDLQKLVNDDELGNETEDGLDGYDGDNEDTAE
                     GKNDEINSEVPENQEKLELMMLRTLAIKARDSREAYEKRKEGEETKDEPESDDGWVVP
                     LPGDPEREALALKFLEYVLEPEPHDHWPSHVRRTIARNINSHAVAEDDAIEVYGVTKE
                     ELYGLKHYHGALWEKTDLVLYPRMAVEALTLRSHGGPLGHYRFIIDRHARKLR"
     gene            complement(5668..8443)
                     /locus_tag="CNL03680"
                     /db_xref="GeneID:3254973"
     mRNA            complement(join(5668..6006,6060..7582,7629..7940,
                     8000..8443))
                     /locus_tag="CNL03680"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534849|gb|CF680690.1,gi|41534854|gb|CF680695.1,
                     gi|41537011|gb|CF682852.1,gi|41537022|gb|CF682863.1,
                     gi|41564309|gb|CF710150.1,gi|41564319|gb|CF710160.1,
                     gi|41575732|gb|CF721573.1,gi|41575737|gb|CF721578.1"
                     /transcript_id="XM_567931.1"
                     /db_xref="GI:58261041"
                     /db_xref="GeneID:3254973"
     CDS             complement(join(5889..6006,6060..7582,7629..7940,
                     8000..8371))
                     /locus_tag="CNL03680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567931.1"
                     /db_xref="GI:58261042"
                     /db_xref="GeneID:3254973"
                     /translation="MQASTPSPTTIQTPTLSFPDTPQMDETPKTAVLRTPRATFDGGE
                     VRIEGSVSGSERGSIDMGTANGERKDKGKERAVESAEDKDEEETGFDMEQLTRLQSRV
                     NELEANGKTGDEWVQRDELLGMVKTLLPLTLNHLPFLQERLAAQKSTIATMQQQAKIS
                     EQLMATERERHAVERDSWHKEMRAVMVSKEEEKVSNKRKVLDLDVGYHKELEAANKRL
                     EMDNRLMAPRLVDTQRQIDRLVNELRLLRPHVILNTSALTSKPTELTPATSAPPVFLP
                     QYMPQLENSKGIHRSSRATMGDARTEHLLLAAKAIRSMRKTNDRLGRLTMGELKKAGV
                     VGPEGGMGYKEGYGEQPMSDVEEDASEEEPLIDQRASGSVTKGKSKSQATPLLSRTKR
                     STKKNVQNASISTIPQTPSKSRTTGQSSLPQTTPGGSNFNDLLRAAEMATRPNSPVHG
                     EPILSTLSATRSTTRPRPDSSDIERGSPKRRRGDVWEGGGSHKAHQHSASAGSASALD
                     LLAQASQLDVASSTAPSSVVQSSPAVPLTSSTPQFGGLLEKDSSPRSHGSSLGAPIDL
                     TPRNRTMANVRLKAHPASDDFVVDPSLQTPTHRIRGSSTTSESLTPARGYASSQIYPT
                     PGGELDERLPPAGASSSAINPTSTPGVISEGGGGPGAGNGNFASPSGKVVPGLGKYWH
                     YTSEMPIKRVRSPYLKWTVEEDELLARAVAIHGEKWDLVSKGVPTRSYHQVRQRWLRK
                     TGAFDKKNQAAKAEREAKTESANEAKSSSTEREV"
     gene            complement(8657..11349)
                     /locus_tag="CNL03690"
                     /db_xref="GeneID:3254833"
     mRNA            complement(join(8657..9150,9206..9277,9328..9362,
                     9412..9474,9527..10459,10513..10584,10654..11349))
                     /locus_tag="CNL03690"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41529958|gb|CF675799.1,gi|41529962|gb|CF675803.1,
                     gi|41530558|gb|CF676399.1,gi|41539105|gb|CF684946.1,
                     gi|41539114|gb|CF684955.1,gi|41551795|gb|CF697636.1,
                     gi|41553059|gb|CF698900.1,gi|41553071|gb|CF698912.1,
                     gi|41558951|gb|CF704792.1,gi|41558958|gb|CF704799.1,
                     gi|41560330|gb|CF706171.1,gi|41560347|gb|CF706188.1,
                     gi|41571253|gb|CF717094.1,gi|41571260|gb|CF717101.1"
                     /transcript_id="XM_567932.1"
                     /db_xref="GI:58261043"
                     /db_xref="GeneID:3254833"
     CDS             complement(join(8748..9150,9206..9277,9328..9362,
                     9412..9474,9527..10459,10513..10584,10654..11010))
                     /locus_tag="CNL03690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567932.1"
                     /db_xref="GI:58261044"
                     /db_xref="GeneID:3254833"
                     /translation="MQPKRTAETRNSTTKRARTVQSGKDETADPPVAVAEDIRSIDSR
                     LKGRAKGRKGKNKAEGTSDSPPPGPKKRVRKPFAAKEATWRDIPDWGDRTDVPLFRLP
                     AEVLDLCFGTKLNLGLQLRDYVALAGVSRYFRFHFTDDVFREIYLKSHPNYMKLRPCA
                     RRSPIKHSQLIFTRAVKDWRQDPPLKRFDHLEIHMRSIPPREEWTQKDYEFVIRADKI
                     IAQARQIWADARAERANIKKEKMKKRRVLRKVIVDGISRTVLATVPGLKHGETQGPKN
                     ELGVPIMTDENGKEIGLGASHAEEGNDGHDDDDDEESDDELNFYSTLQEWEWEESVHN
                     KDGELWQKIYKLEDKMRLLRRTYDNYDKGEDFSDLSSEDEADEGKEGDRSTRKKGKKK
                     QTKKFVRDPNWVLPPEEKPKRPHATLVEYDPLTGERLPHDAYPSPWRARAVEAANKKF
                     INRADAIRVFKVGEAELLCLKHYLVPNPLNPKTPSSIYSLAAIQALALRSHGGPIGHH
                     YHVESANERALKSLATRQANAAKRKADPTYVEKEPKSRQYPQTTVDPDDIGAKYGVDK
                     DCGIWHYQGTFIDFVADWREHRAAKAARKAQRVANGEGSETSDEDGSSQDELLPVPNV
                     PWNDVNEYMYSFTDEEDDLW"
     repeat_region   9957..9984
                     /rpt_type=tandem
                     /rpt_unit_seq="cat"
                     /satellite="microsatellite"
     gene            complement(11591..14321)
                     /locus_tag="CNL03700"
                     /db_xref="GeneID:3254998"
     mRNA            complement(join(11591..11764,11829..11943,12005..12112,
                     12166..12529,12578..12644,12697..12814,12863..12916,
                     12968..13099,13152..13219,13283..13537,13588..13705,
                     13771..13798,13848..13978,14030..14122,14185..14321))
                     /locus_tag="CNL03700"
                     /product="glutamate decarboxylase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530453|gb|CF676294.1,gi|41530988|gb|CF676829.1,
                     gi|41530990|gb|CF676831.1,gi|41531003|gb|CF676844.1,
                     gi|41531277|gb|CF677118.1,gi|41531285|gb|CF677126.1,
                     gi|41532773|gb|CF678614.1,gi|41532779|gb|CF678620.1,
                     gi|41533757|gb|CF679598.1,gi|41533762|gb|CF679603.1,
                     gi|41535289|gb|CF681130.1,gi|41535291|gb|CF681132.1,
                     gi|41537619|gb|CF683460.1,gi|41537631|gb|CF683472.1,
                     gi|41538457|gb|CF684298.1,gi|41538466|gb|CF684307.1,
                     gi|41538661|gb|CF684502.1,gi|41538675|gb|CF684516.1,
                     gi|41540385|gb|CF686226.1,gi|41540388|gb|CF686229.1,
                     gi|41543936|gb|CF689777.1,gi|41543939|gb|CF689780.1,
                     gi|41543944|gb|CF689785.1,gi|41543948|gb|CF689789.1,
                     gi|41545119|gb|CF690960.1,gi|41545128|gb|CF690969.1,
                     gi|41545542|gb|CF691383.1,gi|41545551|gb|CF691392.1,
                     gi|41545942|gb|CF691783.1,gi|41545953|gb|CF691794.1,
                     gi|41546937|gb|CF692778.1,gi|41547632|gb|CF693473.1,
                     gi|41547642|gb|CF693483.1,gi|41547992|gb|CF693833.1,
                     gi|41548000|gb|CF693841.1,gi|41548875|gb|CF694716.1,
                     gi|41548880|gb|CF694721.1,gi|41549683|gb|CF695524.1,
                     gi|415"
                     /transcript_id="XM_567933.1"
                     /db_xref="GI:58261045"
                     /db_xref="GeneID:3254998"
     CDS             complement(join(11732..11764,11829..11943,12005..12112,
                     12166..12529,12578..12644,12697..12814,12863..12916,
                     12968..13099,13152..13219,13283..13537,13588..13705,
                     13771..13798,13848..13978,14030..14112))
                     /locus_tag="CNL03700"
                     /codon_start=1
                     /product="glutamate decarboxylase"
                     /protein_id="XP_567933.1"
                     /db_xref="GI:58261046"
                     /db_xref="GeneID:3254998"
                     /translation="MALSQHVDADKLIEECKDHPIKRHLSHKAALYDIPYTSRYEVED
                     EVPRYRLPSKGVNGRATYQLLHDELMLDGNPNMNLASFVHTWVPDECNRLVQENINKN
                     LVDQDEYPAAQQIHERCISMLSHLWHAPKEATAMGTATTGSSEAIMLGGLALKRRWQE
                     KMKAAGKDIHNPGPNIVMGAEAQVALEKFARYFEVEARLVPIKPESSYVMDPKDVLKY
                     VDENTIGVFVILGSTYTGAFESVKDVAQELDKYEAETGISVPIHVDAASGGFVAPFAY
                     PHYQWDFQIPRVHSINASGHKYGMSTVGVGWIIWRSMEYLPKELIFELHYLGATDYSF
                     NLNFSRPAHPILAQMFTFLNLGFEGYKRIMDKNLTVARLISRALEHSGYFICLSKIHH
                     PKALTESSSSAEQSNILPAVADAANTVLHGKKTTVDDAEYYCEGLPVVSFMFTDEIKK
                     KYPGVKQAWIQMQLRSIGWIVPNYPLAPDCEKTEILRVVVRESLSGDLARKLIHDILQ
                     VTEDLLNDAGPSYSMSTATRRHENLDHGKLDNIDAVHIKQHTSTYSKPC"
     gene            <15293..>16287
                     /locus_tag="CNL03710"
                     /db_xref="GeneID:3254827"
     mRNA            join(<15293..15690,15743..15789,15842..16121,
                     16176..>16287)
                     /locus_tag="CNL03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_568202.1"
                     /db_xref="GI:58261583"
                     /db_xref="GeneID:3254827"
     CDS             join(15293..15690,15743..15789,15842..16121,16176..16287)
                     /locus_tag="CNL03710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568202.1"
                     /db_xref="GI:58261584"
                     /db_xref="GeneID:3254827"
                     /translation="MVVVFYNAPIDHAHSTLEGKVGLRMWFLTVNETSSSFPTWTIGT
                     KRYYDAGEGEVPGRGIGLAAPARNKERAADTGSGGDGGLHAYGFGIWGWCEWTNSRWT
                     GDAVCTRKTGYKLPDDSDSSWDSIYELELPYAVTHVLSGAAIPILITPFVVLSYFIIL
                     CLAILFPGPYPPWPVPSKYPAEVKHYRTRCAWLLRDWRFNLYYFLAMLVLGLSMIVTV
                     LVGRGKVNTEGGGLKARPGTGFGVFFAAWACWICSQMLCMWKTGIIMRREGKERTKYS
                     KG"
     gene            complement(18819..20843)
                     /locus_tag="CNL03730"
                     /db_xref="GeneID:3254851"
     mRNA            complement(join(18819..19483,19546..20611,20663..20843))
                     /locus_tag="CNL03730"
                     /product="glucose-methanol-choline (GMC) oxidoreductase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533766|gb|CF679607.1,gi|41533778|gb|CF679619.1,
                     gi|41534073|gb|CF679914.1,gi|41536098|gb|CF681939.1,
                     gi|41543235|gb|CF689076.1,gi|41543249|gb|CF689090.1,
                     gi|41548416|gb|CF694257.1,gi|41548428|gb|CF694269.1,
                     gi|41552643|gb|CF698484.1,gi|41552653|gb|CF698494.1,
                     gi|41564516|gb|CF710357.1,gi|41564517|gb|CF710358.1,
                     gi|41564865|gb|CF710706.1,gi|41566212|gb|CF712053.1,
                     gi|41566219|gb|CF712060.1,gi|41568982|gb|CF714823.1,
                     gi|41568987|gb|CF714828.1,gi|41569055|gb|CF714896.1,
                     gi|41569058|gb|CF714899.1"
                     /transcript_id="XM_567934.1"
                     /db_xref="GI:58261047"
                     /db_xref="GeneID:3254851"
     gene            <18849..>20752
                     /locus_tag="CNL03720"
                     /pseudo
                     /db_xref="GeneID:3254839"
     CDS             complement(join(18929..19483,19546..20611,20663..20808))
                     /locus_tag="CNL03730"
                     /codon_start=1
                     /product="glucose-methanol-choline (GMC) oxidoreductase"
                     /protein_id="XP_567934.1"
                     /db_xref="GI:58261048"
                     /db_xref="GeneID:3254851"
                     /translation="MVHAATHPKDAPKNFDFIVLGGGAGGCTVAGRLAENPNVSVLLV
                     EAGVNNPSEITDITTPAKAMGLRNSQYDWKYKTTMIDRPDYTRIEKPNTRGKVLGGST
                     ALNYYTWVRGSAATFNDWEEFGGSTWNWENTKEYFNKSTTYHDDLGLFPDDIKSIGNK
                     GGPVDISHSDLVPELKPWRDALERAWVSKGHELTVDVYNGVQKGLFKCVNSIYKGVRS
                     TAAAFLEGKPNITLASSTISKKIIFEGKTAVGVTVIGPDDREYDFYANREVIVAQGVY
                     ESAKILMLSGIGIKSDLEALSIQCVVDSKHVGQNLQDHPILSHVFKIKDGFGLDNHLL
                     RAGAEHDGAISSYRKNHNGPLSSGLLELVAFPRIDNRLENHKQYRDYKAQNGGKDPFG
                     PDGQPHFEIDFVPMFADAFQWHFPTPPTGDYMTVIVDLMRPISQNGVVKLTSTDPFEQ
                     PYINLNFFSHDLDLIALREGVRFVDDILINGEGMKDIVEGDYPWPMPRNSDEGMIRQI
                     LERSQTGFHPCGTARISKDIDHGVVSPELSVHGVKNLRVADASVFPLIPDCRIQNVVY
                     MVGEKAADFIKAAHPDLYKEAK"
     gene            <22133..24104
                     /locus_tag="CNL03740"
                     /db_xref="GeneID:3254847"
     mRNA            join(<22133..22169,22219..22583,22641..22733,22783..22790,
                     22840..22963,23014..23301,23363..23447,23497..23916,
                     23970..24104)
                     /locus_tag="CNL03740"
                     /product="catalase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535201|gb|CF681042.1,gi|41546061|gb|CF691902.1,
                     gi|41567206|gb|CF713047.1"
                     /transcript_id="XM_567935.1"
                     /db_xref="GI:58261049"
                     /db_xref="GeneID:3254847"
     CDS             join(22133..22169,22219..22583,22641..22733,22783..22790,
                     22840..22963,23014..23301,23363..23447,23497..23916,
                     23970..24046)
                     /locus_tag="CNL03740"
                     /codon_start=1
                     /product="catalase"
                     /protein_id="XP_567935.1"
                     /db_xref="GI:58261050"
                     /db_xref="GeneID:3254847"
                     /translation="MTEKTPTYTLSEGCPIADATTAQRLGSCPVKGLMLMQDTQLIET
                     LAHFSRERIPERTVHASAVGAWGEFEVTHDNSDITSAAFLNGIGKKSKVLMRISTVGP
                     EAGTAETVRDVRGWSMKIFTEEGNQDFVFNSIPVFFIRDPIKFPSVNRSHKRHPAKHT
                     ADSSMFWDFHNNNPEGTHAIMMYFSNRGLPYSLRQINSYSGHTYKLTKSDGSFVYVKL
                     HFKSNQGVKGMTQAEGVRTAGEAPDFHTTDMWDAIERGDYPTWTLYAQVMKPEEAENY
                     RWNIFDMTKVWPHKDFPLRPLGKLTLNRNPENYFSDIEQAAFSPSTMVPGVAPSGDPM
                     LQARMFAYPDAARYRLGVNYQQLPCNRPVSEVYAPYQRDGAMRYMTNYGGDPNYVRSS
                     LKEVNFKGQLGAKGHSTGGNEKHNEWVGRVAAYTSEVTDEDYVQARMFWEVLGKAGDQ
                     EDLITNVSCHLSKAIPSVQKGAVEIFAKVNVDLAKSIEDRLAELNKGK"
     gene            complement(24457..27086)
                     /locus_tag="CNL03750"
                     /db_xref="GeneID:3254846"
     mRNA            complement(join(24457..24525,24583..24744,24792..26607,
                     26664..26918,26979..27086))
                     /locus_tag="CNL03750"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41562223|gb|CF708064.1,gi|41568321|gb|CF714162.1,
                     gi|41568323|gb|CF714164.1"
                     /transcript_id="XM_567936.1"
                     /db_xref="GI:58261051"
                     /db_xref="GeneID:3254846"
     CDS             complement(join(25267..26607,26664..26918,26979..27074))
                     /locus_tag="CNL03750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567936.1"
                     /db_xref="GI:58261052"
                     /db_xref="GeneID:3254846"
                     /translation="MSVPTQRFSDIRRSRPSYSCQVCRDRRVRCDQARPKCGNCVRNQ
                     AQCVYQSNLSQKRKDPITDDSANKMPRRNKSSGSERSPSPLETGKLKPGYLVLNSGGR
                     SRYTESTFWACVDAEGLELDRILRNLPLFPRTGGPDDLVTPPAFSSSPGAATSVPNPS
                     TGTSPDRISWGPVRLAKLLQPLPPKLVCDRLFRAFMDCIHPLIPLMHIPSFESAYDEF
                     WSWRLTRPAQNISLSILHRNPSFLPLLISVLSAGSITIHEPWSDRVGQKLRGLMPEAL
                     RVIGFPYYPSVYSLMAYILANSTLIREEDAFSSCSFVAVALRVAQSMGFHRDGTEFEL
                     DPISTEERRRVWWHLMHLDTMTSIAQGLPGIMSSSRCTTQVISEMKDELIGKIKSTDS
                     LDRELWVEPKYVLAAGRYEASTQLRTILERLQEAPNITLSDIAPLEMQIEDLRRRQSR
                     RLESVNLHAHSASLQEILDQLSVRVGGDDFTDHRPPPPTTASKAIQQWNQALLHLTTV
                     KAYCILYQPFMSDKVIWANLRSRFASQSVIEWPYTLKHLVGHYHTFNTFWLCFWR"
     gene            complement(27592..29217)
                     /locus_tag="CNL03760"
                     /db_xref="GeneID:3255035"
     mRNA            complement(join(27592..28144,28194..28381,28430..28869,
                     28922..28986,29045..29217))
                     /locus_tag="CNL03760"
                     /product="UDP-galactose transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530855|gb|CF676696.1,gi|41530863|gb|CF676704.1,
                     gi|41537397|gb|CF683238.1,gi|41537406|gb|CF683247.1,
                     gi|41552485|gb|CF698326.1,gi|41552491|gb|CF698332.1,
                     gi|41553362|gb|CF699203.1,gi|41553368|gb|CF699209.1,
                     gi|41554541|gb|CF700382.1,gi|41554556|gb|CF700397.1,
                     gi|41566440|gb|CF712281.1,gi|41566453|gb|CF712294.1"
                     /transcript_id="XM_567937.1"
                     /db_xref="GI:58261053"
                     /db_xref="GeneID:3255035"
     CDS             complement(join(27613..28144,28194..28381,28430..28869,
                     28922..28986,29045..29058))
                     /locus_tag="CNL03760"
                     /codon_start=1
                     /product="UDP-galactose transporter"
                     /protein_id="XP_567937.1"
                     /db_xref="GI:58261054"
                     /db_xref="GeneID:3255035"
                     /translation="MGVLRLAVCISGVYAAFLLWAIAQERLSKPFPSVHPHPHQQPHS
                     PSDPPPGDKFPSPLFLNFAQALASSLSALCYLSFKAWRDGWKGRGLGQLLGLKEVFGK
                     SQTALNGDAKANKKESELNEKTKEVVEKAPKPPKKSLLALLVQVSVFQTIASPIGFLA
                     LRHISYPTMVLGKSCKLIPVLLLNVLLYRRKFSPHKYIVVALVTVGISMFMLFAETSK
                     KKKGGSDSMWGLVLLLVNLLIDGLTNSTQDQIFSSYPSYTGQQMMFTMALTTQIILLP
                     LLVLPLPTNPISLLAHLPPPFGSSVPTSTLSFSPPAALESISFLLSHPSALAPLFAYA
                     LLGGLGQLFIFETIQHFGSLTLVMVTVTRKLFTMLLSVVVFEHRLTKGQWLGVGVVFA
                     GIGVEAGMKRKDVMKKAKKD"
     gene            complement(30381..33048)
                     /locus_tag="CNL03770"
                     /db_xref="GeneID:3254788"
     mRNA            complement(join(30381..31714,32327..32737,32792..33048))
                     /locus_tag="CNL03770"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531340|gb|CF677181.1,gi|41544299|gb|CF690140.1,
                     gi|41547162|gb|CF693003.1,gi|41547171|gb|CF693012.1,
                     gi|41549039|gb|CF694880.1,gi|41555542|gb|CF701383.1,
                     gi|41555553|gb|CF701394.1"
                     /transcript_id="XM_567938.1"
                     /db_xref="GI:58261055"
                     /db_xref="GeneID:3254788"
     CDS             complement(join(30497..31714,32327..32737,32792..32995))
                     /locus_tag="CNL03770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567938.1"
                     /db_xref="GI:58261056"
                     /db_xref="GeneID:3254788"
                     /translation="MADKEELQERTKVARQEYREYLPLAQQLQGDLRDDAEQLRVQEG
                     WDEDTWNGVEEWVDDVGSIWRALRRNRYDQNKTHSFLLSVLSTRLSLSLHGPIPSILP
                     YSDSPLFHILPLPSHTDKLNRPIVVLTAREIVRDEQGMLDDVKEWIWWALEMCRRTSK
                     DWWSKGMWDGSGVDGYGRGKGKARGEGGEGIVLLVDAAGAGYRNLSRDERSRKVEGDD
                     DGDEEDEMTRVISASDVAAVGPMTGLITQSLTEPEDPQPILSRASSTLTSRSKPPTRA
                     PSSAAVSRIKSLSDFHLYLSPSRLARIDLLSDSSDSEDEPPPPPSIPSLPRRKVLRPA
                     LLEKSLAGTPDEREKRTNRPALRLMGLPGHLADDDPVRSYSGRLQMHHAKWLEGWKGT
                     PEELGLEDNHKLGGVKHEEEENAPIPRTISVSPPIDRPPSPSGTLEPSPSPSPIHSPA
                     MTPQPHDIQPYSTSNPFFGYPVVQFGSSIRPRYPRNRKRDLVKTLLFLFMLKLQSWRD
                     SVERALGLNRLRIPSLSQPYCSSSLYTPGPNRRNPAEGLVRSAATPGTYSKQVAKYRR
                     WDKDWWWMIIGMLLLRGTWGRIVLAPLEALGLGLSEWKAIWGAV"
     misc_feature    32371..32439
                     /note="C-rich"
     gene            <33280..>35042
                     /locus_tag="CNL03780"
                     /db_xref="GeneID:3254992"
     mRNA            join(<33280..33364,33481..33524,33599..33674,33733..33861,
                     33991..34076,34134..34288,34348..34627,34686..34796,
                     34849..34939,34990..>35042)
                     /locus_tag="CNL03780"
                     /product="chaperone regulator, putative"
                     /transcript_id="XM_567939.1"
                     /db_xref="GI:58261057"
                     /db_xref="GeneID:3254992"
     CDS             join(33280..33364,33481..33524,33599..33674,33733..33861,
                     33991..34076,34134..34288,34348..34627,34686..34796,
                     34849..34939,34990..35042)
                     /locus_tag="CNL03780"
                     /codon_start=1
                     /product="chaperone regulator"
                     /protein_id="XP_567939.1"
                     /db_xref="GI:58261058"
                     /db_xref="GeneID:3254992"
                     /translation="MLPTTLFFLLTLALLGGCLAESLYNVLGVRKDASDADIKKAYRK
                     LSKKYHPDINPDEAAHEKFIQVSKAYEVLSNSETRTIYDRHGEQGLKQHEAQKSGGSQ
                     DPFARFFGGGAAQEQKGPGLITNVEVSLADLYTGRTLEFQIPRRVICPHCHGSGAESE
                     KDIHSCNKCGGQGVVVQRHQVFPGMFTNVQMTCPHCNGKGKQITRSCHVCHSEKTVQT
                     QHTLALHIPAGAPEGFEEVFHGEADEQIDMEAGDVVVRVRSKLNEGEGAWRRKENGIL
                     GRVTLSVAEALLGFERRLTHLDGRTITLSRTGTTQPGEVEVIEGEGMPSYMDIPPGDM
                     FIEYSVVFPTAVSSETRQKLSDILKYAPPVHHDEL"
     gene            <35315..36740
                     /locus_tag="CNL03790"
                     /db_xref="GeneID:3254840"
     mRNA            join(<35315..35698,35869..36328,36385..36740)
                     /locus_tag="CNL03790"
                     /product="expressed protein"
                     /transcript_id="XM_568203.1"
                     /db_xref="GI:58261585"
                     /db_xref="GeneID:3254840"
     CDS             join(35315..35698,35869..36328,36385..36515)
                     /locus_tag="CNL03790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568203.1"
                     /db_xref="GI:58261586"
                     /db_xref="GeneID:3254840"
                     /translation="MYIYTADTGLRSFLSAPLIAFSQHHSNQPINTTTTLTPAIMTRT
                     EVSFGRSTARAGDVSISIPQWSCMPSLDQANNCPSASSPILPITVCLPVLYALWTAAL
                     LRPHVNVPSPWYLHLECLLPPCCALIRNQYPAAVLKDRHSRTGLDKTQWNHKNGDGAH
                     NWGSTARKGDDEASGRLDGEAEAEAALDELPSSDVFDLDEEINDPVGAMPVTDSGNDF
                     KPMDLGKRGSIQGQSNIATSPTDSMSSLDSGDRPGMGRRMSAVSDEEREKMRLYREGV
                     LHKKQGVDLAHIARSSHGIAMSPPTNSYLGPVSPSNTRYGFNFVSVQL"
     gene            <38426..42135
                     /locus_tag="CNL03800"
                     /db_xref="GeneID:3254845"
     mRNA            join(<38426..38604,38782..38923,38982..39105,39168..39253,
                     39303..39456,39502..40376,40429..40499,40555..40650,
                     40699..42135)
                     /locus_tag="CNL03800"
                     /product="telomere maintenance protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531325|gb|CF677166.1,gi|41538085|gb|CF683926.1,
                     gi|41560749|gb|CF706590.1,gi|41561317|gb|CF707158.1,
                     gi|41571663|gb|CF717504.1,gi|41575032|gb|CF720873.1"
                     /transcript_id="XM_567940.1"
                     /db_xref="GI:58261059"
                     /db_xref="GeneID:3254845"
     mRNA            join(<38426..38604,38782..38923,38982..39003,39064..39105,
                     39168..39253,39303..39456,39502..40376,40429..40499,
                     40555..40650,40699..42135)
                     /locus_tag="CNL03800"
                     /product="telomere maintenance protein, putative"
                     /transcript_id="XM_567941.1"
                     /db_xref="GI:58261061"
                     /db_xref="GeneID:3254845"
     CDS             join(38426..38604,38782..38923,38982..39105,39168..39253,
                     39303..39456,39502..40376,40429..40499,40555..40650,
                     40699..41827)
                     /locus_tag="CNL03800"
                     /codon_start=1
                     /product="telomere maintenance protein"
                     /protein_id="XP_567940.1"
                     /db_xref="GI:58261060"
                     /db_xref="GeneID:3254845"
                     /translation="MTCLQYMGVVFERHWRDPIISVTQSHGCESSYRPTVSYSILPSN
                     RCTPSPPLSTPQSSQPSQNIHSASAASSHMSSLFEAAAAFEEAAAHGANPVILERSGK
                     GHSPVVTMTDMSGASSRAPTSAEIDAVIAAAIANAPPPPPSDFNSDINRSVTPLMTNL
                     LPSAVGSDGRVNLFVGNLPYRVRWQDLKDLFRKAGTVLRADVSLGPDNRSRGYGTVLM
                     GSREDAARAIDRYNGYTWQTRTLEVRPDRLPPEYEPQSHPIHHNANPRSAMYSFHNFP
                     GPSHTPFSIPGHITPQSGQGWLPGQIPSSRPFSAAGGLIPGGMGVPSSSSAVGLTSST
                     PIPGAQSPPSVFGAQPLPLSVQNTGLNAFHSLGQSPLAGSLTSGTGAAMPAGVSAVRR
                     DSLTPFGASLTTFDSAAAPLSSTSPNMAVSRPTSSSGSVKPPSPGGSRAPPPGTLGPL
                     PPSLFAGIKPAPAVDAIAPTIAGDVPAQSPNGGAGRLAAAPIPQLEGLANQGMGLGPP
                     STLHDRVIFVSNLPLSMQWQDLKDMLRPAGTIIRADVATDAHGKPRGFGTALFATEAD
                     ATRAVLLFNDREIGGFRIRAHLERDIHPEVSQRSARNSVSGEATSLGIQDHLTGVPEG
                     VKDMLQSNGITPIDTSVPSTKPSSTSPIAKLPWSLNTSLQTHTAPGHGQPPHGEPSPT
                     SHTPVFRHPHHPGPISMPPFHMEHGNPISPLHTRGLPPMTPSMPGFVFNYPETPPLHG
                     HASHFMSPAAGPFSPGIPVTSPGAFQYNPFLNPAPGAPVNRFPSTPGNHPQAGSAALG
                     TPTTQAFPNGPIGYGQYAGPPGGALQGKSENSPQARQGQDYFANAIPPQHATSTAGNR
                     TLGVGALGGKDKLRSSPLSGGDGQNDSDEETRAPSAVGDELAKMAEELTVDDENEDGE
                     PGRQSSSGLSLSGLGSSAAVSPRGGRASMDDGKLGRH"
     CDS             join(38426..38604,38782..38923,38982..39003,39064..39105,
                     39168..39253,39303..39456,39502..40376,40429..40499,
                     40555..40650,40699..41827)
                     /locus_tag="CNL03800"
                     /codon_start=1
                     /product="telomere maintenance protein"
                     /protein_id="XP_567941.1"
                     /db_xref="GI:58261062"
                     /db_xref="GeneID:3254845"
                     /translation="MTCLQYMGVVFERHWRDPIISVTQSHGCESSYRPTVSYSILPSN
                     RCTPSPPLSTPQSSQPSQNIHSASAASSHMSSLFEAAAAFEEAAAHGANPVILERSGK
                     GHSPVVTMTDMSANAPPPPPSDFNSDINRSVTPLMTNLLPSAVGSDGRVNLFVGNLPY
                     RVRWQDLKDLFRKAGTVLRADVSLGPDNRSRGYGTVLMGSREDAARAIDRYNGYTWQT
                     RTLEVRPDRLPPEYEPQSHPIHHNANPRSAMYSFHNFPGPSHTPFSIPGHITPQSGQG
                     WLPGQIPSSRPFSAAGGLIPGGMGVPSSSSAVGLTSSTPIPGAQSPPSVFGAQPLPLS
                     VQNTGLNAFHSLGQSPLAGSLTSGTGAAMPAGVSAVRRDSLTPFGASLTTFDSAAAPL
                     SSTSPNMAVSRPTSSSGSVKPPSPGGSRAPPPGTLGPLPPSLFAGIKPAPAVDAIAPT
                     IAGDVPAQSPNGGAGRLAAAPIPQLEGLANQGMGLGPPSTLHDRVIFVSNLPLSMQWQ
                     DLKDMLRPAGTIIRADVATDAHGKPRGFGTALFATEADATRAVLLFNDREIGGFRIRA
                     HLERDIHPEVSQRSARNSVSGEATSLGIQDHLTGVPEGVKDMLQSNGITPIDTSVPST
                     KPSSTSPIAKLPWSLNTSLQTHTAPGHGQPPHGEPSPTSHTPVFRHPHHPGPISMPPF
                     HMEHGNPISPLHTRGLPPMTPSMPGFVFNYPETPPLHGHASHFMSPAAGPFSPGIPVT
                     SPGAFQYNPFLNPAPGAPVNRFPSTPGNHPQAGSAALGTPTTQAFPNGPIGYGQYAGP
                     PGGALQGKSENSPQARQGQDYFANAIPPQHATSTAGNRTLGVGALGGKDKLRSSPLSG
                     GDGQNDSDEETRAPSAVGDELAKMAEELTVDDENEDGEPGRQSSSGLSLSGLGSSAAV
                     SPRGGRASMDDGKLGRH"
     gene            complement(<42332..>43670)
                     /locus_tag="CNL03810"
                     /db_xref="GeneID:3254798"
     mRNA            complement(join(<42332..42636,42705..42811,42857..42884,
                     43011..43184,43253..43293,43348..>43670))
                     /locus_tag="CNL03810"
                     /product="FMN adenylyltransferase, putative"
                     /transcript_id="XM_568206.1"
                     /db_xref="GI:58261591"
                     /db_xref="GeneID:3254798"
     CDS             complement(join(42332..42636,42705..42811,42857..42884,
                     43011..43184,43253..43293,43348..43670))
                     /locus_tag="CNL03810"
                     /codon_start=1
                     /product="FMN adenylyltransferase"
                     /protein_id="XP_568206.1"
                     /db_xref="GI:58261592"
                     /db_xref="GeneID:3254798"
                     /translation="MPNILCFLFNFYPPFVFGKTGDHRNEIREDGLIYRALRGYYVFS
                     VARPRCLLQRFESPQRPQRAAIGTMANISQSLHALLERAQKQDSLGKLIIEALVLIES
                     VIDILGEETVAISFNGGKDCTVLLHLYAAVLYARHTPSLPPHLFPKPSPKITIPPLPS
                     RTPQEPLSPQPVLPPSLPASPNPFAELDEFGGGMKAALEEWLGCGGGRGVKGVLVGTR
                     QGDPNDAPTDPSWPQFIRVHPILHWTYSDVWDFLLELQVPYCILYDQGYTSLGSTTNT
                     LPNPLLKSESVEGGWEPAHRRKSVIGIFEPAVLMRGLVKDASQERAGRH"
     gene            complement(<44510..>45632)
                     /locus_tag="CNL03820"
                     /db_xref="GeneID:3255032"
     mRNA            complement(join(<44510..44550,44704..44817,45050..45080,
                     45242..45279,45351..45531,45627..>45632))
                     /locus_tag="CNL03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_568246.1"
                     /db_xref="GI:58261671"
                     /db_xref="GeneID:3255032"
     CDS             complement(join(44510..44550,44704..44817,45050..45080,
                     45242..45279,45351..45531,45627..45632))
                     /locus_tag="CNL03820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568246.1"
                     /db_xref="GI:58261672"
                     /db_xref="GeneID:3255032"
                     /translation="MADGLAFWTSDGIPGIQVDHWSDTAVGANRNSVRITTKSLFEGG
                     LFIIDLALMPWGCGVWPAFWTLGYEGTWPETSNDYVSSAPKGGSGCSIISASNSSYGM
                     PFNSAGGGVFAMKWDTDGIRMSSLRRRLIPTLVG"
     gene            complement(46764..49705)
                     /locus_tag="CNL03830"
                     /db_xref="GeneID:3254741"
     mRNA            complement(join(46764..47225,47281..47459,47514..47690,
                     47743..47934,47984..48363,48431..48761,48879..49124,
                     49178..49282,49357..49493,49549..49705))
                     /locus_tag="CNL03830"
                     /product="clathrin binding protein, putative"
                     /transcript_id="XM_567943.1"
                     /db_xref="GI:58261065"
                     /db_xref="GeneID:3254741"
     mRNA            complement(join(46764..47225,47281..47459,47514..47690,
                     47743..47934,47984..48363,48431..48830,48879..49124,
                     49178..49282,49357..49493,49549..49705))
                     /locus_tag="CNL03830"
                     /product="clathrin binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534123|gb|CF679964.1,gi|41534131|gb|CF679972.1,
                     gi|41536158|gb|CF681999.1,gi|41536169|gb|CF682010.1,
                     gi|41537121|gb|CF682962.1,gi|41540129|gb|CF685970.1,
                     gi|41540140|gb|CF685981.1,gi|41544460|gb|CF690301.1,
                     gi|41545002|gb|CF690843.1,gi|41548136|gb|CF693977.1,
                     gi|41551926|gb|CF697767.1,gi|41551936|gb|CF697777.1,
                     gi|41564989|gb|CF710830.1,gi|41564995|gb|CF710836.1,
                     gi|41572612|gb|CF718453.1,gi|41573656|gb|CF719497.1,
                     gi|41574870|gb|CF720711.1,gi|41574879|gb|CF720720.1,
                     gi|41575597|gb|CF721438.1"
                     /transcript_id="XM_567942.1"
                     /db_xref="GI:58261063"
                     /db_xref="GeneID:3254741"
     CDS             complement(join(46799..47225,47281..47459,47514..47690,
                     47743..47934,47984..48363,48431..48761,48879..49124,
                     49178..49282,49357..49493,49549..49573))
                     /locus_tag="CNL03830"
                     /codon_start=1
                     /product="clathrin binding protein"
                     /protein_id="XP_567943.1"
                     /db_xref="GI:58261066"
                     /db_xref="GeneID:3254741"
                     /translation="MAMAPPRKGENWELRQQLNSEYRDKRADAIKRVIANHTIGKDCS
                     GLFPDVVKNMQTDDLEQKKLVYLYLMNYAKTQPELVILAVNTFVKDTADPNPLVRALA
                     IRTMSILRAEKILDYLASPLSRCLKDENPYVRKTAALCVAKVFDLKPELAIEYGFIET
                     LRDLIGDGNPMPGSPNDDESPSSVRPNQSLFIIDPATLTKLLVALNECSEWGRIAILT
                     TLARYRTNDEKESEHICERVMPQFQHVNAAVVLGAVKVIMIHMKNVTKEDLLKSLTRK
                     MAPPLVTLISSPPEVQWVALRNINLLLQKRPDILASEMRVFFCKYNDPSYVKVEKLEI
                     MVRLANEKNVDTLLGELKEYASEVDVDFVRKAVRAVGQVAIKIDEAAGRCVEVLMELI
                     ETRVSYVVQEAVIVVKDIFRKYPHSYEGIIPALCANLEELDEPEAKASLIWLIGEYAE
                     KIENADELLGAFLETFSEESYPVQLQTLTAIVKLFLKKPDESQAIVQKVLQAATKDCD
                     SPDVRDRAYIYWRLLSSDPAAAKSVVLSVRPPISLPQTTVAPAILEELIGEISTLASV
                     YHKPAATFIGKGRLGADEMHKKSLDAEDDVSREKALQAVVAGNQAENLLDFDDEPTPT
                     NGESSIPAPGAGLGISSQAIASAAKSTNPLDELMDLFSTASMTTPVVQPGQPAAQAQT
                     SAQSSGGLGGLNGLAGLSSPPQSVSPQPGAPQSQKQQQQAAAQDDLLGLF"
     CDS             complement(join(46799..47225,47281..47459,47514..47690,
                     47743..47934,47984..48363,48431..48830,48879..49124,
                     49178..49282,49357..49493,49549..49573))
                     /locus_tag="CNL03830"
                     /codon_start=1
                     /product="clathrin binding protein"
                     /protein_id="XP_567942.1"
                     /db_xref="GI:58261064"
                     /db_xref="GeneID:3254741"
                     /translation="MAMAPPRKGENWELRQQLNSEYRDKRADAIKRVIANHTIGKDCS
                     GLFPDVVKNMQTDDLEQKKLVYLYLMNYAKTQPELVILAVNTFVKDTADPNPLVRALA
                     IRTMSILRAEKILDYLASPLSRCLKDENPYVRKTAALCVAKVFDLKPELAIEYGFIET
                     LRDLIGDGNPMVVANAVAALGDIHEASLNLPSSQPGSPNDDESPSSVRPNQSLFIIDP
                     ATLTKLLVALNECSEWGRIAILTTLARYRTNDEKESEHICERVMPQFQHVNAAVVLGA
                     VKVIMIHMKNVTKEDLLKSLTRKMAPPLVTLISSPPEVQWVALRNINLLLQKRPDILA
                     SEMRVFFCKYNDPSYVKVEKLEIMVRLANEKNVDTLLGELKEYASEVDVDFVRKAVRA
                     VGQVAIKIDEAAGRCVEVLMELIETRVSYVVQEAVIVVKDIFRKYPHSYEGIIPALCA
                     NLEELDEPEAKASLIWLIGEYAEKIENADELLGAFLETFSEESYPVQLQTLTAIVKLF
                     LKKPDESQAIVQKVLQAATKDCDSPDVRDRAYIYWRLLSSDPAAAKSVVLSVRPPISL
                     PQTTVAPAILEELIGEISTLASVYHKPAATFIGKGRLGADEMHKKSLDAEDDVSREKA
                     LQAVVAGNQAENLLDFDDEPTPTNGESSIPAPGAGLGISSQAIASAAKSTNPLDELMD
                     LFSTASMTTPVVQPGQPAAQAQTSAQSSGGLGGLNGLAGLSSPPQSVSPQPGAPQSQK
                     QQQQAAAQDDLLGLF"
     misc_feature    48396..48419
                     /note="AT_rich"
     gene            complement(49891..51502)
                     /locus_tag="CNL03840"
                     /db_xref="GeneID:3254910"
     mRNA            complement(join(49891..50369,50422..50611,50666..50760,
                     50811..50908,50960..51120,51200..51502))
                     /locus_tag="CNL03840"
                     /product="1-acylglycerol-3-phosphate O-acyltransferase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540049|gb|CF685890.1,gi|41545285|gb|CF691126.1,
                     gi|41545792|gb|CF691633.1,gi|41545798|gb|CF691639.1,
                     gi|41550925|gb|CF696766.1,gi|41550932|gb|CF696773.1,
                     gi|41560365|gb|CF706206.1"
                     /transcript_id="XM_567944.1"
                     /db_xref="GI:58261067"
                     /db_xref="GeneID:3254910"
     CDS             complement(join(49993..50369,50422..50611,50666..50760,
                     50811..50908,50960..51120,51200..51388))
                     /locus_tag="CNL03840"
                     /codon_start=1
                     /product="1-acylglycerol-3-phosphate O-acyltransferase"
                     /protein_id="XP_567944.1"
                     /db_xref="GI:58261068"
                     /db_xref="GeneID:3254910"
                     /translation="MGISWLLKPVALVSTVALSTLGVLSRRYQRARFYFNLTIYVSTL
                     GLMSVWGVVVSILATAAGQRLNINYYVARSLYGLSGPLLGIKFEVEGEEHLEGLMTAR
                     DGQHQGAVLLSNHQSFLDILYIGRIFPKQAAIMAKKELKWTPLLGQFMSLSGAVFVNR
                     KNRHDAVKALAIAGEDMKKKGVSLWIFPEGTRSSSPEPTLLPFKKGAFHLAVQAQIPI
                     VPIVCENYHRLFDGRTRFESGVLKIRVLPPIPTTGLTVDDVTSLAESTRESMLHALRE
                     ISEPGPSSSTPIPTSAEVPLAPPISRNTTQPPAGDSIQLDISESGALRQRGVHSSGVS
                     SEWSEGKFEAQSEETTEDEMDEDVVLLKKPKENVA"
     gene            51644..52491
                     /locus_tag="CNL03850"
                     /db_xref="GeneID:3254775"
     mRNA            join(51644..51706,51755..51842,51904..51981,52032..52078,
                     52134..52180,52233..52317,52369..52491)
                     /locus_tag="CNL03850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568204.1"
                     /db_xref="GI:58261587"
                     /db_xref="GeneID:3254775"
     CDS             join(51704..51706,51755..51842,51904..51981,52032..52078,
                     52134..52180,52233..52317,52369..52440)
                     /locus_tag="CNL03850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568204.1"
                     /db_xref="GI:58261588"
                     /db_xref="GeneID:3254775"
                     /translation="MSRTVDIPQDVLDALKQFRFKNSKGTTAISVKIIKNSLTMAVDE
                     EFEGQSIEEIAEELPENAPRYVLLSHELKHKDGRISYPLLLINWAPTTSPIELMTLHA
                     SSLSYFQQVSETAKVLEARDGAEGLTTEAVDEKLLSH"
     gene            54662..>56924
                     /locus_tag="CNL03860"
                     /db_xref="GeneID:3254849"
     mRNA            join(54662..55062,55107..55731,55793..>56924)
                     /locus_tag="CNL03860"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41564955|gb|CF710796.1,gi|41564968|gb|CF710809.1"
                     /transcript_id="XM_567945.1"
                     /db_xref="GI:58261069"
                     /db_xref="GeneID:3254849"
     CDS             join(54753..55062,55107..55731,55793..56924)
                     /locus_tag="CNL03860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567945.1"
                     /db_xref="GI:58261070"
                     /db_xref="GeneID:3254849"
                     /translation="MPTRLSQRSALAPTRILEPKRHSSDQSFGGIKLQIRQRVPQLSI
                     SKDKFRNESLRTKTLDQQEKEDGEFYYQQEDAGMPSEAYVCEKNIAKKPSRPFVSKGS
                     HQLKVIASLPSISTSPSAFSFPEQPLRESISKSIDLWFDDFKTDSFISTSTIDNPPPT
                     PPPKITIESDEQPTPKATQVAFNIATAVREAPSINSFTANGSFLGLPEEADMLYRSNI
                     VWGDLDHSEDQQTSHKKLAAAQHLSPASAGSQKHIKAADLRFEDAESEASRARNEGSC
                     DLNDNTEKSEPLDKPLPHLPDDSGPSEYSMTTYSQSLSHSGNHQHRADSGITLSQLNP
                     MSIATNLSKVKRNKARPSVIRRAIVRLDGNLPDRMVSVPRGNYGIVIQLMSRVAQVKP
                     ESTRARHGKAGSVSSTATAKTIGQSHYPAGSTLTRNHIRAVAPQETSRLVIDHSIAPA
                     KPIMDTVTNRINSAKGSKSTRGSFELNDHAVVRASTAENQTIHSLVEDDDVEIIGDFT
                     FASSRRPSVSSSVKTMGTVSFASATAARAPRISLRSPHDRNTSSQDSPAQHPVRARSQ
                     SEDPVPRCIFGISAIFSQSKPGPNRKGHRSILDPFSSFDPHVPIVPCKTVPNDNWILI
                     TNTAEDDILRPGWKDVEMRWVEGESFGGWMMRRIRGECWNTVVAREKRADEQLRMMEL
                     RDGKGG"
     gene            complement(57578..59771)
                     /locus_tag="CNL03870"
                     /db_xref="GeneID:3254824"
     mRNA            complement(join(57578..58314,58374..58522,58575..58766,
                     58815..59421,59475..59771))
                     /locus_tag="CNL03870"
                     /product="xylulokinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41569206|gb|CF715047.1,gi|41569213|gb|CF715054.1,
                     gi|41572411|gb|CF718252.1,gi|41572420|gb|CF718261.1,
                     gi|41575201|gb|CF721042.1,gi|41575214|gb|CF721055.1"
                     /transcript_id="XM_567946.1"
                     /db_xref="GI:58261071"
                     /db_xref="GeneID:3254824"
     CDS             complement(join(57658..58314,58374..58522,58575..58766,
                     58815..59421,59475..59750))
                     /locus_tag="CNL03870"
                     /codon_start=1
                     /product="xylulokinase"
                     /protein_id="XP_567946.1"
                     /db_xref="GI:58261072"
                     /db_xref="GeneID:3254824"
                     /translation="MTSPLFLGLDASTQSLKASLLSVNLDVVAECAIHFDSDLPQFGT
                     KGGVHFGSDGQVHSPVMMLVGAMDLLFDKIKIAGWKVDDIRGVAAAGQQHASVYWSKT
                     SPKILASLNSSLPLSSQLVEAFSRPIIPNWQDSSTTAECQALDAAVGGPAALAQLTGS
                     RAYERFTGAQIMRFKRVDPVAYDQTDRIGLVSNSVTTLLCLDGEVKGIDESDACGMNL
                     WTMNRKQRGWNQELLKAIAGDDGAAELSRKLGTVETDGGRVVGRIGKWFVDRYGFSSE
                     CCVFPGTGDNPATFLSLTLRESEGLVSLGTSDVVLISTSAYHPDPDYHAFFHPAQIAP
                     PSEQDDQNRQGAEPLRYFNMIVYKNGSLTRQHVRDLYFDGSWDKFNAAIEELRPKSVI
                     DLPSRTAFWWLLPDIVPHGAHGIYKYITEPTAGTLFEVPAAKKVDQFPDIRQEALALL
                     ESQLFNYRSRASVILDDSSTPYDPSSPNVDAFLPRLTKVYATGGASANRTILSLMADV
                     LSTKVCKNVEYLDGKWKDADWNACSVGVAYKARWGWERVIAADGDERKWVGFDTVIRE
                     CREARKKIRGDEGRGLELEEEGIRIVASPGPGSRAYERRIEWWRELERKALAEQRAEK
                     TA"
     gene            60609..64873
                     /locus_tag="CNL03880"
                     /db_xref="GeneID:3254894"
     mRNA            join(60609..60918,60972..61918,61967..62099,62152..62455,
                     62503..62874,62932..63010,63066..63210,63360..63407,
                     63456..63943,63998..64409,64462..64873)
                     /locus_tag="CNL03880"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41548866|gb|CF694707.1,gi|41548870|gb|CF694711.1"
                     /transcript_id="XM_567947.1"
                     /db_xref="GI:58261073"
                     /db_xref="GeneID:3254894"
     CDS             join(60698..60918,60972..61918,61967..62099,62152..62455,
                     62503..62874,62932..63010,63066..63210,63360..63407,
                     63456..63943,63998..64409,64462..64813)
                     /locus_tag="CNL03880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567947.1"
                     /db_xref="GI:58261074"
                     /db_xref="GeneID:3254894"
                     /translation="MASAPIASASEQPLTSTNPQLGPEPYFTYPTPTPDQLEEELPPY
                     FENENVSLGLVLDRFARKGNHDLRVLLGEVLPQLSIRERPKPIIEYAKTTRQALLKYL
                     AVLRWKTSVDIASTSTGSSVANTAGPASFPTPHSNNDPNDNSPDAFAGKGKSKTQADE
                     SVIKGKVTDAKRIAHFMEHQNQQHEVAIEHVKHVTKVVEGLRERNPDLLTALSLLATG
                     TYNRLPASLVDPYLPKPVLTNSAILKVLRRLNRQIRYRLRCLDYLPPELIVEDIKDGR
                     MYARGDGWRAELTVVGFEDTSRWWLTGVEWGWKAKEKGVDDPGGRVTKKFTGEERQGI
                     LDIANGEVLPPRELPENEMEVDTVITEDPQVKKSEVVEVVKKTVDAPLVRVYNLLQHL
                     SLSYRLEVLFTQAIALSQGKWRGQLIPEMDREDKTLRLKYWLRERPMQVQRQDSTSIK
                     RPQAPATLPASRQTMVGGIIHITLAEKTTPRSELDNLLSDIACGGLVPSERVLRLELN
                     VKWVVDEAGVGGGLKSGDVMDNSMLHLDPDALSVEDLLHVCTRTHASHLTRSHGTSLL
                     TSPRFLNASSVQPSLQESTDPSARPLTLRVPLPSRYAVSHLLIGVSSFSGLLEVEDEG
                     AKGNDARAERAAMSMKSVNEGKTKLVDDITRLTTAIVVENIEAQMRQLGWKPTRQIAL
                     RLKDLIKADLHPVTTVFVPLASSPNHYFVTKAVQNGIVFELLKVAKVPNENGFEVQNK
                     DLKDLFILSNALVAQTIVEQQLKDRSIPYIQQFPPTAGPASPKSTSPLAGMVPTICVD
                     VRDLLRAGRGGGSAAMEVAMPKVWLQIEGWWEGGKCEVVTIVVLRHQPSTVAPGTVSQ
                     EGEDEKDRGESAKAEGISFDPKSSIVRFRAKDISRCVPAFLEQWERLSKVIVVAGEVS
                     RLNKTESFKDVKILSFDLRTATLQYAPGHNASITYSPTDDSYRITFFLSSPSSDTDRN
                     PHELVAPLLSARLNELTSTGIAGENKPKGQVGREFMGLLKNTLPVLKIGKILETKMGW
                     GVVVLGVAKYRLIKDHNGKRFSVDVTLLPDLEHYLIQDGATPRGPDHVVDVYTGPLTS
                     LEMDKVVHAVFDAEKSVSLAETGDEKGQGKKRHVPPVMKLDQGKSLVCEVARFERVLR
                     KVMEEASKVMGLGNNMEMDS"
     gene            complement(<65003..>65673)
                     /locus_tag="CNL03890"
                     /db_xref="GeneID:3254791"
     mRNA            complement(join(<65003..65187,65243..65314,65431..65557,
                     65662..>65673))
                     /locus_tag="CNL03890"
                     /product="U6 snRNA binding protein, putative"
                     /transcript_id="XM_568205.1"
                     /db_xref="GI:58261589"
                     /db_xref="GeneID:3254791"
     CDS             complement(join(65003..65187,65243..65314,65431..65557,
                     65662..65673))
                     /locus_tag="CNL03890"
                     /codon_start=1
                     /product="U6 snRNA binding protein"
                     /protein_id="XP_568205.1"
                     /db_xref="GI:58261590"
                     /db_xref="GeneID:3254791"
                     /translation="MSSRGGRGGARGGGNQGGERKKRESILNLAQFVDKSIRVKFMGG
                     REATGILKGYDQLMNLVMDDVVEEYEDGRPTRSLGLVVLRGPNIVLVSPTDGSSGKSF
                     LKSIRNGQSKSVNMRQSFRNRKPFPTVIM"
     gene            65867..67935
                     /locus_tag="CNL03900"
                     /db_xref="GeneID:3255039"
     mRNA            join(65867..65927,65972..66038,66086..66199,66248..67351,
                     67400..67935)
                     /locus_tag="CNL03900"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540853|gb|CF686694.1,gi|41540861|gb|CF686702.1,
                     gi|41549836|gb|CF695677.1,gi|41563945|gb|CF709786.1,
                     gi|41571839|gb|CF717680.1,gi|41571846|gb|CF717687.1"
                     /transcript_id="XM_567948.1"
                     /db_xref="GI:58261075"
                     /db_xref="GeneID:3255039"
     CDS             join(65894..65927,65972..66038,66086..66199,66248..67351,
                     67400..67883)
                     /locus_tag="CNL03900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567948.1"
                     /db_xref="GI:58261076"
                     /db_xref="GeneID:3255039"
                     /translation="MSTDQVDVSFKVLSLLSKERAVYGLRNGDHERYRRHCSNKVHRL
                     RQVTGTTCGKKTYKAPSKIEVESVKDVRQLQLLLFLAERALAHSHELKKNKNHSKKDQ
                     LSWLRQAFKVSTQLYFLVQSLSASSSDLPGRVDAKTLGEITIYHLTIRSELSFEKSNW
                     IESLTDLACRRKLLTTLGEGAKDSYDEALANEFIDSHDPLIRYCAYKLGRAESHDIEG
                     VMADIEPEVLEEALPGMSQLLESLRTETGVEEMEEGRRKLEDVEFAGEKVELRNAEIV
                     GVMVRVQDALSKLGDGKSKGARGMKRWDRVLSVLGEAEGVARKLLEDNEANGASSSLR
                     STRTAQSLALAHQYIIYLLLTHRIRRDLALVETLSSSPVPKDPTQFKVQGGKAKLEEA
                     VKTLGAVVKLYGTMLQSLKQAAELSVVQEKEGVRSGVEGLEAYFHAIRCYNLARLHCI
                     HPDPSYSSAVQLLSNASLSLRQAQDFLASPVDEPIVSVPAEDLSSLSKNISALEKASK
                     RGLFGRSVEKPVFFDMAFNYIDLPIDELQRLAGNGEKVQVATVKTQEKEVEIKPVENM
                     KKSRDSRETTPAVDSQEEKQEGKKGWLGGWFGRK"
     gene            complement(<68054..>68717)
                     /locus_tag="CNL03910"
                     /db_xref="GeneID:3254740"
     mRNA            complement(join(<68054..68127,68209..68287,68341..68378,
                     68430..68477,68528..>68717))
                     /locus_tag="CNL03910"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_567949.1"
                     /db_xref="GI:58261077"
                     /db_xref="GeneID:3254740"
     CDS             complement(join(68054..68127,68209..68287,68341..68378,
                     68430..68477,68528..68717))
                     /locus_tag="CNL03910"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_567949.1"
                     /db_xref="GI:58261078"
                     /db_xref="GeneID:3254740"
                     /translation="MSAPASYLEHHEPLATELHPISDATLTVRVIKSFEFRTQKSVVL
                     KNLDLRTLTVEALMNLVREEVKKGAGFKPYRNLVLDTMKLYTVAHGHKTQNLIINLDH
                     DEWILDPSKTLEEVGAQNETELSFFNREAYEKFKLDPEVS"
     gene            complement(75628..77702)
                     /locus_tag="CNL03920"
                     /db_xref="GeneID:3255006"
     mRNA            complement(join(75628..76126,76190..76283,76339..76426,
                     76480..76522,76573..76944,77010..77175,77235..77513,
                     77567..77629,77670..77702))
                     /locus_tag="CNL03920"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531472|gb|CF677313.1,gi|41535750|gb|CF681591.1,
                     gi|41535755|gb|CF681596.1,gi|41541896|gb|CF687737.1,
                     gi|41541901|gb|CF687742.1,gi|41545996|gb|CF691837.1,
                     gi|41546001|gb|CF691842.1,gi|41548488|gb|CF694329.1,
                     gi|41548497|gb|CF694338.1,gi|41553481|gb|CF699322.1,
                     gi|41553491|gb|CF699332.1,gi|41553860|gb|CF699701.1,
                     gi|41553865|gb|CF699706.1,gi|41554674|gb|CF700515.1,
                     gi|41554678|gb|CF700519.1,gi|41555942|gb|CF701783.1,
                     gi|41555949|gb|CF701790.1,gi|41558242|gb|CF704083.1,
                     gi|41563997|gb|CF709838.1,gi|41564008|gb|CF709849.1,
                     gi|41567584|gb|CF713425.1,gi|41567593|gb|CF713434.1,
                     gi|41567912|gb|CF713753.1,gi|41567918|gb|CF713759.1,
                     gi|41571539|gb|CF717380.1,gi|41571551|gb|CF717392.1,
                     gi|41573226|gb|CF719067.1,gi|41574902|gb|CF720743.1,
                     gi|41574910|gb|CF720751.1"
                     /transcript_id="XM_567950.1"
                     /db_xref="GI:58261079"
                     /db_xref="GeneID:3255006"
     CDS             complement(join(76017..76126,76190..76283,76339..76426,
                     76480..76522,76573..76944,77010..77175,77235..77513,
                     77567..77629,77670..77699))
                     /locus_tag="CNL03920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567950.1"
                     /db_xref="GI:58261080"
                     /db_xref="GeneID:3255006"
                     /translation="MSTTMVPVPQEELPVLEALINIRNRLTALKKDTTKFIRAPDVMP
                     IYNSVVKQITRLNAIRDEQQQSHSALNPAPGSSTKPPPPPEANRVDQLLADVFGLLSL
                     FFLTVGKSRETPAIYCQIASMRQILSHMDESGAYTEQFLIPFRERLDQLRSVIKQDSL
                     EGKHPEPIVRLMIRKLEGVERQLDELFQSLTVLSVELVPIHQRLVQLRKELAALAAEP
                     KPNKAEYKAILEELRKTDSKRVDGKFLGPGGSSVPEGQALLSGLLETCFEITQDIKAR
                     EAEEEVGPSLKPIYDRLSQMKNQLDQMTLTHRWTLRETDLYNYAMALREIDAMRVDGK
                     FVDADGNKAEGQYALMFLLRRCYGLIYRLMSESEPISEELLPIASKQTLHNQEMSQRS
                     PQIRRALHRARSLPLPPRPAPD"
     gene            77996..80107
                     /locus_tag="CNL03930"
                     /db_xref="GeneID:3254994"
     mRNA            join(77996..78037,78344..78367,78829..78892,78945..79251,
                     79303..79473,79526..79627,79678..79748,79807..80107)
                     /locus_tag="CNL03930"
                     /product="14-3-3 protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533813|gb|CF679654.1,gi|41533828|gb|CF679669.1,
                     gi|41538580|gb|CF684421.1,gi|41538588|gb|CF684429.1,
                     gi|41557443|gb|CF703284.1,gi|41562986|gb|CF708827.1"
                     /transcript_id="XM_567951.1"
                     /db_xref="GI:58261081"
                     /db_xref="GeneID:3254994"
     CDS             join(78829..78892,78945..79251,79303..79473,79526..79627,
                     79678..79748,79807..79862)
                     /locus_tag="CNL03930"
                     /codon_start=1
                     /product="14-3-3 protein"
                     /protein_id="XP_567951.1"
                     /db_xref="GI:58261082"
                     /db_xref="GeneID:3254994"
                     /translation="MSNREDSVYLAKLAEQAERYEEMVENMKSVASSDQELTVEERNL
                     LSVAYKNVIGARRASWRIVSSIEQKEESKGNEAQVAMIKAYREKIEAELAKICEDILE
                     VLDKHLIPSAASGESKVFYHKMMGDYHRYLAEFATGDKRKDSADKSLEAYKAASDVAV
                     TELPPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELDTLSEESYKDST
                     LIMQLLRDNLTLWTSDMNEPEKEEKPEETKQEEVAPAA"
     gene            complement(80159..81665)
                     /locus_tag="CNL03940"
                     /db_xref="GeneID:3254900"
     mRNA            complement(join(80159..81185,81249..81665))
                     /locus_tag="CNL03940"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539896|gb|CF685737.1,gi|41539898|gb|CF685739.1,
                     gi|41544263|gb|CF690104.1,gi|41544271|gb|CF690112.1,
                     gi|41549152|gb|CF694993.1,gi|41571673|gb|CF717514.1,
                     gi|41571686|gb|CF717527.1"
                     /transcript_id="XM_567952.1"
                     /db_xref="GI:58261083"
                     /db_xref="GeneID:3254900"
     CDS             complement(join(80169..81185,81249..81608))
                     /locus_tag="CNL03940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567952.1"
                     /db_xref="GI:58261084"
                     /db_xref="GeneID:3254900"
                     /translation="MADLTPGARKPAPAELTGFRSALAHTGIPHGVLLWKPRLPSRNW
                     LVFWSVSLSLSYAYYYDRAECKRIKQEVVERVEKYGREPMPGGSLGEPRRVVVWAGRW
                     GGDDDADRAGRYFRKYVKPYLVAAGIDYTLPSVPLHGSITRQLHAAILLQRRQALGLA
                     PTATPLSLPGVLDPAEAKRREVESGVVVVGRASLKEYLEGLRRGWECGVDEWAWETEV
                     EKTLAGDGVFESVESPVEPAVETAETVVEPTADAVPKSNFGFLARPAPVTPGAPAIPA
                     HLHTPPSPLPPTPPLLLLPFTNHLGFLQLPYMILDFFNERAKVRQGAQSALALIEGPT
                     RDMHREDAEHWEEKSESWYNKTARQLPERLQKSRTEYYEAIKSRIDLARAYENGDREM
                     TEEEKKANKVERIQDIQAERLKKELRWKGSEEGWEIVKPETPATWRDRWEGWLKVYQV
                     PEDAQKGL"
     misc_feature    80662..80770
                     /note="G-rich"
     gene            complement(<82145..>85590)
                     /locus_tag="CNL03950"
                     /db_xref="GeneID:3254758"
     mRNA            complement(join(<82145..84350,84400..84667,84720..85339,
                     85396..85482,85544..>85590))
                     /locus_tag="CNL03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_568210.1"
                     /db_xref="GI:58261599"
                     /db_xref="GeneID:3254758"
     CDS             complement(join(82145..84350,84400..84667,84720..85339,
                     85396..85482,85544..85590))
                     /locus_tag="CNL03950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568210.1"
                     /db_xref="GI:58261600"
                     /db_xref="GeneID:3254758"
                     /translation="MQSPNTAKRAAAALDSEAKSESDRLRNVLGSQPPWSKEVELHRQ
                     QCRNAHLTLLFSHPFSPYSQSLDSLWLHTTYVLIQAYRDLISRLERFPPAASNSNGGS
                     KGRRGGGGGGNSELKKALTRFRQVLASEETFYRSLAARLVRFYNLGEISGVDETLKAV
                     KLPTEYMPTNDSGEDESSSYAARFASLQEKKDKIPLLYKGLICLGDLERYKKQYKQPV
                     NNNRHAQERERQADKFEVAEKYYLAAWRLMPDDGAAWNQLAVISTYVHNDYSTTYYYY
                     RALAVKNAFQGADGILQRFFGRIFDKWRAKRKDGDGEEGGEVGDGVEKWKEEMVVLMA
                     ILYLKAGFTYIPTILPPLLTSLKDFLSERRLPTESIVQLTSILLGSHFRARSTSGLEQ
                     DPNLLKRSFEAEGKTLEVALGVWKIYLEIAREEIDEARASLRRGLEDSALLDDEDEEE
                     LETDEMPQLISAVLRRILPSLRIISKWLKLNTTYLSGLASPSSNDQVSSPELRAAISS
                     FWNTYNAFFQSSSRLFILERLPSITRPLEEDIDMRGFAPLQKGKTADMDSFAAGATSA
                     TDSADAEGDVDGGQEGREVHPNEEHLMRLGDIQVDGLLIGQSLGFTDPLHTFTTGTFA
                     IPEATELPNVPRVEEHEREHDLQSISTNTEDDPVNLAMRASLGVESVGEEDEDDEEVI
                     VWSRGRENAVDTSVYQQVQTIPAQLPAPMVPPPKHRLQHQQSQTAMDLLQDLLQSTPP
                     LAHSSGNNSPALVASSPYAHQSPSYTQTGFPGMNRNMSGPSAGIPSPHNTQMPPGLPI
                     LGPAPVPQSVRPVQHSGQAKNPGQVPSLFMGPQGNSIWTMTREESQQGRARRAGSGAG
                     TGPGMGWVGGDEGQQGSVASQGPPPPPGFGIPQAPQIAQPLATQMHQPQPQAPVPIQH
                     MGLSTASATLQAQATFPRSSPGAVAPPNLTHRPPSIPKLHHESPARQTPVQVQHPTRQ
                     PRGPSANPSGTWGGLSNMNMGGTGMGMGMSNVPLPVPKSEGEAAVPYYMRPGVFGGGA
                     ATPAGAGGISGVGGVVPASGRDGAGQGIWDGTRGFGQGQGWVSGS"
     gene            complement(85905..87112)
                     /locus_tag="CNL03960"
                     /db_xref="GeneID:3254806"
     mRNA            complement(join(85905..86044,86098..86184,86237..86723,
                     86891..87050,87098..87112))
                     /locus_tag="CNL03960"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542972|gb|CF688813.1,gi|41542982|gb|CF688823.1"
                     /transcript_id="XM_568209.1"
                     /db_xref="GI:58261597"
                     /db_xref="GeneID:3254806"
     CDS             complement(join(86009..86044,86098..86184,86237..86723,
                     86891..87048))
                     /locus_tag="CNL03960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568209.1"
                     /db_xref="GI:58261598"
                     /db_xref="GeneID:3254806"
                     /translation="MGRVIRAQRKSGGIFKSHTHHNKNPARLRNLDFAEKNGYIRGVV
                     KDIIHDAGRGAPLATVVFRDPYRYKLRKETFLAAEGLSTGSFVYCGKKATLNVGNVLP
                     IGQCPEGTIVCNVEEKIGDRGALARTSGNYATIIGHSESGVTRIRLPSGSKKTVSSRC
                     RATVGIIAGGGRIDKPFLKAGRKYHAMRAKRNSWPRTRGVAMNPVDHPHGGGNHQHIG
                     HASTMARDAPAGQKAGLIAARRTGLLRGTQGKNVDNA"
     gene            complement(87464..91176)
                     /locus_tag="CNL03970"
                     /db_xref="GeneID:3254818"
     mRNA            complement(join(87464..88349,88401..88570,88631..88795,
                     88846..88972,89030..89721,89759..89836,89883..89942,
                     90025..90107,90159..90285,90351..90476,90526..90733,
                     90826..91176))
                     /locus_tag="CNL03970"
                     /product="nucleus protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544067|gb|CF689908.1,gi|41544072|gb|CF689913.1,
                     gi|41550562|gb|CF696403.1,gi|41550575|gb|CF696416.1,
                     gi|41551630|gb|CF697471.1,gi|41551636|gb|CF697477.1,
                     gi|41563292|gb|CF709133.1,gi|41563310|gb|CF709151.1"
                     /transcript_id="XM_567953.1"
                     /db_xref="GI:58261085"
                     /db_xref="GeneID:3254818"
     CDS             complement(join(87480..88349,88401..88570,88631..88795,
                     88846..88972,89030..89721,89759..89836,89883..89942,
                     90025..90107,90159..90285,90351..90476,90526..90733,
                     90826..91161))
                     /locus_tag="CNL03970"
                     /codon_start=1
                     /product="nucleus protein"
                     /protein_id="XP_567953.1"
                     /db_xref="GI:58261086"
                     /db_xref="GeneID:3254818"
                     /translation="MAMTALHPTVSSSDIHLDSPHSYTHSGSTLLPDPSASPSPSTSH
                     APLPGASAGDMQAEAPELVEEVPEGESEGMGDQIILDSQPEVDVEDLTGEMEYENLRY
                     RTERERKRVKVYELRDESWFDRGTGICRGMINADGHAVILVEAESPQVQENEDEPGGF
                     LTKDILLNSNVERDDIYGKQQDTLIVWTDPESKLDIALSFQDADGCEDTWQFICEVQK
                     HLISVEDETQVPSSSSPIGGSPMMVANAHMVNAEHKLPWQPPTLANIREQEFCIRAQA
                     KSAMGRERAMEHILNEATEDLESLDDLHALCSLMQTILLFNDNGIFEYILQDDVFLGV
                     IGMLEYDPEFPELKATYRQYFQENARFREVVPIPDPIICNKVHQTYRLLFLKDVVLAR
                     VLDDSAFNILNGFIFFNQVDIINYIQQSDGFLTQLFEAFRDPLPPPPPKDTPPEPLDD
                     KKRDTVMFLHQLVMMGKSIQLPPRLQLYRTLVDRGLLRVIEWSFRRPEAKILHAGAEM
                     LTLVVEHDASSVRSYVFKEQEQKERTLVKEIIELLHKTTNAGLMGQMADTLKTMLEVP
                     PDNESFMAKKEGPLAEQFMTHFYETWATYLFKPLLDIPDYKTEQPTTKLTREYTSLLQ
                     NLVELLSYCLLNHPHKGSYFILSNPISKKVVALLYIRDKPLRHAALRFLKACLRTPNH
                     FIHRHFVKNDLLGPLLMLLEEESLRDNMMSSACMEVVEQIRKDNLKTVINYLFENYTP
                     RLEALSRRPLMRGIMMGIRSRWEMNNEPTPSMPLVAATSATSIGGEDGWVNEEKKEDD
                     YFNGSDDETDRTVVDDTENVIGEEEGEEGAVPAKRKRLQSGGGPKKRAQRTGSALGLD
                     YDDNSDPESPVSTPQHTEHSSSSTPVLTTTTSLLERTVSRAQAVAEKEKNTSELEEDL
                     GDVQAKMREKRRREEEEEEEGGFAGLLVGAKPQPVATVAASAASGGGAIGAGKGEEGK
                     DDERDTAMQSEVSTTGEGKKGLKDMGKKIRLNFGLGKKFSK"
     gene            <91855..>93112
                     /locus_tag="CNL03980"
                     /db_xref="GeneID:3254739"
     mRNA            join(<91855..91906,92008..92116,92173..92536,92597..92833,
                     92927..>93112)
                     /locus_tag="CNL03980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567954.1"
                     /db_xref="GI:58261087"
                     /db_xref="GeneID:3254739"
     CDS             join(91855..91906,92008..92116,92173..92536,92597..92833,
                     92927..93112)
                     /locus_tag="CNL03980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567954.1"
                     /db_xref="GI:58261088"
                     /db_xref="GeneID:3254739"
                     /translation="MFSGNVGALNRRRTLRKATKSFDEVVQSKPQQEVYKPKQKREIG
                     VKAQEQASKSFEFVSILKNLKALQLAKEKALKPSVPSKLSPQQESKVDAHLRNPKFKV
                     TLNVSEVEAGSLRRLKPSTWLDDEVMNAYCDLMCSRFKDGKAGRKVHSLNSFFYGKLV
                     DQGYAAGRLKRWTKKIDIFSLDVLIFPINQGNMHWTACAINFAKKRIEYYDSMGDYGN
                     ARKQVFRKVRGYVEAEHKEKKGRAMDWEGWHDYFNKNNGSDCGVFSCQTLEMITRGRD
                     IVTQGFEFTAKDMPFMRRMMIYEIGEGKLEKRTWGSPAL"
     repeat_region   92881..92908
                     /rpt_type=tandem
                     /rpt_unit_seq="tttc"
                     /satellite="microsatellite"
     gene            95203..97094
                     /locus_tag="CNL03990"
                     /db_xref="GeneID:3254782"
     mRNA            join(95203..95443,95507..95578,95630..95776,95825..95882,
                     95946..96038,96105..96170,96219..96250,96314..96370,
                     96421..96606,96655..96742,96799..97094)
                     /locus_tag="CNL03990"
                     /product="stomatin-like protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530727|gb|CF676568.1,gi|41530736|gb|CF676577.1,
                     gi|41531954|gb|CF677795.1,gi|41531963|gb|CF677804.1,
                     gi|41533730|gb|CF679571.1,gi|41533741|gb|CF679582.1,
                     gi|41535972|gb|CF681813.1,gi|41535987|gb|CF681828.1,
                     gi|41537400|gb|CF683241.1,gi|41537410|gb|CF683251.1,
                     gi|41538981|gb|CF684822.1,gi|41540308|gb|CF686149.1,
                     gi|41540320|gb|CF686161.1,gi|41542613|gb|CF688454.1,
                     gi|41542626|gb|CF688467.1,gi|41545573|gb|CF691414.1,
                     gi|41545582|gb|CF691423.1,gi|41546173|gb|CF692014.1,
                     gi|41546182|gb|CF692023.1,gi|41554603|gb|CF700444.1,
                     gi|41556313|gb|CF702154.1,gi|41556317|gb|CF702158.1,
                     gi|41560923|gb|CF706764.1,gi|41560931|gb|CF706772.1,
                     gi|41561330|gb|CF707171.1,gi|41561335|gb|CF707176.1,
                     gi|41561764|gb|CF707605.1,gi|41561775|gb|CF707616.1,
                     gi|41562287|gb|CF708128.1,gi|41562297|gb|CF708138.1,
                     gi|41562388|gb|CF708229.1,gi|41562399|gb|CF708240.1,
                     gi|41562821|gb|CF708662.1,gi|41562830|gb|CF708671.1,
                     gi|41564285|gb|CF710126.1,gi|41564293|gb|CF710134.1,
                     gi|41571124|gb|CF716965.1,gi|41571131|gb|CF716972.1,
                     gi|415"
                     /transcript_id="XM_567955.1"
                     /db_xref="GI:58261089"
                     /db_xref="GeneID:3254782"
     CDS             join(95249..95443,95507..95578,95630..95776,95825..95882,
                     95946..96038,96105..96170,96219..96250,96314..96370,
                     96421..96606,96655..96742,96799..96944)
                     /locus_tag="CNL03990"
                     /codon_start=1
                     /product="stomatin-like protein"
                     /protein_id="XP_567955.1"
                     /db_xref="GI:58261090"
                     /db_xref="GeneID:3254782"
                     /translation="MSAPAPDHNKPSMDGTTINFNNSAKGHNEPLPVAEENNELDRYV
                     TDDLPRQPRMAAKPQIPDAIMAVQPLRKNEMQPSYAQDLGTGTIDHGCYGSMMNVLGE
                     CIGALGMIPCCPCPNPFNNISQGAVGLVSRFGQFYKSVDPGLVKVNVCTEDVRVVDVK
                     IQLTSVPRQTVQTKDNVSVEVDSVICWHVISPYRAAFGINDVRSALVERAQTTLRQVV
                     GGRVLQSVISDREGLAHEVAEIIEATAEKWGVAIESILLKDINFSVELQQSLSSAATQ
                     KRIGESKVIAARAEVDAAKLMRQAADILASPAAMQIRQLEALQNMARSSGSKVVFVPM
                     NLGTMGAAGMNDVAHQIAASGHDEHADHGPSTATNAGIISSMANV"
     gene            97210..97297
                     /locus_tag="CNL04000"
                     /db_xref="GeneID:3254926"
     tRNA            97210..97297
                     /locus_tag="CNL04000"
                     /product="tRNA-Phe"
                     /codon_recognized="UUC"
                     /db_xref="GeneID:3254926"
     gene            complement(<97624..>98894)
                     /locus_tag="CNL04010"
                     /db_xref="GeneID:3254887"
     mRNA            complement(join(<97624..98282,98349..98725,98782..>98894))
                     /locus_tag="CNL04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_567956.1"
                     /db_xref="GI:58261091"
                     /db_xref="GeneID:3254887"
     CDS             complement(join(97624..98282,98349..98725,98782..98894))
                     /locus_tag="CNL04010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567956.1"
                     /db_xref="GI:58261092"
                     /db_xref="GeneID:3254887"
                     /translation="MDSDAEVILSTDEVLKLFGTIQTAVDATTSSSVPLLNKVQNKEE
                     DLDFANGLSLLNLRPHLLLSSLHQLVILLALRLTSSTEAAPDPSTSTALSIPFPNPRS
                     RPELTDDNVLNEIAGELVMNQEVMDKVRGLENKLEYQIKKLIGLAEAEDKRGKDVVED
                     VEEDPLSFRPNPSAITSRTSPKAARGGSPTGSDDEKSGVYRPPRVAAVPYSEAAPQGR
                     ERERRAPALLSEFAATMDSAPLLESTSGLSVRPVTSAAAKYSNSVSAKRAAELKRIDE
                     FEEENMTRLVTSKREAKRRRDDEAALAMGFGVGPSRGRRGRNGLEAELEGVLGDRGDK
                     GVWDGVSGKFGQRGDALERGKKRVSGTGSTSGKAKKARFEKELARKRK"
     misc_feature    98298..98318
                     /note="AT_rich"
     gene            98381..101084
                     /locus_tag="CNL04020"
                     /db_xref="GeneID:3254735"
     mRNA            join(98381..98518,98754..99254,99329..99561,99612..99656,
                     99711..100104,100153..100353,100407..101084)
                     /locus_tag="CNL04020"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41529991|gb|CF675832.1,gi|41530000|gb|CF675841.1,
                     gi|41531607|gb|CF677448.1,gi|41531615|gb|CF677456.1,
                     gi|41547646|gb|CF693487.1,gi|41553945|gb|CF699786.1,
                     gi|41553954|gb|CF699795.1,gi|41561484|gb|CF707325.1,
                     gi|41561488|gb|CF707329.1,gi|41566385|gb|CF712226.1,
                     gi|41566393|gb|CF712234.1"
                     /transcript_id="XM_567957.1"
                     /db_xref="GI:58261093"
                     /db_xref="GeneID:3254735"
     CDS             join(99369..99561,99612..99656,99711..100104,
                     100153..100353,100407..101046)
                     /locus_tag="CNL04020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567957.1"
                     /db_xref="GI:58261094"
                     /db_xref="GeneID:3254735"
                     /translation="MSVAHIADSKGVQGPAKWSAVKNAVQFSAAAKDKNRRNQTDTLP
                     VSTTSTSVSAAFARSLVLFTGFLFKRPSKLFRPNRVDTWLGLRQLALSTEQTISPAFI
                     RSLLRQKAGIIAVTLTILPPMLVNATLGFLLFTSHSLFTLGLSRLSFFQRKIEMEDGT
                     EVDEEEDINLETLIRGPSIIPNHPTILSAIAGAGAGLVQGAAFTPVENVVRFLHQSAT
                     SWATLLARLVHLPVPEVPNAFEGKQPATPMQAIKNLFASETWRKNRNWWTGWRWVVAR
                     DALSYSCFFAAFDVTRRVALRVKALFGGNIEHGWENIFIIEFPDDHPQSASPSISNSP
                     AKYRPDSDQPQAPTIARVAQATTIVTGGIIASYLAQMAGRPLRTCQRIMMLDERERMR
                     AEKAQGRAQAGGAGSVSSSNSSNTLRRGKPHPILEVLRTKGIRPFIHSEGLLQSAPMK
                     EAFQQEGRLVRTMKSVGWKMAAMGPWGFGFLVWAWVGGEV"
     gene            complement(<101149..>102564)
                     /locus_tag="CNL04030"
                     /db_xref="GeneID:3254831"
     mRNA            complement(join(<101149..101419,101466..101679,
                     101739..102009,102123..102368,102427..>102564))
                     /locus_tag="CNL04030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567958.1"
                     /db_xref="GI:58261095"
                     /db_xref="GeneID:3254831"
     CDS             complement(join(101149..101419,101466..101679,
                     101739..102009,102123..102368,102427..102564))
                     /locus_tag="CNL04030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567958.1"
                     /db_xref="GI:58261096"
                     /db_xref="GeneID:3254831"
                     /translation="MAYPINHSNPTDLLSKLPEKFDEARSSGQLFYFPSEAKDVISQG
                     RRFNVRLCPALQDKAKAKADALAAIRAEKDGSPDKKRPRVTNEDDKVELVNKQNELEP
                     FKPPYVPELFVGSLEGFEGEEGMSILYSLLPGHILLCPFTYQPQDLPPTPPQLALAYN
                     ILLAASRHPIRPSKLLAFYNGGEGAGASQKWRHLQFVEAPGGRAPVEEWVQEVQFDRL
                     DKPVILPNLPYLHIVHPLPPSAQMPVPPTSESTEQLIDFLAPALMRLLDMAFDAARRG
                     GGDKDGGWNILMTLEHLHLIPRTLPSYPLPSPHPPLELNSLGYAGMMLVRSPEQEAAL
                     MQATESQGGLMGVLAKCGVPREFGEQVLEAEAAFHGQIEQEMLSG"
     misc_feature    102660..102713
                     /note="GA-rich"
     gene            complement(<103436..>104040)
                     /locus_tag="CNL04040"
                     /db_xref="GeneID:3254870"
     mRNA            complement(join(<103436..103464,103518..103792,
                     103843..103926,103982..>104040))
                     /locus_tag="CNL04040"
                     /product="bud site selection-related protein, putative"
                     /transcript_id="XM_567959.1"
                     /db_xref="GI:58261097"
                     /db_xref="GeneID:3254870"
     CDS             complement(join(103436..103464,103518..103792,
                     103843..103926,103982..104040))
                     /locus_tag="CNL04040"
                     /codon_start=1
                     /product="bud site selection-related protein"
                     /protein_id="XP_567959.1"
                     /db_xref="GI:58261098"
                     /db_xref="GeneID:3254870"
                     /translation="MPKIRTQRTKPPPEGFEDIQDVLEDYEKKMRDAESESHEGKRKV
                     EAVWPIMRLSHARSRYIYDLYYKRELISRELYDWLLKQGYADANLIAKWKKNGYEKLC
                     CVRCIQTRDMNFQGSTCICRVPKAQLKKGTVVECPHCGCRGCASSD"
     gene            <104546..105928
                     /locus_tag="CNL04050"
                     /db_xref="GeneID:3254969"
     mRNA            join(<104546..105167,105222..105928)
                     /locus_tag="CNL04050"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550617|gb|CF696458.1,gi|41550627|gb|CF696468.1"
                     /transcript_id="XM_567960.1"
                     /db_xref="GI:58261099"
                     /db_xref="GeneID:3254969"
     CDS             join(104546..105167,105222..105673)
                     /locus_tag="CNL04050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567960.1"
                     /db_xref="GI:58261100"
                     /db_xref="GeneID:3254969"
                     /translation="MRPSGSVSPHSNPFAVPSIGQQLFSVQPQPFALELTDIEVPSAS
                     RFPSPERRHRMAVNLPPPVFDSSRPWQFQSFSSQSRPEYSRNHSGVSDSAALAAQPQP
                     TSPQQESVAPPALRQSPLSSASRSWLSQYTHSAPASEPRPVRPLPLRSIGSRRPLSFS
                     RSTRDILNNAPPSTSPLVPLGDRSSSLYPRAQSLVDGPRSTLTPSSSTLRRRRMRDEL
                     GNDSTEERSANRQRRFDPSSEIQRVWQEENNPWNEADPSGRDTRRDGIVFDADVYLTQ
                     GADFLESSPEGAFGARDDDDWVTVVPSVTVPDEIPGDDAWFLPPAGLSTNGVPEVQER
                     NRDSQETTSVLYPSSHLPLNENE"
     gene            105991..107718
                     /locus_tag="CNL04060"
                     /db_xref="GeneID:3254800"
     mRNA            join(105991..106281,106360..106402,106469..106553,
                     106613..106740,106795..106895,106949..107718)
                     /locus_tag="CNL04060"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41557444|gb|CF703285.1,gi|41557459|gb|CF703300.1,
                     gi|41568562|gb|CF714403.1"
                     /transcript_id="XM_568207.1"
                     /db_xref="GI:58261593"
                     /db_xref="GeneID:3254800"
     CDS             join(106234..106281,106360..106402,106469..106553,
                     106613..106740,106795..106895,106949..107701)
                     /locus_tag="CNL04060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568207.1"
                     /db_xref="GI:58261594"
                     /db_xref="GeneID:3254800"
                     /translation="MAVQVDIPKSEASRAEGNTAFKKGKWVEAIGHYTNAVIYNPEDP
                     VAYCNRAQAFLKLEKYHDAERDCTSALALPKGKSNIKALYRRGLARKGLEKIEEALSD
                     MEEVLRLDKSNTAVKPELEELQEMKTKMDQEKKKPSRRPLTPPILPKPLPKKSSNPPK
                     SEDVSDLTNLTQDLGLKSTSSRSPEEKKESSFAAIRKSRDGKKMSFVGESTSQLSKQP
                     QDKEAATDAALSAIFPPSKPRVTSTSGSKKPAASTINVNSTPSTSALPPLPTSLDTTS
                     TSPGAGLSLLRYFTSSPTYNFSLLSLYPAENIPIILGTLLEPDTLGFLLLALDEGASK
                     GTETDKENVKKILEGLRQTKRWKMNIGMLSTDEKKAGENAWKSCGGIGSWI"
     gene            complement(108992..111574)
                     /locus_tag="CNL04070"
                     /db_xref="GeneID:3254957"
     mRNA            complement(join(108992..109754,109825..110264,
                     110354..110465,111276..111574))
                     /locus_tag="CNL04070"
                     /product="transcriptional regulator nrg2, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546429|gb|CF692270.1,gi|41546438|gb|CF692279.1,
                     gi|41548108|gb|CF693949.1,gi|41548112|gb|CF693953.1,
                     gi|41560418|gb|CF706259.1,gi|41560429|gb|CF706270.1"
                     /transcript_id="XM_567961.1"
                     /db_xref="GI:58261101"
                     /db_xref="GeneID:3254957"
     CDS             complement(join(109103..109754,109825..110252))
                     /locus_tag="CNL04070"
                     /codon_start=1
                     /product="transcriptional regulator nrg2"
                     /protein_id="XP_567961.1"
                     /db_xref="GI:58261102"
                     /db_xref="GeneID:3254957"
                     /translation="MSTEASPHQSQHLPSSYPHHPASLPPNEPPRMPNPAPSLPDAAN
                     GSHPFTGDLSINSIKTEDSMSDHSAVAGQPSQSSKGKNGATGPAEGKAKPHVCPICQR
                     GFTTGGHLQRHHRIHTGVKAFKCPFPGCETRTSRQDNLQQHYRTHLSPTLRRGSGSAA
                     RAAVNAAMEAAGLKSSSSRQPRKSKSATGTPTSATASHFPSPYATNPGPNPYAAYMYD
                     QQHGYPPPYPLPPGVAMTQPQSATSSRVPSPVNGHSAAGSLPPAHQQSFFSQPYTPTY
                     ASYPSVHQQPPYRYPTGGMPYPSGPYSHHSLYSPSIAPEHSQHMYSPMQSSFAAHSRE
                     GSYGLSASAYGGRSPTSGAYGHARR"
     misc_feature    112176..112205
                     /note="AT_rich"
     gene            <112372..113173
                     /locus_tag="CNL04080"
                     /db_xref="GeneID:3254928"
     mRNA            join(<112372..112467,112534..112556,112647..112753,
                     112804..112940,112993..113173)
                     /locus_tag="CNL04080"
                     /product="histone h2a variant, putative"
                     /transcript_id="XM_567962.1"
                     /db_xref="GI:58261103"
                     /db_xref="GeneID:3254928"
     CDS             join(112372..112467,112534..112556,112647..112753,
                     112804..112940,112993..113046)
                     /locus_tag="CNL04080"
                     /codon_start=1
                     /product="histone h2a variant"
                     /protein_id="XP_567962.1"
                     /db_xref="GI:58261104"
                     /db_xref="GeneID:3254928"
                     /translation="MSSKVGGGKGGKSKTSSEAKVLTTRSSKAGLQFPVGRIHRFLRN
                     KNANNVRIGAKAAVYVASIMEYLTAEVLELAGNAAKDLRVKRITPRHLQLAIRGDEEL
                     DLLIRATIAGGGVLPHIHKSLVAKNAPLKKPKALDA"
     gene            complement(113269..>118102)
                     /locus_tag="CNL04090"
                     /db_xref="GeneID:3254962"
     mRNA            complement(join(113269..113514,113578..113608,
                     113671..113862,113913..113959,114009..114054,
                     114121..114270,114324..114407,114462..114559,
                     114623..114715,114765..114894,114940..115021,
                     115076..115247,115296..115439,115504..115621,
                     115682..115819,115870..115972,116033..116035,
                     116049..116440,117260..117742,117793..117854,
                     117997..>118102))
                     /locus_tag="CNL04090"
                     /product="phosphatidylinositol 3-kinase, putative"
                     /transcript_id="XM_567963.1"
                     /db_xref="GI:58261105"
                     /db_xref="GeneID:3254962"
     CDS             complement(join(113387..113514,113578..113608,
                     113671..113862,113913..113959,114009..114054,
                     114121..114270,114324..114407,114462..114559,
                     114623..114715,114765..114894,114940..115021,
                     115076..115247,115296..115439,115504..115621,
                     115682..115819,115870..115972,116033..116035,
                     116049..116440,117260..117742,117793..117854,
                     117997..118102))
                     /locus_tag="CNL04090"
                     /codon_start=1
                     /product="phosphatidylinositol 3-kinase"
                     /protein_id="XP_567963.1"
                     /db_xref="GI:58261106"
                     /db_xref="GeneID:3254962"
                     /translation="MIGILSLNRCGLPHSVTGSRLSALKTKSTKINKLLCLDDNERRN
                     TAHWATAAAWHMGDFDTMADHLAFHPRGTSKSLYKAIIDVHNEQYASAFHHINKAQSL
                     SYDELQMQLGAGLQVALKSLAKTEFLVELQEAIQYKSQPELRPTILATWKTRFKRSHA
                     DANSWLKRLEIWTLACSPKTFELQDCFLKTAKLCESAGMHEAARSIIKRITPEVTLPE
                     SPEFIIKALLRLVTLWFRFGESQAVLVEVENQLNITDVEPWLSAIPQLIARLGTPQKD
                     LQCTLIKLLRTISSHYPHAVIWPLLTATQTRKVEHQEAARVIMDYICTMADGTRLVDQ
                     AELVGRELIRTSISKWRGIIDGFLPRQDLMEIKWQDIPEIWEEDLRMLTNPETPDEHQ
                     FVLQYGEQLHLVDKTLIRYNSSRQLNLVNNAYSTLYRLYGEIEAQLNQWRLPGMKLHL
                     ASTAPRLLSLRDCILTVPGLYDPHIKLDDQAFIDGFQPVVHILSSKQLPRKLLIQSYL
                     SDHTFLLKGNEDLRGDERIMQLFNLINTLLNHRSDAFSRNLHLLPYEVVPLSPSAGLV
                     SWVSNTQQLQSMIQANRDKHKRNALTNRELGSLLGYDPDVFNPNNPKLDATAEMGKYD
                     KLPLLIKVQRLKAALSHSNQSDIKDVLWQRSPSADIWIKRRTNFARTVGVASFVGYII
                     GLGDRHGSNILVDQLTWGALHIDFGDLFNVAQERSFLPEKVPFRLTRMMTNAFELASQ
                     GDLETPGSAGTFKQASFITMDVLRGSRSTLLAMLEAFLYDPLLSWTSSQNNPSGTTRL
                     EEAVLREAPKVGASLEGLKSKAGQKDSSQGTQSQQGETKDLSIQEDSLPYEQLDNSLT
                     STCLRTDSYMARVSSTEMTNSKALQVLTQIERKLVGLHNTNSEQPFSVSKQVQELIKE
                     ATNLQNLSQGYVLGWIPHW"
     gene            <119522..>121099
                     /locus_tag="CNL04100"
                     /db_xref="GeneID:3254756"
     mRNA            join(<119522..119631,119920..120170,120229..120416,
                     120472..120612,120675..120844,120907..>121099)
                     /locus_tag="CNL04100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567964.1"
                     /db_xref="GI:58261107"
                     /db_xref="GeneID:3254756"
     CDS             join(119522..119631,119920..120170,120229..120416,
                     120472..120612,120675..120844,120907..121099)
                     /locus_tag="CNL04100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567964.1"
                     /db_xref="GI:58261108"
                     /db_xref="GeneID:3254756"
                     /translation="MGYKGRALIENGDIRFDIKLASPGMELSWFSSQLLMTWNTANQL
                     VTASADGHIRVWDVEELRQPVHDIDSHPLAITSLSVADKKALASSLDGTIVLVDTVNG
                     EQLGKVNSGRVKVSAEGPEIPAFACSLHPQSACWAWSGRSSKVVIRTMVSDDADPTTQ
                     GPLGGESSIMDGGKGKFGMDLQFSPDGRSLALATDQGQVVVFDTETRATIATYTSHNK
                     AVRTIGWSPDSQWLYSGSDDHLIVLYDARAGSQSGAGGKGEGAVAMMQGHQSWVLSVA
                     PSPDGRLLGSGGADHLIKLWDIGQRTCVSTSSSNADVWGFAWQPEGAGTLPPGKQFAV
                     AGDDKVVTLYRAAGAV"
     gene            complement(121106..123077)
                     /locus_tag="CNL04110"
                     /db_xref="GeneID:3254737"
     mRNA            complement(join(121106..121499,121554..121677,
                     121733..122065,122105..122210,122263..122312,
                     122386..122622,122661..122911,122965..122978,
                     123025..123077))
                     /locus_tag="CNL04110"
                     /product="adenylate cyclase binding protein, putative"
                     /transcript_id="XM_567966.1"
                     /db_xref="GI:58261111"
                     /db_xref="GeneID:3254737"
     mRNA            complement(join(121124..121499,121554..121677,
                     121733..122065,122105..122210,122263..122348,
                     122386..122622,122661..122911,122965..122978,
                     123025..123077))
                     /locus_tag="CNL04110"
                     /product="adenylate cyclase binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530726|gb|CF676567.1,gi|41530735|gb|CF676576.1,
                     gi|41531469|gb|CF677310.1,gi|41537587|gb|CF683428.1,
                     gi|41537594|gb|CF683435.1,gi|41543223|gb|CF689064.1,
                     gi|41543227|gb|CF689068.1,gi|41544552|gb|CF690393.1,
                     gi|41550620|gb|CF696461.1,gi|41551228|gb|CF697069.1,
                     gi|41551239|gb|CF697080.1,gi|41559280|gb|CF705121.1,
                     gi|41567704|gb|CF713545.1,gi|41567710|gb|CF713551.1,
                     gi|41573975|gb|CF719816.1,gi|41573986|gb|CF719827.1,
                     gi|41574128|gb|CF719969.1,gi|41574140|gb|CF719981.1"
                     /transcript_id="XM_567965.1"
                     /db_xref="GI:58261109"
                     /db_xref="GeneID:3254737"
     CDS             complement(join(121183..121499,121554..121677,
                     121733..122065,122105..122210,122263..122312,
                     122386..122622,122661..122911,122965..122978,
                     123025..123065))
                     /locus_tag="CNL04110"
                     /codon_start=1
                     /product="adenylate cyclase binding protein"
                     /protein_id="XP_567966.1"
                     /db_xref="GI:58261112"
                     /db_xref="GeneID:3254737"
                     /translation="MATSQGIHSISTILKRLEAVTSRLEDIAVTQTSHGSSVKSPAPT
                     PDTPTGVAPPAPETPKSAEMTQPTLSPASKVYQDEIVNGALNDFLSKSKEVGGLVAEH
                     SALIGLLCEAQLSFLQFASNHAKPSAPNALAPLLEPQGKAIEAVMETKDKLSRSKEGR
                     EWGVCFNVLGEGVPAWGWVQMNAAQFWSDRVIKQYKETNTSVVAWAKSFIALIAALES
                     YVKEWHVTGVVWNPKGSPAPSSIPKTSTSAPPPPPPPPSSSAQAASTPAASGAAALLA
                     DLNRGGAATSGLRKVDSSQMTHKNPSLRSASIVPDNGKKGPPLKPKPGAKPAKKPAKV
                     ELEDGNKWIIENQEDNRSIKIDNTELHHTVHIFGCVNSVVQISGKINAVTMAGCKKTS
                     VVLDSAVSSFSITSSPSFEVQIIGSIPTIQVDTTDSGQVYLSKDCMEVIEIITSKSSS
                     INISVPTGEDGDFVERPVPEQMKSRVVDGKLVTEIVEHSG"
     CDS             complement(join(121183..121499,121554..121677,
                     121733..122065,122105..122210,122263..122348,
                     122386..122622,122661..122911,122965..122978,
                     123025..123065))
                     /locus_tag="CNL04110"
                     /codon_start=1
                     /product="adenylate cyclase binding protein"
                     /protein_id="XP_567965.1"
                     /db_xref="GI:58261110"
                     /db_xref="GeneID:3254737"
                     /translation="MATSQGIHSISTILKRLEAVTSRLEDIAVTQTSHGSSVKSPAPT
                     PDTPTGVAPPAPETPKSAEMTQPTLSPASKVYQDEIVNGALNDFLSKSKEVGGLVAEH
                     SALIGLLCEAQLSFLQFASNHAKPSAPNALAPLLEPQGKAIEAVMETKDKLSRSKEGR
                     EWGVCFNVLGEGVPAWGWVQMEPTPAPYIHEMKNAAQFWSDRVIKQYKETNTSVVAWA
                     KSFIALIAALESYVKEWHVTGVVWNPKGSPAPSSIPKTSTSAPPPPPPPPSSSAQAAS
                     TPAASGAAALLADLNRGGAATSGLRKVDSSQMTHKNPSLRSASIVPDNGKKGPPLKPK
                     PGAKPAKKPAKVELEDGNKWIIENQEDNRSIKIDNTELHHTVHIFGCVNSVVQISGKI
                     NAVTMAGCKKTSVVLDSAVSSFSITSSPSFEVQIIGSIPTIQVDTTDSGQVYLSKDCM
                     EVIEIITSKSSSINISVPTGEDGDFVERPVPEQMKSRVVDGKLVTEIVEHSG"
     gene            <123325..>124340
                     /locus_tag="CNL04120"
                     /db_xref="GeneID:3254987"
     mRNA            join(<123325..123394,123448..123532,123609..123678,
                     123845..123957,124000..124116,124298..>124340)
                     /locus_tag="CNL04120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567967.1"
                     /db_xref="GI:58261113"
                     /db_xref="GeneID:3254987"
     CDS             join(123325..123394,123448..123532,123609..123678,
                     123845..123957,124000..124116,124298..124340)
                     /locus_tag="CNL04120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567967.1"
                     /db_xref="GI:58261114"
                     /db_xref="GeneID:3254987"
                     /translation="MSIPTPNIAHFTESDYEHIYEPAEDSFILLDALELDAEDLLRMN
                     PSVCVEIGAGSGVVSAFMSNLLGHENSCTYITILDPIRCNLVDPLLPRLSEKVDVLLF
                     NPPYVPTDNQELQMTQESRDIGGAWAGGADGMAITNILLQQLPVRHVVFPLICYKGNH
                     QTTSW"
     gene            complement(124542..127418)
                     /locus_tag="CNL04130"
                     /db_xref="GeneID:3254751"
     mRNA            complement(join(124542..125291,125341..125413,
                     125472..125523,125583..125718,125768..125840,
                     125900..125938,125996..126051,126113..126239,
                     126292..126378,126433..126505,126566..126774,
                     126825..127096,127164..127418))
                     /locus_tag="CNL04130"
                     /product="protein threonine/tyrosine kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535544|gb|CF681385.1,gi|41535550|gb|CF681391.1,
                     gi|41538547|gb|CF684388.1,gi|41538560|gb|CF684401.1,
                     gi|41549559|gb|CF695400.1,gi|41549565|gb|CF695406.1"
                     /transcript_id="XM_567968.1"
                     /db_xref="GI:58261115"
                     /db_xref="GeneID:3254751"
     CDS             complement(join(124603..125291,125341..125413,
                     125472..125523,125583..125718,125768..125840,
                     125900..125938,125996..126051,126113..126239,
                     126292..126378,126433..126505,126566..126774,
                     126825..127096,127164..127302))
                     /locus_tag="CNL04130"
                     /codon_start=1
                     /product="protein threonine/tyrosine kinase"
                     /protein_id="XP_567968.1"
                     /db_xref="GI:58261116"
                     /db_xref="GeneID:3254751"
                     /translation="MSQTPSQQPPHSDDVFEPTQLSQPAYSQTQNTQAFISSQVEPRR
                     KYWAIFISTHSDRGILKVPWSKPYIQLGRGPYTLGNDVILPEKRVSNTHCRFTLGMQN
                     AKNLEPSNDTARAWKEGEGEPEVWVEDLKSSNGTFVNGARINTRRLLRHGDEISLGHA
                     GTLDYHDVRYIYRSVGGKRLKNGQASSNSGDLEPVGQVYEKYQLLDRLGKGTFAEVHK
                     AVDVETGNMRAIKQIVKHRFAGNDKTLQLFHREINITRSLEHENICRLIDWYEDPQHI
                     CLVLEYVDGGDLLDYIMDWPEEQGGLPEQHAAELTVQICRAMAYTHSKGITHRDLKPE
                     NILLTKEHEGARIVKIADFGLAKMIHTNTMLVSMVGTPQYLAPEIVMQTEQQPGYENV
                     VDSWSVGIIVYSMMTKALPFDEDSKLPVEQRIRARFTQPPDVSLLEQRNVSQQAIDFI
                     LRLLDKDPAKRMTMAQALDHEWLSEPSSQPIESQRMGLGGDSMWSIQSFDSLQPDFNY
                     GPGSANWQRPATVSSTRLKSGFEGSDDFSQPMTKLHLNTPEICNIPSKKASIKQTSAA
                     IGINTPVSLVSPCVAGNPVNAVSPSAPTSTSPTSLSKQQKRKLEDEKRANSIDSEGEG
                     SESIDRTNNAPVNENIDASVMMDSAVDSVKEDGKDDIVLARRPRKSMRLQ"
     gene            127562..129462
                     /locus_tag="CNL04140"
                     /db_xref="GeneID:3254787"
     mRNA            join(127562..127858,127914..128814,128891..128989,
                     129047..129462)
                     /locus_tag="CNL04140"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531240|gb|CF677081.1,gi|41543987|gb|CF689828.1,
                     gi|41543994|gb|CF689835.1,gi|41549311|gb|CF695152.1,
                     gi|41549326|gb|CF695167.1,gi|41550183|gb|CF696024.1,
                     gi|41550433|gb|CF696274.1,gi|41550445|gb|CF696286.1,
                     gi|41551124|gb|CF696965.1,gi|41551130|gb|CF696971.1,
                     gi|41551403|gb|CF697244.1,gi|41551405|gb|CF697246.1,
                     gi|41555842|gb|CF701683.1,gi|41555851|gb|CF701692.1,
                     gi|41558536|gb|CF704377.1,gi|41558543|gb|CF704384.1,
                     gi|41558591|gb|CF704432.1,gi|41558596|gb|CF704437.1,
                     gi|41560203|gb|CF706044.1,gi|41560212|gb|CF706053.1,
                     gi|41564529|gb|CF710370.1,gi|41564537|gb|CF710378.1,
                     gi|41570074|gb|CF715915.1,gi|41570081|gb|CF715922.1,
                     gi|41571456|gb|CF717297.1,gi|41571463|gb|CF717304.1,
                     gi|41571509|gb|CF717350.1,gi|41571515|gb|CF717356.1,
                     gi|41572299|gb|CF718140.1,gi|41572309|gb|CF718150.1"
                     /transcript_id="XM_567969.1"
                     /db_xref="GI:58261117"
                     /db_xref="GeneID:3254787"
     CDS             join(127586..127858,127914..128814,128891..128989,
                     129047..129330)
                     /locus_tag="CNL04140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567969.1"
                     /db_xref="GI:58261118"
                     /db_xref="GeneID:3254787"
                     /translation="MSDNQHLQGQSSVPETPANTSEVDTSGAPAAASSVGPASSEGTD
                     QQDPVVSTSSSKVQDILQQSINRDNFQEEVGQVMGTINSWWGGVKKQSVSTLATLKAD
                     IDKTVTQAQADFEYLKAAKIEVVRKDATSEPTRVSAKEDQDISADTLKEEPISVQNDQ
                     DKGKGKETAQSSATNQTSPPAFFTKLASSTSQLQQSLLSAVQFTLDATTANSALSNPN
                     AFRQQLVDNLRLASARENLQLSVKQAEKLAEEYLRKGDQWVKGAEKWMEEAVKVVPPE
                     GEETHVVNIGWDGGDWYSFSTSDNTPLHISTIDNGAPGPSAAGTQVKVLASSRKDALL
                     KRLREDKQLLLVDPEGEGETEKRKAEFRDWVKTQWEAQKTNGRLEDEGLVGHIRMELV
                     PEYLTDEQFWQRYLFHKHMIEEEEQKRKLLLQTSQQDQSDDFNWDDEPEETTPLGDGQ
                     ASHGVVTPKVSPVGKLPSSVFSHSKAKLATLDSTSPHDSEESYDLVSDQGGKTARAAP
                     PVGDDDSDWE"
     repeat_region   131899..131949
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     gene            complement(<132076..>133892)
                     /locus_tag="CNL04150"
                     /db_xref="GeneID:3254925"
     mRNA            complement(join(<132076..132429,132797..132821,
                     133171..>133892))
                     /locus_tag="CNL04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_567970.1"
                     /db_xref="GI:58261119"
                     /db_xref="GeneID:3254925"
     CDS             complement(join(132076..132429,132797..132821,
                     133171..133892))
                     /locus_tag="CNL04150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567970.1"
                     /db_xref="GI:58261120"
                     /db_xref="GeneID:3254925"
                     /translation="MIMHMKGTGSFHPCRMCNATSVRHSQNCNPNQLYLPLQSSATDL
                     TVPDHDPYNLPCHTHYQFIRQAREVAAASSAAEKERLGQKHGIKGLSILEKLPTIDFP
                     LSFPVDAMHNLFENILKLQVNLLSGAVKDLADEDFVLTTRQWAAVGESTAAAGATIPS
                     SFAARPPDFVKNRQACTADTWSFWLQYIAPVLLDGLLESRFYKHFMRFSSLVRECLAY
                     EMPRERLAGLKTDWIKWGVDFYRGMRRSCRHYMVSIDQNRRHPTRHVEFEDHLCYGEL
                     LNLITIDLPHHPKSSDTPPVTLAFAHIKPVVSHKHYIGNHEWSYYKEYQAEEMVDLAS
                     VNELVGRVKSISKPGTTYIIDRGTPYSRVSLV"
     gene            <137655..>141899
                     /locus_tag="CNL04160"
                     /db_xref="GeneID:3254809"
     mRNA            <137655..>141899
                     /locus_tag="CNL04160"
                     /product="retrotransposon nucleocapsid protein, putative"
                     /transcript_id="XM_567971.1"
                     /db_xref="GI:58261121"
                     /db_xref="GeneID:3254809"
     CDS             137655..141899
                     /locus_tag="CNL04160"
                     /codon_start=1
                     /product="retrotransposon nucleocapsid protein"
                     /protein_id="XP_567971.1"
                     /db_xref="GI:58261122"
                     /db_xref="GeneID:3254809"
                     /translation="MMDVIDDAMLEARFLQVPTRPRHPPTVANVIAPVPAPPLIAKLA
                     PAPSTTTKGHTTQQLDWLDPAKRLPLGDAGRSARAYLQSINACFSCCVVGHHRLICPT
                     RPPSTPPNASASVPVANLVSLADDDESDHHGVFAVDPVTDTLVQDASSALAGSVPLIM
                     VNCRFKADGDTVPALVDCGAGINVIDRAYAEQQGWQGRPIIPVGTKMADNRAGPVVDQ
                     EYVVDVIIGDTTYNATPFYAMALGPRYRLILGLQFCRQHRLFDGAERLNHLLNAGGSS
                     YTSLVQLQLNSITPVESPTVSTERHSHSDAILREFADILPANISDVSHYPPICSSTSQ
                     VRHRINILPDAMPVARAGFRVPLAWRDTLRQEIEKHCTAGRLRPSSSPWAAPAFLIKK
                     ENGKFRFLCDFRGLNSVTVKDRTPVPNIDDILQRAARGKVFAKLDLTDAFFQTLMHEP
                     DIEKTAISTPWGLYEWVVMPQGACNWPATQQRRLNEALRNLISVCCEAYVDDIIIWGA
                     TDSDLAKNIRAVLTALRNSGFVCSPSKSKFFVDSVSFLGHVISPNHIGPDPKKVEALR
                     AWPSPGCVKDLRSFLGLLQYLRKFIPHIATKTSVLTALLPPNKTAEKAYESRKRQLAK
                     GLPAERLESLSWVWKWTTSAQDAFEALKEMVARITGLSPLSHEAILAGQTNLYLFTDA
                     SNTGLGAWLGTGLSPDNAQPIAYDSRSLTAAERNYPVHEKELCAIIHALKEWRPLLLG
                     VPVHVMTDHATLKWFFQQPNLSERQKRWLLVLADYDLQISHIPGATNVIADAFSWLRN
                     SDAHVNALTMMVLSPNTAFLDAVAEGYGQDPVMSIWREVDRCHPGVRTAEVNGARGVR
                     TVLTYEDRLCIPDVLTLREQCLQECHDAMGHFGVEKTLELLRCKYFWDGMASDVKDFV
                     STCPACQTSKATTTKPPGLLHSLPVPPAKFSDIGIDFVGPLPQSHSFDYLIVITDRLT
                     GWVALIPTVMTLTSSAFAQLYYDHWVSKYGVPQSIVSDRDKLFTAASWRRLNSLLGTK
                     LKMSTAYHPQTDGISERSNKTVIQILRTWTDDQGRNWAANLQRVAFAMNNTIRRSTHH
                     TPAELVFGKRLSLTPPLLPSTSATDQSLAQPTASEWDLAAQRMALEEGIARDELLLAK
                     HRQSVQANKHRRPDPVYRPGDKVYLNTAEFRHEYKTATNRSAKFMPRWEGPFTILKAF
                     PEQSLYELDVPVTSTQSTPRRHVSRLKPYRESEQYHQHAVPRLLDHPAVSSPRILQIL
                     EDRTLTPKGNHPKVYCKRLASDPVTHGHHFPQLLISSHVSICFRFFLQVARVKLHPRS
                     LSQVTCFIFPLFLRAASQFTPAPFLQVARVKLHPHSPSQVTCIILLPLFLFLLSLPFL
                     VLSPSFLSDFSCHKPRCLPGFGRDWFRERRQSAWKG"
     misc_feature    137712..137804
                     /locus_tag="CNL04160"
                     /note="C-rich"
     misc_feature    143267..143359
                     /note="C-rich"
     repeat_region   149498..149517
                     /rpt_type=tandem
                     /rpt_unit_seq="ta"
                     /satellite="microsatellite"
     gene            complement(<150339..>157502)
                     /locus_tag="CNL04180"
                     /pseudo
                     /db_xref="GeneID:3254729"
     gene            158136..159675
                     /locus_tag="CNL04190"
                     /db_xref="GeneID:3254917"
     mRNA            join(158136..158602,158673..159196,159255..159675)
                     /locus_tag="CNL04190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567972.1"
                     /db_xref="GI:58261123"
                     /db_xref="GeneID:3254917"
     CDS             join(158182..158602,158673..159196,159255..159647)
                     /locus_tag="CNL04190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567972.1"
                     /db_xref="GI:58261124"
                     /db_xref="GeneID:3254917"
                     /translation="MPRRSAKYKATARARELYRMATILNHKQLKASLSIPYHALRTSR
                     YLNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLRVNHTEFRKLLCLIKDHPVFVSH
                     GPRKQANPLLQLTVALYRLGHCGCAASTFEIGEQFGVSEGTSAIWTTRVIKAILSLER
                     NNVYWPDENERKAIDRHFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVDFFSYKGRY
                     GFNILGICDHLKRIRYFQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVH
                     SEMISQGEYLLADSAFPAGDWCVPLFKRRRGQNDLDRPEAKFNKKCSSARVKIEHAYG
                     ILKNRWQSLRSLRVKIRNVRDEGVATCWIRACVVLHNLLIDTGDWYNRLDGDADEPDD
                     YIDIERMQERMERVLERHREEEEDEARDARDASNLTRKRVMERMQEIERRDLL"
     gene            complement(<159696..>160910)
                     /locus_tag="CNL04200"
                     /db_xref="GeneID:3254732"
     mRNA            complement(join(<159696..160411,160472..160565,
                     160620..>160910))
                     /locus_tag="CNL04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_567973.1"
                     /db_xref="GI:58261125"
                     /db_xref="GeneID:3254732"
     CDS             complement(join(159696..160411,160472..160565,
                     160620..160910))
                     /locus_tag="CNL04200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567973.1"
                     /db_xref="GI:58261126"
                     /db_xref="GeneID:3254732"
                     /translation="MPPKRQNENENQASEATQKKQRNSNKQWATDTNSDGVSAEEHVA
                     VWLSTIPENGRLPNFHNWKTGHEKKDFWSRKCLQYLTDNGCDSRRQFQSVALKINQIV
                     ESFTKASQIGTGTGAGAMEIDDESLLAQRKKVCPFYEILLPVLGDRASVTAHHASSTL
                     HASLNRPDRDLAALDGLIERQRGEMAADDSEDELSGEDGGLFGDGAGEASETESEADA
                     PIIAAIRRESRSSSQPARSSSVLGSVSTPIRAQTQSQRASIRSSKAKAVSADDKMDEL
                     VMRQEGNDDRRHQELLAVQERKISVQEKHHADMMNIAQENVTIARENAATEKMKMLAE
                     SWNRKMEMLMRSGKSWEEAKVMVGPEPGAPSL"
     gene            <163732..>167381
                     /locus_tag="CNL04210"
                     /db_xref="GeneID:3254941"
     mRNA            join(<163732..164167,164227..164687,164715..165035,
                     165387..165763,165821..166134,166188..166438,
                     166503..166852,166979..>167381)
                     /locus_tag="CNL04210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567974.1"
                     /db_xref="GI:58261127"
                     /db_xref="GeneID:3254941"
     CDS             join(163732..164167,164227..164687,164715..165035,
                     165387..165763,165821..166134,166188..166438,
                     166503..166852,166979..167381)
                     /locus_tag="CNL04210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567974.1"
                     /db_xref="GI:58261128"
                     /db_xref="GeneID:3254941"
                     /translation="MRTLQQAQEGDASNNSVMPGEAEGTNGGAQGDGDAEMSEVSLRP
                     THTDISTPQSSIFVDHSPASVSNPAFQTFINNSLSRVQCQISVSDNEDDSAAPSVSGE
                     HGTESEEELRDAQSHLDVGGRREDMESWDEQAVAREKREAGPRLYAMSEEDIDKIGLY
                     SWKVDHNISRAAYNSLPDHANNIPFISLKEAQSLIDNYSDTLCDYYDMCKHSCLCFAG
                     PYAKDQKCSKCGADRFDRNGKPFQRFLYIKIIPRLQKMYNHPSTKERLMYRDKSTREY
                     DNSNIQDIFDGSMYRILLEKEIEYFADDRDIALSFSSDGFCPFDNGSGTCWPLVLFNL
                     NLPPEERVHTREILSVGLIPGPKKPEDFDSFIYPLVEELLQLTVGVHTWDADLGSFFT
                     LRAHLLYVSGDTPANILKLQVNLFSGAVKDLADEDFVLTTRQWAAVGEATAAAGATIP
                     SSFAARPPDFVKNRQACTADTWSFWLQYIAPVLLDGLLESRFYKHFMRFLSLFRECLA
                     YEMPRERLAGLKTDWIKWGVDFYRLYHENKPSHLHVCSAQVHSVFHFGLIIEMMGPIW
                     VSWQFAMECYCGDLGRNLRNMRHPYASMSQRILAKSHLQHIANKYDLHWGGRGRVSDD
                     EAPKRYETVLPSYAHYALSSPTNDAQGVIRHNLMNKLINTMTTQHDIPPTVELRALVS
                     KGKLRVWNRVRVLNGGDSIRVSRMDTAEEDRRCASFVSYMVSIDWNRRHPTRHVEFED
                     HLCYGELLNLITIDLPHHPKSSDTPPVTLAFAHIKPAVSHKHRIGNHEWSYYKEYQAE
                     EMVDLASVNELVGRVKSISKPGTTYIIDRGTPYSRVSLVFHHLPSSSSSSSSSSSSSS
                     SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPLSLIFLPT
                     DLLSCSYPPSLPCYYLLYLCHGHSLLSPLFRFTSVLSRLFYIFSSFIVLSSSLFFV"
     gene            complement(<173602..>174042)
                     /locus_tag="CNL04220"
                     /db_xref="GeneID:3254802"
     mRNA            complement(<173602..>174042)
                     /locus_tag="CNL04220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568208.1"
                     /db_xref="GI:58261595"
                     /db_xref="GeneID:3254802"
     CDS             complement(173602..174042)
                     /locus_tag="CNL04220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568208.1"
                     /db_xref="GI:58261596"
                     /db_xref="GeneID:3254802"
                     /translation="MDTRRSTTGYIFKVYGGTIAWKPKRQPTVALSTIEAEYMASADA
                     AKQAVWLRLLLEDIGLGLRDQALQLVNDNAGAIALSKNPVNHEKSKHIDMRHDFICEK
                     VEDKTVSLANIPSAENSTFQIWISYFSGLILILFSILILFPSFG"
     gene            complement(176226..178418)
                     /locus_tag="CNL04230"
                     /db_xref="GeneID:3254731"
     mRNA            complement(join(176226..176529,176595..176790,
                     176843..177102,177165..177497,177556..177617,
                     177672..177752,177803..177983,178044..178418))
                     /locus_tag="CNL04230"
                     /product="nucleus protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532528|gb|CF678369.1,gi|41532538|gb|CF678379.1,
                     gi|41534938|gb|CF680779.1,gi|41556352|gb|CF702193.1,
                     gi|41556356|gb|CF702197.1,gi|41562452|gb|CF708293.1,
                     gi|41562458|gb|CF708299.1,gi|41567610|gb|CF713451.1"
                     /transcript_id="XM_567975.1"
                     /db_xref="GI:58261129"
                     /db_xref="GeneID:3254731"
     CDS             complement(join(176311..176529,176595..176790,
                     176843..177102,177165..177497,177556..177617,
                     177672..177752,177803..177983,178044..178199))
                     /locus_tag="CNL04230"
                     /codon_start=1
                     /product="nucleus protein"
                     /protein_id="XP_567975.1"
                     /db_xref="GI:58261130"
                     /db_xref="GeneID:3254731"
                     /translation="MTSQALIQAEAFESQKFLTWFKESGGWYNEELVDIVSVPGMGYG
                     AVAVKDIEEGTPLFHVPDDLILSAYTSDLKDHLDASEWDQLNKGWAQLILVMMWETIK
                     GSKSRWAGYLANMPVLFETPMFWTERQREQLSGTDIADRIGREDAEAEYTSVLAPFIK
                     AHPDLFPVDSPHITMDAFHIQGSRILSRSFTVPLHRFGRSHSQSRSDGNSEKESDDED
                     EEEMVVMIPFADMLNAAWGKDNAHLYVDEDTIEGFDEGVVMKSTQLVKQSEQIYNTYD
                     SPPNSELLRKYGHVDVLPLPSDMLDLLNETELGSWPYGNPGDEVLLQGDLIVGCVTTK
                     LGGAHMKATLQDRIDWWLEEGQEDIFPLNFSHDIDDGLISFIRLLLHDSDWDRAHKKG
                     RMPRAIIDETVADVLHEIINQRLAQYKQNIEHDLKVVRSSYHGADDKPVTSLGRNESA
                     AVVRLGEKRILYLARRKIAQATAGQKSSQKRKNNSTLMGKGKRIH"
     gene            178595..183221
                     /locus_tag="CNL04240"
                     /db_xref="GeneID:3254837"
     mRNA            join(178595..178907,178963..179012,179062..179076,
                     179143..179158,179217..179423,179489..179561,
                     179612..179718,179790..179868,181903..181971,
                     182034..182098,182149..182211,182249..182286,
                     182335..182409,182459..182529,182583..182601,
                     182655..182745,182803..182895,182944..182999,
                     183050..183221)
                     /locus_tag="CNL04240"
                     /product="mismatch repair-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41553658|gb|CF699499.1,gi|41553671|gb|CF699512.1,
                     gi|41553820|gb|CF699661.1"
                     /transcript_id="XM_567976.1"
                     /db_xref="GI:58261131"
                     /db_xref="GeneID:3254837"
     CDS             join(178694..178907,178963..179012,179062..179076,
                     179143..179158,179217..179423,179489..179561,
                     179612..179718,179790..179868,181903..181971,
                     182034..182098,182149..182211,182249..182286,
                     182335..182409,182459..182529,182583..182601,
                     182655..182745,182803..182895,182944..182999,
                     183050..183208)
                     /locus_tag="CNL04240"
                     /codon_start=1
                     /product="mismatch repair-related protein"
                     /protein_id="XP_567976.1"
                     /db_xref="GI:58261132"
                     /db_xref="GeneID:3254837"
                     /translation="MPVPAQLRTIAPEKIKAAVSPSAISAFTQTRHRPGAGSANNKLQ
                     ATTRPSTRASARIEDVSSYVVALLQGKGHGVEIGIAAISLLTGQTVITQVADNASFEK
                     TVQQLYSHPPNTIIVPDTMLKSGAAEASYGDQRDINVKEHLMSRLEDEYEIECIGVDR
                     SHWNRETGRDFVEDLAVDDELKASILMAIENKFYALCALSGLFRYLQVWRNIEFPERS
                     LRMKYVVSEGTMFIDIETAKNLELVRNNLTNKATHTMSGKSTYLKQVGLLTVQAMIGC
                     FVPAEYACFTIHDALLSRLSNDDSMEKCLSTFASEMAASAMILGLASPRSLVLIDELG
                     RGTSSLEGMGLSYAIAESLIRRQSFVFFATHFQDLAVILGNLSGVVKLHLKVQHCNTE
                     TLSPTEFGSTFAYKVAEGAAPMVHYGLEIAKLAALPSTVLQRASEIATQLSELEEQGR
                     RSNLANTSMRRRKILWELRAKLKQVQSNSRLDNETLGEFLLNLQAQCYLTLRQSLEMV
                     QTTTSGSETGH"
     gene            complement(183284..184740)
                     /locus_tag="CNL04250"
                     /db_xref="GeneID:3254815"
     mRNA            complement(join(183284..184023,184076..184187,
                     184251..184448,184499..184582,184633..184740))
                     /locus_tag="CNL04250"
                     /product="bud site selection-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538050|gb|CF683891.1,gi|41538056|gb|CF683897.1,
                     gi|41550441|gb|CF696282.1,gi|41550453|gb|CF696294.1,
                     gi|41576423|gb|CF722264.1,gi|41576427|gb|CF722268.1"
                     /transcript_id="XM_567977.1"
                     /db_xref="GI:58261133"
                     /db_xref="GeneID:3254815"
     CDS             complement(join(183294..184023,184076..184187,
                     184251..184448,184499..184582,184633..184717))
                     /locus_tag="CNL04250"
                     /codon_start=1
                     /product="bud site selection-related protein"
                     /protein_id="XP_567977.1"
                     /db_xref="GI:58261134"
                     /db_xref="GeneID:3254815"
                     /translation="MSTVGQKGTYQDGERILSIQSHVVSGYVGNRAATFPLQTLGYDV
                     DVINTVQFSNHTGYGFTDGHKTSPDELAAIFNGMAVNGLLTHPRILTGYIPSAEALSV
                     VTDRIRRMKADNPSLIYLLDPVMGDIGTGLYVSRDVVPIYKEMLNLATIITPNQFEVE
                     LLSGIAITSLETLQNALEKLHTVNQLPHIAFSSIPLPISLVESLSLPAPPPSYTRLLP
                     QPLPPWYDAVGTGAPDDEVLVCFASSWFDGQMETYAFALPTIRGYFSGVGDLFSAMVL
                     AHFKDPKANPNLPPLPWAVSRALLTVQQILLQTHVHSLAQAEVFGTATPRPLHHPSDP
                     LPADSVIPSDTELDALKPLNPKDPKRKARRMRLRELRVVQERALIQDGGEGWPGKRID
                     WTHISEQLEK"
     gene            complement(184993..187734)
                     /locus_tag="CNL04260"
                     /db_xref="GeneID:3254889"
     mRNA            complement(join(184993..185317,185374..186767,
                     186817..187019,187076..187154,187252..187334,
                     187397..187429,187486..187553,187604..187734))
                     /locus_tag="CNL04260"
                     /product="heat shock protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529891|gb|CF675732.1,gi|41529892|gb|CF675733.1,
                     gi|41530822|gb|CF676663.1,gi|41531356|gb|CF677197.1,
                     gi|41531363|gb|CF677204.1,gi|41534079|gb|CF679920.1,
                     gi|41534083|gb|CF679924.1,gi|41534168|gb|CF680009.1,
                     gi|41534176|gb|CF680017.1,gi|41534346|gb|CF680187.1,
                     gi|41534624|gb|CF680465.1,gi|41534630|gb|CF680471.1,
                     gi|41535272|gb|CF681113.1,gi|41535279|gb|CF681120.1,
                     gi|41535290|gb|CF681131.1,gi|41535294|gb|CF681135.1,
                     gi|41535995|gb|CF681836.1,gi|41536001|gb|CF681842.1,
                     gi|41537841|gb|CF683682.1,gi|41537850|gb|CF683691.1,
                     gi|41538736|gb|CF684577.1,gi|41539371|gb|CF685212.1,
                     gi|41539379|gb|CF685220.1,gi|41540262|gb|CF686103.1,
                     gi|41540269|gb|CF686110.1,gi|41540484|gb|CF686325.1,
                     gi|41540489|gb|CF686330.1,gi|41540685|gb|CF686526.1,
                     gi|41541364|gb|CF687205.1,gi|41542126|gb|CF687967.1,
                     gi|41542134|gb|CF687975.1,gi|41542279|gb|CF688120.1,
                     gi|41542291|gb|CF688132.1,gi|41543101|gb|CF688942.1,
                     gi|41543109|gb|CF688950.1,gi|41543113|gb|CF688954.1,
                     gi|41544210|gb|CF690051.1,gi|41544214|gb|CF690055.1,
                     gi|415"
                     /transcript_id="XM_567978.1"
                     /db_xref="GI:58261135"
                     /db_xref="GeneID:3254889"
     CDS             complement(join(185237..185317,185374..186767,
                     186817..187019,187076..187154,187252..187334,
                     187397..187429,187486..187553,187604..187666))
                     /locus_tag="CNL04260"
                     /codon_start=1
                     /product="heat shock protein"
                     /protein_id="XP_567978.1"
                     /db_xref="GI:58261136"
                     /db_xref="GeneID:3254889"
                     /translation="MLSLSRTLRSTQAINPLRSVARTTSPLLASKRFNSGKVSGPVIG
                     IDLGTTNSCVSIYEGGAPKVLENAEGARTTPSVVAFTKDGERLVGQPARRQAVVNGEN
                     TIFATKRLIGRKFKDAEVQKDITNVPYKIVAHTNGDAWVEARGEKYSPSQIGAFVVNK
                     MKDTASAYLGKPVKHAVITVPAYFNDSQRQATKDAGSIAGLEVLRVINEPTAAALAYG
                     LDKNDSAVIAVYDLGGGTFDISILEMQKGVFEVKSTNGDTHLGGEDFDIALVNHILAE
                     FKKETGIDVSGDRMAIQRIREAAEKAKCELSSAGATDVSLPYITATAEGPQHINLNLT
                     RARFESIVKPLVDRTIEPCKKALSDAGIKASEINDVILVGGMSRMPKVVETVKSTFGR
                     EPSKGVNPDEAVAIGASIQAGVLAGNVTDILLLDVTPLSLGIETLGGVFTRLINRNTT
                     IPTKKSQTFSTAADGQTAIQVKVYQGERELVRDNKLLGDFQLTGLPPAPKGVPQIQIT
                     FDIDADGIVNVSAIDKATNREQSMTIASSSGLSDNEIEQMVADSEKYAEADKARRLVI
                     EEANKGESFVVDTEKSMTEFEAQLDATEREKVKKLLGELREIAAKGAAGDASVKAEDI
                     RQALDAAQQASLGLFQKVYEKRNAESHDNNTESSESTEGEKKQ"
     gene            complement(187971..190202)
                     /locus_tag="CNL04270"
                     /db_xref="GeneID:3254899"
     mRNA            complement(join(187971..188088,188149..189018,
                     189067..189134,189187..189284,189336..189533,
                     189585..189788,189843..190061,190115..190202))
                     /locus_tag="CNL04270"
                     /product="DNA dependent ATPase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531332|gb|CF677173.1,gi|41531337|gb|CF677178.1,
                     gi|41532296|gb|CF678137.1,gi|41532301|gb|CF678142.1,
                     gi|41537959|gb|CF683800.1,gi|41537967|gb|CF683808.1,
                     gi|41555176|gb|CF701017.1,gi|41570394|gb|CF716235.1,
                     gi|41570402|gb|CF716243.1"
                     /transcript_id="XM_567979.1"
                     /db_xref="GI:58261137"
                     /db_xref="GeneID:3254899"
     CDS             complement(join(188012..188088,188149..189018,
                     189067..189134,189187..189284,189336..189533,
                     189585..189788,189843..190061,190115..190183))
                     /locus_tag="CNL04270"
                     /codon_start=1
                     /product="DNA dependent ATPase"
                     /protein_id="XP_567979.1"
                     /db_xref="GI:58261138"
                     /db_xref="GeneID:3254899"
                     /translation="MSRRSRAGGAVRGPSSALTSFLAGLGVEPSHRINAWGDRSAVET
                     PTSNGSNQHPDPANVVSDENVEAGPSRVGLGTPSLDEEGDLPVGFKRERGTNGDEDYK
                     AKRVRAASIDSDDLDADDTPVVGHSARTPKSAPQSSTNVPAGPMRPIGEFMVCGECTK
                     RFTVTAYTKEHPTNSQTYLCVQCCYALGIDPFAKPKKAAPKKAVKKQNRAKIVHYEQR
                     RGVNSLGDICIQLVGKYIENVEQLGDIGSINMDKVCRIICKGRRLTPETAPLFYSVER
                     DSLDMYDCTRLTPEAFFTLANLCPNLQTLRLDLVGQMSTEVVSHWAKSLKQLKRIELH
                     APFLVRKEAWIELFQAAGERLEGFLVTQSPRIDRETVHQLVKNCPNLTELRLAEIGRL
                     DSEMLKELKPLKKLRLLDISSPADSLTDDAIVDLLEAVGDSIEDLNLADNFDLTDAIL
                     PAIVKYCPRLQSLCLRNLTELTDEGVTAFFGSLQAKGHQGLRCIDMEKGHELRDSALG
                     ALIAHSGETIEWLSLLGWKEVALEALNALVRCKNLKYLDVGWCRAVNNFWVKDVLDGC
                     HAIEQVRVWGCNELSDGVPRKKGVKVIGIETHSI"
     gene            <190467..191166
                     /locus_tag="CNL04280"
                     /db_xref="GeneID:3254754"
     mRNA            join(<190467..190623,190672..190759,190829..190901,
                     190953..191012,191076..191166)
                     /locus_tag="CNL04280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568211.1"
                     /db_xref="GI:58261601"
                     /db_xref="GeneID:3254754"
     CDS             join(190467..190623,190672..190759,190829..190901,
                     190953..191012,191076..191165)
                     /locus_tag="CNL04280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568211.1"
                     /db_xref="GI:58261602"
                     /db_xref="GeneID:3254754"
                     /translation="MATHRSAVLNDKPYSDPNPLPSNVPHVDELGVTSAPLKSASFFI
                     GQHCKEVNEDFMLCKQENRDPAHCLAEGRKVTRCAQELINKLRETCLTEFDAHWQCLE
                     KNNQYFQACRKPEKALNQCVFTKLGLTKNIPGSPEGRPQIHEKESPIYSRVQK"
     gene            complement(<191228..>192118)
                     /locus_tag="CNL04290"
                     /db_xref="GeneID:3255026"
     mRNA            complement(join(<191228..191469,191525..191760,
                     191906..192006,192110..>192118))
                     /locus_tag="CNL04290"
                     /product="20 kda nuclear cap binding protein (ncbp),
                     putative"
                     /transcript_id="XM_567980.1"
                     /db_xref="GI:58261139"
                     /db_xref="GeneID:3255026"
     CDS             complement(join(191228..191469,191525..191760,
                     191906..192006,192110..192118))
                     /locus_tag="CNL04290"
                     /codon_start=1
                     /product="20 kda nuclear cap binding protein (ncbp)"
                     /protein_id="XP_567980.1"
                     /db_xref="GI:58261140"
                     /db_xref="GeneID:3255026"
                     /translation="MAQIDRETERRLLALSSTLYIGNLSFYTTETQMYQRGIIMGLDR
                     NTKTPCGFAFVEYFLHEEAVDCMRYISGTKLDERVIRCDLDPGYKEGRQFGRGRSGGQ
                     VRDEFRQEYDSGRGGWGHQRLEEERRRQEQDRLRSQMQFDTYAAVGGLGLAGADVPRG
                     EDFFGDRQKRGRSEDEEEIERREDEKRLRGERDDE"
     gene            <192228..196821
                     /locus_tag="CNL04300"
                     /db_xref="GeneID:3254790"
     mRNA            join(<192228..192362,192404..192814,192864..192936,
                     192976..193303,193354..193675,193723..193830,
                     193889..193990,194032..194365,194417..194583,
                     194634..194932,194980..195094,195145..195301,
                     195351..195366,195419..195493,195563..195869,
                     195923..196280,196339..196444,196506..196821)
                     /locus_tag="CNL04300"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550577|gb|CF696418.1,gi|41550899|gb|CF696740.1,
                     gi|41550908|gb|CF696749.1,gi|41551074|gb|CF696915.1,
                     gi|41563521|gb|CF709362.1,gi|41563529|gb|CF709370.1"
                     /transcript_id="XM_567981.1"
                     /db_xref="GI:58261141"
                     /db_xref="GeneID:3254790"
     CDS             join(192228..192362,192404..192814,192864..192936,
                     192976..193303,193354..193675,193723..193830,
                     193889..193990,194032..194365,194417..194583,
                     194634..194932,194980..195094,195145..195301,
                     195351..195366,195419..195493,195563..195869,
                     195923..196280,196339..196444,196506..196620)
                     /locus_tag="CNL04300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567981.1"
                     /db_xref="GI:58261142"
                     /db_xref="GeneID:3254790"
                     /translation="MSRCCRRASQYEASPIKCLNCLLITLSPVFLPTMADNSNLSDAD
                     KIRLKRLARLGTSTPIPSQTQPQQQPSSSSTPEPHHPPSASSRLLANLPPAASPTSSS
                     PAIVSPKPSASTKPDPQAVQPKLSVTPSLSLKRPSSASTPRDEPVGPRIVHTKPIQPL
                     VKTEYKAWETEKVGQVFAVTLSKQKAQETDWSLCWLKDLEQELNEENYPSPLRTDIEL
                     ADRLLIARLSMDPTLMAQSDDPDALTILAGLPQNETVFEYLAGCWKRLYQASRDANRY
                     AFSEDEKSQWGKSMDKIKGLVVSYCGMTIEDPTMFPQPAEKPLGPAEFLPLLLSVHQP
                     SSGDLLMSTPSVPTPLSGPLQPNDLLPFLQDLAAGFDDDTLKDVISPTLSLFFQEWFK
                     ITPTPDIMGAEWRRYLGAMNLLVQVKHIAAFLPTLPIWVAPNVTAPKLEWQSLLGPLT
                     RLSVFPREFPEIWKTYFSNPTERKKEDIDANKSNLRFTLGSLHSSLFNVYNAIVRASP
                     DAREGILDFFTLALRLNEKRAGMRVDPRTVSSDGYMTNLQVVLLKLFEPVMDARFSKI
                     DKVDPAYYKSSKRIDISEETKIKGAKEEADEYFGSSMDVDTKPNFISDLFFLLNSYLH
                     LGVVKTISTRIRAEKNLSEIEKELKRVEASTGDWANNATLQAQGEATIKKLKSDMSVL
                     HASIHAYDTQLLDRDMIRMVVSFLSFVMTWLIRLVDPNHQYPASPLNLPLPKEAPMAF
                     RMLPEFFIENIAEYFEFLAKYDPDALDDVDKDIFITFAITFLSPNYVNNPFLKAKLVT
                     IISYGLYPMGYWRHGPLFDRLSILSVATDHLMPTLIRFFIDVEITGGHTQFWDKFNFR
                     RDIGHIFKAMWTNPLHREAFVKSRHDDFDQFIRFVNMLMSDTTFHLEESLTGLAKIGQ
                     IESQKANTASWEALPQSEREDLDGQLRQTEGSVPWHTQMGLSNVKLIRDFTATTREPF
                     VAPEIVDRLAASLDENLTALVGPKMSDLKVSNPDKYYFKPKDLLAAIAQIYLNLSVES
                     EFIRAVANDGRSYSKDLFMKFARTLKNRAIMTEGEVAEVISFTQKIEDMKATISMEDE
                     REIPDEFLDPLLSTLMKDPVILPVSRVTIDRGTIRTVLLSKEVDPFNNVPLKYEDCIP
                     DTELKAKIDAWLAESNAKQADSVMDVDQL"
     misc_feature    197689..197740
                     /note="C-rich"
     gene            complement(198033..>200345)
                     /locus_tag="CNL04310"
                     /db_xref="GeneID:3254789"
     mRNA            complement(join(198033..198351,198411..198606,
                     198665..198986,199043..199453,199505..199728,
                     199791..199882,199946..200126,200183..>200345))
                     /locus_tag="CNL04310"
                     /product="monosaccharide transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540472|gb|CF686313.1,gi|41540480|gb|CF686321.1,
                     gi|41575818|gb|CF721659.1,gi|41575821|gb|CF721662.1"
                     /transcript_id="XM_567982.1"
                     /db_xref="GI:58261143"
                     /db_xref="GeneID:3254789"
     CDS             complement(join(198165..198351,198411..198606,
                     198665..198986,199043..199453,199505..199728,
                     199791..199882,199946..200126,200183..200345))
                     /locus_tag="CNL04310"
                     /codon_start=1
                     /product="monosaccharide transporter"
                     /protein_id="XP_567982.1"
                     /db_xref="GI:58261144"
                     /db_xref="GeneID:3254789"
                     /translation="MFFKRNSTDTPKPPKHAPDRDTIPSLEDLGVQLHPDTARYVADS
                     EALAHAIGGNGLKDVFSSGLVLIASFATCMGGLLFGFDQGILTIVLTMKQFLGQFPDI
                     DPDVSSSAAFHKGLMTALLELGALIGALQAGFVADKYSRKSAIGLGSVWFVIGAILQT
                     SSFSYAQLVVGRLVGGLGVGLLSAVAPMYISEIAPPNIRGALLAMEATTINGGIVIMF
                     YITYGSRHIPGDWSFRLPFLVQIAPCILLIFGLWKLPYSPRWLAQAGRDEDALHALVR
                     LRGYPATDPRLQAEWISIRAEAIQNREVIVKSHPSLQGEDFMSEFKLEIASWIDMFKP
                     KLIRRTIIGPTLMMFQQFSGISALVYYSPTLFEQLGLDYTMQLDMSGVLNIIQFVATG
                     LAFFILDRVGRKPPLLFGSVATTICHVIVAVIMAKFSHDWVRYNKEAWVAVAFIFIYI
                     FSYGVGWSPVPWAMPAEVHTSSRRAKGVAITTVFNWLGNFIIGLITPPMLENIKYGTF
                     IFFATFCFLSGLYVWFFCPEPMGKTLEQMDQIFHSNTAHEDNLAKSDIQAAILGISIA
                     GPLSGSAIAGKVGDKDIQQEWIENA"
     gene            <200749..>201256
                     /locus_tag="CNL04320"
                     /db_xref="GeneID:3254904"
     mRNA            join(<200749..200814,201101..>201256)
                     /locus_tag="CNL04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_567983.1"
                     /db_xref="GI:58261145"
                     /db_xref="GeneID:3254904"
     CDS             join(200749..200814,201101..201256)
                     /locus_tag="CNL04320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567983.1"
                     /db_xref="GI:58261146"
                     /db_xref="GeneID:3254904"
                     /translation="MSETAKGHPNAEQSVSPLIKKLIASIDSDPLDYQPVDSGKWKAA
                     TRTPFDPIVQIINQCGHKLSWVPNKVFMA"
     gene            <202394..>202954
                     /locus_tag="CNL04330"
                     /db_xref="GeneID:3254742"
     mRNA            <202394..>202954
                     /locus_tag="CNL04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_567984.1"
                     /db_xref="GI:58261147"
                     /db_xref="GeneID:3254742"
     CDS             202394..202954
                     /locus_tag="CNL04330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567984.1"
                     /db_xref="GI:58261148"
                     /db_xref="GeneID:3254742"
                     /translation="MGDTGGRWGKGGGTFFGADKHIMRPGLALGRTDSGESRQLHARK
                     QSSLPVKRDSGMEEWLSAPRPMTICCKTRSAQNFRAELPCSPSAASSYKSSVSSRNNF
                     HKAIQTPTFYDMDEEELLPPLLPAFGTRKIPFNSIGDSAPIPWGRASPVPFPKSPGTS
                     PGTATRRVHGCLLTADGGTLKAWTQF"
     gene            <203535..>205071
                     /locus_tag="CNL04340"
                     /db_xref="GeneID:3255003"
     mRNA            join(<203535..203755,203828..203999,204083..204239,
                     204316..204663,204723..204901,204961..>205071)
                     /locus_tag="CNL04340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567985.1"
                     /db_xref="GI:58261149"
                     /db_xref="GeneID:3255003"
     CDS             join(203535..203755,203828..203999,204083..204239,
                     204316..204663,204723..204901,204961..205071)
                     /locus_tag="CNL04340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567985.1"
                     /db_xref="GI:58261150"
                     /db_xref="GeneID:3255003"
                     /translation="MVKLPSASRIRSLATVPSTATRAFATVNPTPPAAQPTKSKPRFE
                     KLDDGLTFDDFLSGDVPPENERVVLGNTKQPRLPSFLKHPIPTGASYSGIKKELRGLG
                     LHTVCEEAKCPNIGECWGGGKGNATATIMLMGDQCTRGCRFCSVKTSRAPPPLDVHEP
                     ENTAEAISRWGLGYIVLTSVDRDDLVDGGAAHIASTISKIKQKAPNILVEALTPDFAT
                     KGVNVIHTVASSGLDVFAHNVETVERCTPFVRDRRAGFSQSLKVLEEAKKGAKAAGRE
                     ILTKSSIMLGVGEMEEEIHETLRRLRASDVDVVTFGQYMRPTKRHMKVDRYVEPEEFA
                     KWKNVAEGMGFLYVASGPLVRSSYKAGEFFIENVLKKRRAAAAEHAASQLSTQPPEIA
                     AKV"
     gene            complement(205081..206965)
                     /locus_tag="CNL04350"
                     /db_xref="GeneID:3254771"
     mRNA            complement(join(205081..205378,205453..205686,
                     205737..205835,205902..206203,206269..206303,
                     206371..206441,206512..206626,206686..206769,
                     206824..206965))
                     /locus_tag="CNL04350"
                     /product="ER to Golgi transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539859|gb|CF685700.1,gi|41539874|gb|CF685715.1,
                     gi|41542447|gb|CF688288.1,gi|41542455|gb|CF688296.1,
                     gi|41544646|gb|CF690487.1,gi|41544651|gb|CF690492.1,
                     gi|41561097|gb|CF706938.1,gi|41561107|gb|CF706948.1"
                     /transcript_id="XM_567986.1"
                     /db_xref="GI:58261151"
                     /db_xref="GeneID:3254771"
     CDS             complement(join(205143..205378,205453..205686,
                     205737..205835,205902..206203,206269..206303,
                     206371..206441,206512..206626,206686..206769,
                     206824..206943))
                     /locus_tag="CNL04350"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein"
                     /protein_id="XP_567986.1"
                     /db_xref="GI:58261152"
                     /db_xref="GeneID:3254771"
                     /translation="MYEPHLVDFANQHSHDNEGMSLLEELDKIAPIKRFDAFPKVEST
                     YTIKSRRGGVLTALVGLIIFLLVLNDLGEYLYGAPDYAFQVDSEVQKDLQLNVDLTVA
                     MPCRYLTIDLRDAVGDRLHLSNSFAKDGTHFNVGTATFIKNNPSSTTPSASEIISSSR
                     RRTPNQQSSFSGIKRLFGLDSSASSNRRTSQGHTAYRPTYDKVQDGPACRIYGSVEVK
                     KVTANLHITTLGHGYMSFQHTDHHLMNLSHVVHEFSFGPFFPAIAQPLDQSYEITEQP
                     FTIFQYFLRVVPTTYIDASRRKLITSQYAVTDYSRSFEHGKGVPGLFFKYDLEPMSVI
                     IRERTTSLYQFLIRLAGVVGGVWTVAAFALRVFNRAQKHVSKAVMGEKEYIPSSFHTP
                     SPAIKQDQSGYFGNDPSATLVSRATSWVSGNSPGGGRSG"
     repeat_region   208797..208851
                     /rpt_type=tandem
                     /rpt_unit_seq="ccg"
                     /satellite="microsatellite"
     repeat_region   208978..208997
                     /rpt_type=tandem
                     /rpt_unit_seq="ccg"
                     /satellite="microsatellite"
     gene            209346..>211713
                     /locus_tag="CNL04360"
                     /db_xref="GeneID:3254862"
     mRNA            join(209346..209699,209746..210504,210565..>211713)
                     /locus_tag="CNL04360"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542512|gb|CF688353.1,gi|41542529|gb|CF688370.1,
                     gi|41566069|gb|CF711910.1"
                     /transcript_id="XM_567987.1"
                     /db_xref="GI:58261153"
                     /db_xref="GeneID:3254862"
     CDS             join(209451..209699,209746..210504,210565..211713)
                     /locus_tag="CNL04360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567987.1"
                     /db_xref="GI:58261154"
                     /db_xref="GeneID:3254862"
                     /translation="MLTPCRADEHWVVVELCDEIRIEAVEIAVWEFFSGVVREVRVSV
                     GGEDEEDDAEEPGQDDVAGRGHRWKQVGSFIGKNVRGSQTFSLSQPTSFHRFIRLDFP
                     SYFGSEYYCPVSSLKVYGMNQMEAFKWEQKQLSAVAKDRDRTGNREHEEEERRAKERR
                     EREKKERDERDKQEQRERELDELEKLLHEQAGRLVPELLTESGLFSSIDETAPTNVPT
                     VVSKRDGDSDSPPTNESMATSLIESTSIESTSIESPTSIESPSTSYTRAVPPRSDSSE
                     SIYAFIIRRLNALEGNSSLVARYIEEQAKVMRSMLKQVQVGWDEWKGEWEDEDRGRWQ
                     QERMRQEDRLGRVLSQLEQQRIAFDAERKAIETQLRVLADQLGYERRRGIAQLIIMVV
                     IILLGAASRSSTMDAILTPLLKEARRRRSDYYHRKSLSGPLAGLHIDMGAGRPPAIIG
                     QARPTSTTPSAHPHRHSSSTPTPRLKTSLSRAGSGHRSNTSLKRRGIVPQVPPSYRSV
                     SSSEFTFSPLSHLPPTSSPSPANIPNPNPNPRNVRVSFPPPRQTPPPPSVSSRKLAQS
                     AHLHHLHTTAAAAAAREDTERGITASMRRRRMRSSLVNDDNEQQTTVSGLGSGKADAG
                     GGGGGGGGEEAERVVGAEDNSQGEWGTDDFDTEADDFDTEAEAEAEVSKVEDQVRDKK
                     DSETDRKEQDQLGETEQQPVREKRGVQGEHVGLARA"
     repeat_region   211280..211299
                     /rpt_type=tandem
                     /rpt_unit_seq="cgg"
                     /satellite="microsatellite"
     repeat_region   211426..211480
                     /rpt_type=tandem
                     /rpt_unit_seq="cgg"
                     /satellite="microsatellite"
     gene            complement(211723..214285)
                     /locus_tag="CNL04370"
                     /db_xref="GeneID:3254991"
     mRNA            complement(join(211723..212043,212105..212413,
                     212491..212583,212642..212727,212798..213343,
                     213397..213500,213546..214285))
                     /locus_tag="CNL04370"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532923|gb|CF678764.1,gi|41532928|gb|CF678769.1,
                     gi|41533848|gb|CF679689.1,gi|41533862|gb|CF679703.1,
                     gi|41553004|gb|CF698845.1,gi|41562596|gb|CF708437.1,
                     gi|41563666|gb|CF709507.1,gi|41563676|gb|CF709517.1,
                     gi|41563821|gb|CF709662.1,gi|41563829|gb|CF709670.1,
                     gi|41574218|gb|CF720059.1,gi|41574223|gb|CF720064.1"
                     /transcript_id="XM_567988.1"
                     /db_xref="GI:58261155"
                     /db_xref="GeneID:3254991"
     CDS             complement(join(211756..212043,212105..212413,
                     212491..212583,212642..212727,212798..213343,
                     213397..213500,213546..214207))
                     /locus_tag="CNL04370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567988.1"
                     /db_xref="GI:58261156"
                     /db_xref="GeneID:3254991"
                     /translation="MESSDPQPVRAPVISSSATSSPILFDTFLLLLLRLVYFFISRKF
                     LHSTINPTLRDISQPDTILPPTVLLPTADSSRRGGNALGLETEYNDETDDTSFTPVSS
                     YPGSPAPISVTLASSNNGFRRDDNPSYSSSNLPSYPSQGENTIELQAIGQKLKDASSG
                     VSRKVLQLSHGKRSGAGTKRVKKATRGLHRVSRILFSVCFAEGCNLLSLVVFHAIGVL
                     NARSRQVNFSVSLHFILALILVVVPLVQCLLFTYRSRDSSSTSTTPSQSSSLSFTSRL
                     LISLIPFTLYMFLFTRIPPYITAVPMNVQVVSTPSMDIDDPSSTASSIDEAIVQWSTS
                     GPEGWEQGGWLAPSLGRVVVLGVVILGSLSGFGAVRSAWNFFEHRRAGSRTLTDNDLL
                     QAERSLYRVRQDLISKRDEINRYAVPNGEGSSGWMGRIFRGENNQTASLEAELKGLET
                     MEMQVSRSLRAMKARKRRQDFGHTFRGQIYNVLGYVFAIYCAARLLMCLPSLFFAPRT
                     AEQESGEIPVEGRGNTNGDWISFFLALAISKLPRDFADIDVPTWSRGISLILTGVLIL
                     SSLTQVMRSLSKILRLTSKTVGAGFLLLSLGQLFTTYVISLLIQLRTSLPPTLPESGP
                     FGNHGNYTGIDHDDQFTDSSPKDDSLLSTLPDFRVFGRLFDIMFLLAAATTALYRYIV
                     LIASADDIGDVYT"
     gene            complement(214454..>216766)
                     /locus_tag="CNL04380"
                     /db_xref="GeneID:3254836"
     mRNA            complement(join(214454..215179,215227..215703,
                     215754..215930,215979..216463,216550..>216766))
                     /locus_tag="CNL04380"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41555108|gb|CF700949.1,gi|41555118|gb|CF700959.1"
                     /transcript_id="XM_567989.1"
                     /db_xref="GI:58261157"
                     /db_xref="GeneID:3254836"
     CDS             complement(join(214511..215179,215227..215703,
                     215754..215930,215979..216463,216550..216766))
                     /locus_tag="CNL04380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567989.1"
                     /db_xref="GI:58261158"
                     /db_xref="GeneID:3254836"
                     /translation="MAIPQNAVDRSRASSSELSELSSEENKASKTPKTVGKKRARSAE
                     DKTAGPTKPKAKKVKASGKSAGETKNPKGSNSKKPTKEIVKKEKGAIQAKKDFVVATA
                     LGASAILHEDSDLSDIESDTERTKKQASSKVALKKKATKVAKEPKEKKEKKANGETKK
                     QTKTAGKMKEKAPKGASKNAQRGKEKTQKKTKEAEPRDAKPKSRVKKPEVIPEPPIFE
                     KVVTRLGHEEAEQRMALREFLWRFRQILSIPERSLPALDDFDRPITESNVRLISGALL
                     DVIKDELEASKDEDNEDLKETLFNFREELRYYADVPRFASIFQSLIEPLGLELPPAPF
                     DRRAEANEAALRSLFDLGDDQPAPAWATELSVPSRRGASRMPQPSEVVRMLLALVERT
                     LTTPKIKNSMETFALETQVRKEHANLLKKEQTAWEKRKQRLQEERLLCKTAAETKANV
                     SQTTKESHEHNLRVAQYNTNMRAGINQTSLRFEPLGTDLDGRIYYALSHRPVDNDSKA
                     PIGWGTGILIWGPAVAGKVTEDDNLPHSIERWSHFGKSKDVKPLIKWLEWRYKKAVES
                     AKPNGTATATHEDASPDDTLTQSISQLASHVRSQKHVRHEKDDDASSASSGLTPPPTS
                     SREEMMALINPRNYTPSAETLEDRGKSLTSRLGDVAEWLEVLEWKGLGEP"
     gene            <217670..>218749
                     /locus_tag="CNL04390"
                     /db_xref="GeneID:3254970"
     mRNA            join(<217670..218430,218611..>218749)
                     /locus_tag="CNL04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_567990.1"
                     /db_xref="GI:58261159"
                     /db_xref="GeneID:3254970"
     CDS             join(217670..218430,218611..218749)
                     /locus_tag="CNL04390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567990.1"
                     /db_xref="GI:58261160"
                     /db_xref="GeneID:3254970"
                     /translation="MIPPSIKFSRPLTTVNAVTLVALASFFFSVLYYALSPSPLLPFD
                     TLSSYNAESNKPNDAPREAYVTFLSNEDPYYFQSARLLVYALQHDPLTADPSRPVIVL
                     TTPGVPASYSRKLEAEGAIVIEKPFITSLPMVQTNPRWKDVYTKLWIFNMTSYDRLVY
                     YDADHLVLRPVDSIWEAENSWPESGLAALGSGDGGYVEDSDYFLAGFFLAIPKEEIME
                     GLLAERGYDPVFPEQNLMNKYFSRDGLRPWAPLNPIIHEKCWQGWVERRLAELFYERL
                     GRMEGYWLAKESSGTIPTPDPRG"
     gene            complement(218777..221632)
                     /locus_tag="CNL04400"
                     /db_xref="GeneID:3254902"
     mRNA            complement(join(218777..220256,220310..220401,
                     220457..220528,220588..221029,221085..221169,
                     221223..221323,221377..221632))
                     /locus_tag="CNL04400"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533640|gb|CF679481.1,gi|41533643|gb|CF679484.1,
                     gi|41536274|gb|CF682115.1,gi|41536283|gb|CF682124.1,
                     gi|41536346|gb|CF682187.1,gi|41536351|gb|CF682192.1,
                     gi|41540323|gb|CF686164.1,gi|41540332|gb|CF686173.1,
                     gi|41544092|gb|CF689933.1,gi|41544110|gb|CF689951.1,
                     gi|41550043|gb|CF695884.1,gi|41550044|gb|CF695885.1,
                     gi|41560176|gb|CF706017.1,gi|41562576|gb|CF708417.1,
                     gi|41562585|gb|CF708426.1,gi|41563030|gb|CF708871.1,
                     gi|41565509|gb|CF711350.1,gi|41565559|gb|CF711400.1,
                     gi|41565565|gb|CF711406.1,gi|41568060|gb|CF713901.1,
                     gi|41568066|gb|CF713907.1,gi|41568523|gb|CF714364.1,
                     gi|41569843|gb|CF715684.1,gi|41569847|gb|CF715688.1"
                     /transcript_id="XM_567991.1"
                     /db_xref="GI:58261161"
                     /db_xref="GeneID:3254902"
     CDS             complement(join(218909..220256,220310..220401,
                     220457..220528,220588..221029,221085..221169,
                     221223..221323,221377..221450))
                     /locus_tag="CNL04400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567991.1"
                     /db_xref="GI:58261162"
                     /db_xref="GeneID:3254902"
                     /translation="MADTTKYGNAVEFDVDLHSIYAAYIGLFESTNTDWWEKSWGGYF
                     VSFNEFLGFGWEVMVVVDSETGKPHVAVRREQIALFARMIRTRFGESLSKDPPTTLPL
                     NPVPTRNLALRRLVTVRDLSGYRKLAASLPAAELSYLRSRVRSGEATVIEQLFYAGGS
                     SGERETGGVGVRDNGVGYTFACVKTNWWEKGGPPYGLIPGQGRTHSGSTGQGSNKGLV
                     LEIGLAVLRCANLRALGVWPPVPADNYRKSHYVVEEWVDKRANHNPPTFPRAYAFGQS
                     EFVAEKRVETILDATLNALASQENDGHANALILLTVGEPVPLPLPSSSTLPNNVLQFD
                     VLALEYNFLRRAQAQGIPGTPDRQQPLTSLASLLQTLQIPVQPFAPIGNAGNDAYYTL
                     LAFQKLVMGETRLPDILFSQPGPYASMQFPLSPRSSVALPFPQYPAVALPVPVMPAAA
                     GDSRRSSTSSNRPGSGFVQPSLPPSSSDRTQGGRYASETSTRRRPISIGDPLNIYTDS
                     SNRTSSDLRTPNGLAQDGNSGIGSQRGKRMSVVRSQTVFWDDAAYADSNSVRGAELKT
                     PLPNGLTGESTSYVQEQRSRAREGPPLSRSAGKSTWLGSQGRSISYDVAGSAGGMSGT
                     SSAANSPIDKPSGSLSNINLPHTGMKPSGLSSTSLQRDTNEGAYSSGTGSTGNTKPSP
                     GSSGEVQGMGHRVRYSTGSIQAVDEVKNGAKNGKEKKKGKGPKDLAGAIAKFWIG"
     gene            complement(<222393..>223210)
                     /locus_tag="CNL04410"
                     /db_xref="GeneID:3254733"
     mRNA            complement(join(<222393..222626,222686..>223210))
                     /locus_tag="CNL04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_568213.1"
                     /db_xref="GI:58261605"
                     /db_xref="GeneID:3254733"
     CDS             complement(join(222393..222626,222686..223210))
                     /locus_tag="CNL04410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568213.1"
                     /db_xref="GI:58261606"
                     /db_xref="GeneID:3254733"
                     /translation="MAIDTVMHRAFYVCPLPREDPKRCKFFVWEDEIHKNAKSDQAPE
                     TPCVGRSRFGGSTGQALGQTPVGHSSSSVGLHTPHSLSKGKQAASVLSDNEDDLVPVE
                     DDIDWGAVDVDGLEREAIAGSQNSVKKHGTRDSISSTPTLGFNERLSSVMTGMKRDRE
                     EEDEDLRTPKKANIDSNPFVSSPAGTLPPHPKLLPSISTMEQLNDELYRMDRLLQGSE
                     KLKQGLRNRVKDLESKNKALQDRVKELEARLKQE"
     gene            complement(223860..225123)
                     /locus_tag="CNL04420"
                     /db_xref="GeneID:3254885"
     mRNA            complement(223860..225123)
                     /locus_tag="CNL04420"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542806|gb|CF688647.1,gi|41542813|gb|CF688654.1"
                     /transcript_id="XM_567992.1"
                     /db_xref="GI:58261163"
                     /db_xref="GeneID:3254885"
     CDS             complement(224295..225116)
                     /locus_tag="CNL04420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567992.1"
                     /db_xref="GI:58261164"
                     /db_xref="GeneID:3254885"
                     /translation="MSPEKLTEENILDREETNIPSTSSSILPAPISYPATVSYRIANT
                     WLRLIASGIIAILLIHILHIQLSPMEAVEPAPPTPPPAAEAYVTFLAHSDDPRPWYFN
                     AVRRLMFQLKYDPLTLDPHPRDFVVITTPGVPEWQLEQLREEGAIIASRPLIDHLPLP
                     EKGISRYAEVYTKLFIFNLTDYERVLFVDADQLMVKPLTGIWDDPNAWPESGMAACGE
                     SKSAWDHPTPIEDQNYFNSGFMLARPDEKTFNELLQEKDFDPWFPEQVRLVRVLS"
     gene            complement(225804..228138)
                     /locus_tag="CNL04430"
                     /db_xref="GeneID:3254882"
     mRNA            complement(join(225804..226082,226153..226287,
                     226340..227754,227808..228138))
                     /locus_tag="CNL04430"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41557544|gb|CF703385.1,gi|41557549|gb|CF703390.1"
                     /transcript_id="XM_567993.1"
                     /db_xref="GI:58261165"
                     /db_xref="GeneID:3254882"
     CDS             complement(join(225848..226082,226153..226287,
                     226340..227670))
                     /locus_tag="CNL04430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567993.1"
                     /db_xref="GI:58261166"
                     /db_xref="GeneID:3254882"
                     /translation="MIRLGRWIESGVECPTVSPKAEEFFKMWCEGEKSIKLKPEEANA
                     LIDSQPDKLGGLTLPDGRVAYSMPLPPRKFRRPSQDPDIQFDVTPKMLMEHFHGNRRK
                     VAFVIRRRYYIIPPLPSSAENYYNRLESKQQAEVDSLRRYWLGLKTFKDCFQWGRWFV
                     ATVFFLPFLLICGAYIAGLERVPLTGRWRLILLTPEEEDAISTSLAGGNWYRSVINLL
                     TTPERPAPPIVSTDDWRWAWVQSVLNRLETAALTECQLIPPEQRPHNEYVSALPLPPP
                     IYHPFKPRPRVSSLLHSVLPGGEPNTGREHLEVGPPYNIMLLQKDEQNAFSYGFGGKK
                     AGGIVIYTGLLDEILRHSSPTPQSAPQIETPQSGFLSGLFSTSRTSNQNQQHHIQPTE
                     EQNLHLACILAHEMGHLLLSHHLETLSQQQVLWPSVLGFSMDLIRAFIWPLTVFLGPT
                     VNDALANMGRTSSEELADKYGEIGFQWKHEYEADLAGLRILARAGYDPRATIGHFQSS
                     VASLHEIQPDDKADNNTLTGAAFKLWTKATHPSVEQRTDAIRKEIDRWQEEAKKLTQK
                     "
     gene            <228290..>228987
                     /locus_tag="CNL04440"
                     /db_xref="GeneID:3254781"
     mRNA            join(<228290..228481,228529..228763,228800..>228987)
                     /locus_tag="CNL04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_567994.1"
                     /db_xref="GI:58261167"
                     /db_xref="GeneID:3254781"
     CDS             join(228290..228481,228529..228763,228800..228987)
                     /locus_tag="CNL04440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567994.1"
                     /db_xref="GI:58261168"
                     /db_xref="GeneID:3254781"
                     /translation="MSSHVTTHNNNKSVNLQLHTVYHSIHMKPHPLHTTNHLRDLTPQ
                     EAQQLTAFIDKRKWFEHRLDSLEHIPPVYPFIHPVLEQIPENANQCDLQFMRSGEADS
                     QWQLPDQDQVKAWKRERDEIEEQVLEFDGGDLKRMKKMTRADKSASGYITSPDTAIDT
                     PRVHHSRPYRLDRPYLIFITAARPDPRFGDASTSMGSGSVAGDE"
     gene            complement(233836..>237342)
                     /locus_tag="CNL04450"
                     /db_xref="GeneID:3254727"
     mRNA            complement(join(233836..235096,235149..235710,
                     235762..>237342))
                     /locus_tag="CNL04450"
                     /product="White collar 1 protein (WC1), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531727|gb|CF677568.1,gi|41531737|gb|CF677578.1,
                     gi|41545823|gb|CF691664.1,gi|41545831|gb|CF691672.1"
                     /transcript_id="XM_567995.1"
                     /db_xref="GI:58261169"
                     /db_xref="GeneID:3254727"
     CDS             complement(join(233946..235096,235149..235710,
                     235762..237342))
                     /locus_tag="CNL04450"
                     /codon_start=1
                     /product="White collar 1 protein (WC1)"
                     /protein_id="XP_567995.1"
                     /db_xref="GI:58261170"
                     /db_xref="GeneID:3254727"
                     /translation="MNFQTPPGVQGNSLGPHRSLSSLENGQPGRVSGHSMATPSVEPS
                     SCPGDQYQSFAQGIALSQASSSAINFQAPQPRIVRPSQFSTSQQYAIDSSPRQSQAYT
                     SPNFQFHPYASQQYSHHPSPQISSPHTPADQLFKGKSPASSSSHSHSNLTPGSSVQPS
                     HPEPLRRTSGDMRPSDDGDSGLSLDLSKFPRDVRFQVPSFPTNRAPGAPPAGSQAWTE
                     YSNTSVQSSDASQTAPGGLFARAACVGGPAWTMAPDQGRPFGSNENAGWNRWDQAQMK
                     QNGLSMGVGVGMAMAQMGTVYVNPNLNPAVYGQGIQSFPSNGYYGGQYNLQQGQHMQQ
                     ENESGGGEVGSRDIAMNSPHQYAAISGPIYGPGPPSSNHFSSPGNPHLQPHTSPSSHR
                     APSPRPSHDQTHAPNMMSTSAILPQRPSYDQNISDHRLPHQIDFSSAASVSNPNPHRR
                     EMNFTLSSTTSYVHSADGRALLQHPLLSPAQQALQDGPGLYSTTGFDMLGILGRVAAR
                     KNPSMVIGPVDLSCSFVVVDIRRYDSPIVYASPNFTRLTGYELPQLLGRNCRFLQSPD
                     GEVTKGSKREYTDNEAVYLLKRSLEAGKECQTSLINYRRNGEPFINLVTVVPIPWDGP
                     DIVYHVGFQIDLVEQPNKILRNMQDGNYSVDYTYSIPPEKPLQLDGKGAAIAGLSTAV
                     LDIMGSRTKALAAGTEEGARMEWFKMILDNTDDFIHALSLKGFFQYASSSIRRSLGYE
                     PEDLLNKNISEFAHPSDIVPVIRALKDSTQTIGEEQQPKPVHFTFRIRTKNFGYVWVE
                     SMGRLVVEAGKGRKAVILSGRVRNMPTLSWGKVAEHGGLAKTEFWAKISFQGLLLNLT
                     FGVDKVLGYQAEEILGRNLFSLLPGGQNTPPSGEHLINNYASAPDIAPVAKAIYQTIH
                     DSTHRGALSIRQKMVHRSGQPVDVILVFYAPGQAKDKQSPISYSNNDESASVNFIGTP
                     NGASTYPVKITDIFVQVKLLSSSPSHQRSVQPPSIASLTQARPLVHLPNDNIFEELET
                     GRDSSWQYELHQMKMTNRRLRDSIAALKEKKAGKAKKRKYNIVDESPENQSEIIDTSL
                     SSQIGGIGF"
     gene            complement(238949..242121)
                     /locus_tag="CNL04460"
                     /db_xref="GeneID:3255005"
     mRNA            complement(join(238949..239420,239483..239536,
                     239590..241447,241506..241702,241896..242121))
                     /locus_tag="CNL04460"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534550|gb|CF680391.1,gi|41534556|gb|CF680397.1,
                     gi|41540171|gb|CF686012.1,gi|41540181|gb|CF686022.1,
                     gi|41547409|gb|CF693250.1,gi|41548723|gb|CF694564.1,
                     gi|41548733|gb|CF694574.1,gi|41553156|gb|CF698997.1,
                     gi|41553163|gb|CF699004.1,gi|41555861|gb|CF701702.1,
                     gi|41555878|gb|CF701719.1,gi|41562345|gb|CF708186.1,
                     gi|41562352|gb|CF708193.1,gi|41564727|gb|CF710568.1,
                     gi|41573289|gb|CF719130.1,gi|41573297|gb|CF719138.1"
                     /transcript_id="XM_567996.1"
                     /db_xref="GI:58261171"
                     /db_xref="GeneID:3255005"
     CDS             complement(join(239137..239420,239483..239536,
                     239590..241447,241506..241702,241896..241944))
                     /locus_tag="CNL04460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567996.1"
                     /db_xref="GI:58261172"
                     /db_xref="GeneID:3255005"
                     /translation="MPPIVSTDRWQQKLLGDWFVRLSPVDSSPDILVKDFSVTRLAAS
                     DDIPRKDGKAVNKPVGLVLGGVILGRKSSQVKERIGSGGIASPILSRSHAHITISPSG
                     HVYITDLRSLHGTSIVSAKEPSSSVVLKPFSPVQLCEQDTIVLGKKVNASNKSYAPVK
                     FAVSFRYPELGQGSLDGEREYLGELSQEDVASKFLSTSKKFLAVKAIKSTDTWKKEMA
                     TSPDYSISPGASISGKSYREPNKYGIPEWMRYSSEEPELENIPMIAVGDEDDGIISVS
                     SKSRVSQIRSDVLISDHQSVLSLSSDEDEWPRGSSNEVANGDRNEEADDNSFTDYDDL
                     GSPEVFGVHEADHSEAAKDMHAENYDWGNHALQSQDDQSEHDCWSPSYQSSPVAWHFS
                     PDLSDYDNEADEQQKSSDVAPFSTSAHDEAGALEDNNIGEANYNGEKVNNVSDETLPQ
                     EPPIRQTQADKLDSLDEEEQRESFYRAIAASFAEADAQGDAPQFDSEPLQLSYDNVIR
                     LGPTNSSCQQPPASEFSVYGSEQGLFRNEKAASAKKRAELPYSYESEDEDEDDDEDDS
                     NYDDDAASGEDDMIIVYSSEEEEDDLDDRSIGDEAVDASPTPFSPRPKKNSDCFIREK
                     RPRQEVVPNKYLGDKFLTGKITMDVETTAAQEVITSSSSSEADSRDLPSSEGKKLDLH
                     RDIEEEVAVFLEQSQQMLAAHAAVMNELSRQETTEACGLQPTSSPSSSSSSEGLVTPV
                     IGRKRSLPLEFNEHEEPTIVEETSAVHLGPIEASNPTGPPAKRRNVASTVGLVVLGAA
                     LGSIGTIAGLMQLAE"
     repeat_region   239980..240039
                     /rpt_type=tandem
                     /rpt_unit_seq="tcg"
                     /satellite="microsatellite"
     gene            <242888..244659
                     /locus_tag="CNL04470"
                     /db_xref="GeneID:3254959"
     mRNA            join(<242888..243205,243253..243374,243424..244294,
                     244346..244416,244467..244659)
                     /locus_tag="CNL04470"
                     /product="ubiquinol-cytochrome C reductase complex core
                     protein 2 precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534804|gb|CF680645.1,gi|41536861|gb|CF682702.1,
                     gi|41536869|gb|CF682710.1,gi|41538946|gb|CF684787.1,
                     gi|41538956|gb|CF684797.1,gi|41542163|gb|CF688004.1,
                     gi|41543388|gb|CF689229.1,gi|41543395|gb|CF689236.1,
                     gi|41546424|gb|CF692265.1,gi|41547016|gb|CF692857.1,
                     gi|41547022|gb|CF692863.1,gi|41547234|gb|CF693075.1,
                     gi|41548576|gb|CF694417.1,gi|41548588|gb|CF694429.1,
                     gi|41548674|gb|CF694515.1,gi|41548683|gb|CF694524.1,
                     gi|41550396|gb|CF696237.1,gi|41551477|gb|CF697318.1,
                     gi|41551484|gb|CF697325.1,gi|41553389|gb|CF699230.1,
                     gi|41553398|gb|CF699239.1,gi|41554306|gb|CF700147.1,
                     gi|41554315|gb|CF700156.1,gi|41554586|gb|CF700427.1,
                     gi|41554591|gb|CF700432.1,gi|41555135|gb|CF700976.1,
                     gi|41555142|gb|CF700983.1,gi|41555458|gb|CF701299.1,
                     gi|41555465|gb|CF701306.1,gi|41555714|gb|CF701555.1,
                     gi|41555721|gb|CF701562.1,gi|41560019|gb|CF705860.1,
                     gi|41560026|gb|CF705867.1,gi|41560852|gb|CF706693.1,
                     gi|41560862|gb|CF706703.1,gi|41564632|gb|CF710473.1,
                     gi|41564643|gb|CF710484.1,gi|41565330|gb|CF711171.1,
                     gi|415"
                     /transcript_id="XM_567997.1"
                     /db_xref="GI:58261173"
                     /db_xref="GeneID:3254959"
     CDS             join(242888..243205,243253..243374,243424..244294,
                     244346..244416,244467..244485)
                     /locus_tag="CNL04470"
                     /codon_start=1
                     /product="ubiquinol-cytochrome C reductase complex core
                     protein 2 precursor"
                     /protein_id="XP_567997.1"
                     /db_xref="GI:58261174"
                     /db_xref="GeneID:3254959"
                     /translation="MRFAGGRRICSENRSSIYTFLSPTPHPPPPAPMYSLNRLPRSSA
                     FKNSANLLRRNASTTSAGGVNVVGFENKGPAATSSLTVAIKAGSRYETTPGVAHVLKS
                     FAYKATASASALRTAREAELYGGVLSAALTREHLLLSAEFLRGDEEHFLNVLASVLSS
                     SQFYQHELNELVIPVVEAETISAQATPSAIALDLAHSLAFRRGLGNSLYANKNYPVSI
                     DDVKTFGEAAFAKSNIAVIGTGISTEVLAKSVGNAFGTGTSSSSKLSTPKAAYYGGET
                     RVPLDIHAPATAAPTMVIAFGTSAPPSADLKVLKHLLGGETSVKWTPGASPLAQAADK
                     IPGASAKAFLLPYSDASLFGVVLSAPTSAETKALAQEVASIVKGAGEFKEEEVKRAVA
                     KATFEDAASTETLSGFVAAAGPAALIGSVPEAQSFSGVSASSISKAAGELLKGKPTVV
                     SIGNISVLPYGDELGL"
     gene            complement(<244682..>245434)
                     /locus_tag="CNL04480"
                     /db_xref="GeneID:3254761"
     mRNA            complement(<244682..>245434)
                     /locus_tag="CNL04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_568212.1"
                     /db_xref="GI:58261603"
                     /db_xref="GeneID:3254761"
     CDS             complement(244682..245434)
                     /locus_tag="CNL04480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568212.1"
                     /db_xref="GI:58261604"
                     /db_xref="GeneID:3254761"
                     /translation="MTRIYSGLKADTLSTLLSSFIYFYTYTALQKGLHQYRLKQAIYQ
                     AAPSPAGVGGLSSKASDTASTERTPLEELIIGVLAGVTSKGITLPISTVSVRQQVSES
                     GEDEKRSALQTLLAINKEDGIRGLFSGFGPTIPLTLLPSLTLYIHSFLLRILVPERHR
                     AHPPGVVTFFLGALSNALATIPLYPLILVKVLYQSGKEKENDKENQEESMFSTIRKFI
                     RKEGIEGLYVGLEGQLVKGFVSQGVMMLVKQR"
     gene            <245844..248988
                     /locus_tag="CNL04490"
                     /db_xref="GeneID:3255016"
     mRNA            join(<245844..246276,246330..246350,246408..246439,
                     246498..246505,246554..246620,246678..246737,
                     246788..246853,246910..246993,247043..247119,
                     247168..247278,247327..247456,247512..247661,
                     247711..247784,247839..247916,247969..248092,
                     248240..248401,248643..248988)
                     /locus_tag="CNL04490"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41563996|gb|CF709837.1"
                     /transcript_id="XM_567998.1"
                     /db_xref="GI:58261175"
                     /db_xref="GeneID:3255016"
     CDS             join(245844..246276,246330..246350,246408..246439,
                     246498..246505,246554..246620,246678..246737,
                     246788..246853,246910..246993,247043..247119,
                     247168..247278,247327..247456,247512..247661,
                     247711..247784,247839..247916,247969..248092,
                     248240..248401,248643..248942)
                     /locus_tag="CNL04490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567998.1"
                     /db_xref="GI:58261176"
                     /db_xref="GeneID:3255016"
                     /translation="MKTKINKDTKRGGIYIIIHSQSGTQRPTGDTYRSVPQPVPRCPD
                     PKCLIIYYCQLTHHLQKSICENIPTSRRVPLFTQEQKVSINSKLQLIAKCHHSCNMAC
                     PPPSGKGKDTVKTEMSSEERAAADAKQRSFERSLAGPSVGKAGITRDQTEINRIIAEA
                     SKGSKFYNNQVRKDQELTEKIAWYRNKRDELMRMAPRDQLEDEADRILMEVEATRDLS
                     QTIIHVDMDAFYASVEVQRDPSLKGKAFGVGKGVLCTASYEARKFGVRSAMAGFIAKK
                     LCPHIILTDLHFDLYTKASKAVKEVLVQYDENLMMASLDEGYLNITPYMSTHNMTASE
                     VVTEIRAQVEEKTSLTISAGIAANRMLAKICSDKNKPNGHFELAFDRATIVRFMRDLP
                     VRNIPGFGRVTERCLEGLGIQTCGDIYEKRVDLLLMDHWFGFRGLCRAYLGIADNTVA
                     PGRREERRSVGVERTFRDKTDDEDIMATLIDIVEELGKDLDRLQYAGKTVTVKYKTRA
                     KSIPKYISSATDILPIAQELLKKELPLRIRLLGVRLSTLKDLTIPDKGIKGLPQRSER
                     ALLQHVMPLLQQLVPSVPYAARPLMQGLPTSNSTITLIGVSIRMPSRRLAEFRQWPRK
                     RLKLEGRVKGHLQTSQDHRRKMDQREKRVQFQAG"
     gene            complement(249294..>251510)
                     /locus_tag="CNL04500"
                     /db_xref="GeneID:3254753"
     mRNA            complement(join(249294..250524,250578..>251510))
                     /locus_tag="CNL04500"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542414|gb|CF688255.1,gi|41542419|gb|CF688260.1"
                     /transcript_id="XM_567999.1"
                     /db_xref="GI:58261177"
                     /db_xref="GeneID:3254753"
     CDS             complement(join(249349..250524,250578..251510))
                     /locus_tag="CNL04500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567999.1"
                     /db_xref="GI:58261178"
                     /db_xref="GeneID:3254753"
                     /translation="MNHFSHAQHIHVVLFFIIIIAFICFPHNTILPEPTMSVCGNSPT
                     PPPPPPPNAIHMHPPQVTPSAASHTSHPTHHTPDARAQQYSIRRAYSTPSIAFPLPHQ
                     APPSSALTHASYTSNMSENITRYTPGGTPQSSASRPGNGNSKFPPSFDSPTPHGARYN
                     SAVRMDGIEGAEMLESGDLAGIQPPATFPLPEYPASFMRAEPVPTEETEELQRFLPND
                     GSVRKYRYGGASCNPWDYMLGDVPDADYDHPLSSRPARYGPDAKHGCKVRRRFTKREL
                     EALEVLWSIAKSPSKYERQRLGAWLGVKTKHITVWFQNRRQEEKRYSRDGHHDAPPPS
                     RSNRGTFDPVTGKWRPVPASCISGLQPPPDDKIAVVRAISLGDVTRDMWLNKYPSSSG
                     RGMTASARVSPTPMSLAATSRGRTIKNAHTTPLLPRNQSRSLDQVLQARESSFGTGAQ
                     KRYRRGSGEFVIKGEGQDRIKEILSLMPSDPPSMGLAESDVEESDEDDGGIDEDVEKR
                     KRAKQAKASSTLAGLGRATPYDVLASSSRAKLLAKPISEHSSRNPVLSQLNPNLSHFA
                     PPSNLRKHTLESVATNQPTKRHRSRVTGHPNPNFHAGSRTKDFNRSVSTSALPRSSRV
                     AEGQGSSSSSYLPSQLKTPNLGYTRSHSVSSSSSRVITPEDVKDKREGPQMRGQARGQ
                     EKDQEVIGAAEMLLQLFGGS"
     gene            complement(<251829..>253803)
                     /locus_tag="CNL04510"
                     /db_xref="GeneID:3254801"
     mRNA            complement(join(<251829..251921,252046..252060,
                     252110..252377,252420..252432,252498..252509,
                     252740..253025,253074..253156,253481..253506,
                     253556..253716,253780..>253803))
                     /locus_tag="CNL04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_568000.1"
                     /db_xref="GI:58261179"
                     /db_xref="GeneID:3254801"
     CDS             complement(join(251829..251921,252046..252060,
                     252110..252377,252420..252432,252498..252509,
                     252740..253025,253074..253156,253481..253506,
                     253556..253716,253780..253803))
                     /locus_tag="CNL04510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568000.1"
                     /db_xref="GI:58261180"
                     /db_xref="GeneID:3254801"
                     /translation="MRAFEPGYDPALELSKLNGPNASHVKRREQPLIDGIVRGEEKGG
                     YYLVIGPKGTGKGTMILDAMRKINADDIHLFPNTPEGHGILHQLQQRAEAWAEGGILT
                     MVFSSDDYWCLDVMKKNASRMRILSVYDLSAAESLRALRHLRRQELANQSARSLVSGD
                     LELENDSVLRRVYELVGGRTSYLARVARADDMLGMSKNGQGSCSWLILRHLANAAEPL
                     PPYPSIFPPIPLESPDDAHLEKEDDHKRSSSAVNVTPPREISSADIHLPKVTYEEARR
                     IMTRADFLEALDHYHIVSIDQVVAEEGFDDALDQTRDRVDQIEGTPLSKS"
     gene            254399..260779
                     /locus_tag="CNL04520"
                     /db_xref="GeneID:3254841"
     mRNA            join(254399..255014,255065..255204,255253..255392,
                     255454..255522,255571..255810,255864..255962,
                     256017..256096,256157..256210,256273..256356,
                     256403..256499,256548..256676,256726..257055,
                     257112..260063,260115..260421,260478..260779)
                     /locus_tag="CNL04520"
                     /product="centromeric protein e (cenp-e protein),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41552626|gb|CF698467.1,gi|41552632|gb|CF698473.1"
                     /transcript_id="XM_568001.1"
                     /db_xref="GI:58261181"
                     /db_xref="GeneID:3254841"
     CDS             join(254470..255014,255065..255204,255253..255392,
                     255454..255522,255571..255810,255864..255962,
                     256017..256096,256157..256210,256273..256356,
                     256403..256499,256548..256676,256726..257055,
                     257112..260063,260115..260421,260478..260617)
                     /locus_tag="CNL04520"
                     /codon_start=1
                     /product="centromeric protein e (cenp-e protein)"
                     /protein_id="XP_568001.1"
                     /db_xref="GI:58261182"
                     /db_xref="GeneID:3254841"
                     /translation="MSLSPNKSTLSRQPSSPSLAVGLPPALPESNIMAPSTTSPSKLP
                     KSRIHRGDVESTESSDAEEDVRNHTKTPKRKVINTEPVSMSSSNKAKKRETLAERLAA
                     AAVGNIKVKVKSSSSVNDGLKASNSASTLTTASASTSAMVQTPPAQARTSMMIPSTMP
                     AQRTSRPSSGSNSSDKVVVCVRIKPTQSSFSSMAYEITSTSLTLSDNHPKVKQRGGKA
                     GREDTYTYTFDKLLEYPSKTPELYVDKVAPLIDKAMNGFNSTVFAYGQTGSGKSFTMT
                     GIPTELGIIPCAVDGVFDAITEEPDRAFLLRVSYIEIYNETLRDLLNFKKGPLRDDEK
                     PSIHTSKGKVYVEPLVEEIVSTPEDVMELLEKGNAQRRIGATDWNERSSRSHCVFTIV
                     IESRPRDGDGDEDIRLSRLNLIDLAGSEKAVSDSERRGEGKHINQSLLALREVINKLT
                     EKTKASHIPYRNSKLTHLLENALGGDSNICVICTLSAEEEHCGETLETLKFAGRCSQV
                     KTNAKKNILPASERALIRAKDQEIEELRARLTGLTNSRPSKMEPDTDQVTDLAESVAA
                     MEARKAKLTAQLAKLNSEILTSELPRHSSTIMGVPMSPPKPKRRRISDFSAIMSTGSD
                     RIGLGMGTPKKVDRRAVSGLTRVQEEEDAPGIMGRLSAIGDNGVPNFDHDIALATLRK
                     SLRQKEEELSLANRNLASALSRASQLSERDERIAALSSELSTTLKSLSALQATLRTTE
                     TDLRDRNSQLETTRADLVATIEDKATKIDELEEKVLELRKSREELAIEDEGRLQEVQK
                     QLDMAVKDKQEIEQRVKLLEDEAAARKKAEEGEKDARREVESIKSQLEVLQKEHASIY
                     SSAQNASTRFAEYETSISTLTAQINDLLSAKLSRETALEELRNEHAETKKQRDRAAED
                     LENFQKEAMANETKVLGELREEIGNLRRLREDEKAVWDRSKAEMEASIETLKQGEAKS
                     KARLVEALKTLEDAAQANRSLEKKLSYEAEGRRTAQEERDQAFEKLKEAAGVANAQLE
                     HEITTRHELETQLAFLKEQLDSQRAAVEALTRNLDTERQSAKELARQLDITQKEMETQ
                     ESRIEKAVDERKDVERRLSEMESALEAGEKEWRVRIEDEAHKRREAEEKLNELEKLRE
                     VGTSAETELQMKLDVEAKAREELEQRLKGVEKRHTSFKALENDLRKQLEAQVTSRENV
                     ESKLQEITLFWESENAQLRQQLQSAVSRRQEVEEDLTALQHQHDTITTSEAGLRKILE
                     VESTARRVAEKKIIQLGRQREASSSEAASLQKKLGDEQMAREELERRLQDTEGRLQSE
                     MEELRVKDEAEFKNKQEAERKFTELIEKQCISETANQDMQKRVEAEIVAQQIANDNVS
                     ALKEKLEAASSTEQRLHQRLSEESVSQAQLREQLEVAALTEQRLRQLLEAESASRQAA
                     EKELSEVFASSKTDSEKQKDLGAELAEHRTANQKLTSLEAAHTELQAQFKAHKTASEA
                     AQKDAKAEYSKEVNTLRKELLVLRESLSTAKAEASDAKTEADAHREKVTKLAKDVVEL
                     EARHKENKTLSSSTSVSARLRTLSTPGPWVNSGEMGDASIKGMKARELKGTTAGFGAG
                     ERESSMARLHVGHKDEIERLEKVVEVQKGIIDEQRMKIERWSKEMEKQREIVRLLTND
                     TTSTSLSPSSPLPPNRFRGKSHSISHSPTESPATATPAKGFPSTFTARNLALPTTPTP
                     LPMHSSQFSNASVRKGRRVTIEHDIDLLIESNKVNRAKAIFETPDKGSKQGPASPTRE
                     PLRVNQATWSIPRQRRP"
     gene            <261141..262696
                     /locus_tag="CNL04530"
                     /db_xref="GeneID:3255007"
     mRNA            join(<261141..261720,261775..262474,262535..262696)
                     /locus_tag="CNL04530"
                     /product="DNA-3-methyladenine glycosidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41556034|gb|CF701875.1,gi|41556040|gb|CF701881.1"
                     /transcript_id="XM_568002.1"
                     /db_xref="GI:58261183"
                     /db_xref="GeneID:3255007"
     CDS             join(261141..261720,261775..262474,262535..262640)
                     /locus_tag="CNL04530"
                     /codon_start=1
                     /product="DNA-3-methyladenine glycosidase"
                     /protein_id="XP_568002.1"
                     /db_xref="GI:58261184"
                     /db_xref="GeneID:3255007"
                     /translation="MPSTRSETAKSDPALGIPSVTRAARTNTTSTATSKRAKPDSGAL
                     SLSAGKGHLKPSKKKQKVEPSIMDIQPPSTAVDLPTVPQPTLLPPTLNFNLPSAISHL
                     SALDPRFSLFFEHLPCRPFVNLEAIDPFRTLVTSIIGQQVSWMAARAINTRFRALFGF
                     THEKEGFPSPQMVLMQDVTSLKGVGLSGRKAEYVLSLADHFASGQLSTQLLQSGTDEE
                     ISKALIAVRGIGQWTVDMFMIFSLRRPDILAVGDLGVQKGLLKWALAAHGALEKKSSG
                     TNTPKKTKGKANKGEKKEVKEEVDDKGEGELDTNIKGSTPVKHVTSSAFPPTPLTPND
                     TSENPLPKMGALHTPAAPSGASVAQGPRTPSTPSAMPRETVEVPPKTLPGPTPEVMLT
                     APLEHPDWDPHRAVPLLEGLSVDILKSRLNGKKVKGGAYLTPKEMEALTEGWRPYRSL
                     AVFYMWPVAGE"
     gene            complement(262704..>267562)
                     /locus_tag="CNL04540"
                     /db_xref="GeneID:3254871"
     mRNA            complement(join(262704..263642,263692..263753,
                     263807..263934,263986..264107,264158..264286,
                     264337..264428,264479..265113,265161..265569,
                     265622..265751,265799..265817,265868..265963,
                     266016..266320,266372..266475,266525..266609,
                     266662..266739,266784..267109,267156..267198,
                     267247..267375,267432..267512,267560..>267562))
                     /locus_tag="CNL04540"
                     /product="microfilament motor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41569576|gb|CF715417.1"
                     /transcript_id="XM_568003.1"
                     /db_xref="GI:58261185"
                     /db_xref="GeneID:3254871"
     CDS             complement(join(262794..263642,263692..263753,
                     263807..263934,263986..264107,264158..264286,
                     264337..264428,264479..265113,265161..265569,
                     265622..265751,265799..265817,265868..265963,
                     266016..266320,266372..266475,266525..266609,
                     266662..266739,266784..267109,267156..267198,
                     267247..267375,267432..267512,267560..267562))
                     /locus_tag="CNL04540"
                     /codon_start=1
                     /product="microfilament motor"
                     /protein_id="XP_568003.1"
                     /db_xref="GI:58261186"
                     /db_xref="GeneID:3254871"
                     /translation="MAPSKKAGKKGAVGGFLSGASKPQKVQKADWSEGFTKKKAAGVP
                     DMTLLSTITNEAINDNLKVRFQNQEIYTYIAHVLISVNPFRDLGIYTNDVLNSYRGKN
                     RLEMSPHVFAIAESAYYRMTTEKENQCVIISGESGAGKTEAAKRIMQYIAAVSGGAEG
                     GGIEGIKEMVLATNPLLESFGCAKTLRNDNSSRHGKYLEIMFNGMGQPVGAQITNYLL
                     EKNRVVGQIDDERDFHIFYQFTKGASAKMKEAFGLQGPEAYAYISRSGCLDVKSINDV
                     SDFQETLRAMQVIGLTSDEQDSIFRILATILWLGNIDFVEGDDGNAAISDSGVADFAA
                     YLLEVDSAQLQKVLLMRIMETQRGGRRGSVYEVPQNVAQASSGRDALAKALYNNLFEW
                     IVSRVNISMKPQTPSQYVIGVLDIYGFEIFQDNSFEQLSINYVNEKLQQIFIELTLKA
                     EQEEYVREQIKWTPIKFFDNSVVCSLIEDRRPAGIFATLNDATATAHADPSAADNSFI
                     QRSSMLASNPNFEARGNKFLIKHYAGDVLYTVAGMTDKNKDTLIKDILDLIEGSKDPF
                     LHTLFPDKVDHTSKKRPPTAGDKIKLSANLLVENLMNCQPHYIRTIKPNQHRSPTEYD
                     DKAILHQIKYLGLQENIRVRRAGFAYRAEFSKMIQRFYLLSPATSYAGDYIWTGDDRS
                     GCERILTDAKIKKEEWQMGVTKAFIKNPETLFYLEGERDRYWHTMASRIQRAWRAYVR
                     RKHEAATKIQRFWRNQREALVYERKRDYGHQVLAGKKERRRFSLLGMRKFMGDYLDIA
                     GGSAQGEMLRNAATISPAEQVHFSSRAELLVSKLGRSSKLSPRFLIITDKAVYFVVSQ
                     ARDGRVSTSLERKIPLVTIKAISMTNLRDDFVALNVNACEEGDPIFTCVFKTEMITVI
                     LTLTGGNMSVNIGPTIDYAKKKDKRAVIKTQKNEAVRGDATYKSHTIQVGSGEPPNSL
                     SNPMPPRKPKVKKAAKTASSSRPVNSGRPAAVALPGATKPAAPPALSSMPSHTPVVTK
                     PTAIPTAAIGAARAPPSIPGRAAAPPPPPPPPPPAGPPKEFYKALYNFTGQEGEMNLV
                     KGEEVEVKEKDDNGWWMVVKNGQEGWAPSNYLKKVEQAPPPPPPPPPPSRPVAARPPA
                     ASSAPTAPAVTNGSAVPSWKAKNAASATPSADSTPPTSRPASSASKVPPAIKAKPSIP
                     AKPAIPAKPQVGAKPAPAIGGKPPVPTAPKVQPKAASKLGQVAQPAKAPGQLDLAAAF
                     AKRAARAQQEED"
     gene            <267808..>268944
                     /locus_tag="CNL04550"
                     /db_xref="GeneID:3254820"
     mRNA            join(<267808..267855,267904..267978,268036..268226,
                     268301..268462,268516..268809,268857..>268944)
                     /locus_tag="CNL04550"
                     /product="ccr4-not transcription complex, subunit 7,
                     putative"
                     /transcript_id="XM_568004.1"
                     /db_xref="GI:58261187"
                     /db_xref="GeneID:3254820"
     CDS             join(267808..267855,267904..267978,268036..268226,
                     268301..268462,268516..268809,268857..268944)
                     /locus_tag="CNL04550"
                     /codon_start=1
                     /product="ccr4-not transcription complex, subunit 7"
                     /protein_id="XP_568004.1"
                     /db_xref="GI:58261188"
                     /db_xref="GeneID:3254820"
                     /translation="MPQQEQLPSKDYGIREIWADNLESEFAALRQAVERYPYISMDTE
                     FPGIVARPIGNFKTGSDYHFQTMRCNVDMLKIIQLGITLCDENGDSPEVSTWQFNFAF
                     SLGEDMFAPDSIDLLKSSGIDFKRNEEEGIDVEYFGELLITSGLVLFDNIKWVSFHSG
                     YDFGYLLKILTCEPLPADETDFFRLLFIWFPCIYDIKHIVRSIKTLRGGLQEIAESLG
                     VKRIGPQHQAGSDSLLTAAVFFRIQTIYFDGHLNDDYYKNYLYGFSSGRLGKASPAAA
                     GENLVDKPY"
     gene            complement(<269012..272727)
                     /locus_tag="CNL04560"
                     /db_xref="GeneID:3254853"
     mRNA            complement(join(<269012..269115,269336..269889,
                     269948..270036,270090..270229,270264..270352,
                     270455..270778,270853..271079,271132..271712,
                     271763..271874,271924..271976,272028..272183,
                     272584..272727))
                     /locus_tag="CNL04560"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536262|gb|CF682103.1"
                     /transcript_id="XM_568221.1"
                     /db_xref="GI:58261621"
                     /db_xref="GeneID:3254853"
     CDS             complement(join(269012..269115,269336..269889,
                     269948..270036,270090..270229,270264..270352,
                     270455..270778,270853..271079,271132..271712,
                     271763..271874,271924..271976,272028..272183,
                     272584..272587))
                     /locus_tag="CNL04560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568221.1"
                     /db_xref="GI:58261622"
                     /db_xref="GeneID:3254853"
                     /translation="MAQVSEEHNPHKSHPLAVIPQRASKRKRQSKSEDEPVSEGSRTK
                     ETSVASEKKGPPLRRGDACLRCRAKKLKCSAEKPSCDQCSKRNDNCVYDTARPATRVQ
                     KLEAKLAQMEDQETRPSIEQQRPSSSSFESSISHGLLTPYGNSIGQDDGLIFFSERGF
                     GDFNNAMVPSPNPQALYGQQNIGGSQDVPFMASSSPAFVSSKPSIDIPNSLPIFNEWS
                     WPPSGLGLNLWNNQVEGSSSLGEPRFAQAPFTVIGMSQDVSNTWSPTQETKPLPAFDE
                     TTIPTSSSGHHVLDHSATGRGMDDLNAFLAPSDLNTKNPGPIDGDRHSGKPFIQSEQP
                     TSSLQGLEGLSYPSRVLQMGGGPTQQRPWRLREDDVSASAREYLPEPPRYQFGSEAFT
                     EAQFRAKLTLQPSLQPHPSLLFSMYTLAASTSYIPAIRSLADELSEIAMKRIEEAIRN
                     KDRLIDAINACKIMSKWFYAKGKAFEAYQYSAKAVSHTNQSHLLLRVVFYQLQKTNGS
                     CANVYTHYADEPSVYSWGVWGNEKGQEICTSWTGLLKDELIITPLPRPPEHLFNGAMH
                     GIEDITLRDLYDLPHRTNPPCFEPLYALLLASVHLFTRANNLTSNPPESNPSYRSLSL
                     ASSVSVRQRFPRACEEIALACTYLEETVSQNWPLEDGPEGQAGKGWFIEDVPVMFLLL
                     KCSKIRLLFPPQDPGNQNEFISLVMESGDLVMKWINRTDFGNVAGSAPSARKDNKDSY
                     RNKNGLSGPYRFVQWRFVAERMKECAALLRESGRLLAFGVLELQTLDGSTSTLYLHRR
                     SAERVRKMYMLR"
     misc_feature    274156..274181
                     /note="AT_rich"
     gene            complement(274224..276859)
                     /locus_tag="CNL04570"
                     /db_xref="GeneID:3254780"
     mRNA            complement(join(274224..274301,274365..274488,
                     274549..274807,274860..275110,275161..275275,
                     275327..275403,275450..275520,275577..275686,
                     275750..275775,275815..275839,275893..276158,
                     276217..276253,276306..276324,276382..276391,
                     276460..276491,276553..276574,276674..276859))
                     /locus_tag="CNL04570"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531805|gb|CF677646.1,gi|41531814|gb|CF677655.1,
                     gi|41542901|gb|CF688742.1,gi|41543709|gb|CF689550.1,
                     gi|41545629|gb|CF691470.1,gi|41545635|gb|CF691476.1,
                     gi|41563074|gb|CF708915.1,gi|41563085|gb|CF708926.1,
                     gi|41568161|gb|CF714002.1,gi|41568168|gb|CF714009.1,
                     gi|41571153|gb|CF716994.1,gi|41571162|gb|CF717003.1,
                     gi|41573536|gb|CF719377.1,gi|41573541|gb|CF719382.1"
                     /transcript_id="XM_568220.1"
                     /db_xref="GI:58261619"
                     /db_xref="GeneID:3254780"
     CDS             complement(join(274261..274301,274365..274488,
                     274549..274807,274860..275110,275161..275275,
                     275327..275403,275450..275520,275577..275686,
                     275750..275775,275815..275839,275893..276158,
                     276217..276253,276306..276324,276382..276391,
                     276460..276491,276553..276574,276674..276733))
                     /locus_tag="CNL04570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568220.1"
                     /db_xref="GI:58261620"
                     /db_xref="GeneID:3254780"
                     /translation="MSQQKQVDGKQVAEHNSREKGVWIVVHGNVYDVSDFLDEHPGGA
                     DIILKYAGKDATEEYDPIHPPDAIKENLDPSKHLGPLIPSTLPVEKPAPAPAPPPTSV
                     PVGQATNGTSVTEEFVKPSLAEILSLHDFEAVARRTMSKRGWNYYSSGADDEVTMREN
                     HNAYHRVWFRPRILRNVGTVDYSTEILGFKTSMPVYITATALGKLGHPEGEICLTKAA
                     GEHNIIQMIPTLASCGFDEMVDAAIPGQVQFLQLYVNADRERTKKIIRHAAERGIKAL
                     FITVDAPQLGRREKDMRTKFEGTASAQQTKGGDKYQRDQGAARAISSFIDPSLNWSDL
                     KELVDAARGLKVILKGVQCWEDAVMAAEAGVDGVVLSNHGGRQLDFAPSPLALLPSVV
                     QHLTAHGFMNNPLRPRFEIFVDGGVRRATDVLKAVALGATAVGIGRPMIYAMSTYGKD
                     GVSHALQILKDEFEMNMRLLGAPTMADVVPSMVDTSGLFGPQGSVTMYEENYERMLPV
                     GVKAKL"
     gene            complement(278279..278813)
                     /locus_tag="CNL04580"
                     /db_xref="GeneID:3254785"
     mRNA            complement(join(278279..278456,278531..278604,
                     278677..278813))
                     /locus_tag="CNL04580"
                     /product="expressed protein"
                     /transcript_id="XM_568219.1"
                     /db_xref="GI:58261617"
                     /db_xref="GeneID:3254785"
     CDS             complement(join(278373..278456,278531..278604,
                     278677..278767))
                     /locus_tag="CNL04580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568219.1"
                     /db_xref="GI:58261618"
                     /db_xref="GeneID:3254785"
                     /translation="MSGTQSPSSNKPDPMLPKDVSQMTQADQRPAASGNKPGAAPGEK
                     SEGGVSGSAFKSAQQSADSLSGEGGKSRKEVETGPGPT"
     gene            complement(279819..>283721)
                     /locus_tag="CNL04590"
                     /db_xref="GeneID:3254878"
     mRNA            complement(join(279819..281838,281891..282402,
                     282454..>283721))
                     /locus_tag="CNL04590"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536463|gb|CF682304.1,gi|41540359|gb|CF686200.1,
                     gi|41540365|gb|CF686206.1"
                     /transcript_id="XM_568005.1"
                     /db_xref="GI:58261189"
                     /db_xref="GeneID:3254878"
     CDS             complement(join(279878..281838,281891..282402,
                     282454..283721))
                     /locus_tag="CNL04590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568005.1"
                     /db_xref="GI:58261190"
                     /db_xref="GeneID:3254878"
                     /translation="MSEHNQDLRFLISDDVLNEDPMSTGRFAEEDRGSSDTEQLTDNK
                     NDGEEPKETAVQAAFDGSDDVNRLEEPHNPVSSTANIGNFALLESSSAEVSDASCPAT
                     MPILVRQSPKTCSQPRTRKVKLSTLSLSSDPDPDINDPEFKARLEDSNQDDQDEELDL
                     EMEEADSAGRESGEGNRDSEDEGLLADADLPIEVLLRRYGYPVPEGEGAVNGEPEQSE
                     SKGREQAAPTSTVSETLPSTKLSLAQPANQTDQSLTDTALPEPRVPEQLIISGKRQRR
                     KKEIWTPDDSEPQHLVGKKRIKKVEIVEKVEADVHQNGDGLVIVEEETMGDEDNDDSK
                     VGQEEEDGHEYDSEEEYDEDEDEEEEGAKEDNVDWDDRQDKEGDIGPRVRQPFLLRGT
                     LRPYQQAGLEWLASLWSNNMNGILADEMGLGKTIQTIALLGHLACDKGVWGQHLIIVP
                     TSVILNWEMEFKKFLPGMKVLTYYGNQKERKEKRVGWHTENTWQVCITSYQIVLADQH
                     IFRRKNWCYMILDEAHNIKNFRSQRWQTLLGFKAQRRLLLTGTPLQNNLMELWSLLYF
                     LMPGGIGADATAVVGFANHKEFMEWFSNPMDKAIETGDAMDEETLETVAKLHTLLRPF
                     ILRRLKSEVETQLPGKFEHVVYCRLSKRQRFLYDEFMSRASTHEALTTGGYLGVMNTL
                     MQLRKVCNHPDLFEMRPVKTSFAMDNVARDFEPSDILIRKRLLAEEDERRIDALAIGF
                     GVAHNEAMSGWVARARQTYDASDKLPYAASPLRRGKLSAPPPKDTRSVELWLKYRVWA
                     EEEFSKRRWESIRATNRQRCGISPIYGSTFLSLLGNLPNFLLPQDVQSRREETFADFT
                     PPAAKFITSLPERAKSLEDVIDRFAVIPPNAVARNLATYALPGLEPISHPALTDPAFD
                     TLHRSSVKLQIAFPDASLLQYDCGKLQKLFEMLRDLKSEGHRVLIFTQMTRVLDILEM
                     FLSHNGHRYLRLDGSTKIEDRQVLTERFNSDSRIFVFIASSRSGGVGINLTGADTVFF
                     YDSDWNPSMDRQCMDRAHRIGQTREVHIYRFVSSHTVEENMLRKAEQKRLLDKMVIQE
                     GGFNNDWWGRVGWKDMFGDVPGITDVSGVVEKSGEGIIDIQVEGTPVAEDVEVTRPRA
                     GEERELARALAEVEDEEDAQAARMAQGEGELDLQEFEEGPKAVAKRVRVFEPENSGTP
                     VTTEAGETGDVVEEYDDEPGSVEEYMLKWVEEDWDYFSPYRA"
     misc_feature    282641..282712
                     /note="CT-rich"
     gene            286267..287484
                     /locus_tag="CNL04600"
                     /db_xref="GeneID:3254722"
     mRNA            join(286267..286501,286555..286607,286661..287120,
                     287168..287261,287326..287484)
                     /locus_tag="CNL04600"
                     /product="expressed protein"
                     /transcript_id="XM_568214.1"
                     /db_xref="GI:58261607"
                     /db_xref="GeneID:3254722"
     CDS             join(286316..286501,286555..286607,286661..287120,
                     287168..287261,287326..287471)
                     /locus_tag="CNL04600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568214.1"
                     /db_xref="GI:58261608"
                     /db_xref="GeneID:3254722"
                     /translation="MAQPEDLISTPTPTTRKAAEAAASNQHALVNLIRLVKSLEIKLA
                     ESEEDEYLNIYIIRKDWETVLYARVLLDTLKQGNEQTSSTTSTLSGLEKSLNHIQSAY
                     HSRLASPLPTSRLNPALIALPRSPSSTIPYDSRIPSPPLTTTTQFPIPSNQTASKNVR
                     RRRAQLEDYLAKRSREDTFGEGTGLLTIKPIHDSEDASSKPSEARDELLGDAIPGSAL
                     GAVQVHEELSGQLADMSQRLKLNAIHFSNSLENEKHLIQNSQDVLEKNLSATKTSKKH
                     LSTVSKKGRSTTYLTLGIILLVMIVFIWTYLLIRFT"
     gene            287719..>289078
                     /locus_tag="CNL04610"
                     /db_xref="GeneID:3254724"
     mRNA            join(287719..287890,287945..287994,288044..288060,
                     288129..288403,288456..288661,288717..288766,
                     288813..>289078)
                     /locus_tag="CNL04610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568215.1"
                     /db_xref="GI:58261609"
                     /db_xref="GeneID:3254724"
     CDS             join(287840..287890,287945..287994,288044..288060,
                     288129..288403,288456..288661,288717..288766,
                     288813..289078)
                     /locus_tag="CNL04610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568215.1"
                     /db_xref="GI:58261610"
                     /db_xref="GeneID:3254724"
                     /translation="MQNKPEQDRNQEATVYLGNLDERCTDALIWELMLQAGPVSNVFL
                     PKDRISQAHQGFGFCEFMSEADAEYAVKIMNQIKLYGKPIRVNKASYDKKQVDVGANL
                     FVGNLDPNVDEQTLYDTFSTFGTLAEQPKIARDPTTGLSKGHAFIAYNDFEAADLAIE
                     NMNGQFFGGKQITAQYAFKKDGKGERHGSQAERLLAAQAKKRQLLPATGGPALPYQGQ
                     YANALVVNSVPAAPSGMPTYPPPPPPGMPVYQAPAPDAGYAGYPGAPAGYAPPPPAGF
                     PVAQYQMPVAAPGQAPPAPPPIRMGFQG"
     gene            complement(<289185..292357)
                     /locus_tag="CNL04620"
                     /db_xref="GeneID:3255010"
     mRNA            complement(join(<289185..291810,291859..292357))
                     /locus_tag="CNL04620"
                     /product="exoribonuclease II, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530255|gb|CF676096.1,gi|41530690|gb|CF676531.1,
                     gi|41543421|gb|CF689262.1,gi|41555195|gb|CF701036.1,
                     gi|41558820|gb|CF704661.1,gi|41576671|gb|CF722512.1"
                     /transcript_id="XM_568006.1"
                     /db_xref="GI:58261191"
                     /db_xref="GeneID:3255010"
     CDS             complement(join(289185..291810,291859..292232))
                     /locus_tag="CNL04620"
                     /codon_start=1
                     /product="exoribonuclease II"
                     /protein_id="XP_568006.1"
                     /db_xref="GI:58261192"
                     /db_xref="GeneID:3255010"
                     /translation="MALLPARSAISSSFARRAFASTSRSCDARRTRVGSSTKQPQLKA
                     REILDTLAADATLLSTSRAPTSLKSEKPARVKFEVAEGQSNDRRAYFVNDVDAEVGLD
                     WGSIEGDGSSAGLEIGRVVECRRSGQVSLGLILASILIGERPRFLLLRSSGEIWPVSA
                     HDVQFIMPISLMPPSLTEACWSPELLQAWAQSESSSGLASETTSTTPEMMEARRKVAL
                     MLRRVQRETERMCGKLRGGTFDKGLIGGAEGVWEKWASENDSERTTITAVEAAEYILN
                     PSSGTESQSPPIQIKPNTLPAYAAHVLLMGRPDMFVSDEGDMWATGTFIVRSKAERQR
                     IERVQRWVEAHKSNGDDAEPLRSFVDRAKAVIALSEKIYTETEGDPLKPYTNGLPSWS
                     STDLDMIYTLFGAVAETRSTQTSPFLSLAIAIARLITPDPEEVVDRGTITILLQKMGM
                     ILPWDSLETSRVAESNMKALAKASTSGDIKGEGEFLQGNELDHLRIDYSDQKVYVIDD
                     ATASELDDGIALERILNSEDVWVHVHVADPTRYIPPAHPLAKRASVMGSSLYLPEGNS
                     PLFPSDVIMRELSLGASVQRDEGRQGVITFSARVGKDGEVHDTKVNLGWIKKPRVVTY
                     SSVDRALGLTPVKSYRPFGGPQSFDEPVKSEVISSDIEDLQKLYELAKNIRAKRYATA
                     GFDWTWPSSSVRILNQQAPPNPDVFALPNIPSCPQLFSGSLSVDYCVSSSPATLTSAT
                     MVAEFMILAGRLAASFCSERNIPMIYRGSTAPKPVATNSTLDQWLSLRIPGMGIIDPY
                     VMAEPGWYRSSAFVSLKPSAHWIMGFDAPGGGYVRATSPLRRFDDMLVHWQIKAALAK
                     DRGETGKLAKSLKKEEIVTLAQRSDEGSKRAKRAGVNAELFWKTQVINKHFQSPNGWP
                     VPGRSVKEEEGLVDVRGEMIARIAGVSESSVFGEWTTVAVESLGIHVAKMEHPAGKFW
                     KMGEEVRVRLKRSEGWPNPRITLTLAE"
     gene            <292555..>292751
                     /locus_tag="CNL04630"
                     /db_xref="GeneID:3254743"
     mRNA            join(<292555..292646,292700..>292751)
                     /locus_tag="CNL04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_568007.1"
                     /db_xref="GI:58261193"
                     /db_xref="GeneID:3254743"
     CDS             join(292555..292646,292700..292751)
                     /locus_tag="CNL04630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568007.1"
                     /db_xref="GI:58261194"
                     /db_xref="GeneID:3254743"
                     /translation="MSFFHVVFVAFVIAAIGAAGWFVTPKGKNQTLLRTSLLLTLTCC
                     YLM"
     gene            complement(292961..294475)
                     /locus_tag="CNL04640"
                     /db_xref="GeneID:3254763"
     mRNA            complement(join(292961..293289,293337..293795,
                     293843..293908,293963..294475))
                     /locus_tag="CNL04640"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535281|gb|CF681122.1,gi|41535284|gb|CF681125.1,
                     gi|41538295|gb|CF684136.1,gi|41538308|gb|CF684149.1"
                     /transcript_id="XM_568218.1"
                     /db_xref="GI:58261615"
                     /db_xref="GeneID:3254763"
     CDS             complement(join(293099..293289,293337..293795,
                     293843..293908,293963..294443))
                     /locus_tag="CNL04640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568218.1"
                     /db_xref="GI:58261616"
                     /db_xref="GeneID:3254763"
                     /translation="MRVVSLSRMLPFSPTLPELHHTEDQQDVLLEWKKASLPRFIILI
                     TKCLIPPLLVFALILTLISLLLPTVKHHETTFFSIQPIGHARKVTAGSLPVNSTSSSL
                     SPLRASAVAAIRDIKQELEETSPGNDIVNATKTIVQSGNVRLEEWLGINGPSIFVGAL
                     RICSRMKANESIMCTSSGEAAYHAAFLPLSLGKALIVLPPSPFSPILLLLSGILTLIS
                     VLIFIVGLISWHLPRLALLRQKSHLEAVPHRPDYPRDIDSVRPLVHEDGADDKGKSVA
                     SFKWGNGPHPAFFCTVLSALGVAGGAMMELRDVSKAREQWDDIQAWEVGLEFRLGTLT
                     YLLPLLPICLFLVLVIGSLPWAWSVAQSKHYMNFGSVRNMSPVSTKPDSLQNAQTPQA
                     SSFTGN"
     gene            complement(298782..>301631)
                     /locus_tag="CNL04650"
                     /db_xref="GeneID:3254919"
     mRNA            complement(join(298782..298914,298971..300527,
                     300575..300884,300935..301410,301461..>301631))
                     /locus_tag="CNL04650"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532090|gb|CF677931.1,gi|41532101|gb|CF677942.1,
                     gi|41551702|gb|CF697543.1,gi|41551710|gb|CF697551.1,
                     gi|41557439|gb|CF703280.1,gi|41557451|gb|CF703292.1,
                     gi|41558700|gb|CF704541.1,gi|41558710|gb|CF704551.1"
                     /transcript_id="XM_568008.1"
                     /db_xref="GI:58261195"
                     /db_xref="GeneID:3254919"
     CDS             complement(join(298885..298914,298971..300527,
                     300575..300884,300935..301410,301461..301631))
                     /locus_tag="CNL04650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568008.1"
                     /db_xref="GI:58261196"
                     /db_xref="GeneID:3254919"
                     /translation="MLSFCFLSSPKLPSMLFHSDKRPRSALTAIFTESGHADILLGIF
                     NNLAIQHIPALLRVNKYVNSVFTSSSQLQLRYRKSYHSVSPHTQSSAPSRLTNSAEEL
                     GLLIEQEKRLSNLCPSEIRCLHFPNAEIAQVQLNHILVTERINREIVFPNAPDSNYLW
                     DGWSVWRIRNAYEFDGESRGGKKAQGVWKWKMNFGAPIDSATMCVEDNVVAVAYAVNH
                     PPCDEISYNSTLKVAHRIYFYSLIPPVGTPQQSDGIFQPPIPHPEAKLPYVEVLVPAK
                     HHMHHIELQLGPGGKVGLLLVSADTTRQNFVGLWDWKAGVSIGKLSPTPDVPVCEDFR
                     FLGPFILSSVMRDLVKKPEDELMVLHNRELDSCASGGRPSCLSASTPQRPKPASVYDD
                     IDYDSEEDTFQGVSEAVPPPLETVYSIDTHAPLPTERGTRPFKRSYITHFGPGSEIDE
                     AYTWDWDEIPFCMPLASLQLPTLNTTPLGVYETPLDSIMDSLHVDTDFHPVRLAFDSF
                     SVDPALLQGERLGVIPFTLSGDTSDGLGAPNVVRCKGIIDITTLLGKTIEAMQWHMAK
                     TKGIDIKLLALGAKLNKKTWRDQLIEAFELFLRSGQDDGWETEEDEPSRYKSKKSRSK
                     RISKRATIISPKQTKSTYKWENPHVVPWKSWDSGVSIRFNHRNIVTAWGTRAVMVEPV
                     PDAKPLVRKKDGQLMRQYWMTLRDYSRHTFHDHPGRPRQVLGGLQHPYLSLDKASLST
                     ASSSTSPSPPESGAKREKPRVIKCPLVNPVPVAQMDNNLIEHSTSEIQDKRLWTKRIF
                     YDELLQSKLMYKEVRAKILLDQKRPYRSSAFDGKMVVIGVESGAHIFTF"
     gene            301819..>303409
                     /locus_tag="CNL04660"
                     /db_xref="GeneID:3254918"
     mRNA            join(301819..301971,302027..>303409)
                     /locus_tag="CNL04660"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540457|gb|CF686298.1,gi|41540466|gb|CF686307.1,
                     gi|41546074|gb|CF691915.1,gi|41546089|gb|CF691930.1"
                     /transcript_id="XM_568009.1"
                     /db_xref="GI:58261197"
                     /db_xref="GeneID:3254918"
     CDS             join(301849..301971,302027..303409)
                     /locus_tag="CNL04660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568009.1"
                     /db_xref="GI:58261198"
                     /db_xref="GeneID:3254918"
                     /translation="MTAALPVDIWSHILSYCIEVPPTPGAHVPQPTLVNALRVSSTLF
                     LAAAPHLYSQATVSDPGSFLLGLDRPTSVFPSSFITSQQMDYEYLKWGHKKIPLLRHL
                     QKVTFFRPFISGYDSVVSPESTGSEATFASLGYANQMLSHLLFTETTHVSPKFETLSI
                     LDPPELPVYPQTVPPFAQFIQLFIRYFQPRSVCVQNADILIPSQKVKLQDLYLPENVI
                     IHADLDWKLTVIWGTTNRICFFKSKIAEEGNLDLGALTIADPTEGNGQAMEAAVDIRS
                     DDDGGWEDIDGISGASSGLTSQRAQNTPSNTALHNQSNELYLGAFDPEDLEDDYYDEY
                     DWDDELDADDDFGGIYDDGVGLPSRMSDFDGDDEVAAVLPGGFSEEEVISTLADCLSR
                     SFKHCRINNRKGGGKSIQRTIFEFYGLEQFLSVDTLVYRNPDIYGQDTEDQILQKAMD
                     RIREMVQQHVEQMLAGVGQLPVIKFLRANEASDCEGCGRKMAECRINKPED"
     gene            304288..305785
                     /locus_tag="CNL04670"
                     /db_xref="GeneID:3254748"
     mRNA            join(304288..304456,304510..304596,304654..304743,
                     304803..305110,305173..305232,305285..305785)
                     /locus_tag="CNL04670"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537958|gb|CF683799.1,gi|41540661|gb|CF686502.1,
                     gi|41540670|gb|CF686511.1"
                     /transcript_id="XM_568010.1"
                     /db_xref="GI:58261199"
                     /db_xref="GeneID:3254748"
     CDS             join(304412..304456,304510..304596,304654..304743,
                     304803..305110,305173..305232,305285..305630)
                     /locus_tag="CNL04670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568010.1"
                     /db_xref="GI:58261200"
                     /db_xref="GeneID:3254748"
                     /translation="MRVTTLVSAASLLAVATATPLVVRQNATAPQCAEDCFADVDTIE
                     SICSSGDVACYCTDPMIVGYLRSCLSSSCSTENVNNAIYYGEEVCAANGADVSMRDDG
                     SSTTGSSSATAGSTPSSTSSSYESISSASETTFTSANSAAASESLSVSGTESAPIAAQ
                     TSQVSSSETPTTKSASTSVGETSSVSSSVVDETTSTNSATSESQTSSSSSEESSAVAA
                     ASTSTSASASVSSPTSTSSSSSSSSAPSSTSSESDASSNVASTVSLITSASSETATTA
                     ASGLAASSVSTSSGERMIAGTTGVMVATMLALFVI"
     gene            <307051..>311699
                     /locus_tag="CNL04680"
                     /db_xref="GeneID:3254879"
     mRNA            join(<307051..307700,307914..309082,309141..309810,
                     309861..310477,310526..311033,311084..>311699)
                     /locus_tag="CNL04680"
                     /product="protein-tyrosine-phosphatase, putative"
                     /transcript_id="XM_568011.1"
                     /db_xref="GI:58261201"
                     /db_xref="GeneID:3254879"
     CDS             join(307051..307700,307914..309082,309141..309810,
                     309861..310477,310526..311033,311084..311699)
                     /locus_tag="CNL04680"
                     /codon_start=1
                     /product="protein-tyrosine-phosphatase"
                     /protein_id="XP_568011.1"
                     /db_xref="GI:58261202"
                     /db_xref="GeneID:3254879"
                     /translation="MRSSSMFHASCCLFVLGVGRLMPLLEDDEGRKAGWNRKENEKEC
                     MTSFCNQGLAEPGYLLRVFTQGHSSDGDGAKRGEKRGEEKSKKTHAKKLRRAVARRVR
                     LPFLPYFIVHRHTKTCPNLLSLPPAPCRVGPPNLRHCFRKQRALASLHVIFIIDTSSS
                     SSAGQSSTRIHSPSPAKSRSSTINDPFVPGHPIAIHHTRQPHLCYPPFPFLRHIHSHP
                     PPVDPLSPSPTRSPAASSPFRSPSRPSPASRSSSGFSLPVQQPTPLATTNTGFSSPWA
                     ALAASSGAPTPSSEVPMGRNSPHLGSPFERLNIGGGGNNSSSMLRDDSPRIQFGESLA
                     SPFEGQFSHAAPAMSSPTSNKQASTGAAPPIRGGLSAETLMRYKAIATSAGKPDIGGE
                     PNPLAAAARKKNSLPTKLSSASLGASTPHSTKSPSPLASSVSGSQSPGGMKPQMIAPT
                     DLAKLLPNSTTLILDVRPPSSFQSSHIPSSHSLPIPSTLLRRPAFTLNKLTQMLSPHS
                     MQEVSKWREKSDIVLVDADSGSAPDGGVLDGLAGKFGREGYSGRLWFVKGGHAAMKLS
                     GALPLVSDDDEGPQPQQGAAAAGAQKGLMAGRLASLAFSHESTTRGKSSGRQPPPKGL
                     TIPPTPSLNFQSNPFGSSFPLTTAVSERPAALHRLDKGPVTTTGMADSTQAKFQPANP
                     FFDNIRQNLELSHGGITERIPLNLPDSVRERADQFPDWLRELVTMPEQDSMDKLAHQF
                     YQLELHEQKRLQAIMEWHAKGSGALLQPAVGYDEQILKSASERKGWEWAIQRESDLNE
                     LKRLMNWERGTEDIEYFPFSITAGVERGTKNRYKNIWPYDFSRVRLDSPPDQDSDYIN
                     ASFIQPRGTSRRYIATQGPLDATYRDFWTLVWEQNVRIIVMITKQFEGGLIKCGNYWC
                     EERYGHIKLQLISQSGGEDTALPAANSGFDFGTAGATPKSSKFPQESDSNIKRVFLIS
                     RDDKPDQPPRKIVQLQCIGWPDFDVPETPDTLLKLIQEVNDAAHEAKPEGCYRKADEP
                     PVLVHCSAGVGRTGSFIVVDAILDGLHRDFSQRSAAEARSADGPARLPEVISPQHSSS
                     ATPATTLSAVASPEPVSQSFDLGVSSTSVAPQLSGSPGTIPTQPEHQVALDFSFPPKK
                     RGSNETMEVDPPKAANSADDRFMMYRMASEGTSVSSDTDTRRPSLVSVQTSSDRVSSE
                     SIPGRLADPEPVTSLNRPRREPSPLSKMRDPVSCVLESMRVQRMSLVQTLRQYLFVHR
                     AIIHHYLHMLDHNQVKERPNPSPLQKHVPSVGSSVSGSAIGSLGSIGTLNSGSGSYTD
                     SLSTNSPADLTKGSVDEDSHTKRRASPTELHPDVRLGGEGGSELSKRPSFKKMKPGTT
                     SGRMGRKSSAMWKGMEEEAVAEEAVTEELKN"
     gene            complement(312703..314371)
                     /locus_tag="CNL04690"
                     /db_xref="GeneID:3254814"
     mRNA            complement(join(312703..313215,313269..313640,
                     313692..313834,313943..314003,314059..314371))
                     /locus_tag="CNL04690"
                     /product="membrane fraction protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530519|gb|CF676360.1,gi|41530532|gb|CF676373.1,
                     gi|41532995|gb|CF678836.1,gi|41533002|gb|CF678843.1,
                     gi|41534793|gb|CF680634.1,gi|41534809|gb|CF680650.1,
                     gi|41539532|gb|CF685373.1,gi|41540935|gb|CF686776.1,
                     gi|41540941|gb|CF686782.1,gi|41548653|gb|CF694494.1,
                     gi|41548659|gb|CF694500.1,gi|41549179|gb|CF695020.1,
                     gi|41549183|gb|CF695024.1,gi|41549841|gb|CF695682.1,
                     gi|41549847|gb|CF695688.1,gi|41558862|gb|CF704703.1"
                     /transcript_id="XM_568012.1"
                     /db_xref="GI:58261203"
                     /db_xref="GeneID:3254814"
     CDS             complement(join(312914..313215,313269..313640,
                     313692..313834,313943..314003,314059..314332))
                     /locus_tag="CNL04690"
                     /codon_start=1
                     /product="membrane fraction protein"
                     /protein_id="XP_568012.1"
                     /db_xref="GI:58261204"
                     /db_xref="GeneID:3254814"
                     /translation="MSSCCGGNNSNGCCKSNSQQESNAAVPLLRGNKNSNVNSRPSSS
                     NGTSYGAIWSVDNAAHPSNRTQQLQDVLGDVQPLGSKCGAHESGGQCCKDLKGDDERH
                     LVSPEIVRDVVIGLSDGLTVPFALTAGLSSLGSSSLVVTGGLAELCAGAISMGLGGYL
                     ASQAELDHFHYLRRQTQARVLRSCSGEMEREIHSILGPLGVKEPLSRLVAEDLRSVED
                     EIYGSSGAEGSEGVMSGANVVSESGNKKWALLNWRPKKVEEEDGGMRGNEEMGMTAFL
                     LKFGEGMEEVPVSRLYISALTIGLSYFIGGLIPLIPYMATSTAEEGLLYSAIVTSIIL
                     FIFGGFKTYFTGATGGWYGYAYGAISTMIVGGCAAGAAFGLVKVLDVQD"
     misc_feature    314441..314470
                     /note="AT_rich"
     gene            complement(314756..317861)
                     /locus_tag="CNL04700"
                     /db_xref="GeneID:3254838"
     mRNA            complement(join(314756..316246,316296..317506,
                     317575..317734,317798..317861))
                     /locus_tag="CNL04700"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546448|gb|CF692289.1,gi|41574938|gb|CF720779.1,
                     gi|41574952|gb|CF720793.1"
                     /transcript_id="XM_568013.1"
                     /db_xref="GI:58261205"
                     /db_xref="GeneID:3254838"
     CDS             complement(join(314826..316246,316296..317506,
                     317575..317734,317798..317840))
                     /locus_tag="CNL04700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568013.1"
                     /db_xref="GI:58261206"
                     /db_xref="GeneID:3254838"
                     /translation="MSCPPAPNRIHQLPVRVSYYIPASSQTYSTIFPSLQQVYIHPQS
                     AGGDDETWGSIYLKTVVKGVLAASPELHPAYPGTSDLSLYVLDPRETYFRRARVGSAH
                     HGNTDTTGSEVWTGKGLVSWSLAEHGQGKNLIAGRLERDVAFTTAIRTQGMSALEALM
                     AADQMGNVSEESWGIDISLGLNMGLGAPGGFARARASSPAVRRRRSSLEKEERGHITP
                     PYPRQQKRASVPPAPQTFDIQEKLPAHPSSSSYSHDQPFRPGHNISHASSPIDPPRAR
                     GRPTKSASTGGRPRKVTASSHSSSTSIDGADPRQRPAHSQRPYEIPLPSSEGPNVYDA
                     LSSIPENILARPESLTREQAQRLLASPAFIDMLGKITGTSIPTGKPNPNNKRLRDGEE
                     PEFQPPKRKRGRPTKAEKAAKEAQEAAARLAEAVKQKAEAVDGPQEDSRNPVCWNCGR
                     TKSAIWRTKVMENGQSVRVCNACGLYWNKLGTMRPPNLWADGDDDRRSERAQSTFSEA
                     PSEHGPAHRVDKPLARAQESFKRTLSAAVEQDARRMATRHKGRAPTSPNKHSKLGPMT
                     SPPRGSASATKSLKQRKYTAASSPGGFVETMHDSFESEVNEASPEDEDESPHFRARPA
                     PHPHRLTRNPPSNTDTRTLDLPLSDDGLGSGASRGNNEWNDEVSAFFDVEGFSMSTMA
                     QHEIPEYSRRHHRQEVIQETKLGAHRSNPIHVTSSSMMENGHVGTDSTLEEDTVLSQL
                     FNRTSSIAGPGSSPSGFDFSQLPPSSPPMSVLSSDALPHSALLLSSPVKKNTPSVSGQ
                     TPSASGLTPVDGNRLPQSSSKLRHSVNAGDSHDNDRQAGGNGGVQQLDFEGIQRMFNL
                     MSHPDYVSQENTSAGTNHTPLSTFEDPQYGALNELIDGLGGGASGMKVNVGGEVVCGG
                     EGETSSASAVLADGNGEDIFASFLDGGAFV"
     gene            complement(318272..>321644)
                     /locus_tag="CNL04710"
                     /db_xref="GeneID:3254760"
     mRNA            complement(join(318272..318444,318498..318546,
                     318594..318849,318899..318973,319026..319109,
                     319161..319445,319499..319597,319657..319758,
                     319813..319882,320060..320274,320330..320423,
                     320478..320515,320566..320821,320873..320929,
                     321058..321149,321218..321244,321376..321393,
                     321456..>321644))
                     /locus_tag="CNL04710"
                     /product="phospholipid:diacylglycerol acyltransferase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539290|gb|CF685131.1,gi|41551396|gb|CF697237.1,
                     gi|41558402|gb|CF704243.1,gi|41559609|gb|CF705450.1,
                     gi|41559874|gb|CF705715.1,gi|41560949|gb|CF706790.1"
                     /transcript_id="XM_568014.1"
                     /db_xref="GI:58261207"
                     /db_xref="GeneID:3254760"
     CDS             complement(join(318306..318444,318498..318546,
                     318594..318849,318899..318973,319026..319109,
                     319161..319445,319499..319597,319657..319758,
                     319813..319882,320060..320274,320330..320423,
                     320478..320515,320566..320821,320873..320929,
                     321058..321149,321218..321244,321376..321393,
                     321456..321644))
                     /locus_tag="CNL04710"
                     /codon_start=1
                     /product="phospholipid:diacylglycerol acyltransferase"
                     /protein_id="XP_568014.1"
                     /db_xref="GI:58261208"
                     /db_xref="GeneID:3254760"
                     /translation="MPPRKKEAKSSPSLPASSSPSSSAIEGMPAPATPNLRQRRSQNT
                     DKEARGKDNVEFNVRLKKNNDGRYHLQELLLTRLTLANTPSFHIMMKLQVKISPPAGN
                     NGSLDAKGILLGIIIAIWAMDFSSLPADIKDVWTALPTSLDPRDLISNLTVVDTARRA
                     LENRDFTVGEAVKAEFGIEKHHPIILIPGIVSTGLESWGTEVVARSFFRKRLWGTSTM
                     IRAVLSNKERWVQALSIDPETGLDPPGFKIRAAQGLDAASEFIQGYWIWQKVVENLAT
                     VGYDTNSMDMAAYDWRLAYYNLEIRDAYFTKLKNKIEMLHWHNKQKVVLCSHSLKWVE
                     SDPIANGFGGGGGPHWVEEHVEAWINVAGSLLGVTKAMTAFLSGEMRDTVELHPAGSW
                     VLEKFFSRRERAKLFRRWPGSSSMWLKGGNRIWGNESHAPDDPEDATDTHGRFFSFRH
                     PGVSPDDKSLSEWTVSPNLTVNEAGPYILTHTPPSFQRMMESNYSQGFETDEKKLKEN
                     GKDHRKWSNPLEVQLPDAPSMKIYCLYGHGKGTERSYWYMQGEYEQDESRSDAAGDQA
                     YCDASDPSNGCDNSTVNRTALDFPLARRHWIDSAVTIKGSSPEVRSGVKFGDGDGTIP
                     VVSLGSMCVKGWKGKTKWNPAGIEVITQEYKHTPEGLDLRGGAQTADHVDILGASPLN
                     SAILKIAGGRGDLVTEQIGSKILEYTERMDWD"
     STS             319123..319632
                     /standard_name="Msp1"
                     /db_xref="UniSTS:470730"
     gene            complement(<322029..>323102)
                     /locus_tag="CNL04720"
                     /db_xref="GeneID:3254765"
     mRNA            complement(join(<322029..322262,322322..322488,
                     322526..322736,322791..>323102))
                     /locus_tag="CNL04720"
                     /product="u3 small nucleolar RNA-associated protein 11,
                     putative"
                     /transcript_id="XM_568015.1"
                     /db_xref="GI:58261209"
                     /db_xref="GeneID:3254765"
     CDS             complement(join(322029..322262,322322..322488,
                     322526..322736,322791..323102))
                     /locus_tag="CNL04720"
                     /codon_start=1
                     /product="u3 small nucleolar RNA-associated protein 11"
                     /protein_id="XP_568015.1"
                     /db_xref="GI:58261210"
                     /db_xref="GeneID:3254765"
                     /translation="MSRRNHKERAQPLHRARLGHLEKHKDYVHRARDYKSKQERIRKL
                     REKAAFRNKDEFYWGMVKGKTKGGVAIGERGFEALSTEVVKLLKSQDLGYIRVQIAKD
                     EKAVTKLRAELEVTAPASSATEEWSAASELAEVEKLAEMGIVLSPALTRKKGKGKGKA
                     PSEGHVVFVDERSDFENYGNEYEEEEQQGTEEEQIDLGWEEPQPVKKRKSKAVELAKE
                     EFDEEAAAQEAREYRLQLLSDLSAHLNRLKLLRQAEAKLETTKGLMGKGAARKIRDHG
                     WVEDESQPEDRNGDRKKWQGKIWKWKMERRK"
     gene            323352..325887
                     /locus_tag="CNL04730"
                     /db_xref="GeneID:3254759"
     mRNA            join(323352..324015,324065..324660,324713..325237,
                     325288..325415,325466..325887)
                     /locus_tag="CNL04730"
                     /product="ATP-binding cassette, sub-family b, member 10,
                     mitochondrial precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534094|gb|CF679935.1,gi|41534100|gb|CF679941.1,
                     gi|41540756|gb|CF686597.1,gi|41541183|gb|CF687024.1,
                     gi|41541989|gb|CF687830.1"
                     /transcript_id="XM_568016.1"
                     /db_xref="GI:58261211"
                     /db_xref="GeneID:3254759"
     CDS             join(323405..324015,324065..324660,324713..325237,
                     325288..325415,325466..325783)
                     /locus_tag="CNL04730"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family b, member 10,
                     mitochondrial precursor"
                     /protein_id="XP_568016.1"
                     /db_xref="GI:58261212"
                     /db_xref="GeneID:3254759"
                     /translation="MLSRQGLGLAANFIRTPLRRRFPANIPVPAHAATLHPQLRALLL
                     QSRLRYYSQSSKKQEKIDKEKEPEEERAPSPIPIHPPASIKLPSATASPTTSPTSPGK
                     DAKPDTSSILKLLTLAKPQWKLLTVGVAFLSVSTAVNLSIPWAIGRIIDFFAPGSEET
                     LLFGLPLEHATGALAVVLLIGAAANSGRSVCLRLAGQRTVARIRNKTYDKYLSMPPSH
                     IEASGVGDALSRLGQDTSIVGQSLSENLGEGLKAVLGAGAGIGAMWLISPTLTVVMLC
                     IIPPIALGTFFYGRFIRKLSLKTQEAMGGMSKLAEERLSAHRTITSSNTQAMEKGLYA
                     SKVDGVYKLQKKETVANGIFQGANEVAGDIGMIGLLIYGGVLVKRGEISVGDMTSLFI
                     YVNWIEWSLNTLAGFFTGLMKGVGASQRIIGLHALPSPIPLSSGKLLPKTDAGSIELR
                     NVDFAYPSRPDAKVLNGLNLKINKGERIALVGGSGSGKSSIQLLLLRFYDPTSGSVLF
                     SDNDIRKYIPESWRSRIGVVQQDPVLFGGTIEENIAYGHPNATRGDIKRAAQVAHCDF
                     IEKLPQGYDTLITKNSLSGGQRQRIAIARALVGNPSVLLMDEATSALDSESEHAVNAA
                     LNDLFANSDITVILIAHRLSSIASANRVVLLEDGRVVEDGTYEDLISRRDGKFRKMVD
                     GQLAKIQVGEVEEGPEPVSEEEGQHQVEEVKEDAEVKVERKKE"
     gene            <326360..327936
                     /locus_tag="CNL04740"
                     /db_xref="GeneID:3254811"
     mRNA            join(<326360..326563,326613..327936)
                     /locus_tag="CNL04740"
                     /product="protoheme IX farnesyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41569470|gb|CF715311.1,gi|41569479|gb|CF715320.1"
                     /transcript_id="XM_568017.1"
                     /db_xref="GI:58261213"
                     /db_xref="GeneID:3254811"
     CDS             join(326360..326563,326613..327863)
                     /locus_tag="CNL04740"
                     /codon_start=1
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="XP_568017.1"
                     /db_xref="GI:58261214"
                     /db_xref="GeneID:3254811"
                     /translation="MISRKGLGLAANFLHPIPSDKVAAVHTLHRTFSIQSTQCLPPWP
                     SRSQTLAREMFAPCEGSNHRARKSLTWALFAPRCQKRSSHSIARQTGDTSVDSTRPFF
                     SAHPTPYSPPFRTVYGAANAPVPELPDLRLPHPTSPAAPVSAYKPLPPLTWKRLLGVY
                     SALSKRNLTILMTLTATTGLALSPLPLSIPLLLNLTVGTLLTSAAANTFNQIFESPID
                     AQTPRTRVRPLVTRRISPFHAAVFGLVCTVMGGAILWYGCNPTTAALGIGNLLLYSAV
                     YTPMKRFSVANTWVGAIVGAITPLMGWTATGASLWPTSDQPLLLHTPWSDLPNLPNPL
                     TPLTLFVLLFSWQFPHFNALSHMIRPFYALSGYPMLSVLSPRLNALVSLRHAVLLVPF
                     TAILGPLSGCVDWSFALTSSVPNYFFVRDAWRFYKLTNEANARKLFFVSLWYLPAVLG
                     LMLVHKNVMGWLDGRREAEEQEKVEMEVPVEGRS"
     gene            complement(328063..331019)
                     /gene="CXT1"
                     /locus_tag="CNL04750"
                     /db_xref="GeneID:3254907"
     mRNA            complement(join(328063..328431,328484..328575,
                     328633..328718,328768..328881,328932..328984,
                     329042..329631,329685..329869,329920..330150,
                     330199..330249,330304..331019))
                     /gene="CXT1"
                     /locus_tag="CNL04750"
                     /note="supported by cDNAs and ESTs:
                     gi|41530300|gb|CF676141.1,gi|41530301|gb|CF676142.1,
                     gi|41539121|gb|CF684962.1,gi|41539137|gb|CF684978.1,
                     gi|41539941|gb|CF685782.1,gi|41539951|gb|CF685792.1,
                     gi|41543511|gb|CF689352.1,gi|41543517|gb|CF689358.1,
                     gi|41565511|gb|CF711352.1,gi|41565518|gb|CF711359.1,
                     gi|41567791|gb|CF713632.1,gi|41567799|gb|CF713640.1"
                     /transcript_id="XM_568018.1"
                     /db_xref="GI:58261215"
                     /db_xref="GeneID:3254907"
     CDS             complement(join(328342..328431,328484..328575,
                     328633..328718,328768..328881,328932..328984,
                     329042..329631,329685..329869,329920..330150,
                     330199..330249,330304..330896))
                     /gene="CXT1"
                     /locus_tag="CNL04750"
                     /codon_start=1
                     /product="cryptococcal xylosyltransferase 1"
                     /protein_id="XP_568018.1"
                     /db_xref="GI:58261216"
                     /db_xref="GeneID:3254907"
                     /translation="MPLNLPFSSPLKLPLPRRFIILILSASILILFLHTFAPSTLPPV
                     LTPNLPHHEPDASYFSPSKWLPPILNPNAPTRPLEFDEDGQCLFLSPFDALSAAEKAR
                     ARVLSLDEISPGIVRADAPPAEGTDADPDFDDEFSELSNATRKMPAGLTHPILGLLRD
                     GEAKWNSMVTMQSQTLEQAVDVYMDRWGRRPPKGFDEWWHFAKANNVLLPDEYDPIMN
                     SLLPFYALPIDTLKERLVEAEKIPETFTLIVHDGKVELKWNDDYSRDTWWASRPRADS
                     QINLMEPFIKHIGTFRATFTIHDQPSILLDHERQEELLTAARHGKISTHPNELDRAEQ
                     NWRKACPPDSPLNKGEEELEAPDSFISSHLAAMDICQHPSYMENHGMLLEEKNSDSHP
                     KPHTKLYPILVPSKTALNGDIPVTPIGKDGRRDDIGHDPEWNRKSGKLYWRGLATGLQ
                     HNKKAGAKWRQSHRERLHFLANDKSDTYTEVLSPVGSSGEAELARMPLRELGQYYMDV
                     KLAGGNWQCDWGDGTCEEMEKEIDFAPKDSSERSNDFKYVFDTDGNAWSSRFPRLMAS
                     NNVVIKSTVFPEWNTNSLPEWYAYVPSKMDYSDLFSIMTFFRGTPSGRGAHDEVARRI
                     ALNGQCWVERTWRREDLQAYMFRLYLEYARLTSPDRDNGKMDYVSTQKKASKEADDVP
                     AAADIETPVIDQ"
     misc_feature    330757..330880
                     /note="GA-rich"
     gene            <332911..334574
                     /locus_tag="CNL04760"
                     /db_xref="GeneID:3254757"
     mRNA            <332911..334574
                     /locus_tag="CNL04760"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41558869|gb|CF704710.1,gi|41558881|gb|CF704722.1"
                     /transcript_id="XM_568216.1"
                     /db_xref="GI:58261611"
                     /db_xref="GeneID:3254757"
     CDS             332911..334416
                     /locus_tag="CNL04760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568216.1"
                     /db_xref="GI:58261612"
                     /db_xref="GeneID:3254757"
                     /translation="MHPQSAPSRPPRNRKREPRAHSAFRKSVISSLPPVTPARPLPPR
                     GSQVPARSSRSGRNIPASQPYAQFPHFSPSLQPSQPTYGFFCQSLPLEKQTGPAVAQQ
                     PADRQSASCRGGKEELRSSGTEYNGEPTKKPSQRDGIERTTCIDSSWPNDRKSSEHEG
                     RIQELWQTANPVIPSSTLPLGQEGLPTVTGYNETNHLTEKQTVSAEKMEEIYQSFEAG
                     QRRHTQQDPMQGHISSDTPSQMSSSSQTPAAAVAGCESVMPDDSSSHPISSMPVASTV
                     QSFLPDPPVGDPQPSRPVVPPSTVGDVQPVFDQQIRMNPSDQKITTSSGPDLSDGVGS
                     GDYTVPYTGASQLEAYPAPDPATWVNQFLGHTNTAPVSLSSYHGQQTSLGYDSQQLYV
                     QQPHIGTSAEPGLAMQPPAMYGGMIAEDNMSANKGGEGKWGSIDEKGTSQSTEYPSQI
                     NPIISDNPFTVNPIDLRLGSGGQGCHLESQDVVAKGWNFSQPMNFSMYPPS"
     gene            complement(336221..340319)
                     /locus_tag="CNL04770"
                     /db_xref="GeneID:3254872"
     mRNA            complement(join(336221..336460,336528..336812,
                     336871..337190,337245..337362,337428..337550,
                     337608..337714,337766..338069,338124..338712,
                     338773..338934,338986..340319))
                     /locus_tag="CNL04770"
                     /product="DNA helicase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532843|gb|CF678684.1,gi|41532852|gb|CF678693.1,
                     gi|41534456|gb|CF680297.1,gi|41534460|gb|CF680301.1,
                     gi|41564908|gb|CF710749.1,gi|41564921|gb|CF710762.1"
                     /transcript_id="XM_568019.1"
                     /db_xref="GI:58261217"
                     /db_xref="GeneID:3254872"
     CDS             complement(join(336299..336460,336528..336812,
                     336871..337190,337245..337362,337428..337550,
                     337608..337714,337766..338069,338124..338712,
                     338773..338934,338986..339674))
                     /locus_tag="CNL04770"
                     /codon_start=1
                     /product="DNA helicase"
                     /protein_id="XP_568019.1"
                     /db_xref="GI:58261218"
                     /db_xref="GeneID:3254872"
                     /translation="MGKLDEIKGWVEADYTPPDENISWDEALNIPLSPAPPMEEFPDF
                     FAAPHHLPRKSEITPPVFNFTIESDTSSVDDTALTSNIPAIPLAADGYPLDGNTRFDW
                     RARALGQLRRPLPPHLRPRNRHWMFAKQPRRYQPVVTKLPSDHPLSIALERYRRHFSQ
                     LLKAELQEEARLFNQRLEEWSTEKLVKAGYTLVNVRGDEVSQKHNSQGERSFIYSFVR
                     GKGTMIDAAKFTFGQYVMLSRTHPFQDAVKDDESRPILATVNSKTKGVVQVLSPVPIP
                     DIRQGVWRLDIGHSDYVYRKQLEAMSFLNNNPLEQDVSDYVEDSFESYPQFPLDMPKK
                     NPLVVSTPSSAAPSNQAILKGTSLRETLLRAFSKDFCPPVPSASSPSDSSSPISNAKS
                     DGFVSNAHALSPTDLDAIPKPHLASGTGETKKSGILNRNTLIRSWAERHRSERETPVE
                     VEGDPYVPLNRTQLRAMGMMLSEALSLVQGPPGTGKTRVIVETIKLLKHHFQIPHPIL
                     VCAHTNVAVDNLLAGMVKHGVKAIRTGMAERVPTDLKQYTLGIKMESHPMWTCVQTMT
                     EKTKRLKDEIFRLDFGNPERQQKSSELKKIWRQIWGIQQSITRELLLDADVVCTTCIS
                     AISANLNSIDFPIVFLDEASMATEPLTLLPLMKGSSHVAIIGDHKQLPPVIVSQDAHA
                     GGLSTSLFERLIHEKNVPSIMLDTQYRMHPSLAAFSSKTFYSSLLKNGTPASERPPPE
                     TAFLIPEDPIPDPSTGELRLWGEKTNLTFLNHSHLESPVLQSMANEGEAEIIVDVVTD
                     LLHKNPDLKGSQIGIIAPYLGQIKVLSETLFASETQDSLKRILGDERTEEIQDVEIKT
                     VDGFEGREKEVIIFSTVRSNAGGYIGFLGDWRRVNVGLTRARRALIMVGNKETLKRAK
                     MGKIVAENLPQGGTRVWQDLMAYLEEGGMILDTDQGVD"
     gene            complement(340424..341861)
                     /locus_tag="CNL04780"
                     /db_xref="GeneID:3254901"
     mRNA            complement(join(340424..340670,340723..340779,
                     340841..341049,341113..341200,341295..341384,
                     341449..341861))
                     /locus_tag="CNL04780"
                     /product="carbonic anhydrase protein, putative"
                     /transcript_id="XM_568020.1"
                     /db_xref="GI:58261219"
                     /db_xref="GeneID:3254901"
     CDS             complement(join(340581..340670,340723..340779,
                     340841..341049,341113..341200,341295..341384,
                     341449..341625))
                     /locus_tag="CNL04780"
                     /codon_start=1
                     /product="carbonic anhydrase protein"
                     /protein_id="XP_568020.1"
                     /db_xref="GI:58261220"
                     /db_xref="GeneID:3254901"
                     /translation="MPFHAEPLKPSEEIDMDLGHSVAAQKFKEIREVLEGNRYWARKV
                     TSEEPEFMAEQVMGQAPNFLWIGCADSRVPEVTIMARKPGDVFVQRNVANQFKPEDDS
                     SQALLNYAIMNVGVTHVMVVGHTGCGGCIAAFDQPIPTVENPGATPLVRYLEPIIRLK
                     HSLPEGSDVNDLIKENVKMAVKNVVNSPEAWEKARKGEFREVFVHGWLYDLSTGNIVD
                     LNVTQGPHPFVDDRVPRT"
     gene            complement(<342807..>343196)
                     /locus_tag="CNL04790"
                     /db_xref="GeneID:3254776"
     mRNA            complement(<342807..>343196)
                     /locus_tag="CNL04790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568217.1"
                     /db_xref="GI:58261613"
                     /db_xref="GeneID:3254776"
     CDS             complement(342807..343196)
                     /locus_tag="CNL04790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568217.1"
                     /db_xref="GI:58261614"
                     /db_xref="GeneID:3254776"
                     /translation="MRVLYYNRQMKAWLSRKKKDIVTEYLSCLVELLDLMSFSVPVET
                     VTNKHLIFSDSAFFRHDETSAVLMMTARVRGPSIVDEAALVRPLQFDKVTGFGLEVYD
                     DEAKHFPRVSSDHPCTFCLPQVKTVTS"
     gene            344006..345708
                     /locus_tag="CNL04800"
                     /db_xref="GeneID:3254774"
     mRNA            join(344006..344199,344247..344346,344400..344735,
                     344782..345082,345137..345266,345316..345457,
                     345502..345708)
                     /locus_tag="CNL04800"
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537242|gb|CF683083.1,gi|41537250|gb|CF683091.1,
                     gi|41549619|gb|CF695460.1,gi|41562918|gb|CF708759.1,
                     gi|41563435|gb|CF709276.1,gi|41574779|gb|CF720620.1,
                     gi|41574788|gb|CF720629.1,gi|41575948|gb|CF721789.1,
                     gi|41575954|gb|CF721795.1"
                     /transcript_id="XM_568021.1"
                     /db_xref="GI:58261221"
                     /db_xref="GeneID:3254774"
     CDS             join(344025..344199,344247..344346,344400..344735,
                     344782..345082,345137..345266,345316..345457,
                     345502..345661)
                     /locus_tag="CNL04800"
                     /codon_start=1
                     /product="alpha-1,3-mannosyltransferase"
                     /protein_id="XP_568021.1"
                     /db_xref="GI:58261222"
                     /db_xref="GeneID:3254774"
                     /translation="MSRQSLFTPALGQRKGLISHTVDLVRALLFDRRYFWHTAFLLFL
                     GEVALSLLVIWKIPYTKIDWPAYMQQVDMFLAGERDYSKIEGETGPLVYPALHLYIYT
                     AFHRLLPSIENVRPAQFVFLGFYLATYLAISTIYYLAGRPSNGGHHFPQVLLIPLTLS
                     KRAHSIFLLRLFNDPIAMLIFYLSVIAFQIGGRKGWRLGCVLFSLALGVKMNILNFLP
                     GLLVLLFQYRGIVGTVEGLSIIGLIQFLLPAPFFFSKSNPYLIRAYFTSAFDFSRQFL
                     YEWTVNWRFISEETFLSRERAVTLLAGHLTVLGLFAAFKWSPVPGGTLRVLRKGFSDP
                     LNQALEVSQVPAYHIPLVLFSANLIGMLFARSLHYQFHSWYFHQLPFLLYSGAGWGNM
                     LTSVLIWVTVQYAWETAPSTISTSAALLAGHGAMVFGLFFHGMKRPSSSQKSKAK"
     gene            complement(345709..347942)
                     /locus_tag="CNL04810"
                     /db_xref="GeneID:3254863"
     mRNA            complement(join(345709..346555,346606..347203,
                     347253..347668,347731..347942))
                     /locus_tag="CNL04810"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536264|gb|CF682105.1,gi|41536278|gb|CF682119.1,
                     gi|41540291|gb|CF686132.1,gi|41540300|gb|CF686141.1,
                     gi|41542686|gb|CF688527.1,gi|41542693|gb|CF688534.1,
                     gi|41552243|gb|CF698084.1,gi|41552247|gb|CF698088.1,
                     gi|41552961|gb|CF698802.1,gi|41552969|gb|CF698810.1"
                     /transcript_id="XM_568022.1"
                     /db_xref="GI:58261223"
                     /db_xref="GeneID:3254863"
     CDS             complement(join(345750..346555,346606..347203,
                     347253..347668,347731..347797))
                     /locus_tag="CNL04810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568022.1"
                     /db_xref="GI:58261224"
                     /db_xref="GeneID:3254863"
                     /translation="MRGIPVFVAILIGLACSFVQSLGLTIQRKSHIQEDLLPLPARRP
                     AIRRPLWLIGFIIYMTSNVFATLFQLDALPIVILAPLGAISLVFNALFAHVLLGDKFG
                     MSWVVGTALVAGGAVMIAVFGVVPDEEHGLDELLLLLKRGPFVAFFTIVLIAVAAVLA
                     AAHIASWHVYRHQSNQISLSGASSPVSVPSNYASPRSTIAIPFRSTNPRHRSTSNSDD
                     HEDEYAKPNPRLTLKSPSVQKPLSLSISPRIQEVSPKSTAESSLTHTLTLCGLAFAAA
                     AGTLSGLCLVLAKATVELFMKTVDHWRTGVGRNEFARPQTWALMLGMSVIAVAQIWYL
                     HHSLKFTGPALVCPLAFCFFNLSSIFDGLIFYNQFGQLATYQILLVSFGTAILLLGVW
                     IVSAIQPEGSVEVGTWAEEDVMSDSTSISSHESRDEVEAGEGATLLGRGTTEEPEDDE
                     SLWPLPHHDIGTVSVPPTPTGHYQPVFAPSPSSPHSPMSPRSFHTHSHSLSHAHHHHH
                     RGPRYGSLLPDIGPHAAPMGFSIGLGAASPGFALRSGSMSEHHHGERERNRRSRSDGP
                     LGLGAIIRGEDNSSLQTDVEEGRGENATEVALRDWDVGERRRNNWWDVRRFFESQGNI
                     RLTK"
     gene            complement(349233..352045)
                     /locus_tag="CNL04820"
                     /db_xref="GeneID:3254762"
     mRNA            complement(join(349233..349827,349885..350064,
                     350112..350378,350427..350524,350580..350611,
                     350662..351391,351438..351538,351592..351662,
                     351738..352045))
                     /locus_tag="CNL04820"
                     /product="methylenetetrahydrofolate reductase (NADPH),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531255|gb|CF677096.1,gi|41531262|gb|CF677103.1,
                     gi|41545067|gb|CF690908.1,gi|41545075|gb|CF690916.1,
                     gi|41560686|gb|CF706527.1,gi|41560702|gb|CF706543.1"
                     /transcript_id="XM_568023.1"
                     /db_xref="GI:58261225"
                     /db_xref="GeneID:3254762"
     CDS             complement(join(349540..349827,349885..350064,
                     350112..350378,350427..350524,350580..350611,
                     350662..351391,351438..351538,351592..351662,
                     351738..351824))
                     /locus_tag="CNL04820"
                     /codon_start=1
                     /product="methylenetetrahydrofolate reductase (NADPH)"
                     /protein_id="XP_568023.1"
                     /db_xref="GI:58261226"
                     /db_xref="GeneID:3254762"
                     /translation="MKITEKLQKAEKEGRPFWSFEFFPPRTAQGLQNLYDRIERMRDL
                     GPEFIDITWGAGGKNADLTNSLVQVCQATIGIETCMHLCCTEMPKEKVEWALREAKSH
                     GCQNILALRGDPVAGTSTWEPTPGGFMNAVDLVRYIHEHYPGDFCVAVAGFPQGHPET
                     PDTPEGRAQEMEWLKAKVDAGAEFIFTQMFYDTSIFFDWVKRVREAGINVPIIPGIMP
                     IQNWEKFEKWVQRENIIVPSHFYEALNPVRGDDEKVRQVGTKLVADMCKTILDNKEAG
                     IKGLHIYTLNLEKGARMLLRELGFEGRREQIAPLPWRPSLTPSRREETIRPIFWANRT
                     RSYLSRTADWDEFPNGRWGDSRSPAYGDLDGYPVSIGITAPDAYNLWGHPTTSSDLHA
                     LFARFCRGDLAKLPWSTQPPASETSLIIEQLAKMNELGYLTINSQPAVDGVRSDDKVH
                     GWGPPGGYVYQKAYLEFFVSPDLLSPLIRRIEKDPRITYYAVNKQGDLRTNTHSESPN
                     AVTWGVFPGKEIVQPTIVEAVSFIAWKDEAFELGLQWAHLYPAESPSRKLITDTMNTS
                     YLVNIVANDFRDGMSIFEPFLLDQTTVRKVVEGVKGTVEGIVEGVKGVVGA"
     gene            <352509..355337
                     /locus_tag="CNL04830"
                     /db_xref="GeneID:3254807"
     mRNA            join(<352509..352763,352859..353181,353329..353634,
                     353686..354660,354711..355337)
                     /locus_tag="CNL04830"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540986|gb|CF686827.1"
                     /transcript_id="XM_568024.1"
                     /db_xref="GI:58261227"
                     /db_xref="GeneID:3254807"
     CDS             join(352509..352763,352859..353181,353329..353634,
                     353686..354660,354711..355257)
                     /locus_tag="CNL04830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568024.1"
                     /db_xref="GI:58261228"
                     /db_xref="GeneID:3254807"
                     /translation="MSVHIVHIVQTPTYQYIFEQVSHSCSCIYSPLCGPSLAQVTLST
                     HAVQPARGQPHPISSPLSSLDSSSLLPVSINNLSARRTDLPSITATSCSLGFPGMAHR
                     TNTRSPSGLNRRPTDRCTSQSGSLQTASSPVQSTFGGRIYAAPEEDRGLIMRDRSERD
                     RGENDWADEKGNSMGKTRGMDVGVTRPKRRLSSLPNLLVPPPLHRAMSSTSVSSPPQS
                     PIGQPGHGSYHSLQQPFHNQKAHGSSTANNFPSYSRSNPPKLDDKVGMVGYATAMAAA
                     SREKEGPPSLWGIELKWISLITLALQNAFLTIIMHYSRISTAPNRTYSAAAAVLLNEL
                     LKGGISVFIALKRIDNEMTASPPPPVYSEKLDDKDFDKRSGQKLPSIIHPTRLQALSK
                     AVFSPDCYKLSVPAILYVIQNNLQYVAASNLDVATFQVTYQMKILTTAFFSVLLLRKR
                     LSRTKWASLILLAIGVGIVQIQSSSAPAASHHTHVTVSHERQLRSEIPVSDEPIMSPE
                     RVMHPVRGFVAVTLACMTSGLAGVYFEFILKSSSGSSAPDLWVRNTQLSLFSLVPALV
                     PIIVNPSGPNGMGYFSKVMSCFDNFNGWAIGTVLTQTFGGLITALVIRYSDNIMKGFA
                     TSLSIIISFLASVALFSYPITLSFIVGASIVLFATYTYNSPAPPASSTRKEIAVPGSP
                     ISTSAPILGEPEKPSRASSVINLLGLGSNNGSRKPSVSDIKSYASSQLGLSSYPVSAS
                     VSAPGTPRTNMNDYAESGRSSPASFGAVQTSHGGSGAGFGRGNVGDKVRPILSLDIDR
                     KHG"
     gene            358136..362069
                     /locus_tag="CNL04840"
                     /db_xref="GeneID:3254767"
     mRNA            join(358136..358334,358464..358539,358666..358959,
                     359068..359345,359394..359643,359703..359805,
                     359853..359995,360044..360239,360287..360960,
                     361020..361128,361180..361271,361326..362069)
                     /locus_tag="CNL04840"
                     /product="exo-beta-1,3-glucanase"
                     /note="supported by cDNAs and ESTs:
                     gi|41534505|gb|CF680346.1,gi|41537115|gb|CF682956.1,
                     gi|41541216|gb|CF687057.1,gi|41542767|gb|CF688608.1,
                     gi|41548718|gb|CF694559.1,gi|41562425|gb|CF708266.1,
                     gi|41567788|gb|CF713629.1,gi|41574649|gb|CF720490.1"
                     /transcript_id="XM_568025.1"
                     /db_xref="GI:58261229"
                     /db_xref="GeneID:3254767"
     mRNA            join(358136..358334,358464..358539,358666..358959,
                     359068..359345,359394..359643,359703..359805,
                     359853..359995,360044..360239,360287..360960,
                     361020..361128,361180..361269,361326..362069)
                     /locus_tag="CNL04840"
                     /product="exo-beta-1,3-glucanase"
                     /transcript_id="XM_568026.1"
                     /db_xref="GI:58261231"
                     /db_xref="GeneID:3254767"
     CDS             join(358681..358959,359068..359345,359394..359643,
                     359703..359805,359853..359995,360044..360239,
                     360287..360960,361020..361128,361180..361271,
                     361326..361685)
                     /locus_tag="CNL04840"
                     /codon_start=1
                     /product="exo-beta-1,3-glucanase"
                     /protein_id="XP_568025.1"
                     /db_xref="GI:58261230"
                     /db_xref="GeneID:3254767"
                     /translation="MPRPSYDPVANPNFSPDSNISPDPNRNSSFLDPEANNLFGRPGS
                     EYAPAPSLMSRDSTAASMNLAGGTPSLAGTHRDSWGSGVGLTGAEGATNGNRNPGRSG
                     LAHSTVAYESGDRLSTSEEDDEQGHITPAVAAIGAGTAARGFSEKPRWADHESGQGKK
                     NRKWLWAALAALLIVAIGLGVGLGVGLTRNKDSKSLVASAGNENSSSQAPSGTSSVSG
                     STTATSTSATASATPTTGTQGSLITLEDGSTMTYDNPYGGKWVWDEANPFNNEAQANS
                     WTPALNQNWTWGQDKVFGVNLGGWLVTEPFIVPGLYEKYANGSAGTAIDEYTLSINMG
                     DNLTDALTEHYETFITERDFVEIVAAGLNWVRIPIPFFAIEVWEGEPFLPKVSWEYFL
                     KAIKWARKYGLRINLDLHSVPGSQNGWNHSGRQGSVNWLNGVMGLANAQRSLDYVRTL
                     AQFIAQPEYAPVIQMFGFLNEPNGNAISKGPVASFYIEAHNIIRDITGIGAGNGPMLS
                     MHDGFLGVAAWYGDLAGADRMMLDQHTYMVFQDQPQGTLDTLKTMPCQWWASSTNTTS
                     QQWGPNTAGEWSAAWNDCGKWVNNVGSGSRYDGTYDGYADKVTGSCDYWNDYTQWNAS
                     TIEALNHFVSGSMDALQNFFFWTWKIGNSTDAIQQPNPFWHYRLGLEKGWIPKDPRTV
                     AGTCQADGVSMNNFDGTFSNAYVTGGAGAGTIAASASSSYPWPPASFTNVASDSISLL
                     PQYTQTGTPITMPGPTFTSPGSTATISAGSGWYNANANDRQAYAAISGCSYPAEYSAA
                     DLAIPTGACGAGLSQANKRSAQPTPAPTR"
     CDS             join(358681..358959,359068..359345,359394..359643,
                     359703..359805,359853..359995,360044..360239,
                     360287..360960,361020..361128,361180..361269,
                     361326..361510)
                     /locus_tag="CNL04840"
                     /codon_start=1
                     /product="exo-beta-1,3-glucanase"
                     /protein_id="XP_568026.1"
                     /db_xref="GI:58261232"
                     /db_xref="GeneID:3254767"
                     /translation="MPRPSYDPVANPNFSPDSNISPDPNRNSSFLDPEANNLFGRPGS
                     EYAPAPSLMSRDSTAASMNLAGGTPSLAGTHRDSWGSGVGLTGAEGATNGNRNPGRSG
                     LAHSTVAYESGDRLSTSEEDDEQGHITPAVAAIGAGTAARGFSEKPRWADHESGQGKK
                     NRKWLWAALAALLIVAIGLGVGLGVGLTRNKDSKSLVASAGNENSSSQAPSGTSSVSG
                     STTATSTSATASATPTTGTQGSLITLEDGSTMTYDNPYGGKWVWDEANPFNNEAQANS
                     WTPALNQNWTWGQDKVFGVNLGGWLVTEPFIVPGLYEKYANGSAGTAIDEYTLSINMG
                     DNLTDALTEHYETFITERDFVEIVAAGLNWVRIPIPFFAIEVWEGEPFLPKVSWEYFL
                     KAIKWARKYGLRINLDLHSVPGSQNGWNHSGRQGSVNWLNGVMGLANAQRSLDYVRTL
                     AQFIAQPEYAPVIQMFGFLNEPNGNAISKGPVASFYIEAHNIIRDITGIGAGNGPMLS
                     MHDGFLGVAAWYGDLAGADRMMLDQHTYMVFQDQPQGTLDTLKTMPCQWWASSTNTTS
                     QQWGPNTAGEWSAAWNDCGKWVNNVGSGSRYDGTYDGYADKVTGSCDYWNDYTQWNAS
                     TIEALNHFVSGSMDALQNFFFWTWKIGNSTDAIQQPNPFWHYRLGLEKGWIPKDPRTV
                     AGTCQADGVSMNNFDGTFSNAYVTGGRCWYHCGVRVLFLPLAACFVHQRRLGLHISPP
                     SIYPDGYSYYHARTYIYLSRVYCDHQRG"
     gene            complement(<362118..>362922)
                     /locus_tag="CNL04850"
                     /db_xref="GeneID:3254896"
     mRNA            complement(join(<362118..362165,362222..362306,
                     362364..362621,362672..>362922))
                     /locus_tag="CNL04850"
                     /product="HDEL sequence binding protein, putative"
                     /transcript_id="XM_568027.1"
                     /db_xref="GI:58261233"
                     /db_xref="GeneID:3254896"
     CDS             complement(join(362118..362165,362222..362306,
                     362364..362621,362672..362922))
                     /locus_tag="CNL04850"
                     /codon_start=1
                     /product="HDEL sequence binding protein"
                     /protein_id="XP_568027.1"
                     /db_xref="GI:58261234"
                     /db_xref="GeneID:3254896"
                     /translation="MNIFRFLGDLSHLASILILLHKIQTTRSCRGISFKSQLLYLIVF
                     LTRYVDLVTHPLVSVYNTAMKLFFIASTAYTLYLMKFKYRPTHDASLDTFQLSYIFGP
                     VAVLALLFNYKFTPFEITWSFSIWLESVAILPQLFMLQRTGEAETITTHYLAALGLYR
                     GLYIPNWMYRYFTEGAFDAIAVVAGIIQTAIYADFGYIYVTRVLRGQKFELPA"
     gene            <363409..367817
                     /locus_tag="CNL04860"
                     /db_xref="GeneID:3254768"
     mRNA            join(<363409..363435,363477..363566,363605..363668,
                     363717..364102,364111..364237,364286..364516,
                     364572..364889,364946..365066,365123..365286,
                     365339..365625,365691..365816,365876..365990,
                     366070..366720,366770..366966,367034..367170,
                     367227..367479,367533..367817)
                     /locus_tag="CNL04860"
                     /product="ATPase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531686|gb|CF677527.1,gi|41531695|gb|CF677536.1,
                     gi|41539628|gb|CF685469.1,gi|41539635|gb|CF685476.1,
                     gi|41554307|gb|CF700148.1"
                     /transcript_id="XM_568028.1"
                     /db_xref="GI:58261235"
                     /db_xref="GeneID:3254768"
     CDS             join(363409..363435,363477..363566,363605..363668,
                     363717..364102,364111..364237,364286..364516,
                     364572..364889,364946..365066,365123..365286,
                     365339..365625,365691..365816,365876..365990,
                     366070..366720,366770..366966,367034..367170,
                     367227..367479,367533..367748)
                     /locus_tag="CNL04860"
                     /codon_start=1
                     /product="ATPase"
                     /protein_id="XP_568028.1"
                     /db_xref="GI:58261236"
                     /db_xref="GeneID:3254768"
                     /translation="MNARISYTTAASLESASRVRVIPKKGRGKGEIVPLDRKTAPGAT
                     EPAYSFSYQRDTYVYNRADNVFTPIPYPCDSSPPLSTFQTARGILTHPAARPKPTAPE
                     AGLPSLEALKATYGLNECHIPIPKFAELFAEHAVAPFFVFQMFCVALWCLDEYWYYSL
                     FTAFMLVVFECTVVFQASICSVPRAVADRRVKTLQEFRTMSITPYNVQAFRDGKWVSV
                     ISSELVPGDLVSILRTNPDSGIPCDLLLLRGTCIVNEAMLSGESTPLLKESIELREGT
                     DRLDMNGADRNNVLFSGTKALQVEKAGEGGMTTPDGGCLAVVLRTGFGTTQGQLVRTM
                     IFSTERVSANTFEAFLFIGFLLIFAIAASAYVWIKGLERGMVKGKLLLDCVLIITSVV
                     PPELPMELSLAVNASLVALQKYAIFCTEPFRIPWAGRVDVCCFDKTGTITGEDLVVEG
                     IAGVNSADPKALRPVTESNKETTLALAAAHALVLLDDGTIVGDPMEKTTLAALDWKLS
                     RGDQISPVSKESPYKAQIHIRRRYQFSSALKRMSTISSVSDSQGKKWVAAVKGAPETL
                     KSMYVQVPDWYEETYRWYTRRGSRVLALGVKYMDVQADKINQIHRDHVECKLSFAGFL
                     VFHCPLKPDAVETLKMLNDSSHRCVMITGDNPLTAVHVARDVEIVDREVMILDLKEGT
                     TSNELVWRNVDETNVIPVNSSEPFDQSLFKNYDICITGAALKQYDALPSVTDLIKHTY
                     VYARVSPAQKEFIITTLRSLGYITLMAGDGTNDVGALKAAHIGVALLDGSPEDLKKIA
                     EHQKLERMKKVYEQQVRISARFNQPPPPPPPALREAYPELVKTQQQVAKAHEGAKKAN
                     PLEKFDMATITSKLSELDEDQDVPQIKLGDASCAAPFTSKLSNVSAISNIIRQGRCTL
                     VATIQMYKILALNCLITAYSLSVQYLDGIKFGDYQVTITGMLMSVCFLCISRAKPVEK
                     LSKERPLGNIFNLYVLLSVLLQFAIHIVALVYITGLSKSLEDRGEIDLEKKFEPTLLN
                     TAIYLLGLSQQVSTFVLNFQGRPFREGIRENPPLYYGLLGVSAVAYCGATDFVPELNR
                     WLQLVEMTTSFRVKLTISMVLDFILCWAIEKTCKALFADLEPVEFVTRGRERREKRRA
                     QEAKKLKEDERLRLLAEGEKKAQ"
     STS             367492..368292
                     /standard_name="Pst18"
                     /db_xref="UniSTS:470732"
     gene            <367988..371845
                     /locus_tag="CNL04870"
                     /db_xref="GeneID:3254747"
     mRNA            join(<367988..368593,368649..368901,368965..369321,
                     369387..369605,369677..369838,369910..370184,
                     370242..371399,371481..371845)
                     /locus_tag="CNL04870"
                     /product="calcium-transporting ATPase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533823|gb|CF679664.1,gi|41533834|gb|CF679675.1,
                     gi|41551751|gb|CF697592.1,gi|41551760|gb|CF697601.1,
                     gi|41567650|gb|CF713491.1,gi|41573696|gb|CF719537.1"
                     /transcript_id="XM_568029.1"
                     /db_xref="GI:58261237"
                     /db_xref="GeneID:3254747"
     CDS             join(367988..368593,368649..368901,368965..369321,
                     369387..369605,369677..369838,369910..370184,
                     370242..371399,371481..371786)
                     /locus_tag="CNL04870"
                     /codon_start=1
                     /product="calcium-transporting ATPase"
                     /protein_id="XP_568029.1"
                     /db_xref="GI:58261238"
                     /db_xref="GeneID:3254747"
                     /translation="MDPRSRAPSASRRRSPPAPRPSSPAPLPHSATASTSASSYRAAP
                     HGSTPVARAPPARGPPAHDPTMGGLVDSPGRIDPGPSNAIEAAASSSGGYAYSTTLRR
                     HVSTDVFPHFPHAARRRDSSPHVASPYSRGQHPLTGSPGERLQFAHRDEGLFERAMAA
                     GRRLLGKKDYDERRMEEEEKRLSTERRQRETPSSIYAHKSVQETLDIFATHPTDGLAN
                     SAVAPLLARYGPNEFEVPPSDPLYLKFAKQVYENPLILLLLGSSVVSALMGQFDDAAC
                     VVIAVGIVLTVGFVQEQRSEKSLEALNKLVPHYCHLIRNGTPLSPLANALLPGDLVTF
                     SVGDRIPADIRLITANHLEIDESALTGETRPARKNTQLCERGEGEDTHGEGGGKALGE
                     RHCMAFMGTLVRSGNGSGIVVGTGKDTEFGVIFSMMQDVEEKRTPLQLDMDNLAKQLS
                     IVSFIVIGFIVLIGVIQKRDWLEMFTIGVSLAVAAIPEGLPIVTTVTLALGVLRMSKR
                     KAIVKKLPSVEALGSVSVICSDKTGTLTKNEMTVTHMYSVDELVDLTPHLNVTSPFGP
                     RRPDSQQLWISPALLKVALVGNLCNDAFKNEQGINVGQATEVALLNVLPVLKAEDQRK
                     NFIRKSEIPFSSETKTMSITGSLNNSPDMIYLKGAVEQVIARCRYYYVTDSSTPSLDT
                     ATQKIILDRAMEVSKRGLRVIAMAYGFPGKGDDEPNNLVFVGFEAMMDPPRNGVVHAV
                     SALHSAGVQIVMITGDAEPTAVAIAKQLGLKVSASTSGTLDDHPHSLFSGSSCILGSQ
                     IDQMTERELVERVSSITVYARTTPRHKMAIVKAWQMRGAVVAMTGDGVNDSPALKMAD
                     IGISMGKSGTDVAKEAADVILVDDDFASILPAVEEGKSIFYNIQNFLSFQLSTAVAAL
                     SLITLSTVFKLANPLNAMQILFINILMDGPPAQALGVDPVDEEIMRQPPRKKGSHVLS
                     TRLIYRVLFSAAMIVLGTLWIYTVETSDGSMSRRDQTMTFTVFVFLDLVSALQNRGLT
                     TPMFRNRMLFLTISVSFICQLALIYIPLLQHVFQTEALSARDLFMLLGLAGTSMGLHE
                     GRRWWERKQVEAEILEKSAGGMV"
     misc_feature    368019..368182
                     /locus_tag="CNL04870"
                     /note="C-rich"
     gene            complement(371907..373906)
                     /locus_tag="CNL04880"
                     /db_xref="GeneID:3254816"
     mRNA            complement(join(371907..372127,372184..372274,
                     372328..372676,372732..372913,372978..373419,
                     373474..373508,373570..373647,373703..373726,
                     373777..373906))
                     /locus_tag="CNL04880"
                     /product="ornithine-oxo-acid transaminase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531005|gb|CF676846.1,gi|41531010|gb|CF676851.1,
                     gi|41533745|gb|CF679586.1,gi|41533752|gb|CF679593.1,
                     gi|41545873|gb|CF691714.1,gi|41545881|gb|CF691722.1,
                     gi|41552598|gb|CF698439.1,gi|41552612|gb|CF698453.1,
                     gi|41555514|gb|CF701355.1,gi|41555522|gb|CF701363.1,
                     gi|41557530|gb|CF703371.1,gi|41557535|gb|CF703376.1,
                     gi|41566254|gb|CF712095.1,gi|41566260|gb|CF712101.1"
                     /transcript_id="XM_568030.1"
                     /db_xref="GI:58261239"
                     /db_xref="GeneID:3254816"
     CDS             complement(join(372065..372127,372184..372274,
                     372328..372676,372732..372913,372978..373419,
                     373474..373508,373570..373647,373703..373726,
                     373777..373871))
                     /locus_tag="CNL04880"
                     /codon_start=1
                     /product="ornithine-oxo-acid transaminase"
                     /protein_id="XP_568030.1"
                     /db_xref="GI:58261240"
                     /db_xref="GeneID:3254816"
                     /translation="MSPIASTASPIPSSKPTLSSQEVMNLEHEYSAHNYHPLPICFEK
                     GLGAHVWDPEGNEYLDFLSAYSAVNQGHCHPEILNTLVTQASKLTLSSRAFYSSNLGP
                     FAKKITSMFGYDMVLPMNTGAEAVETAIKLARKWGYEKKKIPDGKAKVLSVEGNFHGR
                     TIGIISMSTDPESRTGFGPFLENVGPRWDTGLIRYNHTEDLEKVLEKHGDEVAAFLVE
                     PIQGEAGIFVPDDGYLAKCAEICKKYNVLLICDEIQTGLCRTGKMLCYEWDNIRPDMV
                     ILGKALSGGMYPVSCVLADKDIMLCIKPGEHGSTYGGNPLGCAVAMTALDVLVKEDLA
                     NRSLKLGEIFRSELAKLNSPFIKLIRGRGLFNGVVIDETASKKGRTAWQLCLLMKSKG
                     LLAKPTHVNIIRFAPPLVISEEDVRKAVKIIGESLEELDTIEKIPGDEGEEHKAAIKL
                     DD"
     misc_feature    372936..372960
                     /note="AT_rich"
     gene            <378406..379398
                     /locus_tag="CNL04890"
                     /db_xref="GeneID:3254843"
     mRNA            join(<378406..378737,378925..379057,379109..379220,
                     379273..379398)
                     /locus_tag="CNL04890"
                     /product="cytochrome c oxidase polypeptide iv,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_568031.1"
                     /db_xref="GI:58261241"
                     /db_xref="GeneID:3254843"
     CDS             join(378406..378737,378925..379057,379109..379220,
                     379273..379334)
                     /locus_tag="CNL04890"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="cytochrome c oxidase polypeptide iv,
                     mitochondrial precursor"
                     /protein_id="XP_568031.1"
                     /db_xref="GI:58261242"
                     /db_xref="GeneID:3254843"
                     /translation="MVPHSWPPAGLLPAPRLNPGLLSLSTYHIADIQSNTSILLLDVF
                     SYSPLFQAPKMASAIRSLRTALPALRRTVPAPAFTARAFSISAARSAGHGPPQLLGPG
                     AKAGEVPNDENQSTGLERFELLGNLEGVDVFDMKPLEITRLGTVDEPIPIYSLFPERQ
                     IGCTGFPVDSHDTIWLNVNHTLKNHRCPECGSVYTLNFQGDEALLHGGGHHH"
     gene            complement(379504..380626)
                     /locus_tag="CNL04900"
                     /db_xref="GeneID:3254810"
     mRNA            complement(join(379504..379746,379800..380311,
                     380504..380626))
                     /locus_tag="CNL04900"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542474|gb|CF688315.1,gi|41542482|gb|CF688323.1"
                     /transcript_id="XM_568032.1"
                     /db_xref="GI:58261243"
                     /db_xref="GeneID:3254810"
     CDS             complement(join(379675..379746,379800..380311,
                     380504..380606))
                     /locus_tag="CNL04900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568032.1"
                     /db_xref="GI:58261244"
                     /db_xref="GeneID:3254810"
                     /translation="MFSINLVRPAMTVAAPLRVRMLSTTSLLLKKKNIDTTLPTVPKG
                     PPTPYTLWFKDHIANVSEKYRRPDGKLDMRRLTNEAATEWASLTSSVKAELQSRADEG
                     RKLADKAYLEFWNSTTPETRTAIEKATGKKVSPPGGKKAFKQSVKERPGNPGKPLTPY
                     FAFAKEVRESGKVELPSDLEGNVRNQQLARETGALWKQLSDSEKQKYKDAYVQARAKW
                     DEWRQTQPDL"
     gene            complement(<381027..>383532)
                     /locus_tag="CNL04910"
                     /db_xref="GeneID:3254875"
     mRNA            complement(join(<381027..381109,381174..381342,
                     381561..381641,381694..381863,381961..382396,
                     382483..382551,382600..382671,382724..382879,
                     382934..382957,383079..383121,383189..383298,
                     383365..>383532))
                     /locus_tag="CNL04910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568033.1"
                     /db_xref="GI:58261245"
                     /db_xref="GeneID:3254875"
     CDS             complement(join(381027..381109,381174..381342,
                     381561..381641,381694..381863,381961..382396,
                     382483..382551,382600..382671,382724..382879,
                     382934..382957,383079..383121,383189..383298,
                     383365..383532))
                     /locus_tag="CNL04910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568033.1"
                     /db_xref="GI:58261246"
                     /db_xref="GeneID:3254875"
                     /translation="MIDRPPDQTGPSKNSEKQAVKGLNAIDIEHLPVDNDPRKWSDRK
                     KWTVLMIMTFAMLGPMMAPSIYNPVISDVREDLHATESELGLSISLYILFQGCTPVLW
                     AAIAETVYLVSYTLYVIALVVASRANSMPLLIVMRILQSTGSGPTVSLGAGSLADMYE
                     THERGAKLGLFYGVPMIAPAVAPLIGGALGQSFGWRSVFYFLAVYAFIMLCCFMRSRV
                     YQRALTKAIERAENRDAKDLKRKAKLAKQSQVLDTIPATPDATPGNSPGNSRRPSAEA
                     GGAAVTDTTLVDVTLSNDQKQTVGRSGRIKVKMMKWLPFGAKEEKIQAENEVEFKPTF
                     RDLNPLPSMALILKQPTNLLILTSSASITLGKAPYSYGSLKIGLVVLAFGIGNILASM
                     IGGKYSDMVLKKLKKKNGGVGNPEMRLRSTVLAMPILVASFLAYAWTAEEKGASSSAV
                     SCNSMFRGICACVMSQVATPIQNGIGDGGLYTLFAGILAFACACNLLLMVKGEQWRSP
                     EHRWPWQKKREEGNDEKE"
     gene            complement(<386864..>387997)
                     /locus_tag="CNL04920"
                     /db_xref="GeneID:3254848"
     mRNA            complement(join(<386864..387634,387689..387823,
                     387878..>387997))
                     /locus_tag="CNL04920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568034.1"
                     /db_xref="GI:58261247"
                     /db_xref="GeneID:3254848"
     CDS             complement(join(386864..387634,387689..387823,
                     387878..387997))
                     /locus_tag="CNL04920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568034.1"
                     /db_xref="GI:58261248"
                     /db_xref="GeneID:3254848"
                     /translation="MGADGGSIPDRRDLVKTKGKTEQADKESLKALFFLCALSKKPLK
                     KPVVIDPLGKLYNKDDLIEYFLDKSKYGDGEQICGHLKGVKDLTTLNLTPNPDFTFSS
                     ASATVTTSRAPFICPLSLREMAGTFPFIALKSCGCVFSDAALRAVVPNLTKGTGAKVI
                     PKDDVPEEGKPVVKENTTEVACPNCGKTFNPTISAAIIPVNPPKEVQDVLLEDLLTSR
                     AAAKSSKKRKADKSTKANNDTGSPATLEPPPKSARISSSSPAPRATPTVNTPASLARS
                     VHEKLAEQEKKRLQAQENMSEAVKAMFKPKTNEKKSGADDFFGRTFNRVSLPSLICCC
                     ADNSQYA"
     gene            388256..390126
                     /locus_tag="CNL04930"
                     /db_xref="GeneID:3254864"
     mRNA            join(388256..388334,388537..388557,388948..389278,
                     389333..389430,389492..390126)
                     /locus_tag="CNL04930"
                     /product="expressed protein"
                     /transcript_id="XM_568222.1"
                     /db_xref="GI:58261623"
                     /db_xref="GeneID:3254864"
     CDS             join(388966..389278,389333..389430,389492..390028)
                     /locus_tag="CNL04930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568222.1"
                     /db_xref="GI:58261624"
                     /db_xref="GeneID:3254864"
                     /translation="MSQVSLSAQYLASARPSGAAPPSISGTPRPVPTSTGNPSQASAR
                     PPYRPNINVPKRSNDDVFARSKVPQTPTTSSSQVGNDSISGAGAEKKKKEDSLRGTMR
                     NEIAKLMYGAGDVADPDIDTVDYMEDMVVEFLSDLCRPVPPIRSNPSQPHQPVPLSGE
                     VVRHRLATTPMLHKYLARFDHMVHMADVLKAHRRVADPSLKDLVDQVGNDYLGLNEHG
                     VPTGTGDAGAAGAGGVGRQKRPAEGEGEDAPKKKGRPPKPPGERKKPGPQKGWKLNRD
                     PNAPPVKKLPRDPNAPKRKYVRKAPLKSQMGTPTASSGV"
     gene            complement(<390169..>391064)
                     /locus_tag="CNL04940"
                     /db_xref="GeneID:3254873"
     mRNA            complement(join(<390169..390291,390351..390469,
                     390605..>391064))
                     /locus_tag="CNL04940"
                     /product="hypothetical protein"
                     /transcript_id="XM_568035.1"
                     /db_xref="GI:58261249"
                     /db_xref="GeneID:3254873"
     CDS             complement(join(390169..390291,390351..390469,
                     390605..391064))
                     /locus_tag="CNL04940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568035.1"
                     /db_xref="GI:58261250"
                     /db_xref="GeneID:3254873"
                     /translation="MAIIEEVPASSTIRSRAPTKDNKQKGKSNGQPTIPLVHPSALPK
                     PTAPPLLNVPPPGTIPDGARVHTVGSAEEIEQLQQQLEGKRGEEEDDEDEDEDEEHER
                     EEQGDDVIFNTLIMAVPFTFLYLMLDILVHLQYSHKAGWYLLGEHALKALPTNEYPTH
                     PLTNSFLMSASILSGCRLVWLVNKASWSVVTAQAPPMGTLWILTIVQLPLGRALLALM
                     FVGGWFWYADLKFAP"
     misc_feature    390742..390809
                     /note="CT-rich"
     gene            complement(391258..392655)
                     /locus_tag="CNL04950"
                     /db_xref="GeneID:3254946"
     mRNA            complement(join(391258..392224,392299..392545,
                     392594..392655))
                     /locus_tag="CNL04950"
                     /product="diphosphomevalonate decarboxylase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534365|gb|CF680206.1,gi|41534377|gb|CF680218.1"
                     /transcript_id="XM_568247.1"
                     /db_xref="GI:58261673"
                     /db_xref="GeneID:3254946"
     CDS             complement(join(391334..392224,392299..392545,
                     392594..392643))
                     /locus_tag="CNL04950"
                     /codon_start=1
                     /product="diphosphomevalonate decarboxylase"
                     /protein_id="XP_568247.1"
                     /db_xref="GI:58261674"
                     /db_xref="GeneID:3254946"
                     /translation="MVYEATASAPVNIACIKYWGKRDTRLILPTNSSLSVTLDQDHLR
                     STTTSRADASFEAGDKLWLNGKEEVIKEGGRLAVCIKELRGWRKEMESKDKDLPKLSE
                     WPLRIASYNNFPTAAGLASSASGLAALVASLASLYSLPQSPSQLSLVARQGSGSACRS
                     LFGGFVAWREGTDPAGSDSLAEEVAPREHWPEMHALICVVSDAKKGTSSTSGMQKTVE
                     TSTLLQERLRIVPKRMDAISQAIKARDFSEFAKLTMADSNSFHAVCLDTAPPIFYLND
                     VSRAIIAVVEELNRAAGEIIAAYTFDAGPNAVIYTLEKNMPVVLGAIKRFFPTGEEFE
                     DPFQTGVRDLPEGFNTGVVREGGWEKGAVKGLIHTRVGDGPRVLKKEESLLGENGVPK
                     VLA"
     gene            complement(393037..396224)
                     /locus_tag="CNL04960"
                     /db_xref="GeneID:3254914"
     mRNA            complement(join(393037..393334,393392..393741,
                     393794..394020,394069..394207,394260..394384,
                     394435..394686,394749..394947,395000..395215,
                     395264..395384,395433..395540,395593..395916,
                     395978..396224))
                     /locus_tag="CNL04960"
                     /product="membrane organization and biogenesis-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532393|gb|CF678234.1,gi|41532403|gb|CF678244.1,
                     gi|41532624|gb|CF678465.1,gi|41532629|gb|CF678470.1,
                     gi|41536989|gb|CF682830.1,gi|41537000|gb|CF682841.1,
                     gi|41537413|gb|CF683254.1,gi|41537419|gb|CF683260.1,
                     gi|41543015|gb|CF688856.1,gi|41543025|gb|CF688866.1,
                     gi|41550231|gb|CF696072.1,gi|41550241|gb|CF696082.1,
                     gi|41557102|gb|CF702943.1,gi|41557113|gb|CF702954.1,
                     gi|41570184|gb|CF716025.1,gi|41570191|gb|CF716032.1,
                     gi|41575448|gb|CF721289.1,gi|41575460|gb|CF721301.1"
                     /transcript_id="XM_568036.1"
                     /db_xref="GI:58261251"
                     /db_xref="GeneID:3254914"
     CDS             complement(join(393118..393334,393392..393741,
                     393794..394020,394069..394207,394260..394384,
                     394435..394686,394749..394947,395000..395215,
                     395264..395384,395433..395540,395593..395916,
                     395978..396189))
                     /locus_tag="CNL04960"
                     /codon_start=1
                     /product="membrane organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_568036.1"
                     /db_xref="GI:58261252"
                     /db_xref="GeneID:3254914"
                     /translation="MNQTPQIAQDLLKNPPQELQQLLNDPRTPDSARKAVQELQAPFV
                     GPGTAGNKDGAKESPRLQIVNENQEFTKELSPYLAKWDLLDKGFAYDVVAVFGSQSTG
                     KSTLLNRLFGTTFDVMDESKRQQTTKGIWMCPSQYSNTLVMDVEGTDGRERGEDQDFE
                     RKSALFSLASTEVLIVNLWEHQIGLYNGANMGLLKTVFEVNLGLFGGGGDNTKPKPQE
                     KTLILFVIRDHVGATPMSNLTATLTQDMERIWDSLSKPAHLEDAVLSSYFDLSFAALP
                     HKVLMPEKFEEAVLELRQRFTDRSREDYVFQPAYHKRIPADGVSFYMEGIWQQVLTNK
                     DLDLPTQQELLAQFRCDEISTVVFEAFLASAKIVRRPVEAGSVVEGLGALMRDWLETA
                     LGKFDRDASRYHSAVYQRKRLDLLASLHASLSPLFLGQLKNLHKIETAKFSKDIVAGV
                     KEPGYDFGVVVEEGKRRARERFLAGAKEVKVEETDWEYEHELALLDEDLKLIADKCRA
                     DETKKMVNAIERNVKRQILEPVEVAMSQPTKTMWDTVLKTYSDVIEAAEEAYLSKAKS
                     YNCSDEENSTALASLRARAWLALRRKLEEQTSDSTVLTTLRTKFEDSFRYDEAGVPRV
                     WRPEDDIEAAFRKAKDETLGLLPLFANIAPTEGSLLPELPPPEPSFDVESDPSPFDPS
                     TAFTLLTATKLLSLESRFKRDADAAYVEAKRSMVSSVAQIPVWMYGVLVVLGWNEAMA
                     VLFNPLYFAMLLVLAASGYIILQLGLAGPILQIASTVIREIRQMVVKKLREAFADVPE
                     AQRILAQPVTASSSDEQERKGDLIKGEMLEK"
     gene            <396479..>397673
                     /locus_tag="CNL04970"
                     /db_xref="GeneID:3254915"
     mRNA            join(<396479..396702,396760..396829,397218..>397673)
                     /locus_tag="CNL04970"
                     /product="hypothetical protein"
                     /transcript_id="XM_568223.1"
                     /db_xref="GI:58261625"
                     /db_xref="GeneID:3254915"
     CDS             join(396479..396702,396760..396829,397218..397673)
                     /locus_tag="CNL04970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568223.1"
                     /db_xref="GI:58261626"
                     /db_xref="GeneID:3254915"
                     /translation="MEQGDMKAASHSDHRREQSHAQPEAQRAAPTQHTTTASHDLRFI
                     DHYLDDEEAALGHVRGRFQSIVSRVEELFGFLYSATKPYTDKVVAVAEQNPILFTPQA
                     AILIPTLAITTILSTLTLSFLLGLFVIHRLYLHLSAATSDEWSLEAVGQGFKGWVEEV
                     GERVGLDGSETIVLKQSPDDDDGRAKIIDEKNDSSGGATSTTAASESEQAGHIEDEKA
                     NTRELNMVTSSTLEKTSQNHDNRRLRDAAST"
     gene            complement(397749..>399725)
                     /locus_tag="CNL04980"
                     /db_xref="GeneID:3254958"
     mRNA            complement(join(397749..398384,398434..399136,
                     399184..399357,399412..>399725))
                     /locus_tag="CNL04980"
                     /product="homoserine O-acetyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534487|gb|CF680328.1,gi|41534493|gb|CF680334.1,
                     gi|41546298|gb|CF692139.1,gi|41546308|gb|CF692149.1,
                     gi|41549822|gb|CF695663.1,gi|41549840|gb|CF695681.1,
                     gi|41553674|gb|CF699515.1,gi|41553690|gb|CF699531.1,
                     gi|41563523|gb|CF709364.1,gi|41563532|gb|CF709373.1,
                     gi|41568818|gb|CF714659.1,gi|41568825|gb|CF714666.1,
                     gi|41575875|gb|CF721716.1,gi|41575885|gb|CF721726.1"
                     /transcript_id="XM_568037.1"
                     /db_xref="GI:58261253"
                     /db_xref="GeneID:3254958"
     CDS             complement(join(397899..398384,398434..399136,
                     399184..399357,399412..399725))
                     /locus_tag="CNL04980"
                     /codon_start=1
                     /product="homoserine O-acetyltransferase"
                     /protein_id="XP_568037.1"
                     /db_xref="GI:58261254"
                     /db_xref="GeneID:3254958"
                     /translation="MGNLSLLFHRPAKPRIGSSPSHSSSLYISRMSDNAPTPQKIRDT
                     NPYASLISQQIAIIPSFTLESGVTLNNVPVAYKTWGKLNEKADNCLVICHALTGSADV
                     EDWWGPLLGLNKAFDPTRFFIFCGNVIGSPYGTISSVTTNPETGKPFGPEMPGSSVKD
                     DVRLHYIILKSLGVKSVAAVVGGSMGGMTVLEYPLNTPPGFVRAIIPLATSARHSAWC
                     ISWGEAQRQSIYSDPDYKDGYYYEIEEEGGKVDLARQPARGLAAARMAALLTYRSRDS
                     FESRFGRRAGGGKSSVPKGGVRIMGGQETTDPSVPSESDLAAKSPSWRAWREHNDGHR
                     SSGARPISRSGSEGPNRGEGDAAQAEVVKTQEVKANGNKIGTGGEAPPKIFSAQSYLR
                     YQGDKFTGRFDANCYIHITRKLDTHDLSAPSRDTSLSSLSSGLPSSADATEEELNARL
                     IHALSLEPPALVIGIESDGLFTTSEQRELAAGIPDAELVVIPSPDGHDGFLLEFEAIN
                     GWVEGWLKRKMPEFYEKRVIDPEDYVQGEEGFDIKKESVFGEAEADVTRW"
     gene            complement(<399911..>403010)
                     /locus_tag="CNL04990"
                     /db_xref="GeneID:3254746"
     mRNA            complement(join(<399911..402621,402683..>403010))
                     /locus_tag="CNL04990"
                     /product="hypothetical protein"
                     /transcript_id="XM_568038.1"
                     /db_xref="GI:58261255"
                     /db_xref="GeneID:3254746"
     CDS             complement(join(399911..402621,402683..403010))
                     /locus_tag="CNL04990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568038.1"
                     /db_xref="GI:58261256"
                     /db_xref="GeneID:3254746"
                     /translation="MLPTTRQAYSRRLTSVASITSLSASPALPAESSRQAFLRAIASR
                     PTHTDAAGLSRSGTRHQSTAPVSGSKGRSMSSGVAAAAWAIAEDDGTGRYSNQQSWGK
                     LAGPTGSDPIKPLSANKLKSFQADLDVHDDFSLHPLPKEPPSEWLDSWLQSYDPSQLP
                     PSPLPPLETFRGLIPSHPLLALLTLPKLPHADLLTIRHAEVRALIWGVTKVTRDIPKV
                     LLRINPEDCAKAIRVLRAIIYALPSCKNSSDPFMGRYLRGKILRNLLTLCYRLKCHRV
                     AKIIFQERLREQLATDSNPPILPFEGIAEDLAAAREWQVIVELFSPETFPHRYFTSEL
                     IAFYMQAHFGIHQSSKVPRIFELHDVLDLEPSVNAMNHLVQAFLHMGDLPTAKAIAKE
                     ANITGGVDYACQQLAILWGYRSLGRDKDLEIKVLDDIERLELPLEARLLHALIRLRLD
                     ANEISKAEELLKKFNLTEWGVEGGGHVTPTSKTASLLFMIASRKGDLKEVKRIWDKMC
                     TSSEVVDEEVVTNLLRALFEQGKSDDALAALQSALPDAPSTDSEWKLPHGVKPDIRAM
                     NFVLGALSRERGIPGLEIAMSLIHSFGIKPNNLTLKTIVDFSRSTLQHSPYDLATLVS
                     RIMESTPTLPPSQSLLDSILADAVSSSARTRNRDASSTKFFPSHNEDTFHPTAGLVLS
                     PPLYSALSAIIESLESIDSRSTSRSLANRLRYDAMTNTDISGVPSARIVWNALIARGF
                     NPDHRHIVALMQGYADAGHMYEVQDLLILASQIGISTTKDMLMVVLTGWGKKRKPRHA
                     RKAYERIRSLGGKEGEGLDLLAVTAMIQAYSFAGKYKEAAQLCYTDLQRLGVRLDEKA
                     VAVVAQALRSDGDLRGALRVMEANGKALGVTGRKITRGIKLYARKQLLKGLDKEQQQD
                     MNEVVQLAEQMIREDELARPTTLKKWNRLGGPTRGRLENAWSGVVSEGRNQEGVRGRR
                     ARTGKRAIVGRGRGIGFRALEARRERRRLVAERRKNGVAL"
     gene            403435..405468
                     /locus_tag="CNL05000"
                     /db_xref="GeneID:3254943"
     mRNA            join(403435..403540,403597..403723,403776..404018,
                     404065..404121,404177..404370,404424..404550,
                     404605..404934,404987..405132,405186..405468)
                     /locus_tag="CNL05000"
                     /product="nicotinate phosphoribosyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531475|gb|CF677316.1,gi|41531482|gb|CF677323.1,
                     gi|41533517|gb|CF679358.1,gi|41533982|gb|CF679823.1,
                     gi|41533996|gb|CF679837.1,gi|41536828|gb|CF682669.1,
                     gi|41537312|gb|CF683153.1,gi|41537318|gb|CF683159.1,
                     gi|41542394|gb|CF688235.1,gi|41542836|gb|CF688677.1,
                     gi|41549699|gb|CF695540.1,gi|41549710|gb|CF695551.1,
                     gi|41554255|gb|CF700096.1,gi|41554265|gb|CF700106.1,
                     gi|41554717|gb|CF700558.1,gi|41554727|gb|CF700568.1,
                     gi|41558994|gb|CF704835.1,gi|41559002|gb|CF704843.1,
                     gi|41566038|gb|CF711879.1,gi|41566046|gb|CF711887.1,
                     gi|41569247|gb|CF715088.1,gi|41569250|gb|CF715091.1,
                     gi|41569927|gb|CF715768.1,gi|41574195|gb|CF720036.1,
                     gi|41574200|gb|CF720041.1"
                     /transcript_id="XM_568039.1"
                     /db_xref="GI:58261257"
                     /db_xref="GeneID:3254943"
     CDS             join(403466..403540,403597..403723,403776..404018,
                     404065..404121,404177..404370,404424..404550,
                     404605..404934,404987..405132,405186..405248)
                     /locus_tag="CNL05000"
                     /codon_start=1
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="XP_568039.1"
                     /db_xref="GI:58261258"
                     /db_xref="GeneID:3254943"
                     /translation="MPDKLHLPIDDVQIPFSILDTDLYKLTMQNAVLHHFSDAHVVIK
                     FTNRSPQMLFSKECFDWVQQRVNDLSKLKLTSEERKELSKACPYFSESYLDYLSNMQL
                     DPVKQVKLTFIPQGSNEKGEKMGEIGCVIEGPWKDTMLYEVPVMAILSEGYFKFVDTD
                     WDYDGQFELAKKKALDLLNPPAPTTSLSFSEFGTRRRRSFKAQDIIMRGLIAGHEEYK
                     SKGGSQGILSGTSNVYLALKYGLNPVGTIAHEWIMAVGATYGYRGANGRAMDMWEEVY
                     PPGTKFSSPLTMLTDTYTAAIFFKDFISDPARALRWAVLRQDSGDAFKFVEDAKEAWR
                     TIEDKAGIKRDVGPNGEEEVAKGKKVIFSDGLDVEKAIKLQQGCDKAGMAASFGIGTD
                     LTNDFRKASDPSQKSKALNMVIKLNKINGKDCIKLSDDKGKHTGSLEEVRKAQQELGI
                     NKN"
     gene            407280..409825
                     /locus_tag="CNL05010"
                     /db_xref="GeneID:3254951"
     mRNA            join(407280..407577,407630..407682,407742..407776,
                     407813..407897,407951..408103,408153..408201,
                     408312..408374,408424..408503,408549..408616,
                     408668..408711,408796..408889,408942..409166,
                     409220..409335,409391..409442,409502..409825)
                     /locus_tag="CNL05010"
                     /product="GabA permease, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531393|gb|CF677234.1,gi|41542502|gb|CF688343.1,
                     gi|41554364|gb|CF700205.1,gi|41569960|gb|CF715801.1,
                     gi|41574989|gb|CF720830.1"
                     /transcript_id="XM_568040.1"
                     /db_xref="GI:58261259"
                     /db_xref="GeneID:3254951"
     CDS             join(407311..407577,407630..407682,407742..407776,
                     407813..407897,407951..408103,408153..408201,
                     408312..408374,408424..408503,408549..408616,
                     408668..408711,408796..408889,408942..409166,
                     409220..409335,409391..409442,409502..409674)
                     /locus_tag="CNL05010"
                     /codon_start=1
                     /product="GabA permease"
                     /protein_id="XP_568040.1"
                     /db_xref="GI:58261260"
                     /db_xref="GeneID:3254951"
                     /translation="MGVDESEKTTSVHQQPVNKVENPSTLTPGDRDGAAARLEEMGYK
                     QELTRNLGMISVLGLSFAIMAVPFGTSTTLNIALTDGGPVTILYGWIFVSLVSLCIAS
                     SLAEICSVFPTSGGVYYWSAMLSTKKYSSFASYLTGWLGTVGNWTVTASITFGGSQLI
                     LAAATLYHEDYVPTAWQTCVVYWAALLVSLLINIFFHKYLDKLNTVCLWWTGSSIIVT
                     LLAMADTRNSGKFAFSHFDAQHSGWPAGWAWFVGLLQGAYTLTGYGMVASLCEEVKEP
                     AREVPRAMVLSVAAAAVTGLVYLPLLAVASLQPMPLLYKEVTGSAGAALGLLFLILGV
                     WVFAAIGSLTAASRCTWAFSRDGGIPASGWWKKVDQRFGIPVNSLILSAIVCALLGLI
                     YLGSSAAFNAFTGVATICLGCSYAFPVLCSLLRRREAVRNASYSLGKFGYAVNIITVV
                     WITFSIILFCMPTAIPVTAESMNYASVVFAGFSFIAALWYVVNARKHYHGPTLSTVRI
                     SDTTEIVEEY"
     gene            complement(<409953..>410946)
                     /locus_tag="CNL05020"
                     /db_xref="GeneID:3254744"
     mRNA            complement(join(<409953..409981,410035..410152,
                     410211..410476,410536..410731,410791..>410946))
                     /locus_tag="CNL05020"
                     /product="hypothetical protein"
                     /transcript_id="XM_568041.1"
                     /db_xref="GI:58261261"
                     /db_xref="GeneID:3254744"
     CDS             complement(join(409953..409981,410035..410152,
                     410211..410476,410536..410731,410791..410946))
                     /locus_tag="CNL05020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568041.1"
                     /db_xref="GI:58261262"
                     /db_xref="GeneID:3254744"
                     /translation="MSRGGWRGGRGGGRGGMPPGVGFGYGQISQTEWKEGINRIKAQS
                     QTNGTLYPPLDNISISYLTGPTDHETLVLSHAISLNITLSTGKLPEGEEGVQLVQSGQ
                     VPPWRITGERKVVGIEIESYSDRFNPPASSEPSKLDPVALRMDQSMFPPSLWAAYFDG
                     QTDKLKGSEYREHITCLDIPLTILSGPKKRRKLDDLDQEGDDKVEEESEISEEEDFDF
                     DDDESDHQDYDANYFDNGEGDDDEGGDDEGGDVYED"
     gene            complement(411199..413720)
                     /locus_tag="CNL05030"
                     /db_xref="GeneID:3254960"
     mRNA            complement(join(411199..411467,411528..411742,
                     411794..411967,412018..412167,412226..412302,
                     412351..412462,412526..412685,412746..412935,
                     412998..413113,413173..413259,413320..413349,
                     413456..413561,413622..413720))
                     /locus_tag="CNL05030"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536249|gb|CF682090.1,gi|41536254|gb|CF682095.1,
                     gi|41545168|gb|CF691009.1,gi|41545180|gb|CF691021.1,
                     gi|41549594|gb|CF695435.1,gi|41550647|gb|CF696488.1,
                     gi|41550655|gb|CF696496.1,gi|41551544|gb|CF697385.1,
                     gi|41551551|gb|CF697392.1,gi|41555369|gb|CF701210.1,
                     gi|41555375|gb|CF701216.1,gi|41566374|gb|CF712215.1,
                     gi|41566380|gb|CF712221.1,gi|41567578|gb|CF713419.1,
                     gi|41567582|gb|CF713423.1,gi|41575297|gb|CF721138.1,
                     gi|41575306|gb|CF721147.1"
                     /transcript_id="XM_568042.1"
                     /db_xref="GI:58261263"
                     /db_xref="GeneID:3254960"
     CDS             complement(join(411359..411467,411528..411742,
                     411794..411967,412018..412167,412226..412302,
                     412351..412462,412526..412685,412746..412935,
                     412998..413113,413173..413259,413320..413349,
                     413456..413561,413622..413676))
                     /locus_tag="CNL05030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568042.1"
                     /db_xref="GI:58261264"
                     /db_xref="GeneID:3254960"
                     /translation="MSTISLDKIPDVPTDDDATVKQFTDETGAPASLPEIGSGGEESK
                     LKVLMGLMRKLMGVKDVANLRLSLPASLLEPIPNLEYWQYADRADILAAVGDSDNELE
                     RMLAVLRFSFSKELKFIRSRLGKPYNSALGEHFRCSWRLPPLLIDNETKEPVVRTHIH
                     VPLPGEPLYGGQGGSGWITPVLRPEDGGKPNSEASSIISSSSKTSKKQPVKALSPESV
                     DRVVPGPGKEVEADPDAGVLESEKVTVVFLCEQVSHHPPISAAYYYCPEKGIEAYCMD
                     QIAAKVSGMSVKLGPGSSNKGIFVKIARDGPGQNEEYQITHPAAAVNGILKGSYYGTI
                     SDVVQVICRGGEKTTTKLKALLDYKEESWLGKPKFLVDGIIYRYTVGNEEEEGWTKAK
                     QVPADKILGYLEGCWMKQIRYKLKGQKEWKVLLDLDQLALIPKDVRPLHEQDEHESRK
                     LWESVTENLISKNWGEATKSKQTIEQRQRDKAAERKTKGETHQARYFQPDYEDGRPKL
                     TNEGQKALEDEIQRCRGQ"
     gene            414126..416708
                     /locus_tag="CNL05040"
                     /db_xref="GeneID:3254725"
     mRNA            join(414126..414464,414518..414859,414913..415005,
                     415064..415073,415127..415200,415264..415565,
                     415630..415713,415769..415902,415961..416162,
                     416236..416253,416316..416708)
                     /locus_tag="CNL05040"
                     /product="beta DNA polymerase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41571207|gb|CF717048.1,gi|41571213|gb|CF717054.1"
                     /transcript_id="XM_568043.1"
                     /db_xref="GI:58261265"
                     /db_xref="GeneID:3254725"
     CDS             join(414189..414464,414518..414859,414913..415005,
                     415064..415073,415127..415200,415264..415565,
                     415630..415713,415769..415902,415961..416162,
                     416236..416253,416316..416451)
                     /locus_tag="CNL05040"
                     /codon_start=1
                     /product="beta DNA polymerase"
                     /protein_id="XP_568043.1"
                     /db_xref="GI:58261266"
                     /db_xref="GeneID:3254725"
                     /translation="MPSRPPVHPYTSSSTSTGVHGHHNAAPHQLYKLFANLTFHIVPA
                     KLEDDLARIYECIDELGGKCVGPEDAWVIVTALKGRQRLSRSLDQKWMETKQIVYVSY
                     IFDTYQACLEHAVSPKTSTPKLPLRKNYLHVLSKEQSPIKISCRLDPGDPSISQPSTK
                     RRKVNDGYVTAYRDDMTLLKEDVPLEGIPASCAQRPCPLVCINQDIVDAIKPIFEERE
                     FEEAQQKNSNVLSYRRSLSMLKSVPRRITSGKEALSLQGVGEKVATRIDEFLQTGEIA
                     ESQEILASSRFNALQNFASVYTIGHFRAKELYERHHCRTLDDVKRHFADMEKDGEAKQ
                     GRGKDKRRMRGGMKEHEIVEEWMKLKNELDQKKEVEEIAACVLDNLEAFIPGCEYTIC
                     GGYRRGKAQSSDVDIVFRPPKDDQDIGLLRALYLRLSELGIVTHVLQVTHRDSNQPIR
                     AAAQNFDNLDKAFVIFKLPGEGRLHRRVDLISAPRDRYASAVLSWTGSMMFERDLKRY
                     AENEKGHKFRAGLIKIATGEEINLETEREIFDYLGLRYIPPELRNADG"
     gene            417613..419997
                     /locus_tag="CNL05050"
                     /db_xref="GeneID:3254968"
     mRNA            join(417613..417758,417818..417939,418058..418158,
                     418209..418578,418637..418716,418778..418841,
                     418903..419156,419215..419596,419712..419997)
                     /locus_tag="CNL05050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568047.1"
                     /db_xref="GI:58261273"
                     /db_xref="GeneID:3254968"
     mRNA            join(417613..417758,417818..417925,417989..417999,
                     418058..418158,418209..418578,418637..418716,
                     418778..418841,418903..419156,419215..419997)
                     /locus_tag="CNL05050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568045.1"
                     /db_xref="GI:58261269"
                     /db_xref="GeneID:3254968"
     mRNA            join(417613..417758,417818..417925,417989..417999,
                     418058..418158,418209..418578,418637..418716,
                     418778..418841,418903..419156,419215..419596,
                     419712..419997)
                     /locus_tag="CNL05050"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534239|gb|CF680080.1,gi|41537212|gb|CF683053.1,
                     gi|41538937|gb|CF684778.1,gi|41538961|gb|CF684802.1,
                     gi|41540160|gb|CF686001.1,gi|41540169|gb|CF686010.1,
                     gi|41541168|gb|CF687009.1,gi|41541758|gb|CF687599.1,
                     gi|41541765|gb|CF687606.1,gi|41546813|gb|CF692654.1,
                     gi|41546827|gb|CF692668.1,gi|41549792|gb|CF695633.1,
                     gi|41549797|gb|CF695638.1,gi|41549992|gb|CF695833.1,
                     gi|41554127|gb|CF699968.1,gi|41559521|gb|CF705362.1,
                     gi|41565206|gb|CF711047.1,gi|41565211|gb|CF711052.1,
                     gi|41567691|gb|CF713532.1,gi|41567697|gb|CF713538.1,
                     gi|41568916|gb|CF714757.1,gi|41568922|gb|CF714763.1,
                     gi|41571082|gb|CF716923.1,gi|41571089|gb|CF716930.1,
                     gi|41572106|gb|CF717947.1"
                     /transcript_id="XM_568044.1"
                     /db_xref="GI:58261267"
                     /db_xref="GeneID:3254968"
     mRNA            join(417613..417758,417818..417925,417989..417999,
                     418058..418158,418209..418578,418637..418716,
                     418778..418841,418903..419156,419215..419554,
                     419712..419997)
                     /locus_tag="CNL05050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568046.1"
                     /db_xref="GI:58261271"
                     /db_xref="GeneID:3254968"
     CDS             join(417716..417758,417818..417939,418058..418158,
                     418209..418578,418637..418716,418778..418841,
                     418903..419156,419215..419551)
                     /locus_tag="CNL05050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568047.1"
                     /db_xref="GI:58261274"
                     /db_xref="GeneID:3254968"
                     /translation="MTYTENTNVVIVGAGIFGMSTALWMLETGKYSVTLLDKSEVLPA
                     PDAASTGEPCLIIRAADYKDPLIAALALDAVEHWRKPEWEGTYHECGVVALSATHEKE
                     GMEFIDCAYKNCRDLGLDVTLLPDATAIKPVVDRNNAFPTGSFGGRQGYINPIGGWGE
                     AGRAVEVGLTRAKKLGAIVRAGSEVIGLIKDGKNVKGVELKSGEKIFCDLVVVAAGAW
                     TPKLFASPAFAARLPPIVATGQSVAILQLTPEESKKYAKVPVVFNLDDGWYIFPPNPT
                     GLMKMAIHSAGYINPVEEINNVSVPRTKLTPGAEDGAIPKVMLQALRKGLSEVYPDLA
                     KKDYAMTRLCWYCDTVTGDWLIDYHPDYNNLFLATGGSGHAFKFASNIGREILRLIER
                     DSSSEFKVRFSFNPPKEMVEPPSEKGDVSAERTQVTDTGADVRSGMRKLLVIDELIRP
                     EDLKAY"
     CDS             join(417716..417758,417818..417925,417989..417999,
                     418058..418158,418209..418578,418637..418716,
                     418778..418841,418903..419156,419215..419551)
                     /locus_tag="CNL05050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568044.1"
                     /db_xref="GI:58261268"
                     /db_xref="GeneID:3254968"
                     /translation="MTYTENTNVVIVGAGIFGMSTALWMLETGKYSVTLLDKSEVLPA
                     PDAASTDINKIIRAADYKDPLIAALALDAVEHWRKPEWEGTYHECGVVALSATHEKEG
                     MEFIDCAYKNCRDLGLDVTLLPDATAIKPVVDRNNAFPTGSFGGRQGYINPIGGWGEA
                     GRAVEVGLTRAKKLGAIVRAGSEVIGLIKDGKNVKGVELKSGEKIFCDLVVVAAGAWT
                     PKLFASPAFAARLPPIVATGQSVAILQLTPEESKKYAKVPVVFNLDDGWYIFPPNPTG
                     LMKMAIHSAGYINPVEEINNVSVPRTKLTPGAEDGAIPKVMLQALRKGLSEVYPDLAK
                     KDYAMTRLCWYCDTVTGDWLIDYHPDYNNLFLATGGSGHAFKFASNIGREILRLIERD
                     SSSEFKVRFSFNPPKEMVEPPSEKGDVSAERTQVTDTGADVRSGMRKLLVIDELIRPE
                     DLKAY"
     gene            complement(<419988..>420396)
                     /locus_tag="CNL05060"
                     /db_xref="GeneID:3254778"
     mRNA            complement(join(<419988..420110,420170..420264,
                     420372..>420396))
                     /locus_tag="CNL05060"
                     /product="hypothetical protein"
                     /transcript_id="XM_568048.1"
                     /db_xref="GI:58261275"
                     /db_xref="GeneID:3254778"
     CDS             complement(join(419988..420110,420170..420264,
                     420372..420396))
                     /locus_tag="CNL05060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568048.1"
                     /db_xref="GI:58261276"
                     /db_xref="GeneID:3254778"
                     /translation="MVKNLVLPSFGVTHVSSPEDWSIMPVEFLRVYLKPSGFFDCNPG
                     LDVPSAEDKESRNADEALANDVEGVHIGKEKIIIPN"
     gene            complement(421812..423958)
                     /locus_tag="CNL05070"
                     /db_xref="GeneID:3254745"
     mRNA            complement(join(421812..421928,421991..422289,
                     422341..422511,422563..422673,422723..423131,
                     423178..423339,423390..423422,423472..423532,
                     423583..423767,423816..423958))
                     /locus_tag="CNL05070"
                     /product="Aldehyde dehydrogenase (ALDDH), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41558773|gb|CF704614.1,gi|41558781|gb|CF704622.1,
                     gi|41575560|gb|CF721401.1,gi|41575564|gb|CF721405.1"
                     /transcript_id="XM_568049.1"
                     /db_xref="GI:58261277"
                     /db_xref="GeneID:3254745"
     CDS             complement(join(421913..421928,421991..422289,
                     422341..422511,422563..422673,422723..423131,
                     423178..423339,423390..423422,423472..423532,
                     423583..423767,423816..423943))
                     /locus_tag="CNL05070"
                     /EC_number="1.2.1.3"
                     /codon_start=1
                     /product="Aldehyde dehydrogenase (ALDDH)"
                     /protein_id="XP_568049.1"
                     /db_xref="GI:58261278"
                     /db_xref="GeneID:3254745"
                     /translation="MRRTITLRHLLPLGIRSKHIMPTHAKLNVPSLGEVEVPVGLFIN
                     NEWVESTSRETFSTVNPATGQKLLDFAHAKKEDIDKAVIAARKAFKTTWGNNVLAAER
                     GVLLNKLADLMERDSDKLAALESINSGKGIRIAREADVADSVACIRYYAGLADKIHGQ
                     TVSSFGKEKFVYTLHQPIGVCGQIIPWNYPIMMWAWKIAPALAAGCTVVMKPSELTPL
                     SALALCDLVKEAGIPAGVINTVPGHGATAGDAISRHMDIDKVAFTGSVSTGRRISIAA
                     AESNLKKVTLELGGKSPVIVFDSADVEEAADWAALAIWFNSGQDCCAGSRLYVQEGIF
                     DKFLAAMKKRAEACAIGQPHDEKTSFGPLISEGQRDKVLNYIVSGKEQGARVVTGGQK
                     WPESNDGYWIEPTILADTTPDMTIVKEEIFGPVVVAAPFKTEEEVLEVANDTSYGLAA
                     AVFTNDTRQATRVSAALDAGTVWINQYALLHPGVPFGGFKQSGIGRELGTYGLEAYMQ
                     IKAVHNNLTQTSPWPV"
     gene            424320..427233
                     /locus_tag="CNL05080"
                     /db_xref="GeneID:3255009"
     mRNA            join(424320..424520,424578..424588,424640..424750,
                     424813..425083,425134..425490,425544..426035,
                     426086..426311,426362..426496,426548..427233)
                     /locus_tag="CNL05080"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530975|gb|CF676816.1,gi|41545418|gb|CF691259.1,
                     gi|41545429|gb|CF691270.1,gi|41549336|gb|CF695177.1,
                     gi|41549342|gb|CF695183.1,gi|41550081|gb|CF695922.1,
                     gi|41550091|gb|CF695932.1,gi|41557763|gb|CF703604.1,
                     gi|41557770|gb|CF703611.1,gi|41560312|gb|CF706153.1,
                     gi|41560321|gb|CF706162.1,gi|41573404|gb|CF719245.1,
                     gi|41573415|gb|CF719256.1"
                     /transcript_id="XM_568224.1"
                     /db_xref="GI:58261627"
                     /db_xref="GeneID:3255009"
     CDS             join(424461..424520,424578..424588,424640..424750,
                     424813..425083,425134..425490,425544..426035,
                     426086..426311,426362..426496,426548..427143)
                     /locus_tag="CNL05080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568224.1"
                     /db_xref="GI:58261628"
                     /db_xref="GeneID:3255009"
                     /translation="MAEGDASQNTSRKRSSRACDSCKIRRSKCEDIKEISGVGPTCKA
                     CREENQECLYTLPVRKRGPARGFKNHINQSSQNVEGSQQSQAQHSGFSGSSVYYGQDQ
                     AIRRNSGSHSPVADSSNRPHILLRQVEPFFGIPTNMVDRLLAVYFTHVHNVWPLICKP
                     VFNPHHTSAHLLLSMLAVAVCVAPEGAADGFNSETLFVMAERALLQRRMEIRVDIIQS
                     FVLMSLRQTGCGDKKSAAVYANRASTMAFIMGLHLDPGTPPAGSGHAKTALTYEHDTR
                     ARVYWNCYVLDKVIAEETGRPFILPYRRSSIPFPSINEVDELEAWPPLPMSSAPLPQS
                     VRHVNPKRGYVMSCFVWTCRMAMLVEEILDLEMEGPNLQGSSEWWDRQFSEEAGQRRH
                     LGQERERIARQLTLWKQSLPSWLDVDTKSEASPLPHHVVGVTWYHTSRILLYSRFLRR
                     HPVASSPTTGEDDTRAFHAICSDAAQAVVDLLSMLDKHRLLQHVSSDIIHLLSLTTLF
                     EAYDSVSSDPALANRAKINFSQCCLWLREFSSSWASASAHRVFFEGLIRGGLHLSSPE
                     DDQRGTKDQNAGQIEPPPSIEDGLRAVRQQFTSNGPQQAYAIPTLMENPTDLAPVNLF
                     QLPQYYWNHLSVNESDANQFPDHPTPERNSTNLQFVQSSEPSHLPATSPITQLNHLPS
                     DPAASVSANKNMRARWDSRLSGETRPTDIESLKDDHVEGEHFVNPMSGVDQNAIYSAL
                     MTYMVDAIKGGS"
     gene            <427302..430359
                     /locus_tag="CNL05090"
                     /db_xref="GeneID:3255002"
     mRNA            join(<427302..427614,427666..427681,427749..427785,
                     427846..427918,427988..428060,428116..428361,
                     428903..429046,429242..429348,429551..429681,
                     429733..429855,429900..429931,429988..430058,
                     430106..430359)
                     /locus_tag="CNL05090"
                     /product="expressed protein"
                     /transcript_id="XM_568225.1"
                     /db_xref="GI:58261629"
                     /db_xref="GeneID:3255002"
     CDS             join(427302..427614,427666..427681,427749..427785,
                     427846..427918,427988..428060,428116..428361,
                     428903..429046,429242..429348,429551..429681,
                     429733..429855,429900..429931,429988..430058,
                     430106..430224)
                     /locus_tag="CNL05090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568225.1"
                     /db_xref="GI:58261630"
                     /db_xref="GeneID:3255002"
                     /translation="MTYCGDVQPSSIRSRLCTCNTYSQWSERGSTLMATELRHARFGF
                     YLLGGRWPISRRCVGQRRATKRWLLYFVGRKHFCQCIQSSPLFTTDIIMRSNHAQYRF
                     DKRPPLTKGSACSECKARKVRCPAEKPACSNCVRHSKTCHYPPSRSNIGRTVDGDRST
                     QSLRALDPPRAVTHPYSPRQRASQSQTPGPDPPRQELHQTTSNLAFFHQPSLGERNQP
                     MPSHLDEVDLSWLLSIPDPRATDVPDMDATAQEHWIVLSAGFEHISSSTDLGGPRREL
                     LLRTRNPICLPARDYIEIADRIYALTRLIRLPRIHRRRTCMSRTYLRRPLHKKTIILE
                     LISNSSSSTFDLNSVVERFASSLPKELKSFEPATSDPLKAATVFMMQTILSATRMYLA
                     DTNDYESPNDAALYQARRIVDLMRITNANGALPPSLSLFILWTLACKILIREVKRLTQ
                     LGENIATIPLDADIDQLFQTFSVAAQKAPLVSVDRLRKLMCFDL"
     gene            complement(430547..431802)
                     /locus_tag="CNL05100"
                     /db_xref="GeneID:3254999"
     mRNA            complement(join(430547..430710,430766..431214,
                     431276..431445,431508..431525,431586..431648,
                     431721..431802))
                     /locus_tag="CNL05100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568227.1"
                     /db_xref="GI:58261633"
                     /db_xref="GeneID:3254999"
     CDS             complement(join(430627..430710,430766..431214,
                     431276..431445,431508..431525,431586..431648,
                     431721..431797))
                     /locus_tag="CNL05100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568227.1"
                     /db_xref="GI:58261634"
                     /db_xref="GeneID:3254999"
                     /translation="MSASSIQWDPSNGGQWTTDSNGFIMQIVCLIIGPTFFSAANYII
                     LGRVVRRTGSNYSSITPSSFSVMFTITDFFCLLVQCAGGGLVGTADTDSGMQNGLYVM
                     AAGVLAQLAVTLAYIFMLSEFIYRHARSKKASRQYDLLAWAKICCCCCSKRKRQSVDS
                     SHRMDDANKTEAGFTASNEGEQEGEDRKFVNLVLCTLIVATVLIVVRYVLCQFALETL
                     LHLFFTRRSVYRCIEMLNFQPNHPGAYGDQTLFLVLDSAFMLALLIVYALIHPGWILA
                     RTLGLSRPVV"
     gene            complement(435516..436354)
                     /locus_tag="CNL05110"
                     /db_xref="GeneID:3254921"
     mRNA            complement(join(435516..436023,436084..436354))
                     /locus_tag="CNL05110"
                     /product="expressed protein"
                     /transcript_id="XM_568050.1"
                     /db_xref="GI:58261279"
                     /db_xref="GeneID:3254921"
     CDS             complement(join(435540..436023,436084..436340))
                     /locus_tag="CNL05110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568050.1"
                     /db_xref="GI:58261280"
                     /db_xref="GeneID:3254921"
                     /translation="MTGPKPNPTNTLPQAYKIVHQILSSAKSGLHTKDIVKQGVALYA
                     DQLPPQAFEIEEPVDERKHKGKKKHIPEPKLVPPGHPFISTNFLKHHVLPTLQSQNLI
                     YKHAVPLEDSESAPSTSTKRGQARRQFVWSLRELPDVESQSTSWSYSEHWQRLLSGAH
                     PKDVGSEHKHFMEQLKKDQRRQAVESGAERRTEEEIRAWEDRKVGVTTEKERGHLNKR
                     RELKRPQKEWKRYGRWEQLFRDQGTATV"
     gene            <436529..437342
                     /locus_tag="CNL05120"
                     /db_xref="GeneID:3254793"
     mRNA            join(<436529..436573,436612..436976,437027..437122,
                     437226..437342)
                     /locus_tag="CNL05120"
                     /product="30s ribosomal protein s13, putative"
                     /transcript_id="XM_568051.1"
                     /db_xref="GI:58261281"
                     /db_xref="GeneID:3254793"
     CDS             join(436529..436573,436612..436976,437027..437122,
                     437226..437304)
                     /locus_tag="CNL05120"
                     /codon_start=1
                     /product="30s ribosomal protein s13"
                     /protein_id="XP_568051.1"
                     /db_xref="GI:58261282"
                     /db_xref="GeneID:3254793"
                     /translation="MHLLGHNLPDHKPLKIALLTFYGISHALSARLLPRLGIHSEATV
                     AQLTEPQVTALSAYLSSPSTTARPSEQQIELAPPGGKVLKPVGHPAIFGELNKGKGKG
                     QEDPLDDLKIETEKRRAMQADIAHLRMVGTYRGRRHAAGYPVHGQRTQTNAKSAKKHN
                     RVERRNFGTQTFTRFTPTDLPQPPTVLSLLGRRQ"
     gene            437810..439682
                     /locus_tag="CNL05130"
                     /db_xref="GeneID:3254856"
     mRNA            join(437810..438872,438948..439184,439241..439682)
                     /locus_tag="CNL05130"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550392|gb|CF696233.1,gi|41566469|gb|CF712310.1"
                     /transcript_id="XM_568052.1"
                     /db_xref="GI:58261283"
                     /db_xref="GeneID:3254856"
     CDS             join(437854..438872,438948..439184,439241..439265)
                     /locus_tag="CNL05130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568052.1"
                     /db_xref="GI:58261284"
                     /db_xref="GeneID:3254856"
                     /translation="MSCAHCHLHRPAPLIDIQTLEPLPAEVRNRIFVLYLEDPVDRLC
                     APHLIDFLLISRRMYQAHAWRLYEIIMINDKNCKTFFNGLYDLRARTKKKEVVDVLHN
                     WSPIPYQTSDYNSERNIPVTLPHIIRKFRLLRHCRCLGFETHTAYLQFVDILGKLYKY
                     VDKHIKGIHDLHDWAECDFFPGMTEVSFGRQFMEQYFETKSTDLTEKADSLNFRPRTR
                     LWESMHVKHVCLFMPEWRADIPMWPNYGFISDPYLAYRFRTAALLEYIGFLGPEGGPE
                     GSSCNLHNAHMEVLKSGWEADEVTFDLAPEELEDLEDRGESHLDEILEYSIFLFSQYL
                     VNERKASSEQQPYRIRFTNYGTCYLSSDKRLRKLKRDEEGMDLMDYANEELQSVLDSC
                     DFYEGQSVKVKGNTGGCRVCIQITKNKRTIALNV"
     gene            complement(439758..443289)
                     /locus_tag="CNL05140"
                     /db_xref="GeneID:3254891"
     mRNA            complement(join(439758..440830,440878..440972,
                     441021..441573,441622..441756,441807..442079,
                     443126..443289))
                     /locus_tag="CNL05140"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531118|gb|CF676959.1,gi|41537578|gb|CF683419.1,
                     gi|41540278|gb|CF686119.1,gi|41542112|gb|CF687953.1,
                     gi|41546435|gb|CF692276.1,gi|41548523|gb|CF694364.1,
                     gi|41549301|gb|CF695142.1,gi|41552482|gb|CF698323.1,
                     gi|41561733|gb|CF707574.1,gi|41564094|gb|CF709935.1,
                     gi|41567683|gb|CF713524.1,gi|41567916|gb|CF713757.1,
                     gi|41574074|gb|CF719915.1,gi|41576208|gb|CF722049.1"
                     /transcript_id="XM_568053.1"
                     /db_xref="GI:58261285"
                     /db_xref="GeneID:3254891"
     mRNA            complement(join(439758..440830,440878..440972,
                     441021..441573,441622..441756,441807..442805))
                     /locus_tag="CNL05140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568054.1"
                     /db_xref="GI:58261287"
                     /db_xref="GeneID:3254891"
     CDS             complement(join(439907..440830,440878..440972,
                     441021..441573,441622..441756,441807..442079,
                     443126..443260))
                     /locus_tag="CNL05140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568053.1"
                     /db_xref="GI:58261286"
                     /db_xref="GeneID:3254891"
                     /translation="MSRIPVPHGGFHHTLPHSPQPTRTDSMSTSSPASDTRRKQSKRD
                     ESLRKKIESELSRKRPGSNATQQSNGGKRSSKRPQKGTVAGLRPSPALTVPEGMSVAD
                     ASQLCAAKRADCVLVVDEEEGLSGIFTAKDLAFRVTAEGLDPRSTSVAQIMTKNPMVT
                     RDTTNATEALQLMVSRGFRHLPVCNEDGDVVGLLDITKVFHEALAKVERGSTATSQLS
                     AALAGVQSELGPGLNHNPQAAAMLAYVETLRERMALPDLTTVIDTRSAPPTVTPRTTV
                     REAARLMKERRTTAVCVMEANAGTSAVSGVSGGNVVPKIAGIFTSKDIVLRVIAAGLD
                     ASRCSVVRVMTPHPDTAPPTMVVQDALKKMHNGHYLNLPVVEADGRLIGIVDVLKLTY
                     ATLEQIESMNEDRSNESGPMWSRFFEGLPGAGGDDDTASIVSASERPDTPSRSHLGHG
                     RGLSSMTSPISEIMPNDSASVVDDNISDLGGKHGPTSSVAAPGLPIDDGTYIFKFRTP
                     SGRTHRFQARHDSYELLRDIVAGKLLTDPFFTAPGAKEGEAVHLPDPSNFTLHYTDDE
                     GDLVTMTADSDVADAVRIARGQKSDRIVLLVDGGKVWEEAARDLGGEKAVEKLKEVEQ
                     EVKVVEEEEKQMAEPTANPAVEPTYGNEHVHAQKWKDHGKTIRADGQELVGGVIPKDM
                     VLPAAIGFLGVVILGVFIAGRK"
     CDS             complement(join(439907..440830,440878..440972,
                     441021..441573,441622..441756,441807..442595))
                     /locus_tag="CNL05140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568054.1"
                     /db_xref="GI:58261288"
                     /db_xref="GeneID:3254891"
                     /translation="MPSSSTTTTTGCDVPPQHIMTSQKPLDTPPASLHSSDSSSSSSN
                     HAVENAVHAVNPIPAAQSAATTTTLPTNSPSKLPHSFSFSLNRKSKKSTKSYKTSAGP
                     PVPFPAPSAPTRSHVASEPSSTLNSSTVTDGTATATPSNADDETRPRYHSAISHSTIS
                     RSQSSSFAGKLQSLRKKIESELSRKRPGSNATQQSNGGKRSSKRPQKGTVAGLRPSPA
                     LTVPEGMSVADASQLCAAKRADCVLVVDEEEGLSGIFTAKDLAFRVTAEGLDPRSTSV
                     AQIMTKNPMVTRDTTNATEALQLMVSRGFRHLPVCNEDGDVVGLLDITKVFHEALAKV
                     ERGSTATSQLSAALAGVQSELGPGLNHNPQAAAMLAYVETLRERMALPDLTTVIDTRS
                     APPTVTPRTTVREAARLMKERRTTAVCVMEANAGTSAVSGVSGGNVVPKIAGIFTSKD
                     IVLRVIAAGLDASRCSVVRVMTPHPDTAPPTMVVQDALKKMHNGHYLNLPVVEADGRL
                     IGIVDVLKLTYATLEQIESMNEDRSNESGPMWSRFFEGLPGAGGDDDTASIVSASERP
                     DTPSRSHLGHGRGLSSMTSPISEIMPNDSASVVDDNISDLGGKHGPTSSVAAPGLPID
                     DGTYIFKFRTPSGRTHRFQARHDSYELLRDIVAGKLLTDPFFTAPGAKEGEAVHLPDP
                     SNFTLHYTDDEGDLVTMTADSDVADAVRIARGQKSDRIVLLVDGGKVWEEAARDLGGE
                     KAVEKLKEVEQEVKVVEEEEKQMAEPTANPAVEPTYGNEHVHAQKWKDHGKTIRADGQ
                     ELVGGVIPKDMVLPAAIGFLGVVILGVFIAGRK"
     misc_feature    442819..442907
                     /note="GA-rich"
     gene            <443446..>444034
                     /locus_tag="CNL05150"
                     /db_xref="GeneID:3254978"
     mRNA            join(<443446..443541,443713..443939,443989..>444034)
                     /locus_tag="CNL05150"
                     /product="Gim complex component GIM3, putative"
                     /transcript_id="XM_568055.1"
                     /db_xref="GI:58261289"
                     /db_xref="GeneID:3254978"
     CDS             join(443446..443541,443713..443939,443989..444034)
                     /locus_tag="CNL05150"
                     /codon_start=1
                     /product="Gim complex component GIM3"
                     /protein_id="XP_568055.1"
                     /db_xref="GI:58261290"
                     /db_xref="GeneID:3254978"
                     /translation="MSLVSAYFSTRTRLIAPSYHPRKKVTESKLPGEEKEYYDDLSTE
                     LELADEDDPQPVMYKIGEAFFYLPLRDARRQLKGDLKKYEKEIEGLESKAEECEKGMK
                     ELKVLLYAKFGKQINLETTS"
     gene            445817..448246
                     /locus_tag="CNL05160"
                     /db_xref="GeneID:3254877"
     mRNA            join(445817..446139,446205..446265,446468..446593,
                     446642..447010,447060..447268,447328..447867,
                     447919..448246)
                     /locus_tag="CNL05160"
                     /product="Eukaryotic translation initiation factor 3
                     subunit 6, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529863|gb|CF675704.1,gi|41529872|gb|CF675713.1,
                     gi|41530640|gb|CF676481.1,gi|41533341|gb|CF679182.1,
                     gi|41533354|gb|CF679195.1,gi|41537734|gb|CF683575.1,
                     gi|41537745|gb|CF683586.1,gi|41541873|gb|CF687714.1,
                     gi|41542552|gb|CF688393.1,gi|41542557|gb|CF688398.1,
                     gi|41542674|gb|CF688515.1,gi|41555888|gb|CF701729.1,
                     gi|41555895|gb|CF701736.1,gi|41559209|gb|CF705050.1,
                     gi|41560452|gb|CF706293.1,gi|41561708|gb|CF707549.1,
                     gi|41561723|gb|CF707564.1,gi|41564060|gb|CF709901.1,
                     gi|41564069|gb|CF709910.1,gi|41569930|gb|CF715771.1,
                     gi|41570411|gb|CF716252.1,gi|41570427|gb|CF716268.1,
                     gi|41570470|gb|CF716311.1,gi|41573547|gb|CF719388.1,
                     gi|41573559|gb|CF719400.1"
                     /transcript_id="XM_568056.1"
                     /db_xref="GI:58261291"
                     /db_xref="GeneID:3254877"
     CDS             join(445831..446139,446205..446265,446468..446593,
                     446642..447010,447060..447268,447328..447867,
                     447919..448200)
                     /locus_tag="CNL05160"
                     /codon_start=1
                     /product="Eukaryotic translation initiation factor 3
                     subunit 6, putative"
                     /protein_id="XP_568056.1"
                     /db_xref="GI:58261292"
                     /db_xref="GeneID:3254877"
                     /translation="MADPSAFYEPEEDELLSQLAIPVQNYQPLSEGDEYRRLQQLEQH
                     AYAQQTAMAQEQEMEQLAVLELIPEDVKRFLVMFHQAILENDLPTITSMYESGWNKLT
                     QAHYLNNEWPEAELIAPLVGNDQVFLTLYRELYFRHVYARLQPTIDDRFQSYENICEL
                     FNYLLNSEGPVPLDLPIQWLWDMLDEFVYQFTSFSHWRSSPKAKTEEELEMLAESPNI
                     WSSYSVLNVLYSLVQKSQINEQLKAERAGKSVEEVTEVAGEYGSKPLYKNLGYFSLIC
                     LLHVHVLLGDPTLALQTMENVDLGNAAFLTRITACHVTTYYHVGCAYMALGRWPDAIK
                     TFVSVLIFFIRMKQYHTRSYQYGSIAKTCERMYALLAICTTLSPGPSDENIMTIVKEH
                     YGDQLAILQRGGPEALEAFKDLYLQACPKYLNVNPPPYEDASALEAWLANPPADATQR
                     HLELFLSDVQAVQGVNGMRNLLKLYTSIDAAKLAAFSVSGEEEGEEEVLQQLMVLKSA
                     SSTYGRGQAETTLLDGERKVTNNLDFTIDGTMVHVEETTSHRRYAGFFIRNAEHAQRA
                     LTSIKSAPLPVRKPASSSAPAPATTAAPISKSGESAAPAPAEAPAAPEKKAGTWVPKS
                     RQARIAA"
     gene            <449216..>450512
                     /locus_tag="CNL05170"
                     /db_xref="GeneID:3254881"
     mRNA            join(<449216..449755,449814..449901,449956..>450512)
                     /locus_tag="CNL05170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568057.1"
                     /db_xref="GI:58261293"
                     /db_xref="GeneID:3254881"
     CDS             join(449216..449755,449814..449901,449956..450512)
                     /locus_tag="CNL05170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568057.1"
                     /db_xref="GI:58261294"
                     /db_xref="GeneID:3254881"
                     /translation="MEYGLSSEIKQQHGIMDNTLSTNVLGIYLPAQGISERDDYEDPQ
                     NDEVPIQPNPDPQNVDRNIVLADYSGFLYSALSNRLPIWPDFTCCCSEHDDHPCYVLG
                     SDCPLLACRPYECPDYRAFGIISVGAHGIIHRATDTRRNEVVAIKVTKEYHGSETGDA
                     HMRWELWKRSFAAREVAMLDVCDHPHIVRPRDIVESPDGKLGLVIDYFPGGDLQKYLR
                     TYGSLSEFEARYTFTQLLSAVTHLQDRHMVHHDIKPENILIDLDGNVVLSDFGVAHIF
                     DESYVPALPICGTIVYAEPELVVRKTRYSPFKWDIWSLGIILFFLLTGRTPYIGYKGF
                     PGHHAHIMDVCTFVASASVDYPRLIPWGPRNLMEKMLEVDSEMRAGCSQLWEHSWIKG
                     TL"
     gene            complement(<450713..>451843)
                     /locus_tag="CNL05180"
                     /db_xref="GeneID:3254828"
     mRNA            complement(join(<450713..451053,451118..451224,
                     451281..>451843))
                     /locus_tag="CNL05180"
                     /product="hypothetical protein"
                     /transcript_id="XM_568058.1"
                     /db_xref="GI:58261295"
                     /db_xref="GeneID:3254828"
     CDS             complement(join(450713..451053,451118..451224,
                     451281..451843))
                     /locus_tag="CNL05180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568058.1"
                     /db_xref="GI:58261296"
                     /db_xref="GeneID:3254828"
                     /translation="MSSPSALSTASPLPFLQEEEEHLEVSDRKDASSVWALKVPNFLL
                     QRWQTVQEPGVELGRLVVDNSVTPPNITLKLTNAEEGTEEGERAKRAKYDVEGLPDEF
                     KVEVPMERSKNTFLFSEVKKIYDKGNRDGTQQADAPRDAWGKRKREKAHPKLLARVDH
                     EGHIQPIRTQKYLDFLKARRMEAEQSRRPVVRMEDTGLSQAEQNQLASGFRSANSTFG
                     RNMIATSGERFARLERHELTDRIFQCFRDHPYWALGALKQTLEQPDAWLREVLRDVAE
                     QVKEGQYQGYWQLKPVWREDSWKGGEKGESVKNEVKEEGDVKPDIDVDDDEDEDDLEE
                     VM"
     gene            <452166..>455552
                     /locus_tag="CNL05190"
                     /db_xref="GeneID:3254749"
     mRNA            join(<452166..452294,452354..452476,452523..452671,
                     452719..452962,453018..453321,453372..453455,
                     453513..453824,453874..453948,453998..454348,
                     454402..454641,454693..455135,455190..455246,
                     455300..455375,455437..>455552)
                     /locus_tag="CNL05190"
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily a, member 3,
                     putative"
                     /transcript_id="XM_568059.1"
                     /db_xref="GI:58261297"
                     /db_xref="GeneID:3254749"
     CDS             join(452166..452294,452354..452476,452523..452671,
                     452719..452962,453018..453321,453372..453455,
                     453513..453824,453874..453948,453998..454348,
                     454402..454641,454693..455135,455190..455246,
                     455300..455375,455437..455552)
                     /locus_tag="CNL05190"
                     /codon_start=1
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily a, member 3"
                     /protein_id="XP_568059.1"
                     /db_xref="GI:58261298"
                     /db_xref="GeneID:3254749"
                     /translation="MSHIDYFGGQPSTAQKRPRQTQPTSSSQEEDDDQQSRAIEHDEH
                     FATFRSDVVGVQYYRGLVGRGEYVLLRREPTNKWDSNAVQVVNAGGSQVGHIPRAVAA
                     NLATLMDRNQISVEGRMIGQNLDGAKHFKLPLDVSIYLNHSMRESLEPALRWVSPGDR
                     VNNQARRPVYTSQSQVRGAAGSGVGLPQPADSTMKELLEGLSKDNADLKQVDKVMDAL
                     TSDVDVSKLPLHPAPPGTANGQLLTDLLPHQSQALQWMITRENPQLPKSPSEPAVQFW
                     VKQKGVGSKPDYWLNVATKTPQSEAPQLGRGGIIADGMGLGKTLTTISLVLATKNDPV
                     GDKVSKSTLIVCPLSVLSNWEKQIRDHVAPSQLRFYTYHGAAKGLTAKKLGGYDIVLT
                     TYQTVAGEDAAVPHTGDTPLAKKSRPSTTKSGPLATIKWKRVVADEGHQLKNPKAKMT
                     IAFANLSAERRWICTGTPIVNSPNDLGSLLTCLHICAPLSNPQYFRALLLRPLSRGDP
                     TASKLLQAVVSQILLRRTKDSKGANGENVVELPDIEFFRVPVKLDNETRKVYEEVLEH
                     SKRRFEETLRTGEGAANVLSMLTRMRQLCLSLELIPQSFLDEIRAPPTSQNGASATSI
                     ASLSTEEMEALVKKLRQIVEDETECGICMDEVEFAKDPAITDCGHPFCLPCIERVITS
                     QGLCPMDRHPIAHGSILRLPSDESLYLPSSQARSINSAKIDELVKYLRIFPRDDKTLV
                     FSQFTSFLDCVGVRLEQEGVKFVRFDGRMPGKQRTEVIKAFQEPVKGDDDEEAPTVML
                     ISLKSGAVGLNLTAASNVFLCDPWWQSAIEAQAIDRAHRMGQKKVVRVFQLIAEDTIE
                     SRVLDIQKRKDAMVAKAFEKSSKESQRTKKEARFEDIKELLGMK"
     gene            457235..460465
                     /locus_tag="CNL05200"
                     /db_xref="GeneID:3254866"
     mRNA            join(457235..457276,457325..458473,458520..459041,
                     459092..459493,459551..460102,460155..460465)
                     /locus_tag="CNL05200"
                     /product="WD-repeat protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531787|gb|CF677628.1,gi|41572226|gb|CF718067.1,
                     gi|41572234|gb|CF718075.1"
                     /transcript_id="XM_568060.1"
                     /db_xref="GI:58261299"
                     /db_xref="GeneID:3254866"
     CDS             join(457241..457276,457325..458473,458520..459041,
                     459092..459493,459551..460102,460155..460460)
                     /locus_tag="CNL05200"
                     /codon_start=1
                     /product="WD-repeat protein"
                     /protein_id="XP_568060.1"
                     /db_xref="GI:58261300"
                     /db_xref="GeneID:3254866"
                     /translation="MVKSYMRHGPTQAFGIICSPTANSSYNGRLAYVPGWEDVLVWDT
                     KRGEMVAMWHSTGLTSPVTYLIPAPTPYTSTSTTPVTFAVSYQDGSIRLWSYDPSTPD
                     VEASETVTFNGHKKSVTTMTWDYDASRLASGGTEGEIVVWDRIGEVGLFRLKGHRAPI
                     TGLAFIPHPRGGHPGWLVSTSRDTYLKVWDLGTQHCVQTVVVGRGEVTSLAVREEAEE
                     SIIGQGEGEAEDEEEIKGRWTVVTGSGDGEAKVYTIEKSQLARGMAEDEKGELPALIT
                     SVCTLPLPSSTHPISQITWHPALPLLSLQTSDRGVAILRLRTEEEVSAKRARRKKRDR
                     EKKKKGKGDKQKEEDKEEDEKDEPVKWEERVAVWCMVRANAKVKSFAFADENVVSVKG
                     GVSLLLALSNNSIESYTIPTPGSKSKLADGTTPEPTKTHSIELPGHRQDIRTISISSD
                     DQVIASASSGTLKLWNARTTACIRTMECGYALCSTFLPGDRHVVIGTKGGELMLYDVA
                     ASSLLKTYKAHTGPVWSVSVRPDGRGLVSGSADKDVKFWDFEMREEGEGEKVVSRLGV
                     ETVYKTKQLALVHVRTLKMTDDILCLKYSPNGRFLAIALLDSTVKIFFSDTLKFFLSL
                     YGHKLPVLSLDISLDSKLLVTCSADKNVKIWGLDFGDCHKSIFAHDEAVMGVMFEKEA
                     GSHNFWTVGKDRMVKYWDGDKFELIQKLSGHHGEIWALSTSQSGQFVVTGSHDKSIRI
                     WEKTDEPLFLEEEREKEIEAMYDSNLADTLNREPGEGEGEGDEAEAVQKLTAETLIAG
                     EKIMEAIELADADRAATRQWQVDNAKSNIEIPRPPRNAELIARGDLEPDEYVLKVVQK
                     LPAAQMEDALLVLPFRMVVSLMGYLDEWAMQGKEIILVSRILFFLLRTHSSQIVSNRI
                     MRTPLLTLRHHLRDALAQQRDVMGYNLAALKFLKGRWEGERVAGLYEQEGLDEEAVRK
                     RLEEGRGKRKRIEVRA"
     misc_feature    458243..458359
                     /locus_tag="CNL05200"
                     /note="GA-rich"
     gene            complement(460590..462633)
                     /locus_tag="CNL05210"
                     /db_xref="GeneID:3254948"
     mRNA            complement(join(460590..461238,461291..461785,
                     461841..461979,462045..462078,462132..462179,
                     462228..462239,462301..462469,462533..462633))
                     /locus_tag="CNL05210"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536118|gb|CF681959.1,gi|41536131|gb|CF681972.1,
                     gi|41539891|gb|CF685732.1,gi|41539904|gb|CF685745.1,
                     gi|41546632|gb|CF692473.1,gi|41548782|gb|CF694623.1,
                     gi|41548788|gb|CF694629.1,gi|41549905|gb|CF695746.1,
                     gi|41552697|gb|CF698538.1,gi|41571072|gb|CF716913.1,
                     gi|41571242|gb|CF717083.1,gi|41571249|gb|CF717090.1,
                     gi|41572533|gb|CF718374.1,gi|41572541|gb|CF718382.1"
                     /transcript_id="XM_568061.1"
                     /db_xref="GI:58261301"
                     /db_xref="GeneID:3254948"
     CDS             complement(join(460667..461238,461291..461785,
                     461841..461979,462045..462078,462132..462179,
                     462228..462239,462301..462469,462533..462548))
                     /locus_tag="CNL05210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568061.1"
                     /db_xref="GI:58261302"
                     /db_xref="GeneID:3254948"
                     /translation="MDLIENLAKQASQLTMYDVKSYYNQAKNAVLNISEMEAKVREAT
                     NDDPWGASSTLMQQIAEGTHNFAQFNEIMPTIYSRFMEKEAREWRQIYKALTLLEFLV
                     KNGSERVVDDARAHVSTIKMLRSFHYIDEKGKDQGINVRNRASEIALLLGDVDKIRTE
                     RRKARANRNKYQGVGNDGGMSFMSSTGSRYGGFGSDSVGSGSSAGRYGGGDDFRSSSR
                     GFRDTSAQQSQFDEYEGADDFDDQPPRRTTSISRSTAQAPPKPVAKEKEVEKPKEINL
                     FDFDDEPVAAPATASAATANAAPAVGGDDEFDDFQSAVPAPAPAPAPAAKPANTNVFD
                     LLNPATSSTPTSAPSISTPAYSPPASNSSGPTFGYGAMSPPLNAAPSIPFSNAAKPPA
                     SSTHPSYTSASTPSALSPKPTGGSSNSTFDDLFASSLSSIGKSSTAQSQNRGGKTIKD
                     LEKEKMVNSLWGSTPSVPSQSTQPAQPAQPAQPKASGNFDDLLL"
     gene            complement(<462922..>463728)
                     /locus_tag="CNL05220"
                     /db_xref="GeneID:3254842"
     mRNA            complement(join(<462922..463553,463602..>463728))
                     /locus_tag="CNL05220"
                     /product="hypothetical protein"
                     /transcript_id="XM_568062.1"
                     /db_xref="GI:58261303"
                     /db_xref="GeneID:3254842"
     CDS             complement(join(462922..463553,463602..463728))
                     /locus_tag="CNL05220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568062.1"
                     /db_xref="GI:58261304"
                     /db_xref="GeneID:3254842"
                     /translation="MHPTSTSLCFNQYDWDYTSKYMSCEDFLFTDDIFPSKSTIEADQ
                     DGQQNADNKEEADLVNTANTTNDNGFVNTYKSDCTVDAVLQNLTPSNSNDIKGYIMTW
                     AGKGNFLRGEIPFRLYHKVVVVLPYGQYPITQEDEILAFRLASNLRRRIMYRMYARYR
                     CQKHSQLPTEIEAAKLHLAIEAKKLLQRDAFAGFVHVSFGDRHLMSRVASTAYKPKIS
                     YDQRCKIAGTIDCEVGGSRTWAELEASWDLERIE"
     gene            464299..464389
                     /locus_tag="CNL05230"
                     /db_xref="GeneID:3254935"
     tRNA            464299..464389
                     /locus_tag="CNL05230"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:3254935"
     gene            <464931..>465865
                     /locus_tag="CNL05240"
                     /db_xref="GeneID:3254795"
     mRNA            join(<464931..465585,465638..465795,465848..>465865)
                     /locus_tag="CNL05240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568063.1"
                     /db_xref="GI:58261305"
                     /db_xref="GeneID:3254795"
     CDS             join(464931..465585,465638..465795,465848..465865)
                     /locus_tag="CNL05240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568063.1"
                     /db_xref="GI:58261306"
                     /db_xref="GeneID:3254795"
                     /translation="MPRSPSPSRDHDRPRSRSRSPPPRKKPKELSFYKKSSSSMGSLS
                     HRRDPLDEPTSKERAEARERGEVPRRFGGTREQGVRNTMGNVPSASVGSFKRGGDPLD
                     RYGVRGDPRDERRDDYGRGDAYRLDRDRDDRRDRDRDDYRKDRDRRDRDRDRDRDRDR
                     DRDSERRTERDRDGSRRDAPRAAAPSSTSAPPQRPAAAPSATSMRLIEVIANDRLGRK
                     VRVKCLPTDTVGDLKRLIAAQTGTTAQKIQLKKWYTAFKDHVSLQDYEIHDGMSLEMY
                     "
     repeat_region   465309..465452
                     /rpt_type=tandem
                     /rpt_unit_seq="cagaga"
                     /satellite="microsatellite"
     gene            complement(465886..>467303)
                     /locus_tag="CNL05250"
                     /db_xref="GeneID:3254945"
     mRNA            complement(join(465886..466157,466213..466634,
                     466692..466917,466967..467071,467127..467157,
                     467216..>467303))
                     /locus_tag="CNL05250"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_568064.1"
                     /db_xref="GI:58261307"
                     /db_xref="GeneID:3254945"
     CDS             complement(join(465938..466157,466213..466634,
                     466692..466917,466967..467071,467127..467157,
                     467216..467303))
                     /locus_tag="CNL05250"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_568064.1"
                     /db_xref="GI:58261308"
                     /db_xref="GeneID:3254945"
                     /translation="MASKQHAHILSLARSMIPPLHPKLHKGQAGRIGVLGGSGDYSGA
                     PYFSSMGAMRFGADLAHVICEPSAGAVIKTYSPDLIVHTILDPQKSREDIRSALKGVM
                     SRLHVLIIGPGLGRDDHMQSCAKIAFELAKDMEQMGVVVDADGLWLVQNEPKVVMDWP
                     GVPRIILTPNVMEFKRLCDTMVGARTVLHLSPSTLINYQKINASGPHTSLCPQLATAL
                     GNATIIQKGPSDIISNGLKIPSALLSDESEEQNYLEVKVEGGLKRVGGQGDILSGSTG
                     VLLAWGSEWVRGTYEHVGHPPPQDKAIAENIPVLAAYGASTFNRTVSKRGFQKKGRSM
                     VTGDLVDMVGEVYEEVFGKPGEMEGRGKL"
     gene            <467514..469367
                     /locus_tag="CNL05260"
                     /db_xref="GeneID:3254867"
     mRNA            join(<467514..468069,468122..469038,469092..469182,
                     469235..469367)
                     /locus_tag="CNL05260"
                     /product="histone deacetylase 3, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533103|gb|CF678944.1,gi|41533110|gb|CF678951.1"
                     /transcript_id="XM_568065.1"
                     /db_xref="GI:58261309"
                     /db_xref="GeneID:3254867"
     CDS             join(467514..468069,468122..469038,469092..469182,
                     469235..469338)
                     /locus_tag="CNL05260"
                     /codon_start=1
                     /product="histone deacetylase 3"
                     /protein_id="XP_568065.1"
                     /db_xref="GI:58261310"
                     /db_xref="GeneID:3254867"
                     /translation="MTNLHFGVCSSTNRLHQKNPTNVLLCLVCIISSAQSYISPDYQL
                     MVPSTSSTNHSAFRVSYLWSPALQRLSDDLPSNVGRSSMVHDLIRSLDLLDFEELKER
                     FLKSDNPEDEDGKSEDDDDNEADRNEVNNGDKQGADGEPQRRKPGSPTASPPHAQNKK
                     ATVVFPQPSLGTKACLLKYHDRSYIERLLMAHTDRDPNDPTHLPSSPSSSASSPRPAK
                     IARTDPYNLSHDNPVFPTLASYISHVTAATSTACRLLATDKADWAVCWDGGRHHAKRK
                     EAGGFCYVNDLVLGGLLLSREGRIPLPLKEGEDPKRQRTRAPRILYLDMDLHYSDGVS
                     AAFHSPTVYPYPLKEGITPPKPPNVLTLSVHHSSPIFFPPPTPLSLLPSPDTESPFSL
                     SIPLSAYPSRQTYAKVFNQCIQPIREAWDPDYIILQLGTDGLPGDRVGQYGNWSVDGE
                     GGIKWVVERVKEWGKKVCVTGGGGYRHDNAARAWAEVTGVLLDRDFVEDMPIPHHDHF
                     EQYAPSFTLQVPDSHMRDENKPEDLEKAAEVFNVLAERIKIIVDANS"
     gene            complement(469319..470814)
                     /locus_tag="CNL05270"
                     /db_xref="GeneID:3254730"
     mRNA            complement(join(469319..469598,469650..469723,
                     469781..470081,470132..470183,470241..470291,
                     470338..470618,470670..470814))
                     /locus_tag="CNL05270"
                     /product="AY086643 putativepod-specific dehydrogenase
                     SAC25, putative"
                     /transcript_id="XM_568066.1"
                     /db_xref="GI:58261311"
                     /db_xref="GeneID:3254730"
     CDS             complement(join(469395..469598,469650..469723,
                     469781..470081,470132..470183,470241..470291,
                     470338..470618,470670..470801))
                     /locus_tag="CNL05270"
                     /codon_start=1
                     /product="AY086643 putativepod-specific dehydrogenase
                     SAC25, putative"
                     /protein_id="XP_568066.1"
                     /db_xref="GI:58261312"
                     /db_xref="GeneID:3254730"
                     /translation="MSLWSNIWLWIRYQVNVIIHCGFPCFFWVQPTWSIDKIENQEGK
                     VVLITGGNSGTGYATALALYNAGATVYIACRNLTRAKEAAEDIKKGGERGIWGVTYPR
                     KELDKAGGNKKGRVEIIQLDLTDLASVEKCAEEFLNKEKKLDLLFANAGIMATPEGQY
                     TKQGYTLQFGTNTLGHHRLITLLLPLLLSSPPSLPSRVILTSSAGHSMAPKGGVNFKS
                     VVRDPSDTGSGQGKYELDKWTEYAQSKWGNIASAKYLEDTYGKEGRLIAVAVHPGLVA
                     TNLTNHLPFVGIFYRWVPWLRHLFTRDPSTGALNQLYAATLPLPDAWFLNGEYVVPYN
                     TVGICRSDLLDKKRIEEVWNWCDEQGKKFA"
     gene            complement(<474711..>475328)
                     /locus_tag="CNL05280"
                     /db_xref="GeneID:3254903"
     mRNA            complement(<474711..>475328)
                     /locus_tag="CNL05280"
                     /product="hypothetical protein"
                     /transcript_id="XM_568067.1"
                     /db_xref="GI:58261313"
                     /db_xref="GeneID:3254903"
     CDS             complement(474711..475328)
                     /locus_tag="CNL05280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568067.1"
                     /db_xref="GI:58261314"
                     /db_xref="GeneID:3254903"
                     /translation="MSSFFRPLAPIARPLLRRAYAAAAKPSGGNPHLHQPADSRSEVL
                     RNTLYPHDSYAPTSSSPTGSYHPDYLERLQAVIPSAEAYETIERAWQLYQRELREARK
                     IALDAKYKSMVEACDELERITNHENGGPESADGKGGLYHRQVYNLAVASVRQAHRRGE
                     QPKGKKTLEQRWLETRVEGLVPREAWVPVESRGKGWNYDWQRPGA"
     gene            complement(475563..477233)
                     /locus_tag="CNL05290"
                     /db_xref="GeneID:3254805"
     mRNA            complement(join(475563..475630,475684..475749,
                     475805..476115,476163..476279,476331..476432,
                     476480..476585,476636..476812,476885..477233))
                     /locus_tag="CNL05290"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543367|gb|CF689208.1,gi|41543373|gb|CF689214.1,
                     gi|41546075|gb|CF691916.1,gi|41546088|gb|CF691929.1"
                     /transcript_id="XM_568068.1"
                     /db_xref="GI:58261315"
                     /db_xref="GeneID:3254805"
     CDS             complement(join(475607..475630,475684..475749,
                     475805..476115,476163..476279,476331..476432,
                     476480..476585,476636..476812,476885..477157))
                     /locus_tag="CNL05290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568068.1"
                     /db_xref="GI:58261316"
                     /db_xref="GeneID:3254805"
                     /translation="MSHSRPLIRTLQTRHIPRLLSTPTPRATTSITSRYIRPCSIRLF
                     GTTVARQVQIPENMKAVLIKNGTGHADDLYLGHEPTPEPGNGQVQVKIRNFGLNRMDI
                     LQREGKYPLPPQASKTILGVEFSGIVTKLGEGVNKWKEGDEVFGLSYGGAYAEYIVSP
                     EIMLLAKPEKLSWVQAASIPEVWMTATQALTLEAPLKEGQNVLIHAGASGVGIAAIQI
                     ALHALGAAKVFTTCGTDEKVEFLKQLGHSDRLHVFNYKTQNFEEEIKKITNGVDLVID
                     FIGTNYFLQNVNVLRLDGTLYSLAFMSGAKFPAGASMAPFLGKRLTFKGSTLRSRSPE
                     YQAKLLKTFEEKILPKILDDTMTIKVHEIYPWSKVTEAHKAMEGNKNSGKIVLEVTE"
     gene            <477927..>478265
                     /locus_tag="CNL05300"
                     /db_xref="GeneID:3255000"
     mRNA            join(<477927..478147,478184..>478265)
                     /locus_tag="CNL05300"
                     /product="hypothetical protein"
                     /transcript_id="XM_568226.1"
                     /db_xref="GI:58261631"
                     /db_xref="GeneID:3255000"
     CDS             join(477927..478147,478184..478265)
                     /locus_tag="CNL05300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568226.1"
                     /db_xref="GI:58261632"
                     /db_xref="GeneID:3255000"
                     /translation="MGSSPNFRHQSSGNFRYTSALIKGDNREDEQWGVQSHWSDWGSE
                     NSRAGGKKDDRRSGGLRRMFTKSGKNGKVDLCREQSLQVLIRRLPPQSTERAFVSS"
     gene            complement(479958..482829)
                     /locus_tag="CNL05310"
                     /db_xref="GeneID:3254752"
     mRNA            complement(join(479958..480064,480124..480820,
                     480885..482251,482295..482695,482751..482829))
                     /locus_tag="CNL05310"
                     /product="mitochondrion protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534795|gb|CF680636.1,gi|41534812|gb|CF680653.1,
                     gi|41536328|gb|CF682169.1,gi|41536335|gb|CF682176.1,
                     gi|41536864|gb|CF682705.1,gi|41536874|gb|CF682715.1,
                     gi|41537183|gb|CF683024.1,gi|41537185|gb|CF683026.1,
                     gi|41540419|gb|CF686260.1,gi|41542309|gb|CF688150.1,
                     gi|41542619|gb|CF688460.1,gi|41542627|gb|CF688468.1,
                     gi|41549663|gb|CF695504.1,gi|41558166|gb|CF704007.1,
                     gi|41559132|gb|CF704973.1,gi|41559145|gb|CF704986.1,
                     gi|41559220|gb|CF705061.1,gi|41560222|gb|CF706063.1,
                     gi|41560230|gb|CF706071.1,gi|41569336|gb|CF715177.1,
                     gi|41569345|gb|CF715186.1,gi|41569613|gb|CF715454.1,
                     gi|41569627|gb|CF715468.1"
                     /transcript_id="XM_568069.1"
                     /db_xref="GI:58261317"
                     /db_xref="GeneID:3254752"
     CDS             complement(join(480020..480064,480124..480820,
                     480885..482251,482295..482363))
                     /locus_tag="CNL05310"
                     /codon_start=1
                     /product="mitochondrion protein"
                     /protein_id="XP_568069.1"
                     /db_xref="GI:58261318"
                     /db_xref="GeneID:3254752"
                     /translation="MYAQLRTAHYRAPRSLRPQPQRRLLATPPPPPPPASGLPPNPPP
                     PTGVVHPRPAVAHAKPPAVPGSSTVARPPPGRPRRFRRVFVYTALGVAGFYALSGYVG
                     TKSDAYRDLFTQYVPGGEAVADYADDNDWDNVSGKAVRAWQSITGARPETRTEKVERK
                     IGEVRQEAAKVPAQVKDKADEAKDHVVGKHTASQKIHERAEELRKAVEQKTHEAEARL
                     KELTGEAKHKVQEATKDAPFNFSEGVEGIVRAAESALHKTEHKAAEAADKVKPAEARP
                     SSPFPDTQRPRELKPETVTPQVPSYEGKKLYTGPPLPLGHEPPPGYYLPPPPSTKKEK
                     VEEKVEEIKERLPLLVPKVKEFASEEPIISQLASTIDSLTSSLSTPSKALSSDATGIL
                     NKAQDDLTALNARLQEVKKAEKAKLEQSISEKKKEFEALLKSMEAEKAKSEEGLKQTW
                     QHERQTMVEDWRKELEGELEQQRQSIEQRLREEVVSQGIELQRRWLRSIKTQVETERG
                     GRLAKLDSLTTSLKQLERITLDNSATLDDNVRLHKIWSALRAVQSKVDSGDLAFDDEL
                     RALKSLSTPTASSGEGVVRSALEQIEKSGIPQTGVKSFAALSSWFTNTVAPRIQSSSL
                     VPAPEEATVISHLASAGLSKIMFRPQAGRVPGDSVGAVLARAEWCLAEKDLDGAAREI
                     NSLTGWPAKLANDWLQQARRKLEVQQALEVVATEATLSSLLLV"
     misc_feature    482186..482341
                     /note="G-rich"
     gene            complement(<483326..>483736)
                     /locus_tag="CNL05320"
                     /db_xref="GeneID:3254888"
     mRNA            complement(join(<483326..483382,483572..>483736))
                     /locus_tag="CNL05320"
                     /product="hypothetical protein"
                     /transcript_id="XM_568070.1"
                     /db_xref="GI:58261319"
                     /db_xref="GeneID:3254888"
     CDS             complement(join(483326..483382,483572..483736))
                     /locus_tag="CNL05320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568070.1"
                     /db_xref="GI:58261320"
                     /db_xref="GeneID:3254888"
                     /translation="MYGADAAPVGLCISPVISNVGHDCRPNAQIVFPLGAVANGGMKI
                     VAVESIQPGEEPNIIVMVRNQMIMDTRVC"
     gene            complement(<485549..>486115)
                     /locus_tag="CNL05330"
                     /db_xref="GeneID:3254989"
     mRNA            complement(join(<485549..485666,485722..485892,
                     485976..>486115))
                     /locus_tag="CNL05330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568071.1"
                     /db_xref="GI:58261321"
                     /db_xref="GeneID:3254989"
     CDS             complement(join(485549..485666,485722..485892,
                     485976..486115))
                     /locus_tag="CNL05330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568071.1"
                     /db_xref="GI:58261322"
                     /db_xref="GeneID:3254989"
                     /translation="MATTDDFVINSNGLGYMAPSSEKITGGVQTDAGVKGDDTMEVRF
                     EFGGGLHLLFSSQPKHVAHLPRFVPGTTPPEPLNMRYVVKWMKENLLSEREEMFGEGD
                     GVRPGILVLINDADWELEGELEYELRDRDEIVFISTLHGG"
     gene            <486848..>488038
                     /locus_tag="CNL05340"
                     /db_xref="GeneID:3254797"
     mRNA            join(<486848..486998,487054..487351,487402..>488038)
                     /locus_tag="CNL05340"
                     /product="riken protein, putative"
                     /transcript_id="XM_568072.1"
                     /db_xref="GI:58261323"
                     /db_xref="GeneID:3254797"
     CDS             join(486848..486998,487054..487351,487402..488038)
                     /locus_tag="CNL05340"
                     /codon_start=1
                     /product="riken protein"
                     /protein_id="XP_568072.1"
                     /db_xref="GI:58261324"
                     /db_xref="GeneID:3254797"
                     /translation="MSVQVSPEQMATLKATLLNTPGNVPLHERFRALFMLKAVGGDEV
                     VDIVSEGLKDPSPLLKHELAYVLGQLLNTRALPTLSRVLENPTGEHCSMVRHEAAEAL
                     GAIGAEESLPILRKYMQDENREVRETCEIAVGKIEFDLSEEGKKTNANPDFPTIDPAP
                     SAAPSDIPSLRADLLNTSLPLFQRYRAMFALRDFGAGSKEAVEALADGFRDGSALFRH
                     EIAYIFGQLSSPYSIPSLLSRLRDAKEDDMVRHEAAEALGGIASDGVESENPEVVLPE
                     DERLPEGGVLAVLREWAVKADAPTVVRESCQVAIDMWEYENSADQFNPLDSLSAKQEE
                     REKTEKVNTTGMERSAHAAVAAMGIAA"
     gene            complement(488177..491387)
                     /locus_tag="CNL05350"
                     /db_xref="GeneID:3254986"
     mRNA            complement(join(488177..488526,488575..488872,
                     488925..489099,489152..489624,489687..489846,
                     489900..489958,490010..490279,490327..490472,
                     490522..490672,490718..490821,490871..491057,
                     491104..491387))
                     /locus_tag="CNL05350"
                     /product="Phospholipase A-2-activating protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534711|gb|CF680552.1,gi|41534725|gb|CF680566.1,
                     gi|41537603|gb|CF683444.1,gi|41537612|gb|CF683453.1,
                     gi|41547824|gb|CF693665.1,gi|41547833|gb|CF693674.1,
                     gi|41550859|gb|CF696700.1,gi|41550869|gb|CF696710.1,
                     gi|41556219|gb|CF702060.1,gi|41559020|gb|CF704861.1,
                     gi|41559433|gb|CF705274.1,gi|41559442|gb|CF705283.1,
                     gi|41567842|gb|CF713683.1,gi|41567848|gb|CF713689.1,
                     gi|41568738|gb|CF714579.1,gi|41568753|gb|CF714594.1,
                     gi|41569541|gb|CF715382.1,gi|41569552|gb|CF715393.1"
                     /transcript_id="XM_568073.1"
                     /db_xref="GI:58261325"
                     /db_xref="GeneID:3254986"
     CDS             complement(join(488253..488526,488575..488872,
                     488925..489099,489152..489624,489687..489846,
                     489900..489958,490010..490279,490327..490472,
                     490522..490672,490718..490821,490871..491057,
                     491104..491335))
                     /locus_tag="CNL05350"
                     /codon_start=1
                     /product="Phospholipase A-2-activating protein"
                     /protein_id="XP_568073.1"
                     /db_xref="GI:58261326"
                     /db_xref="GeneID:3254986"
                     /translation="MPKQYKLAFSLNGHAADVRNVTAPSQQVPLLLSASRDGSAIVWG
                     PSNASREWDVKLRVEGPEKRYVSCVGMTRWDGQAFLLVGSSSGILASYVLPAMDSPAP
                     ADDSPLPEPTHTLIEHSQNLCCMDVSQGGLIASGSWDKTVIVWKDFKKVIQIKAHEQA
                     VWSVKFVGEDRLLTASADKKIILHSVDPASGRTTPLQTYTGHTEPVRGLALKPDRQGF
                     WSCANDGNVNIYSFDKPSPIRTLSGHTSFVYSIATFPDGSGAITTGEDGTMRVWSETE
                     LIQTIPHTSNSLWSCAVVPSLVASSPYIVSSSSDSTIRFFTNEGALVAGPEELAAWDD
                     EVKGRQLDKSQVGDVKHSDLPGIEALGREGKKDGQVLMIKNNGVVEAYQWSAPSSTWQ
                     QIGQVVDAIGQGRKQLYEGKEYDYVFDVDVSEGMPPLKLPYNVAENPWIAAQRFLERN
                     ELPTSYVDQVVEFIQKNTGGVQLGTGEDTASYADPFTGGSRYTGGGVPTTGAGGSSGG
                     FGDPFTGDSRYTGGGISTTGNTTSSGDPFTGGSRYTGAVTASSAPVQQSGAKGILPVK
                     TYLPFKQINVSAAKNKIQQFNDELKTSKPELALTLEEEKTLTEVYAFLSLPAVALPNP
                     NSQDGKEKFDTGAILALVQKWPEDKRFPLIDLARVLAAASPAFALSPPHPFFIAASLS
                     LPFPDPPSKPRETNTLLALRAIANLFVTANGRMVLSTEDVAKDILANVGGVEWGKVGK
                     NVRIAGATIVLHLSILAVEGNLPVALGSPLLDLINQILDSEKEDTEVVYRSAIALGNL
                     VSSPKAAGGLAVGKVAKGKESVKRWAGKESRLGSLATEIEGLGL"
     gene            <491694..>495104
                     /locus_tag="CNL05360"
                     /db_xref="GeneID:3254980"
     mRNA            join(<491694..491805,492103..492186,492479..492855,
                     492986..494551,494604..>495104)
                     /locus_tag="CNL05360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568074.1"
                     /db_xref="GI:58261327"
                     /db_xref="GeneID:3254980"
     CDS             join(491694..491805,492103..492186,492479..492855,
                     492986..494551,494604..495104)
                     /locus_tag="CNL05360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568074.1"
                     /db_xref="GI:58261328"
                     /db_xref="GeneID:3254980"
                     /translation="MIAGPLLLDTLFKHYLSPRQHSDDDKNKAREDLMYDEVPFPSLQ
                     LAAEYMITAFGGEEMAFKVAGVHGGAYYWGSINTHRYTIWRHARKMHGRCFAVNYRKA
                     PQYPFPCAIQDCLAAYLYLINPPPGAPHRPVDPKSIVLAGDSAGGGLCLALLQILRDT
                     PGLELPAGAALLSPWSDLTHSFPSILQNTATKPSSLWPPPPPTVTQAVQSRLRSRVKE
                     AAARVRDHDKEAKSRESHSEGTKGDKLYSVVSRISARSHGKANEGHENAGGDSRIESP
                     NAVHASAPTGVEASDPSTSPSSTLHPTTSSPSDPKAHPAPREGPHNPSFANPASLFST
                     LVPPSPNETRPTTLAQCTTPLYLKVKDEKVVLDTQIQIYATNAQLCHPWVSPVLGYLG
                     GLPPLYIMCGDKEVLRDEIIYLAHKAANPSAHPLRPDVVALLPSLEGIESRYGPTNVH
                     LQVYDGVCHDLPLFSMTTAARGCFRAIASFARYVTPSTPGSLYIGRNSNAAEESEIST
                     PATPNTLITPIDPVDPEKHNKILGAPMDSSPVQVTPRSSQASLRPPGVTSMPLRRTEP
                     LLSEIPSLSGLAMHDNDRCFEETVELETTHGKVDGMKEKKKNEMGILPLRRRTSLPES
                     STPSGSGPQSTAMTPTASATGDQVLGDETGPRFAFGAGDQTKKDKGKSVEFEKREEEA
                     KEEGEEGFSGLNDSRAKKGEAGWPGIYRGDNPFTDHMIRERVSNTGVTRPLTPPSEIQ
                     ALTMPREEIGKIKEGPAMRYINGQTLWDKKYRRTGERVKKRRERNLLQAHKAGEKIGT
                     GLDGVIRESMRAEKAKKRKEIIKEKIKGKKSYEEDEEESETESAVEDEPTTVRTSMTW
                     TWALKGEAPPPSAIVSRRDFASH"
     misc_feature    492273..492328
                     /locus_tag="CNL05360"
                     /note="GA-rich"
     misc_feature    494407..494479
                     /locus_tag="CNL05360"
                     /note="GA-rich"
     gene            complement(<495494..497603)
                     /locus_tag="CNL05370"
                     /db_xref="GeneID:3254834"
     mRNA            complement(join(<495494..495794,495847..496278,
                     496317..496784,496839..497175,497226..497301,
                     497361..497603))
                     /locus_tag="CNL05370"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535531|gb|CF681372.1"
                     /transcript_id="XM_568075.1"
                     /db_xref="GI:58261329"
                     /db_xref="GeneID:3254834"
     CDS             complement(join(495494..495794,495847..496278,
                     496317..496784,496839..497175,497226..497301,
                     497361..497570))
                     /locus_tag="CNL05370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568075.1"
                     /db_xref="GI:58261330"
                     /db_xref="GeneID:3254834"
                     /translation="MFKKPLAHQSNATPIRSSARRQLLSAILEQYPSLLPQDGMDDNS
                     KKELNKLILPEGVRTATFETSTGLEGTFWLSPNGDPLWMTLGRNSKEYIPTLSLLALP
                     LPRPPLPIIQIYHPLPPPILTGAPLFIPAVRNIDKPHRLPAVKKNQLVAFVTSPTKDD
                     NVHYIGVGRVAAEGGMKGAWERRLDHLMDGGDREEGKFSDILCIIDDHLWDLGSKPTL
                     STFILPPPHNPLIAPPEGSEPIPKSSSPPAVQHLSISAEDDAKASMPVSTSLSPSEIS
                     SLLSLSLLQALSGLQPSAFPMSASLLYSSHILPSRPAHIPQAKRDEVVIGKSEWKRLA
                     KWMKEAGKEGIVKIKESKGEVTVVRLVNCLFDSRHPSLQAHVDYMTIAQEETKAAKKA
                     AREAASDQPTSGYKQSLDIEELWKPAGGAISFWEACGISKSDYHSPSALKQAVDGYIT
                     SHNLLHPTNHRFILLDDELGRAVGIKKPEAGEKMARDEIINKLKNGVSWVVSIGGTIK
                     KGALQPITMTVKSRGGRRTVTHVTGLELFNVDIESFAEDMRKRCAGSASIQPREGVSP
                     KLGLQEVLVQGSQQKLITEALVERGVPKRWIMDEGDKKGKK"
     gene            497760..497849
                     /locus_tag="CNL05380"
                     /db_xref="GeneID:3254920"
     tRNA            497760..497849
                     /locus_tag="CNL05380"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:3254920"
     gene            497996..500102
                     /locus_tag="CNL05390"
                     /db_xref="GeneID:3254855"
     mRNA            join(497996..498409,498471..498529,498589..498718,
                     498780..499148,499204..499558,499606..499721,
                     499779..499948,500005..500102)
                     /locus_tag="CNL05390"
                     /product="cAMP-specific phosphodiesterase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538387|gb|CF684228.1,gi|41538394|gb|CF684235.1,
                     gi|41553401|gb|CF699242.1,gi|41553406|gb|CF699247.1,
                     gi|41573414|gb|CF719255.1,gi|41573419|gb|CF719260.1,
                     gi|41575986|gb|CF721827.1"
                     /transcript_id="XM_568076.1"
                     /db_xref="GI:58261331"
                     /db_xref="GeneID:3254855"
     CDS             join(498222..498409,498471..498529,498589..498718,
                     498780..499148,499204..499558,499606..499721,
                     499779..499948,500005..500012)
                     /locus_tag="CNL05390"
                     /codon_start=1
                     /product="cAMP-specific phosphodiesterase"
                     /protein_id="XP_568076.1"
                     /db_xref="GI:58261332"
                     /db_xref="GeneID:3254855"
                     /translation="MGNGTQFRSRIDISATGKTTAARASEHNSMKGFQDVIDQTSEPA
                     FEIVVLGSGGGPLETDCAGYLVKAIDQRWEDGILGLEGGSGLGALSALFSSQSPDTMF
                     PGITFPTDYSTPLLQASYVFSFVSGYLITHAHLDHVQSLIMLTGSAPPRPNLAASTCA
                     SVSQPLPPLCPIVYGTTGTLEKLSTAYTGQIWPELVAWVPGHNEDRKTEAPKKRRKVN
                     QADKHTKSKSPESDTRLPCNKNSTASLVLSPLQTNSPPQSLIGAPSLGVRLYPLVHGS
                     TSKETYESSGAFIRHMPLPYLSPKPVTSVRSRRKPVEGKEFLFLGDMESAYRKSGENG
                     THQELRAKAGRLNSVIWEEAAKSWIEGRLCGIFIECSYDSSRLGQHMYGHLSPPAVYH
                     ELKVLAGHVSRTKTRPLDGLKIFITHIKESLVPHPEGKTQHEIIMAQLQELEKDGKLG
                     VAFIRPVKGDRIIL"
     gene            complement(501113..505202)
                     /locus_tag="CNL05400"
                     /db_xref="GeneID:3254955"
     mRNA            complement(join(501113..501315,501366..501452,
                     501508..501610,501665..501836,501890..502076,
                     502124..502185,502238..503284,503337..503603,
                     503653..503721,503772..503914,503988..504046,
                     504106..504197,504252..504337,504385..504840,
                     504911..504947,504992..505202))
                     /locus_tag="CNL05400"
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /transcript_id="XM_568078.1"
                     /db_xref="GI:58261335"
                     /db_xref="GeneID:3254955"
     mRNA            complement(join(501113..501315,501366..501452,
                     501508..501610,501665..501836,501890..502076,
                     502124..502185,502238..503284,503337..503603,
                     503653..503721,503772..503914,503988..504046,
                     504106..504197,504252..504337,504385..504571,
                     504628..504947,504992..505197))
                     /locus_tag="CNL05400"
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41555180|gb|CF701021.1"
                     /transcript_id="XM_568077.1"
                     /db_xref="GI:58261333"
                     /db_xref="GeneID:3254955"
     CDS             complement(join(501142..501315,501366..501452,
                     501508..501610,501665..501836,501890..502076,
                     502124..502185,502238..503284,503337..503603,
                     503653..503721,503772..503914,503988..504046,
                     504106..504197,504252..504337,504385..504599))
                     /locus_tag="CNL05400"
                     /codon_start=1
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_568078.1"
                     /db_xref="GI:58261336"
                     /db_xref="GeneID:3254955"
                     /translation="MFANESLHVVEDGYISLLATSMVSAICTIFEIICAICFQDLHDL
                     FMIFYLLLTVPWMFLSSGNANRDSQHKRRLPFYGFLATIPPLMWFYYRHSALRIPGAY
                     TYYSMFEWSLVFWDLAFDALSVLELNHLQITFIDTSSPSSQIGIAENAGQSAFYLAKP
                     SIPEHLEDQIHIDWTSQGVGKPSPAWRQAVAWLSDVYFAICFWTVFTGLGFQLFYWSV
                     WKLALAGSEFALAANLAGYLFAFKSAHRYLVSRDGQITQRIVTVICGMGCYFFPWPAA
                     RLLGVTIGTWAGWSAMFGTWTRVKGSQEMIAEGQIIGLGMVIVMLLKYANKSTNPFWC
                     LVNEASGGWNKTGLVLATICLAEFACRPTDLHPASPLVDSSSKKTEKQIPRPLPTKMH
                     TRLITIGLGTLIHLLQTFMMDAGTIISWTWTGYPIKGPTLHPHAGFVIAAASAGLIAP
                     RFSLTSAWSLLGCISAYVLYFYPDWIGFYGGLGLTTYLTSITPAYIRAASACNPATTF
                     GNALLVKIIFDVASVVTTAYAFVPLGWTLRERTDLILGGCMLATAIGAWASNNLVLPT
                     ASELPLRTQRRTRAVTQFTLIASAFLSIFSVVFGYSQVPTEKPLPYYPEHRIFSGGIW
                     TVHFGVDKEGRDSQRRMRELVRDMQVDVLGLLETDLHRFVYGNRDLTRSIAEDLGYYV
                     DLGPGPNKHTWGAALLSKFPIVNSSHHLLPSPHGELAPAIFATLDIHGEEVNVMVSHN
                     GQEEDLLDRELQTTEIARILRSTASTPAVFLGYLVTRTGDRRPWPYQILMEDGKMWDI
                     EIGDRWRWCEYIAFRGLWRIAFARVHESDITDTELQVGKFMLAKPGERVVYENNQELY
                     WHIGENDIPQPWRMPSMFRGKGARGHRYVVWDGPLYYMPPVQSQLRGYGWDWSNDFES
                     AAVERI"
     CDS             complement(join(501142..501315,501366..501452,
                     501508..501610,501665..501836,501890..502076,
                     502124..502185,502238..503284,503337..503603,
                     503653..503721,503772..503914,503988..504046,
                     504106..504197,504252..504337,504385..504536))
                     /locus_tag="CNL05400"
                     /codon_start=1
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_568077.1"
                     /db_xref="GI:58261334"
                     /db_xref="GeneID:3254955"
                     /translation="MVSAICTIFEIICAICFQDLHDLFMIFYLLLTVPWMFLSSGNAN
                     RDSQHKRRLPFYGFLATIPPLMWFYYRHSALRIPGAYTYYSMFEWSLVFWDLAFDALS
                     VLELNHLQITFIDTSSPSSQIGIAENAGQSAFYLAKPSIPEHLEDQIHIDWTSQGVGK
                     PSPAWRQAVAWLSDVYFAICFWTVFTGLGFQLFYWSVWKLALAGSEFALAANLAGYLF
                     AFKSAHRYLVSRDGQITQRIVTVICGMGCYFFPWPAARLLGVTIGTWAGWSAMFGTWT
                     RVKGSQEMIAEGQIIGLGMVIVMLLKYANKSTNPFWCLVNEASGGWNKTGLVLATICL
                     AEFACRPTDLHPASPLVDSSSKKTEKQIPRPLPTKMHTRLITIGLGTLIHLLQTFMMD
                     AGTIISWTWTGYPIKGPTLHPHAGFVIAAASAGLIAPRFSLTSAWSLLGCISAYVLYF
                     YPDWIGFYGGLGLTTYLTSITPAYIRAASACNPATTFGNALLVKIIFDVASVVTTAYA
                     FVPLGWTLRERTDLILGGCMLATAIGAWASNNLVLPTASELPLRTQRRTRAVTQFTLI
                     ASAFLSIFSVVFGYSQVPTEKPLPYYPEHRIFSGGIWTVHFGVDKEGRDSQRRMRELV
                     RDMQVDVLGLLETDLHRFVYGNRDLTRSIAEDLGYYVDLGPGPNKHTWGAALLSKFPI
                     VNSSHHLLPSPHGELAPAIFATLDIHGEEVNVMVSHNGQEEDLLDRELQTTEIARILR
                     STASTPAVFLGYLVTRTGDRRPWPYQILMEDGKMWDIEIGDRWRWCEYIAFRGLWRIA
                     FARVHESDITDTELQVGKFMLAKPGERVVYENNQELYWHIGENDIPQPWRMPSMFRGK
                     GARGHRYVVWDGPLYYMPPVQSQLRGYGWDWSNDFESAAVERI"
     STS             506146..506395
                     /standard_name="AG17"
                     /db_xref="UniSTS:470731"
     misc_feature    506314..506357
                     /note="GA-rich"
     gene            complement(509361..511529)
                     /locus_tag="CNL05410"
                     /db_xref="GeneID:3254823"
     mRNA            complement(join(509361..510304,510352..510594,
                     510632..510779,510830..510901,510948..511012,
                     511064..511114,511163..511200,511258..511529))
                     /locus_tag="CNL05410"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41548285|gb|CF694126.1,gi|41548289|gb|CF694130.1,
                     gi|41550160|gb|CF696001.1,gi|41554525|gb|CF700366.1,
                     gi|41555708|gb|CF701549.1,gi|41558774|gb|CF704615.1,
                     gi|41558782|gb|CF704623.1,gi|41567631|gb|CF713472.1,
                     gi|41567639|gb|CF713480.1"
                     /transcript_id="XM_568079.1"
                     /db_xref="GI:58261337"
                     /db_xref="GeneID:3254823"
     mRNA            complement(join(509361..510304,510352..510594,
                     510632..510779,510830..510901,510948..511012,
                     511064..511114,511163..511192,511258..511525))
                     /locus_tag="CNL05410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568080.1"
                     /db_xref="GI:58261339"
                     /db_xref="GeneID:3254823"
     CDS             complement(join(509543..510304,510352..510594,
                     510632..510779,510830..510901,510948..511012,
                     511064..511114,511163..511200,511258..511411))
                     /locus_tag="CNL05410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568079.1"
                     /db_xref="GI:58261338"
                     /db_xref="GeneID:3254823"
                     /translation="MVIDCVMSEHRAIRKHAAQHDLFNRLHSIATDEEFVKRVGKSWY
                     NNRFEVVPNQRCGNWYCDPTSSSNAYAYFKSTDGHMFHWDFNLRRSNLSLASYAEAKG
                     GLILVDSTRQGKRMPDGLSKTVPIWCAVINIAVSLRHDVPQDWDTNIYLSPQIVPPTE
                     RSQIESKLRAWAESLERSSLPLPHLARPLRPFFIHPSTSYAPSIPETPEYIPIICLSA
                     SRWVSKGGDDIPSVTSIGQRKVGFEYVPGGGDDDELWARGLKPLLFHQHKKDLLSVER
                     DDLPSLVDRLVKSADPVAGINTSLMDCDLSSSVLAGVPTPNSLMALDIGPPSTKAPWS
                     LSPSEVLRVVPVDKYPKNTPFLLGVHPSERVLAVPSAKTDGKFYATALRELVDHVRKV
                     SIEQSKPIVLRPGKAVDVRKAIASVNNAQSIDPAAIKITSPSFLVDARKVILPLALVI
                     LCALPGISESSTHALPAESNLSKDHVADRLHRLVALWPDGNPPRVALKRVNEFLMSES
                     RK"
     CDS             complement(join(509543..510304,510352..510594,
                     510632..510779,510830..510901,510948..511012,
                     511064..511114,511163..511192,511258..511365))
                     /locus_tag="CNL05410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568080.1"
                     /db_xref="GI:58261340"
                     /db_xref="GeneID:3254823"
                     /translation="MRLSTICSTDCTPLQQMKNLLNEWGSHGTITVLRSFRCGNWYCD
                     PTSSSNAYAYFKSTDGHMFHWDFNLRRSNLSLASYAEAKGGLILVDSTRQGKRMPDGL
                     SKTVPIWCAVINIAVSLRHDVPQDWDTNIYLSPQIVPPTERSQIESKLRAWAESLERS
                     SLPLPHLARPLRPFFIHPSTSYAPSIPETPEYIPIICLSASRWVSKGGDDIPSVTSIG
                     QRKVGFEYVPGGGDDDELWARGLKPLLFHQHKKDLLSVERDDLPSLVDRLVKSADPVA
                     GINTSLMDCDLSSSVLAGVPTPNSLMALDIGPPSTKAPWSLSPSEVLRVVPVDKYPKN
                     TPFLLGVHPSERVLAVPSAKTDGKFYATALRELVDHVRKVSIEQSKPIVLRPGKAVDV
                     RKAIASVNNAQSIDPAAIKITSPSFLVDARKVILPLALVILCALPGISESSTHALPAE
                     SNLSKDHVADRLHRLVALWPDGNPPRVALKRVNEFLMSESRK"
     gene            511669..511757
                     /locus_tag="CNL05420"
                     /db_xref="GeneID:3254916"
     tRNA            511669..511757
                     /locus_tag="CNL05420"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:3254916"
     gene            complement(512436..512524)
                     /locus_tag="CNL05430"
                     /db_xref="GeneID:3254913"
     tRNA            complement(512436..512524)
                     /locus_tag="CNL05430"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:3254913"
     gene            complement(512920..516445)
                     /locus_tag="CNL05440"
                     /db_xref="GeneID:3254979"
     mRNA            complement(join(512920..513154,513214..513301,
                     513356..513523,513579..513640,513690..513703,
                     513757..513818,513870..513989,514044..514094,
                     514149..514228,514282..514341,514394..514486,
                     514535..514559,514606..514674,514728..514802,
                     514852..514938,514997..515109,515306..515542,
                     515610..515844,515895..515912,515969..516022,
                     516074..516141,516191..516217,516272..516445))
                     /locus_tag="CNL05440"
                     /product="glycosyl hydrolase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41548181|gb|CF694022.1,gi|41548189|gb|CF694030.1,
                     gi|41549140|gb|CF694981.1,gi|41549149|gb|CF694990.1,
                     gi|41562542|gb|CF708383.1,gi|41562560|gb|CF708401.1"
                     /transcript_id="XM_568081.1"
                     /db_xref="GI:58261341"
                     /db_xref="GeneID:3254979"
     CDS             complement(join(513059..513154,513214..513301,
                     513356..513523,513579..513640,513690..513703,
                     513757..513818,513870..513989,514044..514094,
                     514149..514228,514282..514341,514394..514486,
                     514535..514559,514606..514674,514728..514802,
                     514852..514938,514997..515109,515306..515542,
                     515610..515844,515895..515912,515969..516022,
                     516074..516141,516191..516217,516272..516340))
                     /locus_tag="CNL05440"
                     /codon_start=1
                     /product="glycosyl hydrolase"
                     /protein_id="XP_568081.1"
                     /db_xref="GI:58261342"
                     /db_xref="GeneID:3254979"
                     /translation="MLEPTDIPNKSLDKSGSPVRSIQDHALIGNLRTAALVSVDGSIE
                     SMCIPYFDSPSVFARILDAEKGGHFSIAPTWPFKPKQAYAPNSNVLVTKFLSERGVGV
                     MTDLLVPRGANLNNSSSRAFLPWLIRKVESIRGTVPFKMECAPAFNYCRDKHTAEIVP
                     DDSSSNVISQGTKVLFKSPSFTLDLRTITWSSDQCVSDPEIKLQIEDLSERGLLGPAA
                     ACDFELEEGQCVVFVMRESLVAALIRDTTSYWKKWIGGIKYSGRWRQAMLRSALTLKM
                     LVFEETGAIVAAPTFSLPEFIGGQRNWDYRFTWVRDSSFTLYALIRLGFTEEADAFVN
                     FILERLKDRNSDGSLQIVYTIHGGKDLEEIELSHLAGHKGSKPVRIGNGAADHLQLDI
                     YGELLDCIYLAQKYSKPLGWDSWVAVRQVVDYVCGQVDNPDLSIWEVRGQQKNFTYSK
                     IMMWVAIDRGIRLADKRCLPCPNRSKWLETRDRLYETIQNKAWNPAKQIFAQSYEDLN
                     TLDSAVLIMPLVFFISAADPRFTNTLDAILKTPEKGGLTANNSVYRYNAQLSDDGVGG
                     EEGAFSLCTLWCVEALTRAGVYNAKYLDYAMNMFIDFLGYGNHVELYSEEISPGGEGL
                     GNTPQAFSHVTLISAGFNLDRALSGNGRSAWA"
     gene            <520509..>522889
                     /locus_tag="CNL05450"
                     /db_xref="GeneID:3255029"
     mRNA            join(<520509..520557,520620..520656,520714..521240,
                     521297..521446,521494..521898,521934..522043,
                     522098..522180,522230..522362,522414..522516,
                     522569..522640,522702..522763,522830..>522889)
                     /locus_tag="CNL05450"
                     /product="sodium:inorganic phosphate symporter, putative"
                     /transcript_id="XM_568082.1"
                     /db_xref="GI:58261343"
                     /db_xref="GeneID:3255029"
     CDS             join(520509..520557,520620..520656,520714..521240,
                     521297..521446,521494..521898,521934..522043,
                     522098..522180,522230..522362,522414..522516,
                     522569..522640,522702..522763,522830..522889)
                     /locus_tag="CNL05450"
                     /codon_start=1
                     /product="sodium:inorganic phosphate symporter"
                     /protein_id="XP_568082.1"
                     /db_xref="GI:58261344"
                     /db_xref="GeneID:3255029"
                     /translation="MPVLHQWDYLFAFGVLFAALDAYNIGANDVANSFATSISSRSLT
                     LRQAAMLAAICEFLGGVLAGAQVASTIKNGIISMSAFRNNPGIELLAFVCALAASATW
                     LMIATRKAWPVSTTYSIVSALAGVGVALDGPGAVQWGWNDGKGIATIFAGFAIAPAIS
                     AGFGATVYLITKYAVLTRKNPLKAGLYVSPIYFFTVAAILTMSIVYKGAPQLKLNKLP
                     QTTIALAIVLTGVVIAFLSVIFWLPFVYSKVIKKDYTLRWYHFFYGPLLWRRAAPPPP
                     PEGARHVPDYRVYDRDDEHKEPTTETPTNPVSEGSTEGEGAPLETNLTVTSHEKDKDI
                     ESAPLQSLSKGKPYASALEDLEKDDHKIEGAIILPRNLWILFRYKLPKMLLHGTSANK
                     NPVDIHAMQSHEGKGKESDRMMKMYQHAAQYDNETEHLYSFLQVLTACTNSFAHGSND
                     LANAVGPFAAIYYVWSTGTVTPSETETPVWIFVAGGLMLVIGLATYGYNIMSVLGNRL
                     TMHSPSRGFSMELGSSITVLLASQYGIPVSTTMCITGATAGVGIVSGGIKSINWRAFG
                     WIFLGWVLTVPIAGTAAGCLTGIIINAPRF"
     gene            523297..527335
                     /locus_tag="CNL05460"
                     /db_xref="GeneID:3254929"
     mRNA            join(523297..524103,524149..524336,524381..524600,
                     524666..524744,524802..525305,525356..526090,
                     526143..526274,526338..526352,526405..526563,
                     526622..526855,526909..526961,527013..527335)
                     /locus_tag="CNL05460"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538853|gb|CF684694.1,gi|41538859|gb|CF684700.1,
                     gi|41551234|gb|CF697075.1,gi|41551247|gb|CF697088.1,
                     gi|41559489|gb|CF705330.1,gi|41559497|gb|CF705338.1,
                     gi|41567405|gb|CF713246.1,gi|41574629|gb|CF720470.1"
                     /transcript_id="XM_568083.1"
                     /db_xref="GI:58261345"
                     /db_xref="GeneID:3254929"
     CDS             join(523609..524103,524149..524336,524381..524600,
                     524666..524744,524802..525305,525356..526090,
                     526143..526274,526338..526352,526405..526563,
                     526622..526855,526909..526961,527013..527195)
                     /locus_tag="CNL05460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568083.1"
                     /db_xref="GI:58261346"
                     /db_xref="GeneID:3254929"
                     /translation="MSSTATTCQPHQNNTEIMLETPDLAVRPQKVQATSPPTGSITEP
                     LSPQPPPAYLQPQSTPKVDSTPKDSGTSASSALTPPKLLSTHLVKHPNHTVAKAIRTN
                     FPQPNPLLRLIKRFRVKHSVIEGLTEQEMRKCEERGEELRRKAGWKFEGEKGEGAVVS
                     QLFWKMYISLLPTLDRDPLSGLVPPDLLGSTTTMPLSIISLIPDIMQHYRDVIVRAKK
                     EVFLATNYWQRPSNSVNTISQALHDLSARVLKEGRPKVIVKIMYDRGSWEQLWNAHAP
                     VHHSEWTPLDLPAKEDTKGLDMEVIVLLGTFHAKFLIVDRKVALINSNNIQDRPNLEL
                     MSHFEGPVVDAFYEIALHSWYNRLNPPLPCMTKPYEPPRGPDGKVHYLFQDQNPYFDD
                     IEILKAAKAARILLRRQTKDNEAEAAHHEGAGERLREAVRKVVDQQRQSLADWKPGEE
                     FEAKAQTAMKELREFKDRWGLGMGMMGTGSRANSRGPSRRPSKEKHRDEEKTHTLPAP
                     SEANSSPTITAELPPKSKTYPLPNDRTDGVWNSYILGDEIPRENESDVISRHSPEGGC
                     VAEERALSKKHVCFAPLEMKGVDGMGKIFPDAGTTESPNITTTHLPLETTQDASSNCS
                     PIEDITPQTGFHVQNSTIPEEDATYTADSIATKPASKMDGPRTSETRTREPPASETNE
                     PLPLSAQMPEESGETYEKTKKHLEMDISQEKNAWKPKKEEIQPEGTGSRRMFQLSKKF
                     NAGALSDAWATVEDSDELDNFRPHVVHAPHDPFPIAMCCRKPHGLPGHHDIRNPQNAA
                     WLAGFRYAKRKVFVQTPTLNARPIVRAIKQACRRGVEVVLLLDLGFNDKGESIPFQGG
                     TNEEVVDRLYKKLSSEKKEQYLKVYWYTGKDQVRPLNAVKKQRNCHIKFAAYDDEVLI
                     IGNGNQDSQSWFHSQEVNVMIDSKQIVAEMMDTLLSNQNTIKYGLVSSDGIWRDKDGH
                     TLEHYGATAKGAFRGLSGFIAFAKSI"
     gene            527596..529301
                     /locus_tag="CNL05470"
                     /db_xref="GeneID:3254819"
     mRNA            join(527596..527748,527799..528074,528125..528184,
                     528240..528522,528571..528679,528731..528962,
                     529010..529301)
                     /locus_tag="CNL05470"
                     /product="alanine-glyoxylate transaminase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531716|gb|CF677557.1,gi|41531723|gb|CF677564.1,
                     gi|41557357|gb|CF703198.1,gi|41557366|gb|CF703207.1,
                     gi|41560175|gb|CF706016.1,gi|41560187|gb|CF706028.1,
                     gi|41561592|gb|CF707433.1,gi|41561599|gb|CF707440.1"
                     /transcript_id="XM_568084.1"
                     /db_xref="GI:58261347"
                     /db_xref="GeneID:3254819"
     CDS             join(527711..527748,527799..528074,528125..528184,
                     528240..528522,528571..528679,528731..528962,
                     529010..529160)
                     /locus_tag="CNL05470"
                     /codon_start=1
                     /product="alanine-glyoxylate transaminase"
                     /protein_id="XP_568084.1"
                     /db_xref="GI:58261348"
                     /db_xref="GeneID:3254819"
                     /translation="MSDFHQAPHKLLVIPGPIEFSDPVLAANATPGTAHTSPAFIPVF
                     GEALSLLRDVLLSAKESGSQPLLIAGSGTLGWDAVAANLIEKGEEAVVLNTGYFSDSF
                     GECLEAYGAKVTHVKAEVGGIPTDDAIISALASKPKLLTITHVDTSTGVLSPADHIAS
                     LVKKHSPDTLIALDAVCSVASEEIKFDEWGLDVVLSATQKGLGVPPGLSVVLASKRAV
                     ETVEKRKTPIPAYYVSWKKWIPIMQNYESGKPSYFATPPVQLVYALHTSLKSITSAPL
                     ADRFKAHKAASAYVKDSLAELGLEFVPKSRDIAANGMTAVRFPKGVKAPDVLPKLAER
                     DIVVAAGLHKAIVSEYFRIGHMGITAVDRQRGDLEKVVKGIKEVLGKA"
     gene            529453..529543
                     /locus_tag="CNL05480"
                     /db_xref="GeneID:3254911"
     tRNA            529453..529543
                     /locus_tag="CNL05480"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:3254911"
     misc_feature    529741..529775
                     /note="AT_rich"
     gene            531123..533473
                     /locus_tag="CNL05490"
                     /db_xref="GeneID:3254860"
     mRNA            join(531123..531239,531295..532029,532083..532195,
                     532248..532368,532418..532442,532494..532630,
                     532682..532843,532904..532931,532985..533142,
                     533196..533251,533313..533473)
                     /locus_tag="CNL05490"
                     /product="endopeptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41558171|gb|CF704012.1,gi|41558180|gb|CF704021.1,
                     gi|41564858|gb|CF710699.1,gi|41565382|gb|CF711223.1"
                     /transcript_id="XM_568085.1"
                     /db_xref="GI:58261349"
                     /db_xref="GeneID:3254860"
     CDS             join(531662..532029,532083..532195,532248..532368,
                     532418..532442,532494..532630,532682..532843,
                     532904..532931,532985..533142,533196..533251,
                     533313..533422)
                     /locus_tag="CNL05490"
                     /codon_start=1
                     /product="endopeptidase"
                     /protein_id="XP_568085.1"
                     /db_xref="GI:58261350"
                     /db_xref="GeneID:3254860"
                     /translation="MSQTSAFDSSVPSATDRVSNINSDSESNVGTLAVESSTTSISAS
                     DSFIVSTSGTHASISSFGASSQSDSTSASTTFSQSKWAQPSDSSASLTGVMSQNNAIV
                     YTIDVTIGDGGTTLPVLVDTGSADIWIAASKCENCRAASMVDSGLILPEGCKEEDKGY
                     GSGSVKGCLVNTNITIGTYELEQFHVLAASDSQGFDGSYMSGIFGLAMNKSSINNQAT
                     PMDILSQLGMISTPEVGFYLTRTESGSELVFGSPHNNPHADQSKKVTLPKVATDDGLY
                     RVTMDGFVSHGYMVQSSKGSVNMENIEVILDTGTSDIRVPEDMLLPIYAALGNGTYYS
                     DTLTGDLVVPCNNNDDDAALALQFEGQQFSLSWQDLIANPSSTDANYCYCRIQASPSE
                     ISDYLIVGSIFFHNVYHVINTDTGNTTLYGLVD"
     gene            <534350..542306
                     /locus_tag="CNL05500"
                     /db_xref="GeneID:3255015"
     mRNA            join(<534350..535694,537134..537318,537692..540229,
                     540281..540551,540741..541222,541278..541810,
                     541865..541925,541978..542306)
                     /locus_tag="CNL05500"
                     /product="sulfite reductase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41551097|gb|CF696938.1,gi|41551106|gb|CF696947.1,
                     gi|41570050|gb|CF715891.1,gi|41570059|gb|CF715900.1"
                     /transcript_id="XM_568086.1"
                     /db_xref="GI:58261351"
                     /db_xref="GeneID:3255015"
     CDS             join(534350..535694,537134..537318,537692..540229,
                     540281..540551,540741..541222,541278..541810,
                     541865..541925,541978..542220)
                     /locus_tag="CNL05500"
                     /codon_start=1
                     /product="sulfite reductase"
                     /protein_id="XP_568086.1"
                     /db_xref="GI:58261352"
                     /db_xref="GeneID:3255015"
                     /translation="MPIDPDAYMAGAIPTLSRGGSWLQGERQLRDSTLPPSHLHEGSR
                     YSSSPGSNYNPQIPPTPGPSQFGGNPFILPRSPFQRPLSISDWALPSIYNGGRPPPMP
                     MLSQLQTDISGASFIQGLKSEQVFGPVQHHAWLKSSSEADQNSVTSRSFDVQSLVSGA
                     RSVTSSVSVPQNVKSIRRMQYSHHHFDEHSSPEQGRSWENRGGSPKPLAPEPGYGMKK
                     SPYMKLDGHLRRTSDASNQPPPYRKLSSQQIFPPVSSHDDYFLSSPTSSRHDGQLAIA
                     KHRYPHSPNFLSPRPRHKKLGDQDLFRSAQLNSRTARLSLAGRECRTPDPEPSPDLSG
                     YTIAPHAALRPSGGDDKRPSMERRHTASHIPEPTHASSSLPISPPIHKTLHQLKRTRH
                     NSSSRALSFESSSYDEQATSGSTIDFTMSSPMSSRSSAGSNQSTPVNKQFPHLKADTS
                     SQDSERSWSSWRLAEAHYMYLDGGCVCRRNWKAVKPGVAVGNASDATDRTEKSGGKRI
                     RIMSVLAAISSLPATSYYHPIAQVPAGASKLNPYLPLPQSSTPTVLFTNANLLHSLPT
                     ASLSRTVIHVFDAEEIVTPKGANAVSLISRSSQGAYDHALLSLRLAQDKDAVVYHFIP
                     SGLEGEIQTLEDAQAWLSGPLDAPDLSNGDDAEPSAEAKLIAAYESISLSLLKLTRRP
                     QRPFIHSKAESSRLVVNFLPSPVKSENTIDVVLAIPAPKEKLSSSLSGVQEVVVVEAG
                     SGKYGPAWASVVDALEGADVTIRSVLVGASASSEEIAAAITGDTPITRIGKPLSYNIP
                     SNAVTVPSPESTYTELLASSPSPLEVLNDPSHLAANESTSPLYAFGKAVAIRKERARL
                     VELAKKVLKAPNTKPEVHEALSAWLLVRDEKKGAVEAGKKVEAAIGAGKGDEKEIVEL
                     GQKGHWEKRALWIVISNSWAVDLASSGLHHALASGLDINLLVYETAASPFSPNAPAQP
                     PKERKKDLALYALNMGDVYVASVAVYADYAGVLNAMREAENYSGPGLVLAYLPWGEKE
                     DGQAVSDSENAGPLERLRETKRAVSGGWWPMFRWNPSLPDEKRFSLDSSHIKAALSEF
                     LDRQSHLSQLTLATPAIDSSVTSSAGTELLAARKEKARKAYDALLNSLDGPGLLVLYA
                     SDGGNAEKLAKRLVGRAKMRGVSASLRVLDEVAGSIVETLSQEQNVLIVSSTAGQGES
                     PLNGREFTKALSKLSPSDEFKETKVAVFGMGDSHYWPRPEDAGYYNKPARDLFPKLIS
                     LGCQELLPLGLGDDSDPDGVQTGYKPFEASLWRALGVDSVEVTEEKEEVVANEHIKIA
                     SDYLRGTILEGLADKSTGAISASDAQLTKFHGTYMQDDRDIRESLKAQGLEPAYSFMI
                     RVRMPGGICSAKQWLDMDRISDEHGNGTFKLTTRQTFQFHGIIKSHLKKAMQAINKSL
                     LDTIAACGDVNRNVQCTVNPSLSKTHATVYEFSKAVSEHLLPATNAYHEIWLDKKKIS
                     GDAVQPFDSDSEPLYGPYYLPRKFKIAIAVPPDNAVDVFTNDVGFIAIVENDEVIGYN
                     VSVGGGMGVTHGNKKTYPRLGDVIGFITPEDGKKVAESIMLVQRDHGNRQDRKNARLK
                     YTVDRLGLPKFKAFVEERWGKKFAPARAYHFDSNLDHYGWSQGHDGKWHFTMFIENGR
                     VEDNSRHQFKAGLREIASVHKGTFRLTANQHLILSDIASEDLDEMKRLLAKWGLDNLD
                     HSGVRLSSSACVAFPTCGLAMAESERYLPVLIDKVEKICEEAGVKSDDLVMRMTGCPN
                     GCARPWAAEVAFVGKAPGSYMMMLGGSHLGTRLNKPFLESASEPEILAVLKPMIKRWA
                     LERHEGERFGDWTIRAGYIKPTTHGTNFWEDAFPAQAGTTVTA"
     gene            544272..545121
                     /locus_tag="CNL05510"
                     /db_xref="GeneID:3254829"
     mRNA            join(544272..544359,544434..544456,544701..544821,
                     544888..544906,545010..545121)
                     /locus_tag="CNL05510"
                     /product="expressed protein"
                     /transcript_id="XM_568087.1"
                     /db_xref="GI:58261353"
                     /db_xref="GeneID:3254829"
     CDS             join(544330..544359,544434..544456,544701..544821,
                     544888..544906,545010..545041)
                     /locus_tag="CNL05510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568087.1"
                     /db_xref="GI:58261354"
                     /db_xref="GeneID:3254829"
                     /translation="MPAYIRRTQLGFAGITPERLRFWGTSAAVWGVAAGAAVSFYLSE
                     VPIFQKDVLIKVPVVGSYFKDTTPDSDKPF"
     gene            545389..547234
                     /locus_tag="CNL05520"
                     /db_xref="GeneID:3254813"
     mRNA            join(545389..545453,545776..545834,545923..546018,
                     546313..546369,546429..546457,546506..546573,
                     546626..546860,546906..547234)
                     /locus_tag="CNL05520"
                     /product="ras-related protein ypt1, putative"
                     /transcript_id="XM_568088.1"
                     /db_xref="GI:58261355"
                     /db_xref="GeneID:3254813"
     CDS             join(545802..545834,545923..546018,546313..546369,
                     546429..546457,546506..546573,546626..546860,
                     546906..547005)
                     /locus_tag="CNL05520"
                     /codon_start=1
                     /product="ras-related protein ypt1"
                     /protein_id="XP_568088.1"
                     /db_xref="GI:58261356"
                     /db_xref="GeneID:3254813"
                     /translation="MSAPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGV
                     DFKIRTIELEGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDRDTYTNVKQ
                     WLQEIDRYAVEGVNKLLVGNKSDLATKKVVEYAEAKSFADELGIPFLETSAKNATNVE
                     QAFLTMSKQIKDRMGSSTMASGPGAKSTIKGLGQNVEQKTAGGCC"
     gene            548014..549578
                     /locus_tag="CNL05530"
                     /db_xref="GeneID:3254892"
     mRNA            join(548014..548147,548218..548304,548351..548619,
                     548670..549266,549327..549432,549486..549578)
                     /locus_tag="CNL05530"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543681|gb|CF689522.1,gi|41543698|gb|CF689539.1"
                     /transcript_id="XM_568089.1"
                     /db_xref="GI:58261357"
                     /db_xref="GeneID:3254892"
     CDS             join(548123..548147,548218..548304,548351..548619,
                     548670..549266,549327..549432,549486..549544)
                     /locus_tag="CNL05530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568089.1"
                     /db_xref="GI:58261358"
                     /db_xref="GeneID:3254892"
                     /translation="MSATASIETTIQQGADGQFLDLSSFVFPKMYDEQEMFDPFPGFD
                     SSTSAPHALVATPEVPHSGSPIELFAGQHPSRASTPIQQYTGLEMAVEEDDYSEEDLF
                     RENEKEVAYNEDTDWKMDDDDMHVTNVHIQDLPQYAPLCISTPRISPHLYASAPPPAL
                     PELLVSRLDEQHSARYPQLGRARVDLPAKKSNANKRESSTWVRRSTRVRSRNASELQH
                     RQCTIPDSPPNSSSTAASIATSSAESNYTVSPSPEPSRSRHCLSKGSTSCTPRLASSS
                     PEAQLIQLARQAEGAIRKKEKGRRASAKRNLQNKNAQKKYRDKKKNLAIRTFDFAVEM
                     TKLGCIIEGRMAKAFRDRVNGYLKDISAMDDNYLKEFMERTEMDCR"
     gene            549790..551753
                     /locus_tag="CNL05540"
                     /db_xref="GeneID:3254983"
     mRNA            join(549790..550428,550509..550617,550687..550824,
                     550876..551753)
                     /locus_tag="CNL05540"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535234|gb|CF681075.1,gi|41535244|gb|CF681085.1,
                     gi|41535691|gb|CF681532.1,gi|41535696|gb|CF681537.1,
                     gi|41537703|gb|CF683544.1"
                     /transcript_id="XM_568090.1"
                     /db_xref="GI:58261359"
                     /db_xref="GeneID:3254983"
     CDS             join(549850..550428,550509..550617,550687..550757)
                     /locus_tag="CNL05540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568090.1"
                     /db_xref="GI:58261360"
                     /db_xref="GeneID:3254983"
                     /translation="MTMSPPANPSSPRRSLRTRPSAVASTSTGTIVVNNKVERDGAAS
                     VNCQVVVDTNTTSSSSRSRPSISSASASIDTFARRLSKRPSNEVKEQEGEEELGTSGT
                     EEDEADEDRLSGEEDEDRKQEEEEQLPSGLGQSHGLSRSMTKPLTKYEEEGDSSVLNG
                     RLKKKRRVTERRTLQNKTAQKKYRDKKKFLALRTLDFAVSMTRVCSRGLEGKERKAFK
                     QILKDYLADVSELDQSYLADFLTKTGLHSKLLAE"
     misc_feature    550927..551055
                     /locus_tag="CNL05540"
                     /note="CT-rich"
     gene            complement(<552218..>553879)
                     /locus_tag="CNL05550"
                     /db_xref="GeneID:3254874"
     mRNA            complement(<552218..>553879)
                     /locus_tag="CNL05550"
                     /product="hypothetical protein"
                     /transcript_id="XM_568091.1"
                     /db_xref="GI:58261361"
                     /db_xref="GeneID:3254874"
     CDS             complement(552218..553879)
                     /locus_tag="CNL05550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568091.1"
                     /db_xref="GI:58261362"
                     /db_xref="GeneID:3254874"
                     /translation="MSPYPILAFLSNKLDRPPSVLAHSFLLLLLSGVLLNPYHLSGVI
                     VNILGLLWPGWLTIRHISSLQASSDAKVNPKPKFLARARVRTTRTGEKEWPSQTKRLI
                     DYWILYSFSTVVESTVAQDTLLALIPLWWAFKILAIVWGSISLSLGAADAAGASSGAK
                     EKTRPRPLVSPSIPGPRSNTRILTNAIPPQKLRTNSNLIRIPSPTIAKTSQTAYGDID
                     SSSSSSSPSQHSSSATAVDTSYTNPYPGISTGTGTGTGTRTGAAAETGPTPNSPELQA
                     SRDELGQISPVLSRTPEHLRPRHESAGPEGKEEGPATATSEYGSGVFGLSEVDRESEI
                     SDSDSDSDTGPDSDSNSETDPGSGSESDSNTNSDSDARSDSDPNAPFSDSSPLPRPPS
                     PSPSLATNPTSPNTSARPSHSNNPNPNPNPITANAANAAFTDDSNDIRLPLDTPLDEL
                     ALRGLKTIELEVEEEEEEQDGDGQAEIGHWEGREGREKEKSMKIDPAPVPSSPGNPTK
                     PPATRPQNPLGEMGEGSITRLTLDDLLALEDNGSFSPPPPPSRPV"
     repeat_region   552613..552638
                     /rpt_type=tandem
                     /rpt_unit_seq="ttgggg"
                     /satellite="microsatellite"
     repeat_region   553200..553225
                     /rpt_type=tandem
                     /rpt_unit_seq="gaa"
                     /satellite="microsatellite"
     gene            <554544..>559364
                     /locus_tag="CNL05560"
                     /db_xref="GeneID:3254858"
     mRNA            join(<554544..554724,554766..556470,556535..558371,
                     558438..558585,558651..558924,558986..559163,
                     559227..>559364)
                     /locus_tag="CNL05560"
                     /product="SSK22 like MAPKK kinase, putative"
                     /transcript_id="XM_568092.1"
                     /db_xref="GI:58261363"
                     /db_xref="GeneID:3254858"
     CDS             join(554544..554724,554766..556470,556535..558371,
                     558438..558585,558651..558924,558986..559163,
                     559227..559364)
                     /locus_tag="CNL05560"
                     /codon_start=1
                     /product="SSK22 like MAPKK kinase"
                     /protein_id="XP_568092.1"
                     /db_xref="GI:58261364"
                     /db_xref="GeneID:3254858"
                     /translation="MSNPTSPTDPPDAGPPAPAIASSSKTGRRSVRLFAPDEEDSSDE
                     DGLIGVPAETTFNDDEVPPSNTRSASYPGPPAHTSPTSKISSIVSSASAAQPKLARSI
                     TYVAPSAISSRPAYPLHPAGPETLHASYETWRKTRYTLESFSRAKADGKNAAQRGRSY
                     TDPDVGYFSPDAGDDGWGSDDEDELRSPGWGISHHNMDSGGKTDGSPQLPIKPADVTE
                     DEGQERLDWQGMLESVLNSDVFKVEEQRIYNSMPTDSFREEIGKTLWWQIRAKLRGRT
                     EAEEKKRVQERRARVVDPVLEEINEFKYDPKNNPEGEEDSDADPQDATSTAAPQSKAL
                     NQVNTILAKLHAVKGLYPNLAAMRADKSLYTDENFRKRADALTSWSIIVSSLQTQLKL
                     LQKWTGSDELDITKPNTTHEKALVGKYKYHHSIDSKGTPGRDAADDSSFLDRVIKEDN
                     LQRTFERRAFVDMINLVRNAKETVINYLPQFQEQNLPDFQYEIVRLIGFPGRLIIEAV
                     KVRLDAASRLLDPNPMVVEDFIENLRLSISLAVLIRKQYDEIMAPDAEGRWKIPHCLP
                     TEYNDVLLDALRTFFKLLHWRLRGVGKASYYKETEVLEEEAPFLYEAAEAIVGGDMVV
                     AEQYCALSNKLLIRSANYLDQQLRVPIHSHSRDKERGGDKERDGSSSSQRDRNRDGSL
                     AGPPKHMKVEELFSWYSKLLDSARMRHRKTQRFCRKLTQRFDNSAEYSIEETDVDVLV
                     ETLQDTGHFLVYTGKFEANGTYIVADGSLWGQPDDVRHLLKRVFSVTIPGSRVRPRQT
                     TSQVSGGGGVLANGQVAAAQPDPADPYPEADDFDDEALAAYILLISPRQNFVWSGAVM
                     TLDVDYIDYELADNRVRLIADGPTKRLALCKHYFTQALIHPDTGETIDLPCVVEAQAH
                     LPTIQKQLVKIAKSSYRLSECIVQSAPLVRNAFRGKPGSQELVENWYSFATEHGTRVL
                     VHIEPSAWDRFNRLLMRLAISWISFISQECNPTDRKTFRWTVAALTYAFNMTRGSNIL
                     ALDRSEFSLLRRYVGVCVSLLVSHFDILGARSSMEAKKEADRIEAMRRLQRLQENLDD
                     EFLPRTPTESGGQPRIDRSIRLTVEERLRLIAELEARRSELAPAPVGQVLDEEVSEDR
                     ALVFLAASKSNISMRWQQGAYIGGGASGSVYLGYSLQDNTVFAVKILPTVDLQSSPAL
                     YESIKRESDVMSLLSHPNVVGFLGLEVHRNRVCLFQEYCEGGSLAGMLEYGKIDDEEV
                     VGAFTIQLLRGLEYLHTNRIEHRDLKPENILIGANSVLKLADFGTAKIIKSNKTLART
                     RGGAHAKMEGLEGTPMYMAPEMIKNQRTGKLGACDIWGLGCIVLQMITGRKPWSFLDF
                     DNEWAIMFHLGATKEPPPLPDPNEMSDQGIEFIDQCLSLDPEARPVASELLQDEWLVP
                     MLEQMAELEQEYPDVLAMGQSDSLVPPPENASLTSNAPTLQDDITPPPLE"
     gene            complement(559575..562278)
                     /locus_tag="CNL05570"
                     /db_xref="GeneID:3254822"
     mRNA            complement(join(559575..560189,560255..560432,
                     560487..560819,560878..561180,561245..561421,
                     561478..561669,561731..561811,561908..562278))
                     /locus_tag="CNL05570"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531355|gb|CF677196.1,gi|41531361|gb|CF677202.1,
                     gi|41549893|gb|CF695734.1,gi|41549894|gb|CF695735.1,
                     gi|41555518|gb|CF701359.1,gi|41555523|gb|CF701364.1,
                     gi|41570195|gb|CF716036.1,gi|41570202|gb|CF716043.1,
                     gi|41573128|gb|CF718969.1,gi|41573134|gb|CF718975.1"
                     /transcript_id="XM_568093.1"
                     /db_xref="GI:58261365"
                     /db_xref="GeneID:3254822"
     CDS             complement(join(559651..560189,560255..560432,
                     560487..560819,560878..561180,561245..561421,
                     561478..561669,561731..561811,561908..562261))
                     /locus_tag="CNL05570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568093.1"
                     /db_xref="GI:58261366"
                     /db_xref="GeneID:3254822"
                     /translation="MEEPSSPRKPSPSSPPSSSSSPAGSLDLPSLQPLSHDHPLLTAP
                     TFDPDAFLLSRIHIPLEELRGELREYLGELREELVKLINEDYEEFLSLGIGLRGEEER
                     LKRLEGPLQGVRKEIVSVRDVLAEHQAKLQEKLDERAALREEKALLDLLQRLFDTLAK
                     AEALLDLPHTDELETSKLVTRVAGEYSQIVYLMNKARTEECAIVNVVEERIKNIKSRL
                     SKDLSTVLLSELENLNATGLKQCLKTYELIEGWEEAEEVVRKVFREYCRNTISSSALS
                     LPTSPTAPQTPHQLRNPLDVPRLPASYNTPLALLFNRVLAQVASYQPLLDASKEVSEK
                     FDFFARVFWPEIGDTIIERLGSVIFAAGRPDDLHKYYTTSHKFLDLLETIAPSAHNVL
                     AMRSSPSYTAFERRWQLPVYFQLRWKEIVSSLEQSLAGQPSYTSTSDHKGSKWVLVQS
                     GAVWKALESCWKEDVYISELAPRFWRLSLQISSRYGTYLKSTVDSYVITEEDNSQEDA
                     ALRFASAAVVDLENLAAKVKDLDVVKELNLGEHLTLPTTQYTSKILSILTRRCTDPLK
                     LIRSIASQFRSSPTPSTPSSTRQPSYFVPSVFKPLHSLLSSQPQLKERYQQDFSRQIA
                     DAVFVNYASTLASVKKTEDLLRKHRKSKKSGITSFFGGGGHDGGSGEKEEERFTNQMK
                     VDIDALKEDAKGLGVDPESMNSWNELLAVVNKPDEA"
     misc_feature    562139..562234
                     /note="G-rich"
     gene            complement(<562801..>564876)
                     /locus_tag="CNL05580"
                     /db_xref="GeneID:3254734"
     mRNA            complement(join(<562801..563571,563850..564041,
                     564115..564405,564640..>564876))
                     /locus_tag="CNL05580"
                     /product="hypothetical protein"
                     /transcript_id="XM_568094.1"
                     /db_xref="GI:58261367"
                     /db_xref="GeneID:3254734"
     CDS             complement(join(562801..563571,563850..564041,
                     564115..564405,564640..564876))
                     /locus_tag="CNL05580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568094.1"
                     /db_xref="GI:58261368"
                     /db_xref="GeneID:3254734"
                     /translation="MGACHSRNHFISPPSIHTSTAAPTLPFTSKSYSPVSFPNPIVQV
                     PDDRLPEFIATLHLESQCNKLQGISVAYKFHPNNQGTNMPTRPVDKPTSAVSTATTTT
                     TATKKVCQHLSPSVYPLIKHLYQRPSLPSLHSLRNKSTCSVFSVNSVPQGEQNPVMIV
                     PTPAQAAAPCFNVEDEMTYPRRMSVYSPASNETADFIPPRRGIRPLFLQEKYGTSSRE
                     SLKNKNKNTASGGVAAESEHARSKASSNRISFKTNSFAARITSAFRRSSKPISLKIDI
                     PSSSNFVQQPAKPHLQPLEFGGRFDDNPFIGQPAKFAADAVSSTVTISTPDLVFSSLR
                     SPFPSSVSSTSSLSAYSADSYVESSQAISVVVTPPTEPPSGSQTPNNEPEEPPLTAAS
                     TDTEFSDMAIHTPTDSSFVQPTFYSQEAQSHITTTELVTRPALIPTACGSRFIEMFDT
                     IIAFPDSTSGSASPEIRTPVLTPIDYQAYPQPAYRDINTFLAYSPP"
     gene            <565868..>566850
                     /locus_tag="CNL05590"
                     /db_xref="GeneID:3254931"
     mRNA            join(<565868..565978,566139..566416,566454..566490,
                     566549..566623,566698..>566850)
                     /locus_tag="CNL05590"
                     /product="hypothetical protein"
                     /transcript_id="XM_568095.1"
                     /db_xref="GI:58261369"
                     /db_xref="GeneID:3254931"
     CDS             join(565868..565978,566139..566416,566454..566490,
                     566549..566623,566698..566850)
                     /locus_tag="CNL05590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568095.1"
                     /db_xref="GI:58261370"
                     /db_xref="GeneID:3254931"
                     /translation="MRFLRSVARLYNTNFDRRPVATLVVTNGVLNTIADVLMHNPTPQ
                     TPTPAYDPLRTLRFAIFGMGMGPIIGRWMRFLERAIPIPAKATLGRAGKGAGGILTGP
                     AGASAGVGKGSGEGIQLVKRVVADQIIMCADNAGIRAPIGLVLFVGSMGIMEGHSTEE
                     IKEKFQDIYVSAILANWKIWPAIQGINFKLMPIQYRVPFQSTCGIAWTLYLSLLNAK"
     misc_feature    567158..567185
                     /note="AT_rich"
     gene            complement(567256..569092)
                     /locus_tag="CNL05600"
                     /db_xref="GeneID:3254933"
     mRNA            complement(join(567256..567417,567488..567560,
                     567621..567727,567778..568084,568147..568403,
                     568462..568540,568595..568642,568714..568818,
                     568883..569092))
                     /locus_tag="CNL05600"
                     /product="pyruvate dehydrogenase e1 component beta
                     subunit, mitochondrial precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530493|gb|CF676334.1,gi|41530507|gb|CF676348.1,
                     gi|41533683|gb|CF679524.1,gi|41535679|gb|CF681520.1,
                     gi|41535687|gb|CF681528.1,gi|41536324|gb|CF682165.1,
                     gi|41536332|gb|CF682173.1,gi|41536441|gb|CF682282.1,
                     gi|41536449|gb|CF682290.1,gi|41539602|gb|CF685443.1,
                     gi|41539612|gb|CF685453.1,gi|41542527|gb|CF688368.1,
                     gi|41542535|gb|CF688376.1,gi|41544571|gb|CF690412.1,
                     gi|41544578|gb|CF690419.1,gi|41546669|gb|CF692510.1,
                     gi|41546681|gb|CF692522.1,gi|41547329|gb|CF693170.1,
                     gi|41548007|gb|CF693848.1,gi|41548010|gb|CF693851.1,
                     gi|41551573|gb|CF697414.1,gi|41551582|gb|CF697423.1,
                     gi|41552392|gb|CF698233.1,gi|41552399|gb|CF698240.1,
                     gi|41554467|gb|CF700308.1,gi|41554472|gb|CF700313.1,
                     gi|41556333|gb|CF702174.1,gi|41556335|gb|CF702176.1,
                     gi|41558840|gb|CF704681.1,gi|41558849|gb|CF704690.1,
                     gi|41559579|gb|CF705420.1,gi|41559584|gb|CF705425.1,
                     gi|41566539|gb|CF712380.1,gi|41566547|gb|CF712388.1,
                     gi|41567816|gb|CF713657.1,gi|41567822|gb|CF713663.1,
                     gi|41569143|gb|CF714984.1,gi|41569153|gb|CF714994.1,
                     gi|415"
                     /transcript_id="XM_568096.1"
                     /db_xref="GI:58261371"
                     /db_xref="GeneID:3254933"
     CDS             complement(join(567407..567417,567488..567560,
                     567621..567727,567778..568084,568147..568403,
                     568462..568540,568595..568642,568714..568818,
                     568883..569080))
                     /locus_tag="CNL05600"
                     /EC_number="1.2.4.1"
                     /codon_start=1
                     /product="pyruvate dehydrogenase e1 component beta
                     subunit, mitochondrial precursor"
                     /protein_id="XP_568096.1"
                     /db_xref="GI:58261372"
                     /db_xref="GeneID:3254933"
                     /translation="MASTITRSIPRALRARTAPLSTAARLVARNALLTTAAPTVPRSP
                     ARFLLAEGQRRAASSDEGVTMMTVRDALNQAMEEEMIRDETVFIIGEEVARYNGAYKI
                     TKGLLDKFGEDRVIDTPITEAGFTGMAVGAALAGLRPVCEFMTWNFAMQSIDQIVNSG
                     GKTHYMSGGNVPCPVVFRGPNGAAAGVGAQHSQDYCAWYGSVPGLKVISPWSASDCKG
                     LLKSAIRDSNPVCFLENELLYGVQFPMTKEELSEDFLIPIGKAKIEKAGSDVTIVAHS
                     KMVTHSLEAAELLEKEEGIKVEVINLRSIRPLDIETIITSVKKTKHLITVEGGFPAFG
                     VGSEILAQICESTAFDFLDAPPERITGADVPTPYAESLETMAFPDTPLIAKVIRRHLY
                     RQ"
     repeat_region   569096..569126
                     /rpt_type=tandem
                     /rpt_unit_seq="aggggg"
                     /satellite="microsatellite"
     gene            <569294..571245
                     /locus_tag="CNL05610"
                     /db_xref="GeneID:3254750"
     mRNA            join(<569294..569452,569498..570954,571018..571245)
                     /locus_tag="CNL05610"
                     /product="essential conserved GTPase, putative"
                     /transcript_id="XM_568098.1"
                     /db_xref="GI:58261375"
                     /db_xref="GeneID:3254750"
     mRNA            join(<569294..569452,569498..571234)
                     /locus_tag="CNL05610"
                     /product="essential conserved GTPase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531638|gb|CF677479.1,gi|41531647|gb|CF677488.1,
                     gi|41561410|gb|CF707251.1,gi|41561419|gb|CF707260.1,
                     gi|41561458|gb|CF707299.1,gi|41561462|gb|CF707303.1,
                     gi|41568976|gb|CF714817.1"
                     /transcript_id="XM_568097.1"
                     /db_xref="GI:58261373"
                     /db_xref="GeneID:3254750"
     CDS             join(569294..569452,569498..570916)
                     /locus_tag="CNL05610"
                     /codon_start=1
                     /product="essential GTPase"
                     /protein_id="XP_568097.1"
                     /db_xref="GI:58261374"
                     /db_xref="GeneID:3254750"
                     /translation="MRRIAPVLLRPLAARAYAAKPLDIDHVQDPDFEDVLGELTRRRR
                     KADAKRRQYGSSFVDHAIVTVRGGKGGNGAAALEASLRGPSFPSGGNGAHGGSVYITT
                     SPELTSLATVKKRLIAGAGGSGGGAFKHGRKGEDLVVQVPVGTIVRELKREGEEERME
                     REEDDLGLSDAEKKKKRWQRWFIAHPSTKGEVSEEEYADGEDLLRRERRWIAHTPSFD
                     QTPPFHLDISEPLDEPVLIASGGSGGLGNPFFPSPRLASRGTLPPTHTFEFELKLLAD
                     VGLVGFPNAGKSTILRALTGRRAEVAGYQFTTLNPQIGVVRVYEDGSWGVGKEEVVET
                     WIEREREDFSRQTGGPFPASRIKNGREDKMERLRFTLSDNPGLLPMASQNVGLGHSFL
                     RSIERSPVLAYVLDLTKPSPVQDLQVLKTELEAYKPGLSERAGVVVLNKGDAVPEEEG
                     KKRVEEVAAFVSEHKSGQVIVLSGRYGLGMETLVALLADNVEKARIERAEMLDRERKA
                     VKEEPVSHRVSGFGLKK"
     STS             569659..570463
                     /locus_tag="CNL05610"
                     /standard_name="Eco20"
                     /db_xref="UniSTS:470733"
     gene            <572104..>572577
                     /locus_tag="CNL05620"
                     /db_xref="GeneID:3254950"
     mRNA            join(<572104..572167,572219..>572577)
                     /locus_tag="CNL05620"
                     /product="hypothetical protein"
                     /transcript_id="XM_568099.1"
                     /db_xref="GI:58261377"
                     /db_xref="GeneID:3254950"
     CDS             join(572104..572167,572219..572577)
                     /locus_tag="CNL05620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568099.1"
                     /db_xref="GI:58261378"
                     /db_xref="GeneID:3254950"
                     /translation="MYYEVTDWRLVKVCECWGKHQFYNEATRQCHCPPSFTPSYDNRG
                     ILSCHPRPSQLTADQAQRQQTLKFISRKKKGSMRESSGANDQAPMKGIEAERKGSEGL
                     LCGWGQRACKVGGEWACLEFVFSFLFVLWQVSAKAHIE"
     gene            complement(572992..575396)
                     /locus_tag="CNL05630"
                     /db_xref="GeneID:3254990"
     mRNA            complement(join(572992..574046,574119..574442,
                     574503..574637,574701..575396))
                     /locus_tag="CNL05630"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41568492|gb|CF714333.1,gi|41568500|gb|CF714341.1"
                     /transcript_id="XM_568229.1"
                     /db_xref="GI:58261637"
                     /db_xref="GeneID:3254990"
     CDS             complement(join(573585..574046,574119..574442,
                     574503..574637,574701..575162))
                     /locus_tag="CNL05630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568229.1"
                     /db_xref="GI:58261638"
                     /db_xref="GeneID:3254990"
                     /translation="MGEGRYGLGLEDVVAVPVTFISERSKSNPEATRITSYQSNDLSR
                     SSSRGPPPVPIFPPKHTSLRVKLDPNPPAPRHSRHDDPEDESEDEEEDGDDETVGLKI
                     TDGRDIGKVEEGMYLKSKLWWLGMVLIAVGEGGNFLSYGFAPASVVAPLGTVALIANC
                     IFAPLILGERFRTRDMVGMALAIIGAVTVVQASSDTSPRLDPDQLLMALTRLPFLLYT
                     LFSLLLLPPLLFLSNSSFGQVHLTIDVGICALFGGFTVLATKALSSLLSGDFVGAWKS
                     GVTWACLAVVGGTSLGQIRWLNRALMRFQSKEVIPTQFVLFTLAAIIGSAVLFQEFRD
                     ITLSRFINFAFGVRFLSSLLTIPPPPPLKKTWTYSDAGGYYRLQRFSWVSIFSRPSPP
                     RPLLRKTKRETKLQPSNLTNTSRYHTPHLPRLSTAFSVIPLNERLLSAQSPLPLYLFP
                     LLFLLAVLPV"
     misc_feature    574334..574416
                     /note="GA-rich"
     gene            complement(576040..577363)
                     /locus_tag="CNL05640"
                     /db_xref="GeneID:3254996"
     mRNA            complement(join(576040..576639,576695..577024,
                     577141..577208,577273..577363))
                     /locus_tag="CNL05640"
                     /product="Baker yeast's zinc finger protein RTS2,
                     putative"
                     /transcript_id="XM_568228.1"
                     /db_xref="GI:58261635"
                     /db_xref="GeneID:3254996"
     CDS             complement(join(576121..576639,576695..577024,
                     577141..577208,577273..577330))
                     /locus_tag="CNL05640"
                     /codon_start=1
                     /product="Baker yeast's zinc finger protein RTS2"
                     /protein_id="XP_568228.1"
                     /db_xref="GI:58261636"
                     /db_xref="GeneID:3254996"
                     /translation="MGRAEAGSTKAIANAIKAKGLGRLRWYCQVCEKQCRDENGFQAH
                     CRSEPHMRKIMLLGPKAGQAISDFSRQFQSEFLLLLRTRHLTNRVQANKVYNEYIQDK
                     HHVHMNATRWVTLSGFIQTIGKEGLVKVDEDEKGIWIQWVDNRPETLSKQAAAMKVER
                     SQMDSEERERKMLEEQIARARAQQADQPDLTVGLQKKEGEKIKLNLFGASEPKTEEGK
                     EEESASASAETKPTIGFGKLSAPGTAKPLAVSTNPLKRPAPVNVFKSSKAAKTESGGS
                     AINGDSNGAPKYKSEAERLMMEDQARKASRGQGQGQGYRGFGPSRGGR"
     gene            complement(577927..>578843)
                     /locus_tag="CNL05650"
                     /db_xref="GeneID:3254927"
     mRNA            complement(join(577927..578065,578125..578742,
                     578796..>578843))
                     /locus_tag="CNL05650"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41576235|gb|CF722076.1"
                     /transcript_id="XM_568100.1"
                     /db_xref="GI:58261379"
                     /db_xref="GeneID:3254927"
     CDS             complement(join(577958..578065,578125..578742,
                     578796..578843))
                     /locus_tag="CNL05650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568100.1"
                     /db_xref="GI:58261380"
                     /db_xref="GeneID:3254927"
                     /translation="MGLKDPILNAQVMPAGPRVPRPRVSVASTTSTSHRSTLGEVNNN
                     LPAHQDIHDVKGKGKAPLRPTNEEGPQLRTVSTSAVEDSKRTGRREERKARRSISGPM
                     STANQPVERRVRHSDMGSKPRMIEAIQEEEPEQSENAAGPSSSRQGQPSSSSSQPEPQ
                     EDRYKEEPSIDLTWALRPSAPRTQLPTMPIEKDMTDKEKIAELRREIGNLQLDILRMG
                     RTFRNEIRQAVQPLAEEIRRNKEIIEEQRLEIARLRAPR"
     gene            580145..580234
                     /locus_tag="CNL05660"
                     /db_xref="GeneID:3254908"
     tRNA            580145..580234
                     /locus_tag="CNL05660"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:3254908"
     gene            complement(580487..581156)
                     /locus_tag="CNL05670"
                     /db_xref="GeneID:3254949"
     mRNA            complement(join(580487..580691,580740..580840,
                     580893..580952,581007..581156))
                     /locus_tag="CNL05670"
                     /product="hypothetical protein"
                     /transcript_id="XM_568101.1"
                     /db_xref="GI:58261381"
                     /db_xref="GeneID:3254949"
     CDS             complement(join(580624..580691,580740..580840,
                     580893..580952,581007..581089))
                     /locus_tag="CNL05670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568101.1"
                     /db_xref="GI:58261382"
                     /db_xref="GeneID:3254949"
                     /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     A"
     gene            581652..>583286
                     /locus_tag="CNL05680"
                     /db_xref="GeneID:3254954"
     mRNA            join(581652..581908,581979..582845,582929..>583286)
                     /locus_tag="CNL05680"
                     /product="expressed protein"
                     /transcript_id="XM_568102.1"
                     /db_xref="GI:58261383"
                     /db_xref="GeneID:3254954"
     CDS             join(581703..581908,581979..582845,582929..583286)
                     /locus_tag="CNL05680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568102.1"
                     /db_xref="GI:58261384"
                     /db_xref="GeneID:3254954"
                     /translation="MSTRPQGYSLRKDAISSSVPTSSQSPANARLPAHLPLYHRLLFP
                     HHPLGEPLPQFIIGDAPEIDLLNERIYNLIALALRGYILPWYTRFSKDRSLLPSIHST
                     VIHPIFSPICTRAYDNPERIVKWILRDLLCSVEIHVKVYWEAKAALGGGTLGDRYHAR
                     LPLPSVSVSSFPAPHSPVHPTYTLSSEYLTSLSVALMQPTETEEERSPMGLQDLMIRE
                     ILARAILAGGMRRLCFGWFWYGLILKFLGEPGDPFPWRRWTPQKQDEPKSIHQLVISY
                     TRTITSLFTAIYSAIITLVAMYTAAPPPSPEYEGCTDTWMAVMRIIMGVDGYAGVEAK
                     KWRKRMVWDGVEMVVGLISPILDRIIPHLLSSQLTPKLSFRLIDLAEKLLFPLDGYPG
                     PTPIDPTPAEAAHMRDRAERRIGEIIPRPLRVVFCPEDKDAGRLMEWMSDAGCNAHLV
                     GMILVSLVATLLPDLVDRTDLEDGQL"
     gene            complement(583306..584802)
                     /locus_tag="CNL05690"
                     /db_xref="GeneID:3254906"
     mRNA            complement(join(583306..584336,584389..584511,
                     584563..584802))
                     /locus_tag="CNL05690"
                     /product="ARF GTPase activator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534968|gb|CF680809.1,gi|41534977|gb|CF680818.1,
                     gi|41541792|gb|CF687633.1,gi|41541800|gb|CF687641.1,
                     gi|41545242|gb|CF691083.1,gi|41545252|gb|CF691093.1,
                     gi|41554748|gb|CF700589.1,gi|41554751|gb|CF700592.1,
                     gi|41555001|gb|CF700842.1,gi|41555008|gb|CF700849.1,
                     gi|41557900|gb|CF703741.1,gi|41557909|gb|CF703750.1,
                     gi|41569195|gb|CF715036.1"
                     /transcript_id="XM_568103.1"
                     /db_xref="GI:58261385"
                     /db_xref="GeneID:3254906"
     CDS             complement(join(583437..584336,584389..584511,
                     584563..584790))
                     /locus_tag="CNL05690"
                     /codon_start=1
                     /product="ARF GTPase activator"
                     /protein_id="XP_568103.1"
                     /db_xref="GI:58261386"
                     /db_xref="GeneID:3254906"
                     /translation="MAENYQKKELLALMNTGGNKVCVDCNAPSPQWASVSYGIFICLE
                     CSGVHRGFGVHISFVRSITMDKWSDEQLNKMKTGGNEKFKDFMENYGPEGGYTKGMGM
                     QEKYNSWAAAQYREKLTAECAGQPWSASSPPANFGLPSRPASSQTTRKSRAAGGITGS
                     SLNPSRTNSPSIPQGSDDFYGQKSANEAFFERMGNANATRPDHLPPSQGGKYSGFGST
                     LEPDVASSHPSYSLSSHAAPTLDEFQRNPLGALTKGWGLFSSAIVSAGREINNAVVQP
                     GLDRAQALAAGENSEEWKRYVNQASAQAKDAGGWLGQRAHEGWEGLNDVAKTKGGVDL
                     NESFGKLGLGKSSIPGSRGYGQVGALDRAEDGLLSPHGAGNDDEEDFFESWGATPTAS
                     TTSATTGAKSIADKGKKKDDEKNE"
     gene            584972..588026
                     /locus_tag="CNL05700"
                     /db_xref="GeneID:3254893"
     mRNA            join(584972..586188,586235..587294,587364..587524,
                     587591..587658,587733..588026)
                     /locus_tag="CNL05700"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541839|gb|CF687680.1,gi|41544871|gb|CF690712.1,
                     gi|41544878|gb|CF690719.1,gi|41559307|gb|CF705148.1,
                     gi|41559314|gb|CF705155.1,gi|41571721|gb|CF717562.1,
                     gi|41571731|gb|CF717572.1"
                     /transcript_id="XM_568104.1"
                     /db_xref="GI:58261387"
                     /db_xref="GeneID:3254893"
     CDS             join(585020..586188,586235..587294,587364..587524,
                     587591..587658,587733..587968)
                     /locus_tag="CNL05700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568104.1"
                     /db_xref="GI:58261388"
                     /db_xref="GeneID:3254893"
                     /translation="MPKEDAQLHPPPLKRGDACLYCRKRRIRCSATKPTCTHCAKIGR
                     ECVYDVRKPTSRVQQLEEKVAQLESLLKNGAMKGDGAPSGSGLQASGSTPPLPHQSSG
                     YTPSEATALPQQTSTSTSYSLLNNETIDVNLFGGKYPAIPPAGDDSNLFPSFGGSIFG
                     SMGSIMSQPQPQAEQAFDFSTLDPTFMNMINSFQTSTGLAEPVPQQEQQQLPTAFGQS
                     PAPLASPSYLNPAHANINSHAAQPFPSSTATERMPQSYTSLPKLPFLNNNFCTSVVSE
                     ALPENPSVVAELASANANVHEDMAALLKAAAASNAEQWATGIVQGSDFEGGQENMQLV
                     GGWFDANDLPKVARDHLSVCIHVAGLRFANNISLNMFFSGMRLFGQEFHVPRFMASLS
                     LPLSKRPHNCLLYSMYTMASRISTSQPIRNLEPHFHSIACRQLELAIAQVDKLLDAIR
                     ASSILAVYKYSIARYHEAWMMSGQAARLAIACGLHQIQSSVWKSYNNEAHEMTADFGG
                     LMRRRSYILPPPVDAVEHGERIWAFWSIFVVDRCGSISTQWVPAIPDDAIITPFPRPL
                     HEYELGLVTEADNISISSIYAPSPPRSRPLRYDYADLVKIRLRALTLLERASKLMYLP
                     PEPGWDKNIERHRSESSGSTFFVPKRPDEMYEYLPSPSGSGPTFSSGSNHTDTAGDFR
                     KNRGWTRTAKVRNPKAYNEVREALLLIEEDLPEEWRTNWLEWDGKVQAWHFNGARKDI
                     ISLHLVLGCAWMFIEDVYVFGAENTTAVNIAKRLTVTVRYLAQQAAHSDLDVFTAMIW
                     SFMSKVLIREMKRRESSGDKLGAAALELDIDTLVQALKQFGRGYAMAVMQAMRQERYK
                     NSSWENVESMEGDNEGSSDEETFGRKEGLEWAGRHFGGATS"
     gene            588182..>592460
                     /locus_tag="CNL05710"
                     /db_xref="GeneID:3254966"
     mRNA            join(588182..588602,588675..588938,588994..589192,
                     589241..590290,590356..590451,590511..590620,
                     590683..590938,591017..591137,591197..591388,
                     591443..591892,591946..>592460)
                     /locus_tag="CNL05710"
                     /product="insulin degrading enzyme, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531045|gb|CF676886.1,gi|41531212|gb|CF677053.1,
                     gi|41532022|gb|CF677863.1,gi|41532749|gb|CF678590.1,
                     gi|41537369|gb|CF683210.1,gi|41538832|gb|CF684673.1,
                     gi|41551264|gb|CF697105.1,gi|41551689|gb|CF697530.1,
                     gi|41553255|gb|CF699096.1,gi|41553361|gb|CF699202.1,
                     gi|41554537|gb|CF700378.1,gi|41555147|gb|CF700988.1,
                     gi|41555510|gb|CF701351.1,gi|41562515|gb|CF708356.1,
                     gi|41565103|gb|CF710944.1"
                     /transcript_id="XM_568105.1"
                     /db_xref="GI:58261389"
                     /db_xref="GeneID:3254966"
     CDS             join(588367..588602,588675..588938,588994..589192,
                     589241..590290,590356..590451,590511..590620,
                     590683..590938,591017..591137,591197..591388,
                     591443..591892,591946..592460)
                     /locus_tag="CNL05710"
                     /codon_start=1
                     /product="insulin degrading enzyme"
                     /protein_id="XP_568105.1"
                     /db_xref="GI:58261390"
                     /db_xref="GeneID:3254966"
                     /translation="MLRSFASSTGASTHLTRTHRSLHRLVTPRSRSFTLVPGRHLTTT
                     SLVKPTTKTQSFQSHRLSNTAQSLFKRSFATPVSRQIPPIKLPIEPIMESPYPPCPPI
                     PKANGPVDLILPPTEDRKHKYFTLSNGLEVVVVSDPKADKAAASMDVGVGHLSDPDDL
                     PGCAHFCEHLLFMGTKTHPSENAYQQYLSSHNGHSNAWTAMTSTNYYFDVSPDALEGA
                     LDRFSGFFSEPLFNEDCTEREIKAVDSEHKKNLQNDVWRFYQLEKHLSKPGHPYGKFG
                     TGNYESLWSIPKEAGRDPRRQLIEWWEKEYCARRMKLAVAGKEDVDTLEKWVREKFEN
                     VPVRTEGKPEVGRDGVRVVFDESPYGKEQLGYFTFTKPVRDMRALELMFPFPDMDHLY
                     KTRPTHFISHFLGHEGRGSILSYLKKKGWVNSLSAGNYHDAAGFSLFKISVDLTPDGL
                     EHYQDVALTVFKYISLLRSQPPSVDAFNEIKAIADISFRFAERGRTSSYCTNLSSWLQ
                     SPVPREKIVSSKWLVEEYNQQELEWALQLLDPRRADIGVTSKVLPKNVSGEFENKEPI
                     YGTEYKRVKFDEEFLKEAMSGAPIADLQLPGPNLFIPEKLDVHKFDVQEPAKRPVILR
                     DTSLSRLWYKRDDRFWLPKANLDVMLHSPILNVTPRNAVLSRLFCDLFSDSITEDVYD
                     ADLAELNFNLWNTSHWIQISAGGFSDKLAVLTEKMLEKFVNYKVDEARFQEVAEATRL
                     HWKNFGMSDPWKIGRFYNSYATQEIAWTQEEKLKELEYITAADVQAFGKELLTRLHIE
                     TLIHGNTSPEGAKEIQDMLERVLKPRELTPTELKAPRSLVLPSSSEYVWQISVPNKSE
                     VNGSVIYEIHVGDPSDITLRNHLSLFSQIAAEPCFDILRTKQQLGYIVSGHASQSTGT
                     MGYTVLVQSEKDPVYVETRIEAFLDGLKETIEEMSEEEFEKHKQSLIAKKEEKPKNLG
                     EETKRFWGRIQDRYFEFARRENDVAELRKTTKQDILNVLMTYIHTSSPTRAKLSVHLK
                     SQYRGIKFDLASAAPLVKSFTEAGIAVDPAAIQKLLSNNPTLEQVKEFANSTIDAAAN
                     VADDVKAQLKDVVAELKGQEAGPGAEAGAGPGPEDVKLRPGNVWIEDIQEFKARLVPS
                     KAAVPVEPLKTLVAEL"
     gene            complement(<592698..>593287)
                     /locus_tag="CNL05720"
                     /db_xref="GeneID:3254766"
     mRNA            complement(join(<592698..592823,592881..592974,
                     593044..593095,593153..593176,593239..>593287))
                     /locus_tag="CNL05720"
                     /product="hypothetical protein"
                     /transcript_id="XM_568106.1"
                     /db_xref="GI:58261391"
                     /db_xref="GeneID:3254766"
     CDS             complement(join(592698..592823,592881..592974,
                     593044..593095,593153..593176,593239..593287))
                     /locus_tag="CNL05720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568106.1"
                     /db_xref="GI:58261392"
                     /db_xref="GeneID:3254766"
                     /translation="MPPPPQHSTGGSTLDKIKMGAIMGSCVGLTIGFIFGSFSIMRAG
                     PGPRGVVATLSQYMLSSAATFGFFMSVGSVIRTESEHKYILPPMTNRAASEPWRMAWK
                     RAEERRRAEASQ"
     gene            593521..593603
                     /locus_tag="CNL05730"
                     /db_xref="GeneID:3254923"
     tRNA            593521..593603
                     /locus_tag="CNL05730"
                     /product="tRNA-Trp"
                     /codon_recognized="UGG"
                     /db_xref="GeneID:3254923"
     gene            <597503..>597672
                     /locus_tag="CNL05740"
                     /db_xref="GeneID:3254812"
     mRNA            join(<597503..597550,597589..>597672)
                     /locus_tag="CNL05740"
                     /product="hypothetical protein"
                     /transcript_id="XM_568107.1"
                     /db_xref="GI:58261393"
                     /db_xref="GeneID:3254812"
     CDS             join(597503..597550,597589..597672)
                     /locus_tag="CNL05740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568107.1"
                     /db_xref="GI:58261394"
                     /db_xref="GeneID:3254812"
                     /translation="MGNGLSSALDPTQGKGGVENNFRSYQSLMGTRHLRGRPSTSRL"
     gene            complement(<598606..601759)
                     /locus_tag="CNL05750"
                     /db_xref="GeneID:3254844"
     mRNA            complement(join(<598606..598933,599009..599162,
                     599280..599445,599525..599703,599762..599837,
                     599899..600286,600353..600492,600543..601100,
                     601155..601759))
                     /locus_tag="CNL05750"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545548|gb|CF691389.1"
                     /transcript_id="XM_568108.1"
                     /db_xref="GI:58261395"
                     /db_xref="GeneID:3254844"
     CDS             complement(join(598606..598933,599009..599162,
                     599280..599445,599525..599703,599762..599837,
                     599899..600286,600353..600492,600543..601100,
                     601155..601619))
                     /locus_tag="CNL05750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568108.1"
                     /db_xref="GI:58261396"
                     /db_xref="GeneID:3254844"
                     /translation="MEAPTADPMVHAEKEAERAENELVEVDTPDVVQEAISKNTETAE
                     VSVNSTITTNEEVTERMQVDAAVVSVEGSERPLEPSMGSGKEPLGTLGEAVEDGVEKN
                     DVEDPEGDAEVEGEGEEDGEEGSGSEDEDEEEDEEEEEDESDGDESEDLEGSHEIIAI
                     DGPDGSPHFTLHPVVKTEPTSPGSMPTTLPTEPIETLPTTDGAENVLVPKKKKRARLR
                     SPSEDEDLAPPPPPMKTIRLERPLVQNGETMEWNILDDARANGLCVAWGVGVVDDLPG
                     SVPGTMTPGAAGMSGLTEEGMEIDGSPVAGSSTGGVLGIGFADEDPEEIARKLEEKYG
                     DKKKTKKKKRPTDYDLEDPFIDDSEIMIDAPTHYARPAREGFFVHSGPLQLMKESPLK
                     KRNVSNKPKSNQAKSKGAPSSPEPKAPRTSLAASLLARIRAREGLRDPSSHEDIQDGP
                     ISVTPNLDTAGGNDGDDNNDGGFSISTMGRHVTNEALVLWQSLFQRDLEKQPPVDRVM
                     FRTASRHDKYLPPYPAVPQEVARALLALRLESLEYDWDHANRSKFPEHLKPSLKRAST
                     IAYQHDVFDVFDHTSEDKGFAICLQSVYPYNVFTLRKLVTKLIYEGYLKWLQDCEDEG
                     IRQFKEEIDKDSAMWIEKYETSKRDWEVEVAAWDPSSSAQPAPKPEDIRPPEPQRRFV
                     WTSEMRDIFWQLIENLRVTTELIKKGADWHAAGAKNGKEWTEQGLKSRLYKKIVDIFP
                     EGYTNNNIISRERTCIHQTAVVFAKRGIELTTFLMPLVTKLKKRKEEAQKKSDDTKKP
                     GVSKEEEPEGVKSENASKD"
     misc_feature    601194..601280
                     /note="CT-rich"
     gene            603335..606035
                     /locus_tag="CNL05760"
                     /db_xref="GeneID:3254796"
     mRNA            join(603335..603611,603723..603828,603885..604344,
                     604401..604644,604749..605280,605334..605789,
                     605841..606035)
                     /locus_tag="CNL05760"
                     /product="carnitine acetyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41552121|gb|CF697962.1,gi|41552130|gb|CF697971.1,
                     gi|41564185|gb|CF710026.1,gi|41564193|gb|CF710034.1,
                     gi|41575117|gb|CF720958.1,gi|41575123|gb|CF720964.1"
                     /transcript_id="XM_568109.1"
                     /db_xref="GI:58261397"
                     /db_xref="GeneID:3254796"
     CDS             join(603336..603611,603723..603828,603885..604344,
                     604401..604644,604749..605280,605334..605789,
                     605841..606004)
                     /locus_tag="CNL05760"
                     /codon_start=1
                     /product="carnitine acetyltransferase"
                     /protein_id="XP_568109.1"
                     /db_xref="GI:58261398"
                     /db_xref="GeneID:3254796"
                     /translation="MIIPSSIHRIQSVHTPLRTLRTTSFFPVLAPAHPASITARNVSR
                     RMFAASTYRDNQLKTFENQSKLPRLPVPDLEASLEGYLQSLGPLLEEKYDKASLSNEV
                     EKRRLYVKDFASAGGLGRVLQERLKDLDHVSPNNWLNDTLWLALAYHTWRAPLLVNSN
                     WWLCFAEDPLSPPPPSLPSSTNESNSMGAQTATIKVPNPSPLTDVPAGGQGGGKEWLV
                     SGSIDPPVQYEKVVKKEWITPWQIRRAAWIARRFAEFRTKLERQEIKPDEIKGVKFCM
                     NQYANMFNLSRIPLPNCDAFSNPSPLSTHLSLLVDDYYYAIDIFSPPSSSADGVPEPL
                     PAGEIEKRFQAAVDDAKRRKQRGERAVENRERLLLLSPSNRSTLTSLSTSLLALSLDP
                     YTLPSVPPPSGDPLRLPAVDAQVRNCATGIDGGRNRWFDKAVSVLVETSGRAGIMGEH
                     SPVDALIPSIVVEYVLDKPVDESQFKTSTPVVVATGKGGEGWEKLDWAVDETILQEIE
                     QVKQKNQKLIDDSDASQLWWGEYASEWIKKTAKQAPDAYIQQALQLAWFLDQGYPTAT
                     YETASTRTMLHGRTDVIRSLTSESRAFVKAMTNPESTADERYRLLSSACQAHNALTKR
                     SSSGHGYDRHLMGLKVQLRAGETHPLFEDEVYAKSQEWKLSTSGLSAGGKFTATGFGA
                     AWPDGYGINYMAGPHLIKFGIESKFSCEKTSTQRFKHNIAQVLRDMRAVCEAVGGVDA
                     SRAKL"
     gene            <606207..>607293
                     /locus_tag="CNL05770"
                     /db_xref="GeneID:3254830"
     mRNA            join(<606207..606618,606673..606765,606825..606896,
                     606953..607071,607168..>607293)
                     /locus_tag="CNL05770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568110.1"
                     /db_xref="GI:58261399"
                     /db_xref="GeneID:3254830"
     CDS             join(606207..606618,606673..606765,606825..606896,
                     606953..607071,607168..607293)
                     /locus_tag="CNL05770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568110.1"
                     /db_xref="GI:58261400"
                     /db_xref="GeneID:3254830"
                     /translation="MRHLTLIRPALQPIVPRTFARTLITTPPRLLATPSNDTGPQHVT
                     PGPPKSPNPLDTATQSAISAQKYPDYSTGPSAIDKASQILFLTEIVRGMWVVLEQFFR
                     PPYTIMYPFEKGPLSARFRGEHALRRYPNGEERCIACKLCEAICPAQAITIESEARED
                     GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVETQNQEFSTETREELLYNKEKLLLNGD
                     RAEAEIAANLQSEHGLEDSMWEWDVHAQYHGYKMYHNYALQLSCSQRGVISRRMR"
     gene            complement(<608709..>610789)
                     /locus_tag="CNL05780"
                     /db_xref="GeneID:3254876"
     mRNA            complement(join(<608709..609317,609373..609578,
                     609631..>610789))
                     /locus_tag="CNL05780"
                     /product="hypothetical protein"
                     /transcript_id="XM_568111.1"
                     /db_xref="GI:58261401"
                     /db_xref="GeneID:3254876"
     CDS             complement(join(608709..609317,609373..609578,
                     609631..610789))
                     /locus_tag="CNL05780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568111.1"
                     /db_xref="GI:58261402"
                     /db_xref="GeneID:3254876"
                     /translation="MTPASDPAQPDTPPDGRVPARSPSSSPRSFGAPDGHGHGTQPSP
                     RQVPLPTSTSSPTLSPRSALSYTLSFQNASPSSLHALEHENFPPILEGNAIGNGIDAE
                     DGDLSAPFESIPLSSTPPREVPTVPLPSSPREMLSPKSVKKRRSWGGFGMSSDGHQTA
                     RGELPEHPPPHSSQSAEPLPSTHDGHNGQGIPGRASTATPPRRAAPPPHPFPWPIPTS
                     PRPSSSKRLSTVSNASNGTHATQASQGSTSANPSHSPGQTHQHTPALGAKGVSTFEKV
                     ISHTRPSWLPPKDRIEDVTHLHQWEDMMRHAREHEKVLAKQAEIRRLEKEKRLTAEAP
                     KWEKLLSDEKDFSAKKVKENEELRKLWFEGVPSHLRGKAWSMAVGNPLALSKDIYKTY
                     LARARKGLATNRFPPDLLKTIEGDMDNTLVTLKVFTRGSPLRDDLRELICAWLVFRSD
                     EGLGYAPYINLLCAMLLLASPPPTAFLTLLNILSRPLLRAFFTPLSPEISAYYRILEN
                     LQADRYPKIYANCKALGVGVPENWFRSLLVEQVGFESSCRLWDQIMLDGDGFVFRAAL
                     AIFGYLEPRLYYPDKQEVLSVLEGHNPASLAILQRERERAKLRGETFVQEGIDGTLTA
                     FGLDEGKLFGMIESDGWREKDFERLVMREMPDY"
     misc_feature    609192..609303
                     /note="G-rich"
     gene            <611176..>611830
                     /locus_tag="CNL05790"
                     /db_xref="GeneID:3254835"
     mRNA            join(<611176..611609,611692..>611830)
                     /locus_tag="CNL05790"
                     /product="hypothetical protein"
                     /transcript_id="XM_568112.1"
                     /db_xref="GI:58261403"
                     /db_xref="GeneID:3254835"
     CDS             join(611176..611609,611692..611830)
                     /locus_tag="CNL05790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568112.1"
                     /db_xref="GI:58261404"
                     /db_xref="GeneID:3254835"
                     /translation="MPTMTSPYSSYPQTPQSNPHSHTHSPNLLNLPYLQPQTSGSSSS
                     LLEAVVGRPQPRTPPTAYASQLATQVTPVSVSRPPPAVYPHRQGPGSDAGAGHGSTEP
                     STSASSGSHGESDWDMVSKASGVNCDGQSEEAVKDLEQKVEKRRSQLPRLESQLAELE
                     AQIKAAEERIARAQSVGSKESVAQAQTGQR"
     gene            <612541..>613035
                     /locus_tag="CNL05800"
                     /db_xref="GeneID:3254769"
     mRNA            <612541..>613035
                     /locus_tag="CNL05800"
                     /product="hypothetical protein"
                     /transcript_id="XM_568113.1"
                     /db_xref="GI:58261405"
                     /db_xref="GeneID:3254769"
     CDS             612541..613035
                     /locus_tag="CNL05800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568113.1"
                     /db_xref="GI:58261406"
                     /db_xref="GeneID:3254769"
                     /translation="MRIYHPLVPLLFAVPSLGSLFGSDSSSTTSASSSSSTTSSSATS
                     DEVTFLQTLQAAEISSMSCLITLVNMTTSSLGSCLSLTSLASLISNPSSSSVSSAGQG
                     FSDQLNTYLGTVCSSTCSESDLLDGKSQLAAVCDTNNTLVSVLDAVLDNYSSSYRTLA
                     CQVY"
     gene            613870..615839
                     /locus_tag="CNL05810"
                     /db_xref="GeneID:3254922"
     mRNA            join(613870..613996,614132..614246,614313..614377,
                     614441..614511,614578..614662,614734..614838,
                     614896..614982,615038..615147,615212..615839)
                     /locus_tag="CNL05810"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530471|gb|CF676312.1,gi|41530475|gb|CF676316.1,
                     gi|41534603|gb|CF680444.1,gi|41534611|gb|CF680452.1,
                     gi|41563357|gb|CF709198.1,gi|41563365|gb|CF709206.1,
                     gi|41571255|gb|CF717096.1,gi|41571258|gb|CF717099.1"
                     /transcript_id="XM_568114.1"
                     /db_xref="GI:58261407"
                     /db_xref="GeneID:3254922"
     CDS             join(613914..613996,614132..614246,614313..614377,
                     614441..614511,614578..614662,614734..614838,
                     614896..614982,615038..615147,615212..615585)
                     /locus_tag="CNL05810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568114.1"
                     /db_xref="GI:58261408"
                     /db_xref="GeneID:3254922"
                     /translation="MARLALLASALLATAAYAAKSNWGEACAQANTHLNQDNYELVTD
                     CNSLTYCADNGTCAWKGCRKDTYPFGYNDYSFDQLPPLCPTGEFCPDEGDHCLNQVPV
                     GSSCQKDRDNECQPPPNWKQLNGYLNSNGSICLDYTCYYANVTVGQTCVNDNTVYTAY
                     KDDGSAYAFIVSRDNCANGHYCDATELVCYKSKAFGATCSGNKECLSYNCEDNGKCGK
                     AANDVVHPPAWQYVLVGLGIVILIVAVMTGLWFMHRRWRNEKQVMLEQYYNEQIAYRQ
                     SIMSMSHAKQSLLSLPPNTTAGAARASLYGDTAWTSGTDYQSVPLPPNLRRDSTSGWS
                     HDSDRVGHDSEVFLMQNGRYADAPEVSKYR"
     gene            complement(615847..617708)
                     /locus_tag="CNL05820"
                     /db_xref="GeneID:3254832"
     mRNA            complement(join(615847..616220,616323..617336,
                     617398..617708))
                     /locus_tag="CNL05820"
                     /product="NADPH-adrenodoxin reductase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538743|gb|CF684584.1,gi|41538751|gb|CF684592.1,
                     gi|41544782|gb|CF690623.1,gi|41544793|gb|CF690634.1,
                     gi|41572674|gb|CF718515.1,gi|41572684|gb|CF718525.1"
                     /transcript_id="XM_568115.1"
                     /db_xref="GI:58261409"
                     /db_xref="GeneID:3254832"
     CDS             complement(join(615885..616220,616323..617336,
                     617398..617667))
                     /locus_tag="CNL05820"
                     /codon_start=1
                     /product="NADPH-adrenodoxin reductase"
                     /protein_id="XP_568115.1"
                     /db_xref="GI:58261410"
                     /db_xref="GeneID:3254832"
                     /translation="MIPRSARLRLPSSSLSAHARRRLYTPVRPPLKLAIIGAGPSGFY
                     TASRILSLIPPTSPEGQKLEVHMYERLPTPYGLVRYGVAPDHPEVKNCQHKFDELAHD
                     SRFKYFGNTLFTSHPSSTFSPSPTEKAPSYTYPHALRLSFSDIMPYYSTLILTYGASL
                     SNPLNAVPGSSSNSDPLTGVYPALALVSWYNSHPAYADLPVNLEKVKQVSVVGQGNVA
                     LDVARMLLKPVSSLAETDLSEEVLDVLSESSVEKVRVVGRRGPGQVAFTTKEFREMLS
                     IPDVGYAGIDPALMEYAKENIEKGNGERMKKRLLQLMDKTKQQDGRKIFELDFLKGPK
                     SFLPSTENASQVGEVEWNLNQLETRPATESQPASIVAKSTGETIRTPADMVVESVGYR
                     SEPLTGPGHEWDLPFDIARGRVSNLNGRVIAEEGGFVPGVYAAGWAARGPVGVIATTM
                     NDAYALASTILDDIYAPTTSSPAACMLNSRPYAGIPEKVQNAAMEGKIVVDLEGWAKI
                     DKAEVERAKRMGSGKEREKFRRVEDMLAVLQ"
     misc_feature    616258..616282
                     /note="T-rich"
     gene            617985..621711
                     /locus_tag="CNL05830"
                     /db_xref="GeneID:3254880"
     mRNA            join(617985..618194,618262..618348,618405..618525,
                     618584..618891,618944..619351,619416..619676,
                     619744..620066,620104..620291,620353..620474,
                     620536..620817,620878..621007,621059..621078,
                     621137..621227,621291..621354,621409..621711)
                     /locus_tag="CNL05830"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41547809|gb|CF693650.1,gi|41551475|gb|CF697316.1,
                     gi|41551483|gb|CF697324.1,gi|41562931|gb|CF708772.1,
                     gi|41562935|gb|CF708776.1"
                     /transcript_id="XM_568116.1"
                     /db_xref="GI:58261411"
                     /db_xref="GeneID:3254880"
     CDS             join(618093..618194,618262..618348,618405..618525,
                     618584..618891,618944..619351,619416..619676,
                     619744..620066,620104..620291,620353..620474,
                     620536..620817,620878..621007,621059..621078,
                     621137..621227,621291..621354,621409..621685)
                     /locus_tag="CNL05830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568116.1"
                     /db_xref="GI:58261412"
                     /db_xref="GeneID:3254880"
                     /translation="MGDPALSQLIDMGIPVGRARAALKRSKGDAMSAAERVFAGEFDD
                     IPSDDEGEDGTEGSSSVQVKADPVVIDNNEDDAMDEDEMGHEDEEDDYDDMNDGNFDY
                     DEDMSDGEQMASDPYAGIFFSKNRVEEIIEPIETEETMTISIPGGSTVEVKILGRGEW
                     MSGCPEGGEQSFLFQLYNTLEEGGMPCSAGCGHSFTRKKQDFFCLFPKFPQYTTYLNS
                     IIRPNCPQCHQITCLACGERVDRPSALHSQHSKDKAPMTSAPSIPSETTQEALLHCPN
                     LQGVILGVGLHMIEKTFSQGRDHNSCAEKSGRTPPSKKRKTDDNPPFLKGKGAVKGTG
                     YAGNVQEDRTGQVAAEKAQKKADQKVATILQQVQHFLPNPHRAGGPATSDYLVHPTAL
                     AHLRRRSTFMNDLLRNDSLFDMSQRGDIYRALFDWLEIVSNNESLASMLGMPQMRPAK
                     SVPSPTVSNSLIVTYEGAPSPRELLENIVLQAKAALKGLEGIQPAQIEGIALTEEELR
                     TNIKEMEKKEAERIEKESLDENSVLKAFCLTEQSSLRIIKSAEIIDKRLVETKGKAFV
                     QRMKEQLPRIDESGVQIEENPVENGTDEEIIKIYEEWATRARFQYVDLRAGSDITGAP
                     SYKHAYSTLIAGIELNNAPKRSLAIAKELAILTTSLPVAWHSSVFLRVDEARVDVLKA
                     MIIGPEGTPYENGCLLFDIFLPLEYNQRCPLVKYMTTNGGKWRYNPNLYADGKVCLSL
                     LGTWQGPGWIAGQSTLLQVLISIQSLILCEEPYLNEPGWANMSGSAQSKAYNANIRRM
                     VLADAMANNIKSPPHPFENEIKTHFRLKAKAIRQQIEKWREMDDSKEVEADYWGGAHT
                     SAASALSNRSFEAAAKEVLRLLDELEGKVQPVPKAEEEARIKSPKEEKKKSSSVIWNK
                     MIGGSKKKSKKDV"
     gene            622096..623850
                     /locus_tag="CNL05840"
                     /db_xref="GeneID:3254975"
     mRNA            join(622096..622290,622348..623850)
                     /locus_tag="CNL05840"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532512|gb|CF678353.1,gi|41532527|gb|CF678368.1,
                     gi|41534496|gb|CF680337.1,gi|41534507|gb|CF680348.1,
                     gi|41539540|gb|CF685381.1,gi|41539546|gb|CF685387.1,
                     gi|41540805|gb|CF686646.1,gi|41540812|gb|CF686653.1,
                     gi|41544076|gb|CF689917.1,gi|41544091|gb|CF689932.1,
                     gi|41545861|gb|CF691702.1,gi|41545867|gb|CF691708.1,
                     gi|41553097|gb|CF698938.1,gi|41553104|gb|CF698945.1,
                     gi|41553784|gb|CF699625.1,gi|41553798|gb|CF699639.1,
                     gi|41554084|gb|CF699925.1,gi|41554096|gb|CF699937.1,
                     gi|41555132|gb|CF700973.1,gi|41555146|gb|CF700987.1,
                     gi|41556039|gb|CF701880.1,gi|41556047|gb|CF701888.1,
                     gi|41559520|gb|CF705361.1,gi|41560064|gb|CF705905.1,
                     gi|41564752|gb|CF710593.1,gi|41564761|gb|CF710602.1,
                     gi|41569783|gb|CF715624.1,gi|41569792|gb|CF715633.1,
                     gi|41574875|gb|CF720716.1,gi|41574884|gb|CF720725.1,
                     gi|41575097|gb|CF720938.1,gi|41575101|gb|CF720942.1"
                     /transcript_id="XM_568117.1"
                     /db_xref="GI:58261413"
                     /db_xref="GeneID:3254975"
     CDS             join(622184..622290,622348..623689)
                     /locus_tag="CNL05840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568117.1"
                     /db_xref="GI:58261414"
                     /db_xref="GeneID:3254975"
                     /translation="MQSPLKGTGRPGIITSFDETRAIKRRRGRNVDVIGTMPTPRSHQ
                     LPTPETVRRPSKSEVSQDEPTLSSQLPTPQTQRHRRHASPKSGDAFPASPSGQTTFYL
                     AANHPTSRAEISRRRPGLMFAQQMGLISSSISRGVGVGMGGHTIGQQKVDLVQATSHE
                     DNPFLVSKADEQTMDVPVGLASPGAITTHRPGDLSSDTEDDAEPLCSFTLLKQSPART
                     QPSSSIQPSPVYPASGLLSPPPTKPAPRIADPNSKTVLTRAEHAAKIASRRKAEERRQ
                     MLDVEHNPFLIKPGEPSTRRAGPIVDEDQPTVTYLFRGAKRVFANPLWNSKMPFPRAE
                     LPPEDDDFEPHPLPKPKLLWPEGPSPSKRINLEKVTRSSTPSPSRIAGLSPESSPVAT
                     PTILRRFGGTSLSTDSPNPLGVGQGAFTDDENDLNHQDAEGESDFEPEEEQEELPVRR
                     GLLFGGTGMKRDRPSSPGGTRTVKKLKGAERL"
     gene            complement(625071..627244)
                     /locus_tag="CNL05850"
                     /db_xref="GeneID:3254940"
     mRNA            complement(join(625071..626702,626766..627244))
                     /locus_tag="CNL05850"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531203|gb|CF677044.1,gi|41537810|gb|CF683651.1,
                     gi|41544170|gb|CF690011.1"
                     /transcript_id="XM_568118.1"
                     /db_xref="GI:58261415"
                     /db_xref="GeneID:3254940"
     CDS             complement(join(625441..626702,626766..626949))
                     /locus_tag="CNL05850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568118.1"
                     /db_xref="GI:58261416"
                     /db_xref="GeneID:3254940"
                     /translation="MQLPATNNNTNEKITSDDIDGFEIVTQMVTEKSATPTPVTETET
                     LVSEARRSNKDDTPDTIIEGAMNLRIGSPELDNNDDQARPRHRGFDHHHGHFYRPRDF
                     MGPSPGFMPFHFDGSMPPHPAIFHRGPPGLTFDGPFPPEFAFGCGFGKHHKHGKHGGK
                     FAKRINGTGHKHRHHRAYSPPSFEEVKAESGLDSHKKYMKDFFGPRGRHDRRHHKYAF
                     DDEVAAQKPAEKQATTSESDSASPSVSDSETYSAATISEGEKKYAEYYAGMRGGLAFG
                     GRGRGKAQHRGMKGMGHGKGRYMGPMGMDMRAIPGMGFDGEHPPPPPPFVPEFEMGMG
                     KGMGKGMGKGKGKGKGMGKGMGMGMDMGGRHCPRGFRGKGGLRGMHGCSFGPMSGMGP
                     DAFFGRGEGGPKHMPMHGRHHCGPPPPPEFMSNEQGPRAPFLPHPNHFGRHHDHHGRR
                     GFGGRFAQFDYEMRGTSPSSATSPAPAAAAA"
     gene            627680..629847
                     /locus_tag="CNL05860"
                     /db_xref="GeneID:3254976"
     mRNA            join(627680..628153,628281..628668,628719..629150,
                     629208..629847)
                     /locus_tag="CNL05860"
                     /product="Succinyl-CoA:3-ketoacid-coenzyme A transferase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533268|gb|CF679109.1,gi|41540804|gb|CF686645.1,
                     gi|41540811|gb|CF686652.1,gi|41543648|gb|CF689489.1,
                     gi|41545167|gb|CF691008.1,gi|41545179|gb|CF691020.1,
                     gi|41565377|gb|CF711218.1,gi|41565389|gb|CF711230.1,
                     gi|41566318|gb|CF712159.1,gi|41566325|gb|CF712166.1"
                     /transcript_id="XM_568119.1"
                     /db_xref="GI:58261417"
                     /db_xref="GeneID:3254976"
     CDS             join(627769..628153,628281..628668,628719..629150,
                     629208..629688)
                     /locus_tag="CNL05860"
                     /codon_start=1
                     /product="Succinyl-CoA:3-ketoacid-coenzyme A transferase,
                     putative"
                     /protein_id="XP_568119.1"
                     /db_xref="GI:58261418"
                     /db_xref="GeneID:3254976"
                     /translation="MIRTALPTTRALARSRVLHRAAALARPGAITASRYINTEPVKGS
                     PSDLKSVPSQGTHGRSRITPSEKSKVWPDAKTAIRDIKNGQTILSAGFGLCGTAETII
                     KAMRESDLKDLTVVSNNAGNAGTYGLSPLITSKQIKKMILSYLGTNKGLQDAYLSGEI
                     EIELCPQGTIAERLRAAGAGMPGFFTRTGAGTDVETGGIPQKWSKPDADGKQTIAIPG
                     VKKDTQVFDGKKFLFEPAIHGDVAVFRAWKVDKAGNCVFRYTTRTFGPLVARAAKLSI
                     VEAENIVEIGELDPMEIDLPGIFVDRVVPATEDKQIEIFTTREENENVSPSSGEETSV
                     NKSVGQAQREKIAQRAGKELYDGAYVNLGVGIPVLAANYLPDGMKVWVQSENGILGMG
                     PYPTKEEVDADIINAGKETVTLVPGASVFDSSESFGMIRGGHVDVSILGAMEVSANGD
                     LANYMIPGKLVKGMGGAMDLVSNPDETKIVVVTTHTDKHGRPKIVESCKLPLTGVSVV
                     SRIITDLAVFDVDRTGQNGGGLELIEIAEGVSLEEVQEKTGATFKVREPLGRF"
     gene            631395..633981
                     /locus_tag="CNL05870"
                     /db_xref="GeneID:3254850"
     mRNA            join(631395..631675,631734..631877,631933..632536,
                     632589..632617,632665..632789,632841..632847,
                     632897..633363,633414..633417,633482..633548,
                     633602..633697,633753..633981)
                     /locus_tag="CNL05870"
                     /product="meiotic recombination-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530004|gb|CF675845.1,gi|41530012|gb|CF675853.1,
                     gi|41537576|gb|CF683417.1,gi|41537580|gb|CF683421.1,
                     gi|41554320|gb|CF700161.1,gi|41555179|gb|CF701020.1,
                     gi|41568243|gb|CF714084.1,gi|41568248|gb|CF714089.1,
                     gi|41568462|gb|CF714303.1,gi|41568466|gb|CF714307.1,
                     gi|41570607|gb|CF716448.1,gi|41570611|gb|CF716452.1"
                     /transcript_id="XM_568120.1"
                     /db_xref="GI:58261419"
                     /db_xref="GeneID:3254850"
     CDS             join(631448..631675,631734..631877,631933..632536,
                     632589..632617,632665..632789,632841..632847,
                     632897..633363,633414..633417,633482..633548,
                     633602..633697,633753..633877)
                     /locus_tag="CNL05870"
                     /codon_start=1
                     /product="meiotic recombination-related protein"
                     /protein_id="XP_568120.1"
                     /db_xref="GI:58261420"
                     /db_xref="GeneID:3254850"
                     /translation="MLESISCLPAQLQPYFIWLSALTLGEIWLTIYNPPNRVNLSIAF
                     IIISFKLPTWARKYNSWKNERKVVRFGYPVPKEASKQWEGRVIENPNLLSHLEDESLL
                     PPETGLSGRKREHITCYDPSTGYHLNTLPLHTAEEVSLQISKANSAFFAWSRTTFAQR
                     RHFLRNVRGWVLRDMDYIVQVACRDTGKTNVDAVFGEILTSLSKIDWLLKHGEKTLSP
                     QKRAGNLLLAHKVSKVHYHPLGTVLALVSWNYSFHNLLSPIIAALFAGNTIVVKCSEH
                     VAWSSMWFIGGIKECLKICGLDPEVVQLVICLPGGAEKVTRNPIFKHITFIGSEPVGK
                     KVAAAAAEIMVPTCIELGGKDPAFILPGTDLDFFASTWMRGAFQSAGQNCIGIELFLV
                     HRSQYSRFLEILTPRVQALRPGHDVGSLISHAPISKLQSLLASSISSGARLLAGGHPY
                     VHPLYPQGAYFEPTLIADVTMDMAVAKEELFAPVMTVVPYDDVNEAVEWLNKGKFGLG
                     GGVYGKDKKECRRVAEKLECGMVAINDFGVFYLNQAMPFGGVKASGHGRFGGEEGLRS
                     LCSVKAITEDRFFSWIRTTIPRPVDFPLPEDGTAWQFLKGLVGLAYAPTTPGRVSGLV
                     NLVKAST"
     gene            complement(633817..>635421)
                     /locus_tag="CNL05880"
                     /db_xref="GeneID:3254817"
     mRNA            complement(join(633817..634099,634149..634380,
                     634431..634775,634831..635134,635182..>635421))
                     /locus_tag="CNL05880"
                     /product="cysteine synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534390|gb|CF680231.1,gi|41534403|gb|CF680244.1,
                     gi|41543615|gb|CF689456.1,gi|41543622|gb|CF689463.1,
                     gi|41546453|gb|CF692294.1,gi|41573006|gb|CF718847.1,
                     gi|41573015|gb|CF718856.1,gi|41576358|gb|CF722199.1,
                     gi|41576366|gb|CF722207.1"
                     /transcript_id="XM_568121.1"
                     /db_xref="GI:58261421"
                     /db_xref="GeneID:3254817"
     CDS             complement(join(634003..634099,634149..634380,
                     634431..634775,634831..635134,635182..635421))
                     /locus_tag="CNL05880"
                     /EC_number="4.2.99.8"
                     /codon_start=1
                     /product="cysteine synthase"
                     /protein_id="XP_568121.1"
                     /db_xref="GI:58261422"
                     /db_xref="GeneID:3254817"
                     /translation="MVDYKFPIFFRNPAVVSPELISSSLHISSKSIQNMVVSRSASIL
                     RSVCPTFISSRAYATAAPAFGKPVNGFVGAIGNTPLIRLSRLSEETGCNILAKAEFMS
                     PGGSIKDRAALYLVQDAEEKGLIRPGGTVVEGTAGNTGIGLAHVCRSKGYKCVIYMPD
                     TQSQEKIDLLRMLGADVRPVPAVAFDNPQNYNHQAARYAASLENAVWTNQFDNVANRN
                     AHIVSTGPEIWEQTDGGKLDAFICSTGTGGTLAGVTRYLTEKSNGRVEAWLADPPGSV
                     LFNLVENGEIKREGNGSITEGIGQGRVTNNLAPDLSLLSGAIHVPDSASINMIYRLLD
                     EEGLYVGASSALNVWSAVELAKRKGKGSTVVTVLCDGAYRYQARLFSRVWLESKGLVS
                     HIPDHLQKYIVLP"
     gene            complement(636336..638440)
                     /locus_tag="CNL05890"
                     /db_xref="GeneID:3254997"
     mRNA            complement(join(636336..637185,637243..637533,
                     637581..637702,637748..637821,637869..638440))
                     /locus_tag="CNL05890"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535675|gb|CF681516.1,gi|41535690|gb|CF681531.1,
                     gi|41575783|gb|CF721624.1,gi|41575791|gb|CF721632.1"
                     /transcript_id="XM_568122.1"
                     /db_xref="GI:58261423"
                     /db_xref="GeneID:3254997"
     CDS             complement(join(636359..637185,637243..637533,
                     637581..637702,637748..637821,637869..638033))
                     /locus_tag="CNL05890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568122.1"
                     /db_xref="GI:58261424"
                     /db_xref="GeneID:3254997"
                     /translation="MVTSVVSSVNDSFDGLAIAPEADVVIIGAGLAGLCAARSLHEAG
                     KRVVVLEARGRVGGKTLTVTSKSGGRVDVGGAWVNEHTQPEVCKLNKEAGNILFKQRV
                     LGTTCWELSEDRQLRYYDDGGVGDNSPIPLEGEELEDYNRIFKELDRLSRTVSLKNPN
                     DTPGAVEYDSVTVANWLDQMDAGQISRQALIPLVRALVGAEMHETPLFYFLHYAKTAK
                     GFFDLIAADETGGQFQRTRYGNQTMSTWIQNHILPPGAVKLNAAAHQIIQSPDGESVR
                     VITRDGRQFTGRRVICSIPTPLYPNIVWQPSLPVDKTLLVQRSFLGTYTKVVLLYEKA
                     WWLEAGFSGFALSSEWPVSLVFDTCDGWYGSDDPSIRPRQHSLSCFVVAANGVAFSEL
                     SRDRREQVVKQQVARMIGSPELVNNTVEVLEFQWIKEEFSQGAPCPVTSTGAFTLYGD
                     SLARPHGLIHFAGSEFSDVWKGYMEGAIISGRKTAKEVLELL"
     gene            <638546..>639577
                     /locus_tag="CNL05900"
                     /db_xref="GeneID:3254930"
     mRNA            join(<638546..638605,638662..638720,638817..638851,
                     638903..638979,639035..639436,639491..>639577)
                     /locus_tag="CNL05900"
                     /product="Mango esterase, putative"
                     /transcript_id="XM_568123.1"
                     /db_xref="GI:58261425"
                     /db_xref="GeneID:3254930"
     CDS             join(638546..638605,638662..638720,638817..638851,
                     638903..638979,639035..639436,639491..639577)
                     /locus_tag="CNL05900"
                     /codon_start=1
                     /product="Mango esterase"
                     /protein_id="XP_568123.1"
                     /db_xref="GI:58261426"
                     /db_xref="GeneID:3254930"
                     /translation="MSSKKTHIDQIVLIGDSLTQFALGEKGFAGQLANHFQRQFDVVV
                     RGFSGYNSRWVLEMARLFMPELKRIRLAVIWLGTNDALLPPEPRAIDPESYKANIAKI
                     VSLVPLSAKVILVSPPPYSLKGKAKDLGLEYYPGVKLDRDPAHSLLYNLKARELADNL
                     NEAGDRKGNVAFCDTRTSMERAALEESPDDLEEGLFKYLRDGVHLSPDGYQCMYETLL
                     HVIKSRFPELGQEPYFFADYE"
     gene            complement(<640678..>642516)
                     /locus_tag="CNL05910"
                     /db_xref="GeneID:3254803"
     mRNA            complement(join(<640678..641037,641093..641940,
                     641999..642145,642205..642273,642327..>642516))
                     /locus_tag="CNL05910"
                     /product="amine oxidase, putative"
                     /transcript_id="XM_568124.1"
                     /db_xref="GI:58261427"
                     /db_xref="GeneID:3254803"
     CDS             complement(join(640678..641037,641093..641940,
                     641999..642145,642205..642273,642327..642516))
                     /locus_tag="CNL05910"
                     /codon_start=1
                     /product="amine oxidase"
                     /protein_id="XP_568124.1"
                     /db_xref="GI:58261428"
                     /db_xref="GeneID:3254803"
                     /translation="MPPPVTDDGYHWTRSTGMQQGVLRCKGVVDPPSRIDNSFLEYDV
                     VVIGAGYAGLIAARELVQRGHSVALLEARDRVGGRTWTAEVDGYMYEMGGTWVTHWMG
                     YLQKEMERYGMEDDLITTRLKGAGDDFYTLNVPGAKPRKMSHAEAGALAARAWDIFVN
                     VDGNGGRTVCPLPHAPFNNVRTTKADVEAIDQLSAVDRLEQIGHLLTNEERGVLEALL
                     LHISGGTLETTSTWDIVHSNALQGHSSVNFEEVWTTYKLREGQSGLARAMFDEACIAG
                     LDYAFKTPVDTIRDLRNFVEIHTTTGSTFRATRVISTIPLNVLHTIKFDPPVSPTRAE
                     AFRLGHVNHMSKIHAEVKGDIASWCGLTYPAKLMFGYSDGLYPNGNTHIVTFGADETD
                     DFVPEKNPEQVIEAMNRIRPVDVQRMVFHNWNTDPWSMAGPAWYRPGYATKYQEELQS
                     RHGNIFFASADWARGWRAAIDGALEQGFCNAQSVSRELQGRHWKRGYFLPQGDSVSDS
                     IPHVGAMKGGVNGKDGVNGLSNGVNGFHI"
     gene            <643776..>644075
                     /locus_tag="CNL05920"
                     /pseudo
                     /db_xref="GeneID:3254985"
     gene            complement(<644631..>645770)
                     /locus_tag="CNL05930"
                     /db_xref="GeneID:3254924"
     mRNA            complement(join(<644631..644658,644712..644868,
                     644923..645217,645270..645340,645418..645593,
                     645718..>645770))
                     /locus_tag="CNL05930"
                     /product="L-xylulose reductase, putative"
                     /transcript_id="XM_568125.1"
                     /db_xref="GI:58261429"
                     /db_xref="GeneID:3254924"
     CDS             complement(join(644631..644658,644712..644868,
                     644923..645217,645270..645340,645418..645593,
                     645718..645770))
                     /locus_tag="CNL05930"
                     /codon_start=1
                     /product="L-xylulose reductase"
                     /protein_id="XP_568125.1"
                     /db_xref="GI:58261430"
                     /db_xref="GeneID:3254924"
                     /translation="MSPLTPKTAPALADNVLDKVAVVTGASVGIGLAAATAFAEAGAN
                     VVLLYARSKHTEKTASDLAARTGVKVKAYQLDVRDYDATQRLVENVVKELGRLDIWVA
                     NAGIPQDDTILDGNRKHWEDIIAVNYTAVVYQAQIVGKAFKKQGNGSFIITASAAGIA
                     NIRPTDQGVYNSSKAAVIALARSLAQEFKDFARVNSVSPGYMGDAQGAPESEITNALT
                     RQVLNRTGEYRELAGAYLYLASDASTFCTGTDLIVDGGYHC"
     gene            <646189..>646933
                     /locus_tag="CNL05940"
                     /db_xref="GeneID:3254726"
     mRNA            join(<646189..646455,646508..646577,646629..>646933)
                     /locus_tag="CNL05940"
                     /product="Maltose O-acetyltransferase"
                     /transcript_id="XM_568126.1"
                     /db_xref="GI:58261431"
                     /db_xref="GeneID:3254726"
     CDS             join(646189..646455,646508..646577,646629..646933)
                     /locus_tag="CNL05940"
                     /codon_start=1
                     /product="Maltose O-acetyltransferase"
                     /protein_id="XP_568126.1"
                     /db_xref="GI:58261432"
                     /db_xref="GeneID:3254726"
                     /translation="MPPAPAPHLTNKLIPPPEEGEDPTQLSLMISAKPYLALDKYLDR
                     LRNRGAIKLDEITRTPDHEKRMELWKEFANIGENVSITQRFFCEYGFNLHFEGENFIA
                     ADCTFVDVCPIYIGKRTMIGPNVRIYTPDHPISPEARAGLTGEEWGKIVRIEEDCWIC
                     GSAIILPGVTVGKGSTVAAGAVVTKDIPPRSLAMGNPARVVKKILEDGTIVKA"
     gene            complement(<647475..>648042)
                     /locus_tag="CNL05950"
                     /db_xref="GeneID:3254938"
     mRNA            complement(join(<647475..647717,647791..647920,
                     647990..>648042))
                     /locus_tag="CNL05950"
                     /product="hypothetical protein"
                     /transcript_id="XM_568127.1"
                     /db_xref="GI:58261433"
                     /db_xref="GeneID:3254938"
     CDS             complement(join(647475..647717,647791..647920,
                     647990..648042))
                     /locus_tag="CNL05950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568127.1"
                     /db_xref="GI:58261434"
                     /db_xref="GeneID:3254938"
                     /translation="MSSIPFHAVDTKGKVLGDNFAPAAAVILPANAKTLYISGVVGEN
                     EDGSFGDFRTQVFLIFDRITEILLNASPSYKSAGNAWKHVFEITAYHVGPLPEHLPIE
                     LEAVDKYLKGAHPTWTSAAVEKLFHDEQLYEVHVKAIVP"
     gene            <648542..>649295
                     /locus_tag="CNL05960"
                     /db_xref="GeneID:3254932"
     mRNA            join(<648542..648888,648947..>649295)
                     /locus_tag="CNL05960"
                     /product="hypothetical protein"
                     /transcript_id="XM_568128.1"
                     /db_xref="GI:58261435"
                     /db_xref="GeneID:3254932"
     CDS             join(648542..648888,648947..649295)
                     /locus_tag="CNL05960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568128.1"
                     /db_xref="GI:58261436"
                     /db_xref="GeneID:3254932"
                     /translation="MSESFVKTLQDLTFHPYSSAPVATTLQHDHLKIQAPKLVDWWRN
                     PEPVKVNRKDGPFAHIAIDGSRPFQVEIWLRSGLKGLYDQACLVLHGGDLADTSAHWL
                     KTGTETFDERQWINAVVAAPWCDVSAVPSDRELSSEAGGDWIYLRLVKELSITGHTIL
                     IKWARQSIVDTDNPPTEDELANLREVQAFGVKENGERSHDFNWSIGVMVSGLMNDEGA
                     FAEFKGFKFKYLD"
     gene            649542..651243
                     /locus_tag="CNL05970"
                     /db_xref="GeneID:3254728"
     mRNA            join(649542..649918,649970..650316,650373..650576,
                     650627..651005,651051..651243)
                     /locus_tag="CNL05970"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41551180|gb|CF697021.1,gi|41551187|gb|CF697028.1"
                     /transcript_id="XM_568129.1"
                     /db_xref="GI:58261437"
                     /db_xref="GeneID:3254728"
     CDS             join(649870..649918,649970..650316,650373..650576,
                     650627..651005,651051..651148)
                     /locus_tag="CNL05970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568129.1"
                     /db_xref="GI:58261438"
                     /db_xref="GeneID:3254728"
                     /translation="MPINVALLGGGIFAVDAHLPALAKSGTLASLEAVWSRSESSSTK
                     AAEAWKSLTGQEVTKYSETGCDNLDKLLSREDIEAVIIALPILSQPDIIVRALKARKH
                     VLSEKPVSQDVTSATKMLKDYQENYQAQGLVWRVAENWEVEPAHIFAAQALKAGHIGN
                     LNTFSISSVLFVDNEDNKYFETEWRKRPQHQGGYLLDAGVHNAGVLRTVLPSPITHLS
                     AHTALNNEHLPPYDWLSVITRSEPNNIHGQILIDYGARGREPMWELRLTGSDGEIYSE
                     DINDDGVDSIKVQVRSGKFGRTNREIKIFPKTGVYEEQRRFFEAIAGKPDEYGSVQGA
                     LNDVALIQAALTSNGNEVALNILK"
     gene            complement(651266..653855)
                     /locus_tag="CNL05980"
                     /db_xref="GeneID:3254784"
     mRNA            complement(join(651266..651892,651943..652084,
                     652368..652422,652769..653420,653486..653505,
                     653573..653583,653651..653855))
                     /locus_tag="CNL05980"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543613|gb|CF689454.1"
                     /transcript_id="XM_568130.1"
                     /db_xref="GI:58261439"
                     /db_xref="GeneID:3254784"
     CDS             complement(join(651275..651892,651943..652084,
                     652368..652422,652769..653420,653486..653505,
                     653573..653583,653651..653787))
                     /locus_tag="CNL05980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568130.1"
                     /db_xref="GI:58261440"
                     /db_xref="GeneID:3254784"
                     /translation="MSGSTSSAPKTAGKARTKQGSLLAAVQLVPDGDKPYRRSRTGCL
                     TCRKRKKKCPEQYDDNSCLRCKAGGWKCIREEDVSGGSSRSQMTDSSPKARGSPATQQ
                     RQQQQQLQAHQHQIQHHQVAGTGPSQFHQLHDEVRSPSDGASSEQSTAAAATEAYHNM
                     DENSLSMAAHGAPTNPDNLVGNYRSNFLPDDIWMDQPLDAILSATAPTFDISFYGSLG
                     DPSAPDPFHFTPALDFDMVNNGSGSGHRDPTLFDNLPSELTLEHISSEEELLYDFLDA
                     EEMVREAMLLVRSPKDYIPFYLRAFAMIDLNRSICQRRRTFFAFLETPQMGASGFLND
                     GSHDQWFGLPAGLAVSFASLSNLVAHIRDPSCTLSPNDISSASKRIEANFKAYQSPFA
                     VHDISFDRHPIAWAAELSVETEIWRHLGLLLLWRLVDQQSVLSTPMRDTVHLVINLLK
                     SLQYVSTPRVESENNVIDFWSLNYTTPAFLIGTLLVDRDDRAFCKRFLERLGGEKNLE
                     DMIVALETTWAATDRSGQVADWFEECTRLDLAVTFF"
     gene            <654208..>654848
                     /locus_tag="CNL05990"
                     /db_xref="GeneID:3254984"
     mRNA            join(<654208..654412,654466..654683,654738..>654848)
                     /locus_tag="CNL05990"
                     /product="hypothetical protein"
                     /transcript_id="XM_568230.1"
                     /db_xref="GI:58261639"
                     /db_xref="GeneID:3254984"
     CDS             join(654208..654412,654466..654683,654738..654848)
                     /locus_tag="CNL05990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568230.1"
                     /db_xref="GI:58261640"
                     /db_xref="GeneID:3254984"
                     /translation="MMELPQPNTFVYRTVHQPEPAGTLQLKVDVYSPPEATDNESPIL
                     VYFHSGGLTAGSRQLNSWFPTWILDHALSLGFTFVIPDYTLLVPGNAHDLLEDVKVLT
                     NWLHTHLNKALQDAGLRDVRTEDIVVVGQSAGGYLAYLMSIHINPPPKAVAIFYGMGG
                     DFLSDMHIVPKKVGLNR"
     gene            655829..658267
                     /locus_tag="CNL06000"
                     /db_xref="GeneID:3254898"
     mRNA            join(655829..656131,656193..656232,656305..656461,
                     656517..656683,656734..656834,656888..657012,
                     657066..657177,657232..657443,657491..657531,
                     657582..657668,657724..658051,658116..658267)
                     /locus_tag="CNL06000"
                     /product="GabA permease, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539387|gb|CF685228.1,gi|41539392|gb|CF685233.1,
                     gi|41539396|gb|CF685237.1,gi|41554489|gb|CF700330.1,
                     gi|41558096|gb|CF703937.1,gi|41570728|gb|CF716569.1,
                     gi|41570735|gb|CF716576.1"
                     /transcript_id="XM_568131.1"
                     /db_xref="GI:58261441"
                     /db_xref="GeneID:3254898"
     CDS             join(655949..656131,656193..656232,656305..656461,
                     656517..656683,656734..656834,656888..657012,
                     657066..657177,657232..657443,657491..657531,
                     657582..657668,657724..658051,658116..658206)
                     /locus_tag="CNL06000"
                     /codon_start=1
                     /product="GabA permease"
                     /protein_id="XP_568131.1"
                     /db_xref="GI:58261442"
                     /db_xref="GeneID:3254898"
                     /translation="MSHQGEIRPASQLSVPVDVAGSDGGHSNKKATSSSTRIEIVGDV
                     QPDNEISAMGYTPQLKRNRGQLTIQTMLLSLFAVPFGISSGFYTAMIGGGPASLLWGF
                     ILVGCLQECVAVSLGEICSRFPTSGGPYYWSYALAPPGIRTMLSYVTGWLYMLAIWML
                     DLGTHYGTAILIAGAINIYYPDWNAPVWVTLLICYGLYVLSTLITWKGHRWVPMLDTV
                     NAVFTGICLVAIVASLLGIAAEGRRSASFVFTHYDWSYSGWGRGFTFCIGLLPGCFVM
                     CGIGFISSMSEEVAVPTKQIPRAMVIGIPMAVFSGLIFILGCLFTLPDVDKLLNAPGG
                     SPMPVILATATGSKAGGVALLSLIISNATIACVANQYISSRTTWSFSRDHALPKSRFW
                     SAVTEDSQPRNALIMSSVVQMLVALIGLGSSSAFNAFLNVGIIGVDLAFGMPIAISLW
                     SGRKLVKDAPWYAGTVGKVCNIISVLWVSFSLVLFSMPIAIPVDAVSANYAPAVLVFF
                     MGFSTLWYIFRARRVYKGPPSVDFLVSLDIPELSQREEQ"
     gene            complement(659029..659966)
                     /locus_tag="CNL06010"
                     /db_xref="GeneID:3254909"
     mRNA            complement(join(659029..659297,659352..659455,
                     659518..659628,659684..659824,659891..659966))
                     /locus_tag="CNL06010"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41567400|gb|CF713241.1"
                     /transcript_id="XM_568132.1"
                     /db_xref="GI:58261443"
                     /db_xref="GeneID:3254909"
     CDS             complement(join(659198..659297,659352..659455,
                     659518..659628,659684..659824,659891..659938))
                     /locus_tag="CNL06010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568132.1"
                     /db_xref="GI:58261444"
                     /db_xref="GeneID:3254909"
                     /translation="MRRTPYRGVPGLLAHNHTQYDIQGPKEIDLFPSGDKQHEEGITF
                     ETGEVYTVEVWITDAKDPSPQPAADLDKTLHQIPPSKDISSLSAEIKEAYNCITKKVG
                     TFPFHTRVLGDSALVNAGDVLEAADILATYPAFTLKDRSKAVAQSVVSFIVTIDGVHV
                     LSAPILS"
     gene            complement(661222..664131)
                     /locus_tag="CNL06020"
                     /db_xref="GeneID:3254964"
     mRNA            complement(join(661222..661990,662047..662209,
                     662274..662491,662553..662689,662749..662831,
                     662885..663058,663112..663240,663296..664131))
                     /locus_tag="CNL06020"
                     /product="CAT1 catalase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41559290|gb|CF705131.1,gi|41559297|gb|CF705138.1"
                     /transcript_id="XM_568133.1"
                     /db_xref="GI:58261445"
                     /db_xref="GeneID:3254964"
     CDS             complement(join(661307..661990,662047..662209,
                     662274..662491,662553..662689,662749..662831,
                     662885..663058,663112..663240,663296..663813))
                     /locus_tag="CNL06020"
                     /codon_start=1
                     /product="CAT1 catalase"
                     /protein_id="XP_568133.1"
                     /db_xref="GI:58261446"
                     /db_xref="GeneID:3254964"
                     /translation="MSARNLASGTPYRKNLSPANSSHFDAPSVSSTSDSVKSAYSVGY
                     TPVPTADRSYSGLLHGTLSKVFRKGGQEIIVSEEPVSFSSSKEDSESTRFNGCPYMNG
                     SIPQTPTPKSTSKSASVAVPVPLPPPSAARLKVQKQNDSIPRENGNALADDVGKLTVR
                     SYEKDRDLKSQEVIYTTSNGVPVPHPYAVQRAGVNGPLLLQDFHLIDLLSHFDRERIP
                     ERVVHAKGSGAHGTWECTDGLEDLCLANMFQKGTTCPLTIRFSTVGGESGSPDLARDP
                     RGFAVKFRTAEGNWDFVANNTPVFFLRDPAKFPHFIHTQKRDPATHLSGGDDSTMFWD
                     YLSQNPESIHQVMILMSDRGIPAGWRHMHGYYGHTLKIVNDNGDWVYAQFHLISDQGN
                     KFFTSEEASTKSPDWGQKDLYEAIGRGEYPSWTMKVQVMTQEQAEEAWEKKRINVFDL
                     THVWPHGDYPLRTIGKITLNENPSNYFAEVEQATFNPAHMIPGVEPSADPVLQARLFS
                     YPDAHRHRVGANYQQLPVNQSATPYATGNFQRDGAMAFYNQGGRPAYLSSIEPIKFRE
                     KRVNLNKVHGQFIGEAVSFLSEIRPEDFNAPRALWQKVFSDESKERFIQTVAGHMSTC
                     KRKEIIARQIAIFRQVSPDLGARLEKATNVRGYGSIEGMSFNGTHNGFGVKRGANGLR
                     QDADVVFNNGAPQKTQRAR"
     gene            complement(665268..668040)
                     /locus_tag="CNL06030"
                     /db_xref="GeneID:3254982"
     mRNA            complement(join(665268..665580,665639..665828,
                     665883..666221,666277..666480,666534..666783,
                     666832..666895,666943..667384,667468..667544,
                     667937..668040))
                     /locus_tag="CNL06030"
                     /product="protein-nucleus import-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532122|gb|CF677963.1,gi|41532131|gb|CF677972.1,
                     gi|41532423|gb|CF678264.1,gi|41532495|gb|CF678336.1,
                     gi|41532501|gb|CF678342.1,gi|41535443|gb|CF681284.1,
                     gi|41535458|gb|CF681299.1,gi|41536507|gb|CF682348.1,
                     gi|41536512|gb|CF682353.1,gi|41537135|gb|CF682976.1,
                     gi|41537156|gb|CF682997.1,gi|41537811|gb|CF683652.1,
                     gi|41538878|gb|CF684719.1,gi|41540298|gb|CF686139.1,
                     gi|41540302|gb|CF686143.1,gi|41542608|gb|CF688449.1,
                     gi|41542617|gb|CF688458.1,gi|41545019|gb|CF690860.1,
                     gi|41545023|gb|CF690864.1,gi|41545267|gb|CF691108.1,
                     gi|41545289|gb|CF691130.1,gi|41546410|gb|CF692251.1,
                     gi|41546418|gb|CF692259.1,gi|41549190|gb|CF695031.1,
                     gi|41549920|gb|CF695761.1,gi|41549923|gb|CF695764.1,
                     gi|41550983|gb|CF696824.1,gi|41551088|gb|CF696929.1,
                     gi|41551095|gb|CF696936.1,gi|41551222|gb|CF697063.1,
                     gi|41552061|gb|CF697902.1,gi|41552391|gb|CF698232.1,
                     gi|41552400|gb|CF698241.1,gi|41554052|gb|CF699893.1,
                     gi|41559175|gb|CF705016.1,gi|41559313|gb|CF705154.1,
                     gi|41565199|gb|CF711040.1,gi|41565207|gb|CF711048.1,
                     gi|415"
                     /transcript_id="XM_568231.1"
                     /db_xref="GI:58261641"
                     /db_xref="GeneID:3254982"
     CDS             complement(join(665516..665580,665639..665828,
                     665883..666221,666277..666480,666534..666783,
                     666832..666895,666943..667384,667468..667544,
                     667937..667997))
                     /locus_tag="CNL06030"
                     /codon_start=1
                     /product="protein-nucleus import-related protein"
                     /protein_id="XP_568231.1"
                     /db_xref="GI:58261642"
                     /db_xref="GeneID:3254982"
                     /translation="MEDDREMRGDEPMAPEAGDRYRRDDRDRSRSRERHSSRRDEDRY
                     RSDLTQDDDGGMDIDEQRRRSYSRSHSRSRTRSPHRHRHRSPSRSRSRSRDRRDRDRS
                     RSRDRGERRSYREDRHGGDHRGSGRPRSPRRGSGRYGAPRQDWEKSVDGPMNAPASEA
                     EAHAKVSKRENRLYVGNLAYDCNYKDLANFMERGGGKVVFSEVLTTPAGQSKGCGIVE
                     FASQEEAQRAKAELSDKAFFGRSVFIREDREETARFGAPPIPGKIGIALGEARHFLGN
                     QQPHGFHGHGPAIPNRNLFVGNLPLQASWQDLKDLMRQAGEVIRADIGFRPDGTPKGN
                     GTVVFLNADDAKAAIEMFNGFDWFGNVLEVREDRFAHGGAFRGRGGFRGAFFPRGGFG
                     FRGGFRGGFRGGFMGGGMGMGHMGMNAVAGGVGAGGAAAAGGRNFSNDLYADYNGPEG
                     GEGMAVDQVAPSGLEPIPAEPNQQILVRNLPWSTSNEDLVELFETIGTVTLAEILYSG
                     GQSKGEGIVQFAETADAANASEKFMGWPYGGRALDVQFNPRWHEFSASAIKVPQA"
     gene            complement(668307..670182)
                     /locus_tag="CNL06040"
                     /db_xref="GeneID:3255036"
     mRNA            complement(join(668307..668581,668638..668715,
                     668769..668865,668919..668978,669034..669069,
                     669118..669230,669285..669311,669361..669436,
                     669491..669564,669616..669736,669788..669825,
                     669892..669991,670041..670182))
                     /locus_tag="CNL06040"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41561831|gb|CF707672.1,gi|41561847|gb|CF707688.1,
                     gi|41569309|gb|CF715150.1"
                     /transcript_id="XM_568239.1"
                     /db_xref="GI:58261657"
                     /db_xref="GeneID:3255036"
     CDS             complement(join(668411..668581,668638..668715,
                     668769..668865,668919..668978,669034..669069,
                     669118..669230,669285..669311,669361..669436,
                     669491..669564,669616..669736,669788..669825,
                     669892..669991,670041..670117))
                     /locus_tag="CNL06040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568239.1"
                     /db_xref="GI:58261658"
                     /db_xref="GeneID:3255036"
                     /translation="MSSIEEISKAAITADLARNLTPLIISLGVDALMMGVIGNQFLRY
                     LLITEHESVHIKLVIYFATAAAVATTCFTWAMEVNMFAYNYGQYAQFTSQHWSAWYGL
                     LCSLTKIPVQAFYGERAWRINNRSVIISATLLFTLSLSAIGSIGYTALDHRLDFSADI
                     SYAGTVFFYLWPTACIVSDLINTGGILWGLYKSRTGWIVTDKLIYKLMRIAVEAQIPP
                     TIFASIVLMAWSREMASISTLFMIMLPKVYLTGALSVLNSRDTIRQNNSTYYSNSDFN
                     SGQKSSRRQADTGVTVSTDTYVESHFSYEAPKMGLNRILAKDHRHDSVDDLEAGMSLS
                     AIPVQMSKEELIDDDKGRVHI"
     gene            <671841..>672527
                     /locus_tag="CNL06050"
                     /db_xref="GeneID:3254773"
     mRNA            join(<671841..672019,672071..672200,672273..>672527)
                     /locus_tag="CNL06050"
                     /product="hypothetical protein"
                     /transcript_id="XM_568134.1"
                     /db_xref="GI:58261447"
                     /db_xref="GeneID:3254773"
     CDS             join(671841..672019,672071..672200,672273..672527)
                     /locus_tag="CNL06050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568134.1"
                     /db_xref="GI:58261448"
                     /db_xref="GeneID:3254773"
                     /translation="MLAAKNCLNKSLRALRPLTERSASPVIARSARASPLLRSRATSA
                     RTFVTSLPRQSQPLPPPPTSTLSHDEYEHVSERDMETLNESLEIFCEDFGNGNWEIEY
                     SSGVLNLTLPPYGTYVLNKQPPNLQIWMSSPVSGPSRFEYINGSWVHHRKEGVKLGEL
                     LSGELKEILEKSGNEAAAGVWEGVGLP"
     gene            complement(672580..>675182)
                     /locus_tag="CNL06060"
                     /db_xref="GeneID:3255034"
     mRNA            complement(join(672580..672941,672999..673071,
                     673148..673191,673251..673272,673325..673381,
                     673429..673730,674261..674359,674417..>675182))
                     /locus_tag="CNL06060"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546223|gb|CF692064.1"
                     /transcript_id="XM_568238.1"
                     /db_xref="GI:58261655"
                     /db_xref="GeneID:3255034"
     CDS             complement(join(672871..672941,672999..673071,
                     673148..673191,673251..673272,673325..673381,
                     673429..673730,674261..674359,674417..675182))
                     /locus_tag="CNL06060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568238.1"
                     /db_xref="GI:58261656"
                     /db_xref="GeneID:3255034"
                     /translation="MSATPDTPLPQFHLDHPFLLYHPAPSIAGNASVCSISTNSAIQY
                     QVPSPCRSSSSQLGVSPAPSWDPAETRQSWGGYEWCGQEGTYASGSRPVNQYYNQTTT
                     INTYSFQPPRTNSYAHSQPAKFYSINQTPSFPQSYIPTPNNSSPPLLPHQHTHPPTLP
                     PREDSAHLPLYHSFETFDLRPSLQFLASKTPPPEKPLPPPPTLVNSIPIHQRPIPPRT
                     MSDSEIAKTDGAGPAAFACLSMDFGLTSGMSDPGTKSSAVSPPTTCFAPGQNPWGGNS
                     AVRDPIAQGRNQARPTPGTLHFSATVPGDFDMNEQLNESKLQSKCHFDQSDHLPLMTT
                     EPMSLVPIADNLPSRAVRTSTGLRRRRPSDGRSTKVNEGRAKKRVRTTLSGLKHFKRF
                     TCSECCEGFTRKNDMDRHMQCKHSDKLPFVCPACSKAFGRKDKLDLHIERSEDCKRSA
                     PPKEQRLVRHRGSPKSHMRTAEPCRIE"
     gene            complement(676509..678830)
                     /locus_tag="CNL06070"
                     /db_xref="GeneID:3254777"
     mRNA            complement(join(676509..677048,677219..677431,
                     677495..677591,677630..677850,677900..678082,
                     678139..678385,678545..678830))
                     /locus_tag="CNL06070"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41548466|gb|CF694307.1,gi|41548486|gb|CF694327.1,
                     gi|41554211|gb|CF700052.1,gi|41554220|gb|CF700061.1,
                     gi|41570943|gb|CF716784.1,gi|41570964|gb|CF716805.1"
                     /transcript_id="XM_568135.1"
                     /db_xref="GI:58261449"
                     /db_xref="GeneID:3254777"
     CDS             complement(join(676928..677048,677219..677431,
                     677495..677591,677630..677850,677900..678082,
                     678139..678385,678545..678596))
                     /locus_tag="CNL06070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568135.1"
                     /db_xref="GI:58261450"
                     /db_xref="GeneID:3254777"
                     /translation="MSKPDEIPALSYILEPAFVASLLTAGCLLNRRPPSLIVQAQAAT
                     NEDVPPPGDNSWNWKDMMFLKWPVRVPGNERFRGRWTSRLLGMFPFLMEVWYWLLTYW
                     IYQVARAIQALTMGADFRVLAEKHAREIIAIERWLHIDCELSLQKFVMKTNWLLMFFN
                     KTYAMVHIPATIAFMAYSYRYFKPYIFQSTRRTLVLCNCLAFIVFSSWPCMPPRLMPY
                     EEFGYIDTLHTGKAASSADEFAHPVWTTNKFQNQLAAFPSLHFGYSFVIGLSLFLYSP
                     HRPIRAISLLYPLLILLVIMATANHYLLDAVGGFFVTVLAHRINRLVLNLRPLEEWFF
                     WLIRTERPMDKVVFDSVISRENVSHRDSSDISHRPLIFQGNPA"
     misc_feature    677150..677197
                     /note="T-rich"
     gene            680316..681997
                     /locus_tag="CNL06080"
                     /db_xref="GeneID:3255013"
     mRNA            join(680316..680381,680440..680507,680561..680706,
                     680756..681299,681351..681860,681912..681997)
                     /locus_tag="CNL06080"
                     /product="eukaryotic translation initiation factor 2B,
                     subunit 2, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530350|gb|CF676191.1,gi|41530363|gb|CF676204.1,
                     gi|41536481|gb|CF682322.1,gi|41546225|gb|CF692066.1,
                     gi|41546230|gb|CF692071.1,gi|41547164|gb|CF693005.1,
                     gi|41560450|gb|CF706291.1,gi|41560462|gb|CF706303.1"
                     /transcript_id="XM_568136.1"
                     /db_xref="GI:58261451"
                     /db_xref="GeneID:3255013"
     mRNA            join(680316..680381,680440..680507,680561..680706,
                     680756..681156,681220..681299,681351..681860,
                     681912..681997)
                     /locus_tag="CNL06080"
                     /product="eukaryotic translation initiation factor 2B,
                     subunit 2, putative"
                     /transcript_id="XM_568137.1"
                     /db_xref="GI:58261453"
                     /db_xref="GeneID:3255013"
     CDS             join(680361..680381,680440..680507,680561..680706,
                     680756..681299,681351..681860,681912..681984)
                     /locus_tag="CNL06080"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2B
                     subunit 2"
                     /protein_id="XP_568136.1"
                     /db_xref="GI:58261452"
                     /db_xref="GeneID:3255013"
                     /translation="MAVDSAPQMQKSADPNARLTDTLCTSLRRRQIVGSLNVALATAA
                     LIQNIVRSARYNTIDELLALIKAVGRKLTEANPKELAAANIIRRILRLIREEYRAAAA
                     AHVSSAPNSIPSTPLMGPSTPGINAPLDHYLSAAQSATVDAQYFPTHIQMSRQTSLSN
                     FVAMRHSRAQMERSGALSGGTAEGYSANTTNLFATPNGNGHGRGSSGMATPRASVDSD
                     EFMKHSAKLKPLLIQAIEEVVGELETTHEDVAKGAREHIHSSEIILTMGHSRTVEAFL
                     KQAYKDRKFTVVVAESAPSYLGHSLASSLSASGIPTLLIPDSSIHALLPRVTKVILGA
                     HSVLANGGLFALSGSLACALAAKTHSKPVVVTTGQFKFAPAWNLYHEYGAVDFQGPGA
                     VIGEQGKGGGGGMEGVEVVDPYYDYIRPELVNLFVTNEGDHPPSYIYRLIKEAYDDED
                     VEI"
     CDS             join(680361..680381,680440..680507,680561..680706,
                     680756..681156,681220..681299,681351..681860,
                     681912..681984)
                     /locus_tag="CNL06080"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2B
                     subunit 2"
                     /protein_id="XP_568137.1"
                     /db_xref="GI:58261454"
                     /db_xref="GeneID:3255013"
                     /translation="MAVDSAPQMQKSADPNARLTDTLCTSLRRRQIVGSLNVALATAA
                     LIQNIVRSARYNTIDELLALIKAVGRKLTEANPKELAAANIIRRILRLIREEYRAAAA
                     AHVSSAPNSIPSTPLMGPSTPGINAPLDHYLSAAQSATVDAQYFPTHIQMSRQTSLSN
                     FVAMRHSRAQMERSGALSGGTAEGYSANTTNLFATPNGNGHGRGSSGMATPRAIEEVV
                     GELETTHEDVAKGAREHIHSSEIILTMGHSRTVEAFLKQAYKDRKFTVVVAESAPSYL
                     GHSLASSLSASGIPTLLIPDSSIHALLPRVTKVILGAHSVLANGGLFALSGSLACALA
                     AKTHSKPVVVTTGQFKFAPAWNLYHEYGAVDFQGPGAVIGEQGKGGGGGMEGVEVVDP
                     YYDYIRPELVNLFVTNEGDHPPSYIYRLIKEAYDDEDVEI"
     gene            complement(<682058..684535)
                     /locus_tag="CNL06090"
                     /db_xref="GeneID:3254770"
     mRNA            complement(join(<682058..683848,683899..684165,
                     684219..684535))
                     /locus_tag="CNL06090"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41570713|gb|CF716554.1,gi|41570721|gb|CF716562.1"
                     /transcript_id="XM_568138.1"
                     /db_xref="GI:58261455"
                     /db_xref="GeneID:3254770"
     CDS             complement(join(682058..683848,683899..684165,
                     684219..684428))
                     /locus_tag="CNL06090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568138.1"
                     /db_xref="GI:58261456"
                     /db_xref="GeneID:3254770"
                     /translation="MSSSLRTTKPCARCLAAIRARPPAETTVSIAGPSSYQAYMTESF
                     PSKRRSRLTSTRAFTSPPSLRGDFYQGQPDCLQYPTQHSIQSKRQRSPHIKSTFTKGF
                     SSTSRDVTSAPLLQNDAARKIAHSIAGPSAYQAYVIEYNPFLKGSPRSTLASERLCQG
                     QLDYLRRPSHHSTLNIFRKYFQTTAASANSIPRPDPVLQHLSHMAIPDFKPPPPETKA
                     SPIPQHTFSPKERSAALSALQRSTSSPPSQDITSAQLLQSYTDLYMSSPQSQLFTVSE
                     VQDVLKALKLLQAREAGDRQVAEEQIEPLLEEIKALVGDERKSSQGLELLALSSRTKH
                     SRRIKTKNLVDAEKTFRSLFPEPPPEKDIGGRRRYKAALNHLIYLCALAGQGGRLEDW
                     CNRLERDGLKADGHTWLSRMILLDRAGKGEEVNGILDKVLENFDEEVVTKEDMSILVN
                     YAMVVYAKLGRWDVVSEVYGRLRPTDSHDLSIIRSSLPNPSYFDGTHPHVPHHIPLPP
                     FSVRLTRRSYSPLLVSLSVQGHLPATLTIFKHIFEDGHTPSVDDYTALFKGFVKHGVT
                     PSIDTGGFGNAGQVSEAGKMLGVASASGGGELDGLGGSFEQRMSGIWERGAMFAEPFQ
                     WPVEKFREGNGEWTLEALQDIFESFLTLRPILPSFSPLTFSDPQSGPDLKSDVNILQA
                     EKQARLYAKAPGRKAVWTVLKAFGRVTHGDEEVLRQVWERMETKFGPENEEGWKGWRV
                     DKRLDWFRKALFAEE"
     gene            685323..689778
                     /locus_tag="CNL06100"
                     /db_xref="GeneID:3255019"
     mRNA            join(685323..685923,685980..686117,686167..686389,
                     686437..686635,686685..687730,687798..688995,
                     689050..689778)
                     /locus_tag="CNL06100"
                     /product="serine/threonine kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546095|gb|CF691936.1,gi|41546101|gb|CF691942.1,
                     gi|41549272|gb|CF695113.1,gi|41549281|gb|CF695122.1,
                     gi|41553239|gb|CF699080.1,gi|41553247|gb|CF699088.1,
                     gi|41558327|gb|CF704168.1,gi|41558341|gb|CF704182.1"
                     /transcript_id="XM_568139.1"
                     /db_xref="GI:58261457"
                     /db_xref="GeneID:3255019"
     CDS             join(685783..685923,685980..686117,686167..686389,
                     686437..686635,686685..687730,687798..688741)
                     /locus_tag="CNL06100"
                     /codon_start=1
                     /product="serine/threonine kinase"
                     /protein_id="XP_568139.1"
                     /db_xref="GI:58261458"
                     /db_xref="GeneID:3255019"
                     /translation="MPDSNAQGSREKESGHHRSHKERIGNYVVGAEIGRGSFATVYKG
                     YRSKTRVPIAIKAVSRQKLTSKLLENLESEINILKVINHRNIVALTDCFKNDTHIYLV
                     MEYCSGSDLSVYIKQRGNIPTLDFVPKAGSSMALLPTDDEGKIYWPHPPTGGLDERVT
                     RSFLGQLAQAIKFLRAQDLMHRDIKPQNLLLQPATETEVAEGHPYGIPVLKVADFGFA
                     RILPAAAMAETLCGSPLYMAPEILRYEKYDAKADLWSVGAVLFEMSVGRPPFRANNHV
                     ELLRRIEKSNDNIVFPDEKERDSKSSDETSIPVPSDIKALIRALLKRKPNDRMGFDDF
                     FNCGVWDGHMAESTEEESLSLDVSTDSSAGLGESDRIRQMVASTEQSKDRLIPTRAPQ
                     PLAADAALNPQPAVPISRDTSEGRSRLSTPPSRPTPTRRSTPKYYVGDATPSEPTAII
                     PPSPSSAPTPTSAPDPGLTTQQSPTSRANPRPIITAASSAQRRMSGKGDGREASSVEE
                     AAPITPPFAGPSPTMARPSRGINEGSPLAAAPPITMGPDGRLERSSALEGSTSGVGTD
                     YVVVEKQTVEINALADELDQASKRPMIRRSSRGSVVSRPVSSFKPISPNIAKNDPTLG
                     PISYSPPFALSSTPPFAMQVPRHASGGNSFPRNPSIPSSLNAFPPTTISASPSYGQDA
                     AARFGVSPGSLQTGALARALTNTAIRLIGTSANTAATAIARATAKRRPNIVRVSDMDA
                     AEDDLLCTVEDLARKAFVLFELADERLLAQTQLAQTARTSSTPTGLTGTTPPFSMQAA
                     AAAQAGSRRKSSSSSMNSEVWILRQQEAAANDAVVLYMKSLAFIVKAMDKVKRYWKNR
                     TDVYDGYVASQELNESKFCFLLLHLRIIALIICSGPMASC"
     gene            complement(689909..693172)
                     /locus_tag="CNL06110"
                     /db_xref="GeneID:3254764"
     mRNA            complement(join(689909..690128,690206..690325,
                     690398..690497,690566..690780,690834..690860,
                     690917..691018,691080..691147,691215..691296,
                     691357..691378,691504..691569,691621..691697,
                     691758..691792,691860..692030,692102..692390,
                     692450..692684,692741..692804,692861..693172))
                     /locus_tag="CNL06110"
                     /product="GTP-Binding protein lepA, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41547065|gb|CF692906.1,gi|41565467|gb|CF711308.1,
                     gi|41565473|gb|CF711314.1"
                     /transcript_id="XM_568140.1"
                     /db_xref="GI:58261459"
                     /db_xref="GeneID:3254764"
     CDS             complement(join(689995..690128,690206..690325,
                     690398..690497,690566..690780,690834..690860,
                     690917..691018,691080..691147,691215..691296,
                     691357..691378,691504..691569,691621..691697,
                     691758..691792,691860..692030,692102..692390,
                     692450..692684,692741..692804,692861..693135))
                     /locus_tag="CNL06110"
                     /codon_start=1
                     /product="GTP-Binding protein lepA"
                     /protein_id="XP_568140.1"
                     /db_xref="GI:58261460"
                     /db_xref="GeneID:3254764"
                     /translation="MSSLFRISRLCPQCLSKNRVFRPVKTTLASPLVGPSGYKHSLET
                     RSLLPRVQNTIRGVRLLSTSVARLAKPSASLVDKRTVDMSQFPPERIRNLSIIAHIDH
                     GKSTLADRLLQMTGTVPASSSPQFLDKLKVERERGITVKAQTVSLIHQHKDGHKYLIN
                     LIDTPGHVDFSYEVSRSLGACEGALLLVDCSQGIQAQTLSVFHHALEADLEMLAVINK
                     VDLPHAYPEETSEEIESSLGLEKSKHMRISAKSGLGVEGVLDSIIEGLPAPGTWVGGE
                     DGKLRGLIFDTFYDQFRGVVSLVRIFSGSLKKGDKVRFLQAERKYEILEVGINNPDEV
                     PVVELKDGQVGYIVCNMKNSEEAFIGDTICWADKPVEPLPGFKPMKAMVYAGVFPMDS
                     ADFPKLEESIERLTLNDRSVSVQRESSAALSQGFRLGFLGTLHMDVFKQRLEDEYASE
                     VIVTAPTVPYKVVYNDGKEVYISNPVEFPEVSDSKMNVSHVEEPMINATIFVPNDYIG
                     PMMDLCARYRGVQQEYRILENSDRAVLRYTLPLSEIVTEFFSELKSQSSGFASFDYEE
                     AGYEKSNLVKMNILINGKPVDALAMIVHKFAAQSIGKAWVTKLKEVVPRQQFELSIQA
                     AIGAKVIARENVKAFRKDVTAGLYGGHYDRKLKHLNKQKEGKKRLKKLAGNIEIPQTA
                     FYKVLSSRPRK"
     gene            694017..695838
                     /locus_tag="CNL06120"
                     /db_xref="GeneID:3254738"
     mRNA            join(694017..694516,694579..694612,694667..694746,
                     694805..695071,695136..695838)
                     /locus_tag="CNL06120"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41553030|gb|CF698871.1,gi|41556609|gb|CF702450.1,
                     gi|41556626|gb|CF702467.1,gi|41571106|gb|CF716947.1,
                     gi|41571116|gb|CF716957.1"
                     /transcript_id="XM_568141.1"
                     /db_xref="GI:58261461"
                     /db_xref="GeneID:3254738"
     CDS             join(694103..694516,694579..694612,694667..694746,
                     694805..695071,695136..695708)
                     /locus_tag="CNL06120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568141.1"
                     /db_xref="GI:58261462"
                     /db_xref="GeneID:3254738"
                     /translation="MPESRQVIAPSPLFILPSYSSMGSPSKCLLQPPITPIPVLPQTQ
                     TDPAVPFRSSVDRLNSATPLLPKKEGSFFHDLRRGHWHFPWRRHRSVKCSTHYNGHAR
                     LQGCVWLLWKLMLAVLIGIFLYWWGWQDARDQRLTLFNQLEQLPISINTTISTKGVTK
                     IWANSHNDEMQGKGALTLALKQGFGYIEIDTHLDASSLRNSSLTLLTGHDISDLNSNR
                     TVKDLYLDPLLAILDAHNQGWTPGGEKNWTGVYEDDPREEVTLFFDIKSDGDATWPYL
                     EAALEPFLSKGYLTTYNTTSNTLTPGPLTVVGTGNTPLHRVYYSSLRYIFYDAPLLEL
                     YQPYTLPASQYGPETTIYWHPTISPIASAKFPLQSYLALGPGSRGGGINPFSCNLKLT
                     SAIAKQMGIQSRWWGVLHKPGWARRILWEMVWESGAGVMNADELEDMGNWLRAHEGKE
                     RSLKC"
     gene            698260..699847
                     /locus_tag="CNL06130"
                     /db_xref="GeneID:3254755"
     mRNA            join(698260..698756,698817..698892,698952..699173,
                     699232..699847)
                     /locus_tag="CNL06130"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41529999|gb|CF675840.1,gi|41530003|gb|CF675844.1,
                     gi|41533258|gb|CF679099.1,gi|41548964|gb|CF694805.1,
                     gi|41549750|gb|CF695591.1,gi|41559918|gb|CF705759.1,
                     gi|41559929|gb|CF705770.1,gi|41576556|gb|CF722397.1"
                     /transcript_id="XM_568142.1"
                     /db_xref="GI:58261463"
                     /db_xref="GeneID:3254755"
     CDS             join(698373..698756,698817..698892,698952..699173,
                     699232..699815)
                     /locus_tag="CNL06130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568142.1"
                     /db_xref="GI:58261464"
                     /db_xref="GeneID:3254755"
                     /translation="MCDVKIYPLSSTFFLAPTHHSTYMMPKGKQLAAEQKQDSGQADT
                     ATTKRKRHRTVNWENDLGSDQRNANDHLIDWLGMPDSDGTLMFYRWKSDNVTGKTREH
                     WSKVALEYLVQKGCASNRDVQSVLRQIKKMWGTFKNTSDEINKTDSEGPNGNYAIRIC
                     PWYSELMPIMSHSAAAMVGPGRSTLDEGEDKDRERLRKRIRHAKEEEREDDDNGQCDT
                     GLEQFGLDETADTADATPSRPSSSVCTQALVPIPFSTRPDHSKVIADTASASSSVAPS
                     LPTPRTVFESRGSPYDAPSGLLTPDSQGTAERNSHPRATQRMLSVNEKAEACSAEDQL
                     QRLVEASEVNWERRHRDMLLLQEEENAILKDIIAAEEKKAATAVKRLDFEMWKEFLAL
                     HRAEGASYEKAKKRAMDDVKEWNDKHGRM"
     gene            complement(701113..702443)
                     /locus_tag="CNL06140"
                     /db_xref="GeneID:3254956"
     mRNA            complement(join(701113..701353,701511..701586,
                     701770..701803,701915..701972,702107..702206,
                     702400..702443))
                     /locus_tag="CNL06140"
                     /product="expressed protein"
                     /transcript_id="XM_568237.1"
                     /db_xref="GI:58261653"
                     /db_xref="GeneID:3254956"
     CDS             complement(join(701282..701353,701511..701586,
                     701770..701803,701915..701972,702107..702206,
                     702400..702419))
                     /locus_tag="CNL06140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568237.1"
                     /db_xref="GI:58261654"
                     /db_xref="GeneID:3254956"
                     /translation="MPLQTAPYPHVFNALNGPTAPAVSYIVFYSNIVDGQMWCPDCRA
                     VENVVKETFDAPDKPNAAIFWVGNRQEWRTPNNQARTEWNVNSIPTILRLENGKETGR
                     LVEDEILDKARLQAFLK"
     gene            702549..705568
                     /locus_tag="CNL06150"
                     /db_xref="GeneID:3254772"
     mRNA            join(702549..703950,704017..705168,705277..705568)
                     /locus_tag="CNL06150"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41559085|gb|CF704926.1,gi|41566968|gb|CF712809.1,
                     gi|41566975|gb|CF712816.1,gi|41572323|gb|CF718164.1,
                     gi|41572324|gb|CF718165.1,gi|41576618|gb|CF722459.1,
                     gi|41576625|gb|CF722466.1"
                     /transcript_id="XM_568143.1"
                     /db_xref="GI:58261465"
                     /db_xref="GeneID:3254772"
     CDS             join(702589..703950,704017..705168,705277..705501)
                     /locus_tag="CNL06150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568143.1"
                     /db_xref="GI:58261466"
                     /db_xref="GeneID:3254772"
                     /translation="MSPRPTRKTPRPVAPLPATANTVNASSQLDIQLGTGIARHHNGD
                     EDDDADRDRGYGGQYRGSGLVPGSLAAQDADGGASGNSPKSPSGSASRSGIVVKRQVT
                     VEVQPLSTSTSRPGERRSARVRGKERGRDKRPDGGQPERLERPVELASVDGQQAAGQG
                     SDGTVEHEVEKLVGLPSSATEVTGIGQKPASTDGQPSAAVSQPTESGISENKPRAKVS
                     SSITTTVVKPAPPRKSTPRTKPPMRSKGTSSTPSANPAPALAPASASTPASTDPKYKG
                     KPIERRVLPARIRRAAGGGLEGMRDVEEMVVDWLQRWGEPVTTPPDGLPILLTTLPLE
                     MLNPPPVFTSTASSSGQEQSSRPPITLTPSRKIDPASIEMVRVKMEGTDALVDVKGEN
                     TLGQEEMIETPGWVMVKPGEDDEQEAREELKNGPLIGTGTGGVGKGKGVVSPVKRLRR
                     MHDEPEEDTSDAHYIQLHRRHEAFERRQRLREKEKLQFERYKLRSRIDLLRNLSKPAW
                     ASIVATVLARDEDGWKSGRVKVEKEGEEWLRERLLKEGEEVMKRYEELLPPENRKHKA
                     GAGINAQHHHHHLPTDATPNSTRFSSPSGSTCASRIQSLTPEPTVLPARVAALRDPVV
                     ASTGKRKRSSMGAGTSMGTSKGRHSSALGDRNRDRNENENGKPDGVGEEEGDSSGWKK
                     VAKACTRKKQSVQSARRLDVDVNEGEAQVVGDGDGDGDDDGNGERAEQLWKNQNSLPD
                     PMVSSLPPPQISQPQVPAPPPLPPPFFPPFTASGLPCLIEAASRRESALQEAEASKAR
                     AAEPRKGRLISREKTRMSTRLGVVSPFGLPIPGVVEYKYEFTLTEEEDFWPIIAEREA
                     AANRHRRESLLGQNGLSGLGNMGTSSNGSVHNEGSTRQVEQAAVSGAEKMENIVVL"
     misc_feature    702935..702979
                     /locus_tag="CNL06150"
                     /note="G-rich"
     STS             703132..703933
                     /locus_tag="CNL06150"
                     /standard_name="Eco1"
                     /db_xref="UniSTS:470736"
     gene            <706728..708691
                     /locus_tag="CNL06160"
                     /pseudo
                     /db_xref="GeneID:3254971"
     repeat_region   708789..708812
                     /rpt_type=tandem
                     /rpt_unit_seq="cata"
                     /satellite="microsatellite"
     gene            709004..711033
                     /locus_tag="CNL06170"
                     /db_xref="GeneID:3254736"
     mRNA            join(709004..709184,709238..709660,709716..709986,
                     710048..710125,710181..710339,710390..710644,
                     710702..711033)
                     /locus_tag="CNL06170"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544691|gb|CF690532.1,gi|41544700|gb|CF690541.1"
                     /transcript_id="XM_568144.1"
                     /db_xref="GI:58261467"
                     /db_xref="GeneID:3254736"
     CDS             join(709030..709184,709238..709660,709716..709986,
                     710048..710125,710181..710339,710390..710644,
                     710702..711004)
                     /locus_tag="CNL06170"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_568144.1"
                     /db_xref="GI:58261468"
                     /db_xref="GeneID:3254736"
                     /translation="MSSTNQKPLSAFVSFPSPYTQSLLVQALVSTLPALSLSLVQFPE
                     DQPPALQWADYDLMSFDIPHKSPSKYLISSYIYRKALTRKHQLHNTIIAYLAKCSHRK
                     IPSILSPLPEGPVGNGDGTDVLGGGAPKGWIVDLQFADELDEALMDDLYELEAGMREN
                     EGKEEGERRWWILKPGFADRAQGIRMFSTEEELRAIFEEFEPSSSDEEDDDEDKEEED
                     DEQESEEARQMAKGGVDGMIDMLAKKAVELGFSGEDDQDSNEKEDEDGEGGTGVMTSQ
                     LRHFVIQEYIPKPILFDIFNIPEEPSSSLEGYKFHLRAYVLITGAYTVHLARTMLALF
                     SGSPYTPPKPTEDGQLDLRPHLTNTCLQTDAYGAPTPPEELVKLFWELEGISALNCSS
                     SPSSDGKYSYIPRGEVTKEWLDKTFAKVGDVVAETVKAGAECGSFGLQFMPNAFEIFG
                     VDLILSFPPSSSKSTSLPIPTVTLLEFNASPDFHQSGDRLRSELLHMFKGVIRLSVAP
                     FFGLETAEDDEKNEEEMQLGEDRWGWRLVGKGEVRGSEW"
     misc_feature    709753..709813
                     /locus_tag="CNL06170"
                     /note="GA-rich"
     gene            711497..713199
                     /locus_tag="CNL06180"
                     /db_xref="GeneID:3254825"
     mRNA            join(711497..711935,711992..712119,712175..712837,
                     712895..713044,713102..713199)
                     /locus_tag="CNL06180"
                     /product="class III aminotransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41541428|gb|CF687269.1,gi|41541435|gb|CF687276.1"
                     /transcript_id="XM_568145.1"
                     /db_xref="GI:58261469"
                     /db_xref="GeneID:3254825"
     CDS             join(711551..711935,711992..712119,712175..712837,
                     712895..713044,713102..713185)
                     /locus_tag="CNL06180"
                     /codon_start=1
                     /product="class III aminotransferase"
                     /protein_id="XP_568145.1"
                     /db_xref="GI:58261470"
                     /db_xref="GeneID:3254825"
                     /translation="MSPIALNQRTGVSTTHLKSSVAPTPISTAATSTYQLHHTVPNPV
                     ATKGDGMHFTLTTGETVLDAAAGGAAVSCLGNGNSEVIETMYEQAKKMAYTYHQSLDA
                     EGSEKLAKWLCDRSEGALVAGAFLNSGSEAIEAAIKMARQYWVEAGKPERKYIIARFP
                     SYHGNTLGALAIGNAPGRRDIYKPLISMNAFHHVTSPVYKRYAQPGETEEAYSARLAD
                     ELEAKILELGPENVIGFFAEPVVGSALGVMPPPKGYFPAMDKVIKKYGTLFIMDEVMS
                     GSGRVGQLFAHQAVGEGVKPDIVAIAKGLGGGYVSISGVFVGQRVADRVREGGQWKNS
                     HTYQNHPINCAVAAKVMEIVERENLLQNVRERGEQILEELKEAAKGVPTIIDVRGKGL
                     FIGVEFDGPSSLKPRFASRVKDQAFKNGLIVMGISGTIDGVEGETTIICPAYTVTKKQ
                     ISEIVRLLVKSIKEVVEEL"
     gene            complement(713524..>714732)
                     /locus_tag="CNL06190"
                     /db_xref="GeneID:3254897"
     mRNA            complement(join(713524..713666,713720..713815,
                     713866..714350,714407..714578,714631..>714732))
                     /locus_tag="CNL06190"
                     /product="aldo-keto reductase, putative"
                     /transcript_id="XM_568146.1"
                     /db_xref="GI:58261471"
                     /db_xref="GeneID:3254897"
     CDS             complement(join(713610..713666,713720..713815,
                     713866..714350,714407..714578,714631..714732))
                     /locus_tag="CNL06190"
                     /codon_start=1
                     /product="aldo-keto reductase"
                     /protein_id="XP_568146.1"
                     /db_xref="GI:58261472"
                     /db_xref="GeneID:3254897"
                     /translation="MPRAISIRLFNTPRNILSEMSGPAPVKSLDARLKMHDGNAIPQF
                     GLGVYEMNDKETYDCVKWALEAGYRHVDTAEWYENEAPCGKAIADFLKATGTSREEIF
                     LTSKLKNNSSYEQAFVDLKGSLKRSGVEYFDLYLMHSAIGGPVIRKNVWKALCDAQSQ
                     GLVKSIGVSNFGKKHIQEFIDQKVPLPTVNQVDLHPFMRHPEIVEICEQNEILLEAWG
                     PLARAMRFDHPVVVKIAKEKGKDAAQIMLRWGIQHGFVVIPKSVSQKRIVSNSKIFDF
                     ELSSEEMKELDGLDEYLVTDWDVVDCE"
     gene            714953..715752
                     /locus_tag="CNL06200"
                     /db_xref="GeneID:3254799"
     mRNA            join(714953..714987,715034..715106,715156..715277,
                     715329..715526,715588..715683,715731..715752)
                     /locus_tag="CNL06200"
                     /product="expressed protein"
                     /transcript_id="XM_568147.1"
                     /db_xref="GI:58261473"
                     /db_xref="GeneID:3254799"
     CDS             join(714958..714987,715034..715106,715156..715277,
                     715329..715526,715588..715680)
                     /locus_tag="CNL06200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568147.1"
                     /db_xref="GI:58261474"
                     /db_xref="GeneID:3254799"
                     /translation="MPQHLVSPEEFLTKLGQCFSDPSSSSSVWLTHKRLTYSDDADVQ
                     MNDEERENNSEGPEHEVLIRCTQGNNKFSARIPASSLPSFHAAYGSLLKTSMAPLMRK
                     RDKKKEKARAEALTKKRKELYVEVVIGNEGKRGKGRRQRQRKIAAQKKKETEREKLEI
                     RQAQQKASGDL"
     gene            complement(715775..>720208)
                     /locus_tag="CNL06210"
                     /db_xref="GeneID:3255004"
     mRNA            complement(join(715775..716966,717036..717171,
                     717238..717424,717575..717804,717856..717909,
                     717975..718079,718399..718719,718772..719684,
                     719769..719852,720137..>720208))
                     /locus_tag="CNL06210"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536690|gb|CF682531.1,gi|41536696|gb|CF682537.1,
                     gi|41570405|gb|CF716246.1,gi|41570417|gb|CF716258.1"
                     /transcript_id="XM_568148.1"
                     /db_xref="GI:58261475"
                     /db_xref="GeneID:3255004"
     CDS             complement(join(715817..716966,717036..717171,
                     717238..717424,717575..717804,717856..717909,
                     717975..718079,718399..718719,718772..719684,
                     719769..719852,720137..720208))
                     /locus_tag="CNL06210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568148.1"
                     /db_xref="GI:58261476"
                     /db_xref="GeneID:3255004"
                     /translation="MMACHDSLINAFCRILRRSFGVRITPPPPPATGDRKPTVTGQLL
                     RLSGDLLSTSSKHNGPLTIKMLSAKTALYVTLVSIPLFGLVHALGDDKIVAFPNLSQL
                     SGEGYIWLGPSDHAKHQEQTTFIATDDRLNQASSVNGAGDDYFVLASNHHHFASSLLL
                     SSEDDQSIHVAAQTFAEDIYKVTGQRPDLYNDTLPDDVHRAVIVGSVESEIIRGLKTD
                     SKRDHLKGKWESFDISWEASPLGGLEEGLVITGSDRRGTIYALYTLSEQMGISPFYFW
                     SDVPIPHHSTIAILKNMSLSHGEPTVKYRGLFINDEHPALWGWAAEKWNRDPWEPAFQ
                     VEMYELWFEMMLRLKANYFWPAMWASKFSVDGLDITNGLPRPAIPGPNQILANKMGIV
                     MGTSHHEPMSRNKPEWDVFGKGPWDWTNKDVLKDFWRYGAERAKGVETLFTMGMRGDG
                     DEPLTDASNELVQITVLFADDNYGNIMSVLPPERQGHKAGAGIYYHVDYVGFPRDYKW
                     INTVNPAKTWDQMNIARSFNTTQIWILNIGTLKPLEMPTEWFLDLAWDFDRWERNSWK
                     RWLREWAGREFGDEWKEEVGDIMGKYSRGGILTRRYTIRAERVLTEWQDLTTRAGMVY
                     DQLPKETQPAFFQLVYMLCAAQENLNKLHIAVARSELYAFQAKTAANVFAHEAIEAFY
                     QDANITETFHSLLNRKWDHMWDQTHINYYTNLEPIRDSLPPIHLVNPFQPSRPGIPLK
                     ERDLPGQIGYVRLTVENSLGAWPGDNVRNCERGYKCPDPTLLPMDPWGEQSRWIDIGA
                     GGPKNVSWKMEVDVDWLTVEPRKGKTVWDGSGDERVWVSVDWDKVPASTKGERVEKEG
                     HIEFSAADRTNVTVSVPIIIPPSPPSSFRGHVQGDGYVVIEAVHYTRNTSEEGYAFEE
                     LEGYGRTLSGLEMFPVTTQNFTLGKGPKLEYDFWTHGDSVDGNGKVEITVQVGPTLNF
                     LIGEELAFGLQLDDLPPREIHPVPIKGLGESGSDRNSGEVGSVPKDWMEVVSSEIRNV
                     TMEVTKDDWEAGRHTVTIWGLTTGVVVERIWVDMGGIRERGYSYLGPPESKRV"
     gene            complement(720749..723847)
                     /locus_tag="CNL06220"
                     /db_xref="GeneID:3254961"
     mRNA            complement(join(720749..721842,721897..722065,
                     722121..723398,723653..723847))
                     /locus_tag="CNL06220"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537339|gb|CF683180.1,gi|41537342|gb|CF683183.1,
                     gi|41541289|gb|CF687130.1,gi|41543630|gb|CF689471.1,
                     gi|41551272|gb|CF697113.1,gi|41558927|gb|CF704768.1,
                     gi|41558932|gb|CF704773.1,gi|41562449|gb|CF708290.1,
                     gi|41562455|gb|CF708296.1,gi|41563755|gb|CF709596.1,
                     gi|41570175|gb|CF716016.1"
                     /transcript_id="XM_568236.1"
                     /db_xref="GI:58261651"
                     /db_xref="GeneID:3254961"
     CDS             complement(join(720925..721842,721897..722065,
                     722121..723398,723653..723705))
                     /locus_tag="CNL06220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568236.1"
                     /db_xref="GI:58261652"
                     /db_xref="GeneID:3254961"
                     /translation="MPSASNGWKPSTSPVGEGLTAPRTPEQSTSSLAATSPSSSTFPR
                     PKKLRSRTSTMTNIYTPPLPPVMSRENSAEDVRGEYGQDSYRPPPGTLLPSAHGRRAS
                     KSVSSVRPSVVVTPSKYYTPQTHNQISFVNTPNSNTGNGVMDSPEADKKNMLKRRTST
                     PSLFKRATRGDEDEEDEGLRGKLMSKEEPQQSQLLQQQQRSEVRARSTSTSVVVPQTQ
                     GLTEHSTYTSNPIRPSMPPSSFTQQPPPPRPWSPGPASPSSHVEGASHERSSGFLSSA
                     YNYTESGIVQLFNYVRPSSFSHHSYARHEPSDVDSEKGLNGSEDETEESSVSYFTLPP
                     TPPEQSEFSSFASALPSDSLPTPTLSTQSLSRDEPKRGKLRRAFRRRSGLEGDNGNGL
                     LSAVWSKVMGSGGGNGKLSEVLRDLGWIVGVLALTFVVTLGIVIWLIQGMPITTLKHI
                     PQSTTDVQLLSAEIRGYMASSSYGWWHTVGVLTFVGCWKHAWSVPGAVVLNILVGSLL
                     EPMPALGLLTIITASGSLGAYLLSRPLAPLIAVLFPKPLALVRAALAPESIPAPDSVE
                     PTLNETITPIQASSDPSAQAIGGPTEASTIWRRLLVMRAMGFVPWSGMNVACGVVGVD
                     WKVFWLTTAAGSASWSYVTASVGNILSRLKVPNSAISAAPGEMTGESLTSLLRDPVLI
                     TKLVFLSGLTLLPVILKRRSPASPSPTPRSTSSFELSELPTSSSASSSRPLNPKINTL
                     RLSGLDNQPMSPLSQSLAKFTPTPRIFDLLSFGRIAVRQSGRIVVGGVRSVVGGVRGA
                     VRSVTQQ"
     gene            complement(724808..727967)
                     /locus_tag="CNL06230"
                     /db_xref="GeneID:3254963"
     mRNA            complement(join(724808..726739,726791..727019,
                     727292..727967))
                     /locus_tag="CNL06230"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531151|gb|CF676992.1,gi|41531158|gb|CF676999.1"
                     /transcript_id="XM_568235.1"
                     /db_xref="GI:58261649"
                     /db_xref="GeneID:3254963"
     CDS             complement(join(725087..726739,726791..726985))
                     /locus_tag="CNL06230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568235.1"
                     /db_xref="GI:58261650"
                     /db_xref="GeneID:3254963"
                     /translation="MSVLDPFLIAHPPARATHLSAQAEEAPFEVYCIVCDKRIVQIEA
                     SEKGKEGEKKSKKKMAGGTIRVKNPDGTTTTRNANGKVIRPPLKRNPNSAARTAVTNA
                     AKGQCLTRTETNEGVVSPSESPQSKKSPPLSSSPPFKSAIYCSRECMETDAGRSTEVY
                     KDLARTMSFDFSNTFFSPDENVPVTDQGKSPNAPPSPLFVSGSDTESSTSNSAGLTRD
                     HNTSSSAPKIMDYFRFSKEDSDRTWNEIERQRRSSMQPAVRRPAPSTESLTSLWHQEA
                     ELGQSSSGGGKLRAMTPLHGCVSNKERRPSGSAERSAPIPVRPIPRSNMSHTSLVGSS
                     SSYRSTALPVDLGSAPSHTLGLLHSYASAFSVRSSNNTPSSYTQRGFVYPDGTVVPSS
                     VSPPMAASRTDSTSSITRPVGGTIKARKSEPTWDSFGKVEVQAHNERIHRRSGAGANA
                     CTDSTPVAVPRRRRDISSGPSENTPRQNLEREGSNWKITYVVPAGVERQTTVKRSQGP
                     ACSLPPDRYHPQGVLIPRSSAQLSTSNSTAYGSHTPSSRHMPLRAATSAAFPDIGGLK
                     VSDDKIVPVPSSQSVPRRIGFNWDQAKGVKTYEIPGKVDRNPKGLFYFQ"
     STS             726318..726877
                     /standard_name="Hae3"
                     /db_xref="UniSTS:470735"
     misc_feature    727216..727250
                     /note="A-rich"
     gene            730881..732536
                     /locus_tag="CNL06240"
                     /db_xref="GeneID:3255008"
     mRNA            join(730881..731126,731175..731445,731502..731824,
                     731878..732536)
                     /locus_tag="CNL06240"
                     /product="glutamate-5-semialdehyde dehydrogenase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535000|gb|CF680841.1,gi|41535006|gb|CF680847.1,
                     gi|41540193|gb|CF686034.1,gi|41540199|gb|CF686040.1,
                     gi|41544485|gb|CF690326.1,gi|41544501|gb|CF690342.1,
                     gi|41552778|gb|CF698619.1,gi|41553063|gb|CF698904.1,
                     gi|41553079|gb|CF698920.1,gi|41564075|gb|CF709916.1,
                     gi|41564091|gb|CF709932.1,gi|41570349|gb|CF716190.1,
                     gi|41570361|gb|CF716202.1,gi|41575134|gb|CF720975.1,
                     gi|41575137|gb|CF720978.1"
                     /transcript_id="XM_568149.1"
                     /db_xref="GI:58261477"
                     /db_xref="GeneID:3255008"
     CDS             join(730941..731126,731175..731445,731502..731824,
                     731878..732480)
                     /locus_tag="CNL06240"
                     /codon_start=1
                     /product="glutamate-5-semialdehyde dehydrogenase"
                     /protein_id="XP_568149.1"
                     /db_xref="GI:58261478"
                     /db_xref="GeneID:3255008"
                     /translation="MADSIASASNSGAESIAIAARRAFEASQLVNPSERDVALKAIRE
                     TLQASKDEIIAANKKDMEAAEALAATGKLSSSLVSRLDLGRPGKFEAMLQGITDVAAL
                     PAPTGIVTFAKEIGPELELHRVTCPVGVLLVIFEARPEVVVNIAALAIKSGNAAILKG
                     GKESINTATLLSSLISQALAKTSIPPAFVQSVSTRSEISSLLAQDKYIDLVMPRGGNE
                     LVRSIQNNTRIPVMGHADGICAVYLDESAVQEKAVRIAVESKIDYMAACNAAETLLIH
                     SSLLTTVWPAVASALMSNSVCLRCDAATLSALRDANIPKTSEFVTASSPADYSTEFLG
                     PTIAVKAVESVQEAIQHINSHSSHHTDSIVTEDEASMSAWCRGLDSANCFVNASTRFA
                     DGTRYGLGTEVGISTGKTHARGPVGLDGLIIYKYMMRSRKQDGSVIADHEKGGKGYTH
                     KDLVKGEPPF"
     gene            complement(<732601..733811)
                     /locus_tag="CNL06250"
                     /db_xref="GeneID:3254936"
     mRNA            complement(join(<732601..732739,732794..733147,
                     733204..733385,733434..733516,733574..733811))
                     /locus_tag="CNL06250"
                     /product="expressed protein"
                     /transcript_id="XM_568150.1"
                     /db_xref="GI:58261479"
                     /db_xref="GeneID:3254936"
     CDS             complement(join(732601..732739,732794..733147,
                     733204..733385,733434..733516,733574..733718))
                     /locus_tag="CNL06250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568150.1"
                     /db_xref="GI:58261480"
                     /db_xref="GeneID:3254936"
                     /translation="MSAPGAISKKLKFKGDKPKKKKRSHHHSSGGGGGDGDELEALAA
                     ADPRGWMFPSNPMEINGPAYILLPTEPLTCLAWDATRQKVYAAPIDIPQAPEGANDLS
                     ESEILLTIEPTDVNHVWVISRLSGSEDVVSLRTSTGTFLTASPSGSLTATTPSRGPLE
                     AFIPITSRSSSSSVFPTFALQIQHNSKYFSATTVAGKAELRADADDVGEFEGLRIKCQ
                     REFVYKARQGEDVKGKKRMVDSGPSAASIEDDEMRRNREAQTWGAGRVKLSDKDRRDV
                     KKAKKEGRYAEAMLDRRAALKRSV"
     gene            <734146..>734990
                     /locus_tag="CNL06260"
                     /db_xref="GeneID:3254972"
     mRNA            join(<734146..734251,734522..734637,734706..>734990)
                     /locus_tag="CNL06260"
                     /product="hypothetical protein"
                     /transcript_id="XM_568232.1"
                     /db_xref="GI:58261643"
                     /db_xref="GeneID:3254972"
     CDS             join(734146..734251,734522..734637,734706..734990)
                     /locus_tag="CNL06260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568232.1"
                     /db_xref="GI:58261644"
                     /db_xref="GeneID:3254972"
                     /translation="MLSATWRSGMRLCFGTSPERYDLRYQMVDIDVLHGQRRLGINSF
                     MMEMMEMMGDYVVRYLLITRKALLHIKFILTVATAIMIVCTCYKVYIPPRPLVTQRII
                     LTSIAVVAQLTKDERAPHQANPKMCLSPPFTKDLSCPTDDLESGILFPALSLNHTFEQ
                     GRSAIKCG"
     STS             735016..735519
                     /standard_name="Hae5"
                     /db_xref="UniSTS:470734"
     gene            735455..737825
                     /locus_tag="CNL06270"
                     /db_xref="GeneID:3255017"
     mRNA            join(735455..735773,735838..735922,735970..735994,
                     736047..736147,736197..736316,736368..736530,
                     736581..737043,737101..737469,737538..737825)
                     /locus_tag="CNL06270"
                     /product="carboxypeptidase s precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540548|gb|CF686389.1,gi|41540554|gb|CF686395.1,
                     gi|41550582|gb|CF696423.1,gi|41550593|gb|CF696434.1"
                     /transcript_id="XM_568151.1"
                     /db_xref="GI:58261481"
                     /db_xref="GeneID:3255017"
     CDS             join(735477..735773,735838..735922,735970..735994,
                     736047..736147,736197..736316,736368..736530,
                     736581..737043,737101..737469,737538..737723)
                     /locus_tag="CNL06270"
                     /EC_number="3.4.17.4"
                     /codon_start=1
                     /product="carboxypeptidase s precursor"
                     /protein_id="XP_568151.1"
                     /db_xref="GI:58261482"
                     /db_xref="GeneID:3255017"
                     /translation="MPKGPIYLPVTSNDVPSSEGISKRRWPLIVLGLLAASSIITSWP
                     LSVSQLITYKGDYSAYNGSLRDGLCAQAEPIMPAGYDTSKIWEDKDIIIKRLQEAVRI
                     PTEVFDEMGPVDEDPRWEIFTEFHAFLEKTFPLIYEVAEVTETDWALVYEIQGSNPSL
                     KPLFLTAHQDVVPVLPSTRSQWTHDPYGGEYDGTVIHGRGASDTKSSLIAVMSAIEHL
                     LKTTDFKPKRTIILGFGSDEERGGQVGAPAIARYLLDKYGRNSMALLIDEGSGMINTW
                     GQQFATPAVAEKGHYDLGITVSTLGGHSSVPPPHTAIGLISLLIAELERNPHEATIAE
                     SSPVYEFMTCAAAYAKDMPKRLKSMIIKAEDGDPKAWKSLPEEIISVGMGGAPAGPGQ
                     GDPIKSMLTTTQAVDIIQGGLKVNALPEAVTAIVNHRINSLSNHFELQGRTLNLLKPV
                     CEDYNLTLIGFEGETVFEGSPTSKVILDEAFGYYTDPSPHSPVSIEDPAWRVMAGTAR
                     GMWASRKEVSEDGKIVELEAGDDLIMAPFMSTGNTDTRRYWDLTPNIYRFRYTPMAGS
                     AGAHTINEYSNADDLVEFARFYQAMILNLDTAEDVA"
     gene            <738669..>738993
                     /locus_tag="CNL06280"
                     /db_xref="GeneID:3254912"
     mRNA            join(<738669..738748,738924..>738993)
                     /locus_tag="CNL06280"
                     /product="hypothetical protein"
                     /transcript_id="XM_568152.1"
                     /db_xref="GI:58261483"
                     /db_xref="GeneID:3254912"
     CDS             join(738669..738748,738924..738993)
                     /locus_tag="CNL06280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568152.1"
                     /db_xref="GI:58261484"
                     /db_xref="GeneID:3254912"
                     /translation="MDAAPEAEEGSKTEELADVVPIYVSSWPAFPQINTSTIVFQKSC
                     GGTPR"
     gene            739377..742040
                     /locus_tag="CNL06290"
                     /db_xref="GeneID:3254977"
     mRNA            join(739377..739747,739805..740198,740250..740397,
                     740447..740536,740597..741125,741216..742040)
                     /locus_tag="CNL06290"
                     /product="riken protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546398|gb|CF692239.1,gi|41546795|gb|CF692636.1,
                     gi|41546802|gb|CF692643.1,gi|41553548|gb|CF699389.1,
                     gi|41553554|gb|CF699395.1,gi|41561897|gb|CF707738.1,
                     gi|41561905|gb|CF707746.1,gi|41562089|gb|CF707930.1,
                     gi|41562098|gb|CF707939.1,gi|41571362|gb|CF717203.1,
                     gi|41571371|gb|CF717212.1,gi|41575017|gb|CF720858.1,
                     gi|41575025|gb|CF720866.1"
                     /transcript_id="XM_568153.1"
                     /db_xref="GI:58261485"
                     /db_xref="GeneID:3254977"
     CDS             join(739457..739747,739805..740198,740250..740397,
                     740447..740536,740597..741125,741216..741614)
                     /locus_tag="CNL06290"
                     /codon_start=1
                     /product="riken protein"
                     /protein_id="XP_568153.1"
                     /db_xref="GI:58261486"
                     /db_xref="GeneID:3254977"
                     /translation="MLQYRLLAAIALNTAVYASPAPNHFVLTSPEEVLDRSYDSYPYF
                     SHGQKEIEAITIYDGTGYVQEYSIELPHAAVWTEQGWLSRWLALGGEGEVVVHLDDPK
                     GAEKAENITLPHRPAAFPSHPSISLPLSGRLLPFSSFLTPSASHSPSELLACIPSSII
                     PRPPTRPGKSEDVKIALIERGTCDFATKAMAAQDRGAHAVIVGDTKARAGETDAEGRK
                     REGLITMFSPQETDSLYIPAVFVSRASYLGLRDLLANQTGSKSPGQGLYIDISEGSDE
                     GNALSGLLSFAILMPTLFLLAMIGIHRLRVVRQREADRAPAMVVLSLPERVWTPDIVW
                     EKDDDSSEGPGSPSPEGGERSLLTDEQEVHDSQRSILNDPTDADASQTHPPPPVDLSI
                     ISPPLLPPLTETNPSFSPILPAHPPLSSSTDNAGPSRNSRKHKRPTRRYFSKDECAIC
                     MDAFEKGDIVRILPCGHVFHKEECDEWLMKWRKLCPTCRADVTLPQVKIKGSTMTPVI
                     GPPMAVDADRTEQTPSSFDTLAAFPNPDFNSNLGGGTLGSGPGTSSSPSRPWRLPEVW
                     RDVRERLIGWVGPGFGLRRTGVRLGEGEEEGGAGEEEEERERMVAGEESV"
     misc_feature    741537..741587
                     /locus_tag="CNL06290"
                     /note="GA-rich"
     gene            complement(743907..744955)
                     /locus_tag="CNL06300"
                     /db_xref="GeneID:3254783"
     mRNA            complement(join(743907..744114,744243..744418,
                     744554..744955))
                     /locus_tag="CNL06300"
                     /product="gal4 DNA-binding enhancer protein 2, putative"
                     /transcript_id="XM_568154.1"
                     /db_xref="GI:58261487"
                     /db_xref="GeneID:3254783"
     CDS             complement(join(744098..744114,744243..744418,
                     744554..744936))
                     /locus_tag="CNL06300"
                     /codon_start=1
                     /product="gal4 DNA-binding enhancer protein 2"
                     /protein_id="XP_568154.1"
                     /db_xref="GI:58261488"
                     /db_xref="GeneID:3254783"
                     /translation="MSIENLHIADETEIPAGATVELHSRPERKARKALEGLGLKRVQG
                     IQRVTLRRARNVLLVVSSPEVYKSPGSDCYIVFGEAKVEDPNSAAQLQAQAQLAASSQ
                     AAQQAHAHGGFKEGVPKSLEELMQDAPSTDSSAPAPSGEATDASASGDFKVSDEEIQL
                     IVAQTGVDEAKAREAYISEKGDLINAIMKLQ"
     misc_feature    744163..744231
                     /note="GA-rich"
     repeat_region   744464..744507
                     /rpt_type=tandem
                     /rpt_unit_seq="tcca"
                     /satellite="microsatellite"
     gene            <745159..747113
                     /locus_tag="CNL06310"
                     /db_xref="GeneID:3254808"
     mRNA            join(<745159..745377,745439..745456,745512..745732,
                     745822..745929,745997..746054,746161..746276,
                     746356..747113)
                     /locus_tag="CNL06310"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530339|gb|CF676180.1,gi|41530345|gb|CF676186.1,
                     gi|41536655|gb|CF682496.1,gi|41536659|gb|CF682500.1,
                     gi|41543269|gb|CF689110.1,gi|41543280|gb|CF689121.1,
                     gi|41544887|gb|CF690728.1,gi|41544890|gb|CF690731.1,
                     gi|41547751|gb|CF693592.1,gi|41547762|gb|CF693603.1,
                     gi|41559617|gb|CF705458.1,gi|41559629|gb|CF705470.1,
                     gi|41568809|gb|CF714650.1,gi|41568819|gb|CF714660.1,
                     gi|41569965|gb|CF715806.1"
                     /transcript_id="XM_568155.1"
                     /db_xref="GI:58261489"
                     /db_xref="GeneID:3254808"
     CDS             join(745159..745377,745439..745456,745512..745732,
                     745822..745929,745997..746054,746161..746276,
                     746356..746947)
                     /locus_tag="CNL06310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568155.1"
                     /db_xref="GI:58261490"
                     /db_xref="GeneID:3254808"
                     /translation="MSSDKFISNLFSLSLFDTPPTAMSFFKSRSASASTASLKPESLG
                     PKTSEVFTVPPQESSVKKRWEYDDHQLGLIAQLKEYTKTIALPESDEYYPWEQRFLSD
                     PATHARYMRAAKWKLHDGKHRIRGTMEWRREYKPELIQPDDVGVEAETGKIILTGFDM
                     DARPILYMRPGRENTETSPRQIRHLIYHLERAIDLMPPGQEQVAIIVDYKSATSQSNP
                     SIGTARKVLHILQNHYVERLGRGLVVNMPWWINAFFSGISPFMDPITRDKIRFNPRLL
                     DLVPAAHLDSEFGGDYNFTYDYSVYWKTITEFCHIAPNGRRVPPPGKEEEGKGREGWI
                     PPAGNGIKAAVEGYVPKEGTVKSGEIVKAGEKNEKSEKTGKGAAATSANGVAGAAPTA
                     SSTTAPAPPEKEMESLAIQTAPGEPIGGSVFDHPPSEGEVHEAKKSLNVSA"
     misc_feature    746065..746121
                     /locus_tag="CNL06310"
                     /note="CT-rich"
     gene            complement(747594..>748852)
                     /locus_tag="CNL06320"
                     /db_xref="GeneID:3254821"
     mRNA            complement(join(747594..748141,748229..748260,
                     748319..748365,748519..748620,748679..>748852))
                     /locus_tag="CNL06320"
                     /product="hypothetical protein"
                     /transcript_id="XM_568156.1"
                     /db_xref="GI:58261491"
                     /db_xref="GeneID:3254821"
     CDS             complement(join(747867..748141,748229..748260,
                     748319..748365,748519..748620,748679..748852))
                     /locus_tag="CNL06320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568156.1"
                     /db_xref="GI:58261492"
                     /db_xref="GeneID:3254821"
                     /translation="MFIQAILGASVTAMAGLYALKSGANPTHSDNVPYEVDLHWMRKS
                     IEVMPPCHFNAYGSVIVNASNNELLCSGYNSQLEIGDPTEHGEVNAIRITEIWPQSWI
                     YTTAEPCPMCGSTILQSGFKRVVYGTSSPDLVSMGWTEYLVSVRNKWLRKAAVVQPGF
                     GGGRPVTQVVGHVGNNETDPRLAWQFNLDYPCPEGCHRHGEEQICKPVA"
     gene            749480..>751624
                     /locus_tag="CNL06330"
                     /db_xref="GeneID:3254883"
     mRNA            join(749480..749685,749743..749804,749859..750030,
                     750088..750190,750252..750420,750474..750596,
                     750661..750836,750898..751009,751073..751404,
                     751476..>751624)
                     /locus_tag="CNL06330"
                     /product="purine-cytosine permease, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536037|gb|CF681878.1,gi|41574056|gb|CF719897.1"
                     /transcript_id="XM_568157.1"
                     /db_xref="GI:58261493"
                     /db_xref="GeneID:3254883"
     CDS             join(749506..749685,749743..749804,749859..750030,
                     750088..750190,750252..750420,750474..750596,
                     750661..750836,750898..751009,751073..751404,
                     751476..751624)
                     /locus_tag="CNL06330"
                     /codon_start=1
                     /product="purine-cytosine permease"
                     /protein_id="XP_568157.1"
                     /db_xref="GI:58261494"
                     /db_xref="GeneID:3254883"
                     /translation="MSIAPPEYDEKDIEAQSFVSPTGRQHNHASAGGILQAEDGVPRG
                     KGISAPLWKAMAWFDRFGVEARGIERVPEDDRPHTSWWDNGTLWFSVNSCVGTFSVGY
                     LGHLYYGMGLRDAALTIVFFNLLSCAPVAYMCIFGKELGLRQMVLSRFALGYWTGIIP
                     VIFNLIACCGWATMNTIGGISCWRAISTTHQIPVIAAAVILAFLGLIVSFCGYKFIHL
                     YEKFAGYPVLIAFLVSMGTSAKYMDLPGAWGPSGPVGAAGVLTFGCAIAGYAIGWVGF
                     AADFTVSMPKETSTKKLFWVTFWGLAIPLIFIELMGALAVTTFNARPDWEEMFNDGAV
                     GGLLAGLLQPCGGFGKFLLVILGLSTVAVNTPNVYIFTNTFHALSPYCQAIPRPFIAL
                     IVSIIYAVLAAAGANSFSAVLEHLLLFLAYWLTMYFGIVATEHLVFRKNSFDNYVPDD
                     YRNWRMLPLGVAGFFALGLGWTGAALGTGMNTSWFIGPIAKQIGGGGDVGFELAFGFA
                     VTTFIPLRYFEKKYWGH"
     gene            complement(752020..754811)
                     /locus_tag="CNL06340"
                     /db_xref="GeneID:3255022"
     mRNA            complement(join(752020..752549,752612..752986,
                     753042..753458,753512..753958,754009..754040,
                     754095..754236,754283..754416,754470..754628,
                     754677..754811))
                     /locus_tag="CNL06340"
                     /product="Catalase A, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534356|gb|CF680197.1,gi|41534361|gb|CF680202.1,
                     gi|41543771|gb|CF689612.1,gi|41543779|gb|CF689620.1,
                     gi|41545575|gb|CF691416.1,gi|41545583|gb|CF691424.1,
                     gi|41572949|gb|CF718790.1,gi|41572958|gb|CF718799.1,
                     gi|41574051|gb|CF719892.1"
                     /transcript_id="XM_568158.1"
                     /db_xref="GI:58261495"
                     /db_xref="GeneID:3255022"
     CDS             complement(join(752133..752549,752612..752986,
                     753042..753458,753512..753958,754009..754040,
                     754095..754236,754283..754416,754470..754628,
                     754677..754698))
                     /locus_tag="CNL06340"
                     /EC_number="1.11.1.6"
                     /codon_start=1
                     /product="Catalase A"
                     /protein_id="XP_568158.1"
                     /db_xref="GI:58261496"
                     /db_xref="GeneID:3255022"
                     /translation="MAQMLNQAVTAVTGDAKYRQMAENTIEQTSKTPLTTYFGVKVPE
                     TDVALRAGARGPTLLEDFHNREKIQHFDHERIPERVVHARGSAAHGEFKLHTPLTGIT
                     TAKVLTDTSKVVPAYVRFSTVVGSRGSADTVRDVRGFATRFYTDEGNWDLVGNNIPVF
                     FIQDAIKFPDVIHALKPEPHNEMPQAQTAHDNAWDFISLHQQATHMQQWVTSDRAIPR
                     SYRMMQGFGVHTFRLINEEGKSTFVKYHWIPHLGIHSLVWDEALKIAGQDPDFHRRDL
                     WDAIEAKAYPKWELGVQLIKEEDEHKFDFDILDSTKIIPEELVPVQKIGTLTLTRNPV
                     DFFAEVEQVAFCTQHIVPGMDFTDDPLLAGRNFSYADTQISRLGTNWHDLPINRPICP
                     VMTNFRDGQMSMFSKTNRTPYHPNRHDSLPLTSSNNGGFQSYREKISGVKERLNGPKF
                     QEFYSQATLFWNSMSETEREHIIAAYNFELSHCAEDIVIQNVINSLNEIDHGLATSVH
                     ATFPHLTLPEAKPTHNKKSEYLSQINGKHQVFTASGRRIGIYLVPGYTYSQVVPLLAA
                     FEADGCMVKFIGPTLGPIKASNGQSFTAEFTFEGCRTTFFDAIVFVGGPDDSFIAKLK
                     IGRLIHAAREAYMHLKPIGVLGNATQWMVNTCLPGDFSEKTKTESSVVVENGVVFAPG
                     DPTLHSIKFAKQFLEGVAHHRVWDRQVAHIAA"
     gene            757039..758349
                     /locus_tag="CNL06350"
                     /db_xref="GeneID:3254857"
     mRNA            join(757039..757229,757331..757399,757523..757638,
                     757695..757772,757840..757974,758023..758349)
                     /locus_tag="CNL06350"
                     /product="RNA cap binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536150|gb|CF681991.1,gi|41568684|gb|CF714525.1"
                     /transcript_id="XM_568159.1"
                     /db_xref="GI:58261497"
                     /db_xref="GeneID:3254857"
     CDS             join(757175..757229,757331..757399,757523..757638,
                     757695..757772,757840..757929)
                     /locus_tag="CNL06350"
                     /codon_start=1
                     /product="RNA cap binding protein"
                     /protein_id="XP_568159.1"
                     /db_xref="GI:58261498"
                     /db_xref="GeneID:3254857"
                     /translation="MDALIPFTTSGSLVDLVDKKVLVILRDGRKLIGLFRSYDQFANF
                     LLESCVERLHYKLEYADKDIGVLLVRGENVVALGEIDLIAEDMVPLQQVNVQEIEEKI
                     SAENKQRERDHAVKESVLSKMGFVNEGKEGDAY"
     gene            759315..760314
                     /locus_tag="CNL06360"
                     /db_xref="GeneID:3254974"
     mRNA            join(759315..759402,759468..759725,759798..759994,
                     760061..760314)
                     /locus_tag="CNL06360"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536144|gb|CF681985.1,gi|41568680|gb|CF714521.1"
                     /transcript_id="XM_568233.1"
                     /db_xref="GI:58261645"
                     /db_xref="GeneID:3254974"
     CDS             join(759332..759402,759468..759725,759798..759994,
                     760061..760272)
                     /locus_tag="CNL06360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568233.1"
                     /db_xref="GI:58261646"
                     /db_xref="GeneID:3254974"
                     /translation="MGNGDVEGSNKRRRIDILEQQPRRFIPPTPASGAFEGSQHLRHP
                     QPSHNFQTNRPMSRAFSSIAPMAIPRMGAPTQVPLQGPGGRPKSTIGHMGGERRADDG
                     DDIKSRLETYRYDPANPSPNRRAPQERSGTTLPNQHERRFNTQSLQTQRLQMSVPQRP
                     QSSFVQRLKMSNSSFVNRPGSARPTPLQQHMSAPSMNSSQSMVIGTGMGGVQDSASVR
                     MREGVLQGGARMTLTHGVGQRGSGNRF"
     gene            complement(<760814..>761839)
                     /locus_tag="CNL06370"
                     /db_xref="GeneID:3254965"
     mRNA            complement(join(<760814..761049,761128..>761839))
                     /locus_tag="CNL06370"
                     /product="hypothetical protein"
                     /transcript_id="XM_568234.1"
                     /db_xref="GI:58261647"
                     /db_xref="GeneID:3254965"
     CDS             complement(join(760814..761049,761128..761839))
                     /locus_tag="CNL06370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568234.1"
                     /db_xref="GI:58261648"
                     /db_xref="GeneID:3254965"
                     /translation="MSRFNPDELSSFREHYHTYGYVIVPSLIPDDLFPLLRESADHVV
                     DLSRSGKWDNVRVVGKPFPPWDAKDKEDIWGVQSVMHPDLGQKVFAEWYGSEGMLEVS
                     RALMGCEQEDMQFGEHTWSNFRSQRRLQKAKSSIAELFNLLVNPTNAAYALVWHRDDV
                     KPTATPQEEIAALQKDYHGIQWNAALYDDECLSVVPKSHLRVSAPDEKKALLGDGEMP
                     GGIKVKLKAGETVFYNNNILHIGSYDPATKRRTLHGCYGCPPPGDTSRARNILQHDLT
                     YTLDPKFRESVPEKLKGMVDKLNGMQKLLEGQVLEYSQN"
     gene            complement(762253..>762933)
                     /locus_tag="CNL06380"
                     /db_xref="GeneID:3254865"
     mRNA            complement(join(762253..762517,762587..762780,
                     762830..762841,762893..>762933))
                     /locus_tag="CNL06380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568160.1"
                     /db_xref="GI:58261499"
                     /db_xref="GeneID:3254865"
     CDS             complement(join(762402..762517,762587..762780,
                     762830..762841,762893..762933))
                     /locus_tag="CNL06380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568160.1"
                     /db_xref="GI:58261500"
                     /db_xref="GeneID:3254865"
                     /translation="MQRPNDSLAQRALFVKNLNFNITGADLYDLFGKYGPIRQIRLGT
                     DANLKTKGTAYVVFESPDDAKEAVNQLNGFHLMERYIVVLYHHPSKQQASALAKAELR
                     AREEALAEEKRRLGMKDE"
     gene            763210..764805
                     /locus_tag="CNL06390"
                     /db_xref="GeneID:3254869"
     mRNA            join(763210..763612,763663..763758,763806..764455,
                     764503..764805)
                     /locus_tag="CNL06390"
                     /product="zuotin, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532537|gb|CF678378.1,gi|41541729|gb|CF687570.1,
                     gi|41541735|gb|CF687576.1,gi|41544701|gb|CF690542.1,
                     gi|41544708|gb|CF690549.1,gi|41549774|gb|CF695615.1,
                     gi|41549788|gb|CF695629.1,gi|41550198|gb|CF696039.1,
                     gi|41550205|gb|CF696046.1,gi|41557035|gb|CF702876.1,
                     gi|41557042|gb|CF702883.1,gi|41564541|gb|CF710382.1,
                     gi|41564547|gb|CF710388.1,gi|41568191|gb|CF714032.1,
                     gi|41568200|gb|CF714041.1,gi|41569787|gb|CF715628.1,
                     gi|41569798|gb|CF715639.1,gi|41575806|gb|CF721647.1"
                     /transcript_id="XM_568161.1"
                     /db_xref="GI:58261501"
                     /db_xref="GeneID:3254869"
     CDS             join(763228..763612,763663..763758,763806..764455,
                     764503..764751)
                     /locus_tag="CNL06390"
                     /codon_start=1
                     /product="zuotin"
                     /protein_id="XP_568161.1"
                     /db_xref="GI:58261502"
                     /db_xref="GeneID:3254869"
                     /translation="MASVVTLPITLTATPAGYSKPSPSKASAPKQLPIYPAGPSFISA
                     ARRQILQRSFADDDKAILEAREREAEEKANASGDGTQYPGLGEEEESQTVLSSDPKEW
                     KKQDHYAILGLGHLRYTATDDQIKVAHRRKVLRHHPDKKASQTGHGTNDDSFFKCIQK
                     AHETLTNPERRRQFDSIDWNINDEVPDFKKLSPEEFCAQANALFAREGRFSKVQPVPE
                     FGDLNSSKKDVEGFYDFFYNFDSWRSFEWHDKEVNEGSDSRDDKRFTEKKNKSERTRR
                     KKEDNTRLRELVDSVLALDPRIKRIKAEEKAAREAKKKGGAVGAPKQLSAAEKKKLEE
                     QKKKEEEEKKVAEKKANEASKADREAAKKAKEAARKNLKKWKKAISTVVASSNYFQAE
                     GTAASAQVIEKQLGELDALVELLEPEQVKDLKEKIEKAGNGAPAKAALQEKVAALGEK
                     GAGKFTEFA"
     misc_feature    764306..764357
                     /locus_tag="CNL06390"
                     /note="GA-rich"
     gene            767155..769107
                     /locus_tag="CNL06400"
                     /db_xref="GeneID:3254786"
     mRNA            join(767155..767811,767865..769107)
                     /locus_tag="CNL06400"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530437|gb|CF676278.1,gi|41546789|gb|CF692630.1,
                     gi|41546793|gb|CF692634.1"
                     /transcript_id="XM_568162.1"
                     /db_xref="GI:58261503"
                     /db_xref="GeneID:3254786"
     CDS             join(767334..767811,767865..769063)
                     /locus_tag="CNL06400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568162.1"
                     /db_xref="GI:58261504"
                     /db_xref="GeneID:3254786"
                     /translation="MISTAAVNTPGASMNHSPAVLPTDIPRRPSPWHDIAHSLSTTSL
                     PPTSRCDSTTSLPTPPSSDPSTPPSQTPVLSASQAFKEWEERLSQPDSDATRHQLVHP
                     KRSPTPKLAAERDKMGFIEYKLKLINPTTERFERLVTQMMWRLKQGKNEAIYELGLAD
                     DGTVVGLTRAEMDASLRTLELMASEVGATVIVLKEIVLNGLASQQPTASIETITALPP
                     SDVLSHSKLLTNGWTAKRPDLDEDGQPRRGNGIPDSHGKGRRSKREKKKKKETRSQME
                     LKQKSEGDGEIVDSTRDCSMSSAASLSTDTDSSFQFDNDESPPNDLHQHQSILSPALF
                     PRKIINPVSPKSDKKRRKSAAKQEQRRLDLLRGDGTNPMWAEITSQSSKFPVESPKVN
                     LPHQPARPSSLRLATPAECPDNSFVDDLLHVPLDSLSLSFADVRTVSGTSPRQSHYPR
                     FHPHSTQLSIPSPIRPLSPVSDHSVAATTKTGTETEIVLPLDDAALTTNKILPPPPGE
                     ELICVEALVVRKVQHDHDREDEDDEAEEEEMNDWGYGGEEDVWGFGAEED"
     misc_feature    768153..768197
                     /locus_tag="CNL06400"
                     /note="GA-rich"
     gene            complement(770182..>772483)
                     /locus_tag="CNL06410"
                     /db_xref="GeneID:3255028"
     mRNA            complement(join(770182..770351,770410..770676,
                     770726..770961,771014..771073,771134..771256,
                     771315..771674,771730..771796,771865..771919,
                     771979..772075,772138..>772483))
                     /locus_tag="CNL06410"
                     /product="expressed protein"
                     /transcript_id="XM_568163.1"
                     /db_xref="GI:58261505"
                     /db_xref="GeneID:3255028"
     CDS             complement(join(770322..770351,770410..770676,
                     770726..770961,771014..771073,771134..771256,
                     771315..771674,771730..771796,771865..771919,
                     771979..772075,772138..772483))
                     /locus_tag="CNL06410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568163.1"
                     /db_xref="GI:58261506"
                     /db_xref="GeneID:3255028"
                     /translation="MVTNHHSPEVIEHVAEKAPSSSSNSDAIEGKEDLAASQYDTISG
                     QLPELAAVGSNMDRKNEENGPRAGEELETVIPLAYRLIAFSMILFFATGSSYMQSVAS
                     PLKSTFKEKLNINNAQYGTISSASSLVNTILPIIGGIGMDYWGATYAAIISSIFVLVG
                     AIIAAAASNAENYGMLIGGLILMGFGSTVIESTQNKLYSHWFRGTSLGLVFAVDIAWN
                     RITSVIAKNTAVPMSTINGWWGWALWIPAIVCAVNMAVVMLYWWYERAVPKKYRPLLG
                     KDARVKEGWDKRKFQFGTLRRLPKFFWIFCGSQLFQNAAVSVYTSNLADIQTVTRGTS
                     TLAAGYNSSLQSVIPIFLTPLTGFFFDKIGWRMPFVSFTGALYIIVFALIGLTTVHPL
                     CPILISSFALSTNAITFIASIPILVGDDSLLGTALGIWKAFANGNSIVLDVAAGAIQD
                     RSSNGSYNNVIYFIIAIKGVQVLLGPTYYYLDRRWLAGSLRMTEENRLAKLKEVKENN
                     LDYEGWRVSKMTAAIVGFELIGLIITAWVVYIIYSLGT"
     gene            complement(773918..778231)
                     /locus_tag="CNL06420"
                     /db_xref="GeneID:3254988"
     mRNA            complement(join(773918..774092,774153..774241,
                     774293..774362,774427..774554,774608..774637,
                     774685..774964,775024..775260,775404..775687,
                     775754..775971,776024..776186,776257..776456,
                     776638..777152,777200..777421,777469..777690,
                     777738..777809,777864..777946,777997..778062,
                     778109..778231))
                     /locus_tag="CNL06420"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41554861|gb|CF700702.1,gi|41555380|gb|CF701221.1"
                     /transcript_id="XM_568164.1"
                     /db_xref="GI:58261507"
                     /db_xref="GeneID:3254988"
     CDS             complement(join(773973..774092,774153..774241,
                     774293..774362,774427..774554,774608..774637,
                     774685..774964,775024..775260,775404..775687,
                     775754..775971,776024..776186,776257..776456,
                     776638..777152,777200..777421,777469..777690,
                     777738..777809,777864..777946,777997..778062,
                     778109..778211))
                     /locus_tag="CNL06420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568164.1"
                     /db_xref="GI:58261508"
                     /db_xref="GeneID:3254988"
                     /translation="MDQQVLQCLQSTLSPEENVRKHAEEQLKQLFAVPEGGLSLARLL
                     NAQDVPLFQRQMTGVLLQQYVNQHWTPASAQFQHPITPIEVKAQIRPLVFSGLSDPER
                     KIRLASAFSLSAIARYDWPDDYPDLLPQLVNLLTSGSSDSVHGGMRVISDFVRNELSE
                     DQLLPVVQDLLPAVLNILANPEAHSPSTRASTVHVFRQVVRMLETVREEQPRAVKSAL
                     ESLGAVWLDAFSQLLSQDAGAEVQQNWESLSIRIEIFRTLSLFQSAFPRIIAPNVPSF
                     IRLAILNLQSLLPLFTAFYLSTTDDTPEPPSPTSDSGTGMTDPKIDITDLASAIFDYL
                     TPTVRTKSAVGVLMEGQDESARATEVLENLVRVVQEFTQITKENASCLLLFIGVVLIR
                     WCRPKSGWKTPMRSLSMRTKKLKSTAQEHLVMISLATKQDAQHYADICENRWKPLESV
                     LAMLGGISDDIRNALEEDLEKKRSPTIDVSYLFDQVIPSLLGQSEAPFLQGRAFVFAS
                     QFSSFLPQTLVTQYLNAAVSVLESPEVSVPVKISAVKTIKNFCRHVDTAILQPQTGKL
                     LSLLLPLLPQAERETLYLLLETIRAITSIDDSILNAQNTGPVVEQMFDVWLRCADDPV
                     TTSIIEENIESLTLFPDPGVLSALVHTLAPKLAAAISTPVTDEIVHIPGEAVQLANSM
                     IRMRGGPLETELVATVTRAVMEILRTTDDMDVIQDTELLCRHDLEGNNGIASIFGLLG
                     RFLAPTFSESGGIFVGELIMHLFRKAGEAIGPVLPDLLRAVVARLATATMPSFIQTLV
                     LPFAYLFSTEHTANTIDLLSQFSVPVPSGGEKRALDLVLSAWCDTSDTITGSWNIRVS
                     DMGMSKLFVLSDQRLREVIVKGDLIISEANRNTIMTRSRTRHTPNQYTQIPFPLKALK
                     LILKDVQSEPTSAKKATTGLDIEDDDGDEEWDDDDLLGGGSNVGEFDYLSSWLDNNGA
                     ESDAQDDDEDLKSDPLAQIDLGQHLTDVLRHAYASNSNGMHEMVEGLSDEEKGILRGV
                     LTL"
     gene            778372..781506
                     /locus_tag="CNL06430"
                     /db_xref="GeneID:3254947"
     mRNA            join(778372..778452,778569..778694,778785..778934,
                     779004..779093,779142..779275,779331..779603,
                     779654..779955,780008..780167,780220..780311,
                     780362..780671,780719..781007,781064..781506)
                     /locus_tag="CNL06430"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533561|gb|CF679402.1,gi|41533571|gb|CF679412.1,
                     gi|41537606|gb|CF683447.1,gi|41537620|gb|CF683461.1,
                     gi|41563947|gb|CF709788.1,gi|41563953|gb|CF709794.1"
                     /transcript_id="XM_568165.1"
                     /db_xref="GI:58261509"
                     /db_xref="GeneID:3254947"
     CDS             join(778425..778452,778569..778694,778785..778934,
                     779004..779093,779142..779275,779331..779603,
                     779654..779955,780008..780167,780220..780311,
                     780362..780671,780719..781007,781064..781440)
                     /locus_tag="CNL06430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568165.1"
                     /db_xref="GI:58261510"
                     /db_xref="GeneID:3254947"
                     /translation="MPLKDLLKARFTSAIQSIPAGTWKILITDEHSHALLTTVYKQFD
                     ILQQHVTSIEPLHSTRQPMTVDAIYLLTPTLQNVDRIIADFANGTRTYKSAHVYFIDG
                     IDDQLAQRLTDGMPQGILQAFVELYCNIWALEDRVFSLKAPWSFYTMFGSLGGAASAD
                     LAMEAFQDDLKVTGRSILNFLATINENPYIRYYQPHHHPPLGPLAHTAQSSSHSPQPQ
                     SNASLRWKSAMGGLSSKAPEVVGEHLSKKIAEQLQTDLDEYLTNNPEFPPASGRPRSV
                     LFVVDRSMDPAAPFLHEFWYQAMVNDLLNVEEGVRYKYKYTNTLGGLEDKVAELTEQD
                     PVWVSVRHLHMKDAIDTLMTDFGKFAQEHAGFRGGGNVNVNDLKDMLASLPQFQTQRE
                     QFSLHLDMAQECMNIFEKKRLAQVGNVEQCCATGYTAEGKTPKSIVEEMVPLLDDRLN
                     ITSLDKVRIMALYILFRDGVADEDRRRLYQHARLSLSEQDMVNNLVHLGVKVIKASAA
                     PQTHGPEADKIQDHSKSSKSRIKQKPTMAEGEYELSRYKPVIQMMLEDQNSNKLDPAN
                     FPYIKDMPPEANPSLRGSSAQLATTSNPSGSLRSARPTWHKAPSARINNTEGKQRFII
                     FIAGGMTYSEMRCAYTVGQALGKDVYIGSTHVLTPETYCSQLRALGRGGVGSNPPTPI
                     PLHPQGPSRINRQPGQPVSYQEILNFRHWRPPVGPPSLAPTPQAQPQLQQKQSSHSLL
                     TNGMSSLSLTSTAGSKDKKEKQEGEKKKKKLFGLKL"
     misc_feature    781381..781419
                     /locus_tag="CNL06430"
                     /note="GA-rich"
     gene            complement(781582..783083)
                     /locus_tag="CNL06440"
                     /db_xref="GeneID:3255030"
     mRNA            complement(join(781582..781788,781840..782514,
                     782591..782724,782848..782888,782953..783083))
                     /locus_tag="CNL06440"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541872|gb|CF687713.1,gi|41541875|gb|CF687716.1"
                     /transcript_id="XM_568245.1"
                     /db_xref="GI:58261669"
                     /db_xref="GeneID:3255030"
     CDS             complement(join(781765..781788,781840..782514,
                     782591..782724,782848..782888,782953..783035))
                     /locus_tag="CNL06440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568245.1"
                     /db_xref="GI:58261670"
                     /db_xref="GeneID:3255030"
                     /translation="MPPTSATASVSPTKRAPSPAPTITELDLEIAMLRCLGEIRPLGR
                     YKHFLIIQLQTEIHRRTGSWLPIELLWQRLDKLYNLEGLDEMASSSSVSIPSTPHTLS
                     PRFPLSPRSSSSPLSDLSPQRAKSRKTRNPSNKTPSNANNKKGESLDISKSARIINSE
                     HFHRTFDLPYFKSRYHLTEDEEEQSQKDSEEESDLDEPIELDGEEERIWQDMIYPRAL
                     APEGTDASWQGGSLTVEEDESEDEDMKFDDERKGKKTSVVSTVSRRESAGSGAGVEND
                     GRKRGRQTRAQEESEEDSPNVMKRKGARDVSAADSRKSKRRR"
     gene            complement(790688..790780)
                     /locus_tag="CNL06450"
                     /db_xref="GeneID:3254942"
     tRNA            complement(790688..790780)
                     /locus_tag="CNL06450"
                     /product="tRNA-Glu"
                     /codon_recognized="GAA"
                     /db_xref="GeneID:3254942"
     gene            795148..797763
                     /locus_tag="CNL06460"
                     /db_xref="GeneID:3255012"
     mRNA            join(795148..795235,795410..795427,795485..795506,
                     795581..795592,795753..795920,795970..796041,
                     796092..796184,796231..796298,796347..796675,
                     796726..796833,796886..797000,797052..797163,
                     797214..797239,797296..797406,797460..797763)
                     /locus_tag="CNL06460"
                     /product="UDP-glucose 6-dehydrogenase"
                     /note="supported by cDNAs and ESTs:
                     gi|41535914|gb|CF681755.1,gi|41536038|gb|CF681879.1,
                     gi|41536043|gb|CF681884.1,gi|41536190|gb|CF682031.1,
                     gi|41536195|gb|CF682036.1,gi|41536569|gb|CF682410.1,
                     gi|41536573|gb|CF682414.1,gi|41538460|gb|CF684301.1,
                     gi|41538469|gb|CF684310.1,gi|41539539|gb|CF685380.1,
                     gi|41539545|gb|CF685386.1,gi|41540343|gb|CF686184.1,
                     gi|41540352|gb|CF686193.1,gi|41541953|gb|CF687794.1,
                     gi|41541956|gb|CF687797.1,gi|41544310|gb|CF690151.1,
                     gi|41544321|gb|CF690162.1,gi|41547155|gb|CF692996.1,
                     gi|41547163|gb|CF693004.1,gi|41547940|gb|CF693781.1,
                     gi|41547950|gb|CF693791.1,gi|41549419|gb|CF695260.1,
                     gi|41549423|gb|CF695264.1,gi|41549973|gb|CF695814.1,
                     gi|41549981|gb|CF695822.1,gi|41550758|gb|CF696599.1,
                     gi|41550768|gb|CF696609.1,gi|41550794|gb|CF696635.1,
                     gi|41550800|gb|CF696641.1,gi|41550823|gb|CF696664.1,
                     gi|41550831|gb|CF696672.1,gi|41550964|gb|CF696805.1,
                     gi|41550967|gb|CF696808.1,gi|41552120|gb|CF697961.1,
                     gi|41552131|gb|CF697972.1,gi|41553017|gb|CF698858.1,
                     gi|41553023|gb|CF698864.1,gi|41557583|gb|CF703424.1,
                     gi|415"
                     /transcript_id="XM_568166.1"
                     /db_xref="GI:58261511"
                     /db_xref="GeneID:3255012"
     CDS             join(795202..795235,795410..795427,795485..795506,
                     795581..795592,795753..795920,795970..796041,
                     796092..796184,796231..796298,796347..796675,
                     796726..796833,796886..797000,797052..797163,
                     797214..797239,797296..797406,797460..797578)
                     /locus_tag="CNL06460"
                     /codon_start=1
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="XP_568166.1"
                     /db_xref="GI:58261512"
                     /db_xref="GeneID:3255012"
                     /translation="MAPITVKKICCIGAGYVGGPTCAVIALKCPQIQVTIVDLNQQRI
                     DAWNSDNLPIYEPGLDEVVKATRGKNLFFSTDVDKGIEDADLIFVSVNTPTKKSGVGA
                     GYAADLKFLQLATRRIAEVATSSKIVVEKSTVPCRTAESMRTILEANCRPGCHFDILS
                     NPEFLAEGTAISDLFNPDRVLIGSLQTEQGIDACQALSGVYANWVPKERILTVGLWSS
                     ELSKLAANAMLAQRISSVNALSAICEATGANIDEVSYAVGKDTRMGSKFLKASVGFGG
                     SCFQKDILNLVYLSESLHLPEVAKYWRAVVEMNEYQKSRFARKVVDTLFNTITGKKIA
                     ILGWAFKKDTGDTRESPSIGIANHFLSEKARIAVYDPQVTESQIWLDMTDYGEIPAEP
                     IQPHLTICKSVEEACANAEAIVICTEWDEFKTLDWKKIYDNCPRPAFVFDGRLILNRQ
                     ELTNIGFKVVTIGTGDRI"
     gene            797897..799787
                     /locus_tag="CNL06470"
                     /db_xref="GeneID:3254723"
     mRNA            join(797897..798145,798211..798341,798412..798549,
                     798611..798688,798753..798809,798863..798930,
                     798985..799098,799154..799194,799251..799313,
                     799375..799496,799549..799787)
                     /locus_tag="CNL06470"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540149|gb|CF685990.1,gi|41540156|gb|CF685997.1,
                     gi|41561155|gb|CF706996.1"
                     /transcript_id="XM_568167.1"
                     /db_xref="GI:58261513"
                     /db_xref="GeneID:3254723"
     CDS             join(797903..798145,798211..798341,798412..798549,
                     798611..798688,798753..798809,798863..798930,
                     798985..799098,799154..799194,799251..799313,
                     799375..799496,799549..799582)
                     /locus_tag="CNL06470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568167.1"
                     /db_xref="GI:58261514"
                     /db_xref="GeneID:3254723"
                     /translation="MTAEIATVSLDVFLADPSSKAAQLEARNAAESLIRTGALIVRDS
                     RAPKEANDRFLDLFEDYFAQSQEALKEDERPELGFQVGVTLENTEKPKCSSDGDCKAI
                     IASLEASERPQDLEGFGADPKCRFFHRMSEVPPYQSNFPVLEAPNVTPRAFERTWEER
                     VNEWGMFMRQSVEGVARMVALGLDMEERAFLDAGRYGSHLLAPTATDLEKYGELNTIC
                     AGFHTDLNFLTIHGQSRYPGLHIWARNTGKKIQVKIPPGCLLVQAGKQIEWLTGGLIK
                     AGYHEVVCTEATLQTLKRRKSEFPDRPSIRISSTFFWHLSPDYELSPIPSLQREAEKR
                     FGKQEDYGTMLVGDQVRRELGLIALMPA"
     gene            799991..802369
                     /locus_tag="CNL06480"
                     /db_xref="GeneID:3254794"
     mRNA            join(799991..800173,800234..800674,800724..800843,
                     800892..801139,801192..801683,801736..801798,
                     801855..802369)
                     /locus_tag="CNL06480"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543243|gb|CF689084.1,gi|41563200|gb|CF709041.1,
                     gi|41563204|gb|CF709045.1,gi|41571272|gb|CF717113.1,
                     gi|41574327|gb|CF720168.1,gi|41574336|gb|CF720177.1"
                     /transcript_id="XM_568168.1"
                     /db_xref="GI:58261515"
                     /db_xref="GeneID:3254794"
     CDS             join(800472..800674,800724..800843,800892..801139,
                     801192..801683,801736..801798,801855..802264)
                     /locus_tag="CNL06480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568168.1"
                     /db_xref="GI:58261516"
                     /db_xref="GeneID:3254794"
                     /translation="MPPTSRPLPPTPHSNTSDRMLPTNTLFSVLLSLAVASAAVVPRD
                     ASASFDLNSGSGTAVKDPAPVAVSIEFFTFPGYVQDLDTTSQCLNNLDRAAGAATRVR
                     IGGTTQDRATYDPTSSSAVNYYVADPADAPANLTYGPSFFDLASKLNGPTTIGLNRRL
                     NNINNTIAAAEQAVKTMNNLYAIELGNEPDLYSSSDPIADGQSWTPALDAQIQVDWQK
                     QVATSLNKKDIIQGGVFLQPPKFSIQELGPLEQSSGSIDYVKSWADHAYPQSACGDST
                     TNLEGLQNHTTIVNFVKGFEAEVTAAKSLGERPLFFGETNSATCGGGGISPTYGAALW
                     IVDYVFQSVKLGYERLYFHQGTIGNSPYSWWGKSNVFAPYYGAYFAASALKDVTSISQ
                     IDDGSSHVAVYALHSHDCISKAVVLNTFYYPNTTTTARSSEDITLTGLPNGVKKAKAK
                     RLTAEYSTSQVELGQVPTFGGQTFDNESCHVQGKEQYETVEVNKGRATISVAASEALL
                     IYF"
     gene            803359..808982
                     /locus_tag="CNL06490"
                     /db_xref="GeneID:3254779"
     mRNA            join(803359..803603,803663..804392,804448..804785,
                     804839..805075,805125..805174,805214..805268,
                     805307..805379,805427..805767,805823..806358,
                     806406..806745,806797..806939,806986..807176,
                     807230..807555,807603..807664,807713..807768,
                     807819..808145,808200..808256,808308..808316,
                     808367..808655,808709..808750,808799..808982)
                     /locus_tag="CNL06490"
                     /product="ABC transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533061|gb|CF678902.1,gi|41533065|gb|CF678906.1,
                     gi|41540123|gb|CF685964.1,gi|41540292|gb|CF686133.1,
                     gi|41540301|gb|CF686142.1,gi|41552232|gb|CF698073.1,
                     gi|41558837|gb|CF704678.1,gi|41558841|gb|CF704682.1,
                     gi|41560925|gb|CF706766.1,gi|41560933|gb|CF706774.1,
                     gi|41567408|gb|CF713249.1,gi|41569063|gb|CF714904.1"
                     /transcript_id="XM_568169.1"
                     /db_xref="GI:58261517"
                     /db_xref="GeneID:3254779"
     CDS             join(803451..803603,803663..804392,804448..804785,
                     804839..805075,805125..805174,805214..805268,
                     805307..805379,805427..805767,805823..806358,
                     806406..806745,806797..806939,806986..807176,
                     807230..807555,807603..807664,807713..807768,
                     807819..808145,808200..808256,808308..808316,
                     808367..808655,808709..808750,808799..808835)
                     /locus_tag="CNL06490"
                     /codon_start=1
                     /product="ABC transporter"
                     /protein_id="XP_568169.1"
                     /db_xref="GI:58261518"
                     /db_xref="GeneID:3254779"
                     /translation="MTGVIGDDYSTPPHNNGNTDQLLGSTVTISEKRPQAPSPDDSEW
                     NLASQLRADQELLKSRGLTPCKSLPLAWEHLSVRGVGGLDNIEYGSSMSTILAPWLRR
                     KYRKKAALLAATRSDLPEAEKGDGDVMAWRPGMPTPKKGEPGLRKGERYLLRDFSGVV
                     KSGEMMLVVGRPGSGCSTFLKILAGHRDGYAGVEGIVKYGTLQPDKDFQPYKSEVIFN
                     SEEDLHDPNLLVGHTMDFALQMCTPSRDSRLPEEPAGNGMSRKKYQDRTKWELLKMFG
                     LTHTHDTKVGDQYVRGVSGGEKKRVSIAEVLATKASVQMWDNATRGLDADTALRYAKT
                     LRTLADIQRNTTVVSLYQAGNGIYDLFDKVTVIAEGRVIYYGPRAEARGYFEDLGFVH
                     PDGGNTADFLTAVTATNERKIREGFTGPIPTTPAEFSTLYEKSDIARRMREELEAHLA
                     DPAVDEQTKKFKESVEKQKDRWASKSRPEKADFMTQVRAALIRDYQQRWGDKWTFWMR
                     PATLLFQALIAGSMFYNMPVSTAGLFLRGGTLFLSLFFPSMISLGETTAVFSGRSVLS
                     KHKGFSMYRPSALLLAQTIGDMPLYFVMIVMFTLIIYFMTGLKVDAGLYFIYLLFIYF
                     TTLCTTALFRSIGYAFSTFNNASKASGFALLMLSMYAGYIIYTPQMHPWFSWIRWLNP
                     FYYSLEAIMASEVYGLELECVSPQLAPYGGDYAQYNQGCAITGAEPNSITLDGTLWME
                     SALNFYKSHVWRNFGILIAFWVFFLGFCALMIEMIPAAGSTKSVLLYKPGGGGKYIRN
                     AQKNGASPRDEEDGPNDSQLNEKSQGTSDGTAAEVQAVNSVLTWKNLCYTVNANGQPR
                     QLLNNIFGYCKAGTLTALMGSSGAGKTTLMDVLAARKTDGDIRGEILMNGKQLPISFQ
                     RTTGYCEQVDVHLPQATVREALEFSALLRQPRTLSDKEKLAYVDVIIDLLELHDIEDA
                     LIGTPEAGLGVEQRKRLTIGVELVSKPTLLFLDEPTSGLDGQSSYLIVSFLRKLAAAG
                     QAVLCTIHQPSAALFARFDQLLLLKGGGNTVYFGPVSELTSYFEKQGVTIPKNVNPAE
                     RMIDIVSGDLSKGRDWAQIWLESDECKERARELEELKKAGADNTASVEGDEHEFASTN
                     ITQLKLVTKRASVQLWRDTEYVMNKVALHVLAALFNGFSFWKIGDAYADIQNRIFTIF
                     LFVFVAPGVIAQTQPKFLHNRDIFEAREKKAKLYSWHAFCFAEIVAEIPYLLVCALLY
                     FAPWYPTAGFSFKPGIAGAIYLQMTLYEFLYTGIGQFVAAYAPHEVFAALVNPLLIGI
                     LVIFCGVLVPYDQITAFWRYWMYYLDPFQYLLGGLVSRALWDVEVKCKSDEYAVFNPP
                     EGMTCENYMSAFLSEAPGYLNNPNATSDCEYCVISKGSDYLKALNLEKKVDGWRDIAL
                     TFLFVLTSYGMVFLLLKLRSKRSKMAQ"
     gene            complement(<809553..>811232)
                     /locus_tag="CNL06500"
                     /db_xref="GeneID:3254854"
     mRNA            complement(join(<809553..809699,809753..810536,
                     810571..811001,811053..>811232))
                     /locus_tag="CNL06500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568170.1"
                     /db_xref="GI:58261519"
                     /db_xref="GeneID:3254854"
     CDS             complement(join(809553..809699,809753..810536,
                     810571..811001,811053..811232))
                     /locus_tag="CNL06500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568170.1"
                     /db_xref="GI:58261520"
                     /db_xref="GeneID:3254854"
                     /translation="MSKTTLLRKASLVGYPDNTTYSVLVKDGKVAAIRETGAGDIEKA
                     DETIDMRELDSHWVSPSLIDWHTHTKLNALHNHRLDLQTAKTAQEVLDRVVVAIKDPK
                     YEPKYDTNFCGINLRNAEWPDPEKLTRLSLDNISTERPIFLFFNGYHSICANSLGLKL
                     GGYVPEGHNGYLYEGEAFELSRVIGNVDVEAIDKWIMDEAKYAALIPHSTLGVTEIVD
                     LEWELNIPNWQRRYKKGFRTLRVHVGMYTEHLPYSIERGWKSGDDVPETNGLIKVGPF
                     KIVTDGSLGSQTAFCHEPYPGSTDNYGMLAYKPEALSELIRRGTDNGFKLAIHAIGDH
                     ANQLTLQTLAKAEKKVLPGSTIEHAQLLSFEDLPLFRSLNVIASIQPCHLVDDRDLCH
                     KFWPGREHRAYPFRWLVDAGVPIKLGSDCPVAPLQPWEAIAVAMTRAAEGDEHNPFCK
                     EQIIDLEVAWQASTSNGKPKLEVGDRADLCILSANPLNCDAAGIRAMKVKGTMLGGDW
                     THKAF"
     gene            <812088..>812831
                     /locus_tag="CNL06510"
                     /db_xref="GeneID:3254868"
     mRNA            <812088..>812831
                     /locus_tag="CNL06510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568171.1"
                     /db_xref="GI:58261521"
                     /db_xref="GeneID:3254868"
     CDS             812088..812831
                     /locus_tag="CNL06510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568171.1"
                     /db_xref="GI:58261522"
                     /db_xref="GeneID:3254868"
                     /translation="MHIPAVHAELNLPVLHAFIRQYPLGLFTTSIPHPKNDTLQMSHI
                     PFVLDVDPDQADDKGRLRGHMARVNPQSKSIIDSLSAKGDSTQLVEEDILIVFNASVH
                     SYVTPKFYLETKPTSGKVVPTWDYAAVQVYGRAKIHYANNDATGSFLQKQIQDLSEQE
                     EKTMLKRTGNEGGSTWKVSDAPEKYVEILKKAIIGVEIDIKKIEGRFKLSQEKNGGDW
                     QGVVSGFRSLGTDEGNSMAEMVEENGKKS"
     gene            complement(813315..815755)
                     /locus_tag="CNL06520"
                     /db_xref="GeneID:3254934"
     mRNA            complement(join(813315..813595,813646..814066,
                     814120..814317,814365..814584,814643..815203,
                     815706..815755))
                     /locus_tag="CNL06520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568173.1"
                     /db_xref="GI:58261525"
                     /db_xref="GeneID:3254934"
     mRNA            complement(join(813315..813595,813646..814066,
                     814120..814317,814365..814584,814643..815639,
                     815706..815755))
                     /locus_tag="CNL06520"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530348|gb|CF676189.1,gi|41537175|gb|CF683016.1,
                     gi|41541589|gb|CF687430.1,gi|41542106|gb|CF687947.1,
                     gi|41542916|gb|CF688757.1,gi|41542920|gb|CF688761.1,
                     gi|41550398|gb|CF696239.1,gi|41550410|gb|CF696251.1,
                     gi|41553275|gb|CF699116.1,gi|41553288|gb|CF699129.1,
                     gi|41557308|gb|CF703149.1,gi|41557313|gb|CF703154.1,
                     gi|41560214|gb|CF706055.1,gi|41560221|gb|CF706062.1,
                     gi|41563214|gb|CF709055.1,gi|41563217|gb|CF709058.1,
                     gi|41565648|gb|CF711489.1,gi|41565653|gb|CF711494.1,
                     gi|41568633|gb|CF714474.1,gi|41568642|gb|CF714483.1,
                     gi|41570884|gb|CF716725.1,gi|41570893|gb|CF716734.1,
                     gi|41573931|gb|CF719772.1,gi|41573934|gb|CF719775.1,
                     gi|41575387|gb|CF721228.1"
                     /transcript_id="XM_568172.1"
                     /db_xref="GI:58261523"
                     /db_xref="GeneID:3254934"
     CDS             complement(join(813550..813595,813646..814066,
                     814120..814317,814365..814584,814643..815089))
                     /locus_tag="CNL06520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568172.1"
                     /db_xref="GI:58261524"
                     /db_xref="GeneID:3254934"
                     /translation="MQIGPLVPLLALLAAPALARSSLHPNAAAHRRQDVGQERINSAV
                     ERREALAQSQPRALSEKPNKRKITRRGGRSCRARNSTATASDSATASATASALSEDSS
                     AVYSDAESASSTQAPVENTSSSSENVAATTSSIENIAALQQPSSSSSTEDSSTAASLT
                     SVASAAATSSAAATSSAAATSSSAATSSSSNSTGSYTPNGIKAGVTGDDPLSFLQGHI
                     GWYYDWNATPTGSASGASPANMLWGAGTVDSTDASRLAAFQALTTAPQYIIGFEEPDC
                     STSGSSNIGVSDAASLWDSTIAPWKDQGSILISPSMCHQAAEEYTKWLSTFSTQISTS
                     WDITNLHINKNSMDGVKEDIDYYYNTYGKPIWVTEFACVDDSTDFVPCTDQSEINTFI
                     NDIVALFESDDRVQAYAYSTGEGLSSEWDMVSNGALTESGQTYLTAISQYH"
     gene            <818172..>821902
                     /locus_tag="CNL06530"
                     /db_xref="GeneID:3255001"
     mRNA            join(<818172..818607,818673..819558,819621..819699,
                     819747..819841,819892..820300,820358..820462,
                     820524..820853,820910..820993,821051..821452,
                     821515..821739,821792..>821902)
                     /locus_tag="CNL06530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568174.1"
                     /db_xref="GI:58261527"
                     /db_xref="GeneID:3255001"
     CDS             join(818172..818607,818673..819558,819621..819699,
                     819747..819841,819892..820300,820358..820462,
                     820524..820853,820910..820993,821051..821452,
                     821515..821739,821792..821902)
                     /locus_tag="CNL06530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568174.1"
                     /db_xref="GI:58261528"
                     /db_xref="GeneID:3255001"
                     /translation="MADGLTREDIILQNLGDDRSESGNVEEDERDRALGEEDDGQRGH
                     EGSSEPGENDNQGVGEEVEKEEVKDAQQEHGADGEAAEKSAETSVEEVTPEDNGDAAA
                     DAVPQVKGGDDEEPVEMAKEVDLEDKKETTTGVRKVLKSGVFGDAPKPTPLPKAAAGV
                     ASSARLSRPSLAPVRPGAAATKTTAPSTSKPASGSAATTSAAARKTGASRASAPAISG
                     ANGTIARPTTTTATSSTRPRTTTAASDRTTSSGTARPATTSTTSTIAARARAGMTKPS
                     VPTAASARTAARPTSSTTARPTHPTTTSTLARKPETKPASSTATATRTTRPSVTSTTS
                     TATRAPLASQRTSASAAGTTAARTGVTRPLAGRASMAPTASSSRAATGVPPKVRAGSG
                     PSTLASGGKEVTVLKAKVEELEKNIADEKTKYEEKIAALAQEKVDLEECHGKALEELR
                     AELANATDKAGSDAEGKIAELTALHETQLKEAEEERNRLMMEMVSKLQKMGAEYSSIQ
                     TQLQSARSELTSSENELCSLKSSLQTAQDELSRLRTTASDRDTAFAELESSKASLQTR
                     LDELETIRNSLETKLAEGEGEADKSLADVAGLGDKVKELEDQIVELENKLGSEKGVWK
                     QEEVKWQEIKAALEKEIEDLKNAAEGHAEGLSRASSSAEASKEELGALRIAHEQLTTT
                     YAGLVEASSRHPEDVENLQRQLKEATDKHGALLLEASSSTNDQSAELKAQIEELKKEK
                     EEKEKEVEELKGTLEEVEQEVELLKNARREGEERERQLNKIIAGLEAEIVELKAEFED
                     RYTAGYEDAKRAAGEEHHKELASIRSEISVTHSRLQDAHTAELESLKASQSTTLATLN
                     ADHSSQTSALGLSLQAANAQVEQDQAKLESVSEERDALAEQVERLKAELEGASARGDE
                     VDPEVEAELKKVKAELQHVSDELAGALEMSEMNKAHFEQTLSTMQEQQADEVRAAVEG
                     REKQYAQEKAQYTSEAGELRAEMEKLKIELNDEKAEKESVLARLAEKLGAPSTPPRAE
                     IVSSPSFARLHEAHNAKVTELER"
     STS             822384..822635
                     /standard_name="Pvu10"
                     /db_xref="UniSTS:470737"
     gene            complement(<822393..>823912)
                     /locus_tag="CNL06540"
                     /db_xref="GeneID:3254995"
     mRNA            complement(join(<822393..822774,822826..823216,
                     823615..>823912))
                     /locus_tag="CNL06540"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_568175.1"
                     /db_xref="GI:58261529"
                     /db_xref="GeneID:3254995"
     CDS             complement(join(822393..822774,822826..823216,
                     823615..823912))
                     /locus_tag="CNL06540"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_568175.1"
                     /db_xref="GI:58261530"
                     /db_xref="GeneID:3254995"
                     /translation="MPPLQTYSERPVVLLTVRPPSPPPSSWPCVPPPADIPQNDDGPP
                     CDSSPNIFSFAKTLQARLGWDVRVVIPDSQKSWCVAPPLPRAWTPDSPPRTGSARHGR
                     NSSTAFALSSGTIGAALAATLSVPLPGPAPLASLHTEHVPCIALSYAVVSRPVPPRLL
                     ALAAETSVDVCKRLFDNWGHDSVPGKGGKVQIYSVNVPLVEEYLEKGNRKAVYTELWK
                     NAYGRLFKPTALDTTHFDPGDDPDQGKKDITENQPNRPQALPVPAHTETSKGTPGPAA
                     LPTPSPTPTPVNAADPAHNPQQQQQLKFRFAPNLQPVLFPREDTLPEGTDAWALASGY
                     VSVTPLRAEYNCIPVGQFGSEL"
     misc_feature    823022..823165
                     /note="G-rich"
     gene            complement(<824093..>825090)
                     /locus_tag="CNL06550"
                     /db_xref="GeneID:3254993"
     mRNA            complement(join(<824093..824601,824677..824788,
                     824902..>825090))
                     /locus_tag="CNL06550"
                     /product="orotidine-5'-phosphate decarboxylase, putative"
                     /transcript_id="XM_568176.1"
                     /db_xref="GI:58261531"
                     /db_xref="GeneID:3254993"
     CDS             complement(join(824093..824601,824677..824788,
                     824902..825090))
                     /locus_tag="CNL06550"
                     /codon_start=1
                     /product="orotidine-5'-phosphate decarboxylase"
                     /protein_id="XP_568176.1"
                     /db_xref="GI:58261532"
                     /db_xref="GeneID:3254993"
                     /translation="MPHPTTLKTYASRIPLHTNPTARRILSIMDRKRTNLCVSVDVTK
                     AAEVLEVVRRVGASVCMVKTHCDIIEDFTLEFADELVKLSKQLDFVIFEDRKFADIGN
                     TVSLQYSSGTHKIASWSDLTNAHSVPGPGIITGLASIGLPLGRALLLLANMSSKGALA
                     TGEYTKQTMRMAREAGREFVVGFIAQERVDAGEDGDWLIMSPGVGLAAKGDKLGQQYR
                     TPKEVVRDAGADVIIVGRGIYGVQGGEEAVKAEAERYREEGWKAYEERLSR"
     STS             826583..827176
                     /standard_name="Pvu9"
                     /db_xref="UniSTS:470738"
     gene            complement(829079..830720)
                     /locus_tag="CNL06560"
                     /db_xref="GeneID:3254981"
     mRNA            complement(join(829079..829465,829520..829758,
                     829812..829918,829994..830153,830207..830310,
                     830374..830720))
                     /locus_tag="CNL06560"
                     /product="t-SNARE, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533943|gb|CF679784.1,gi|41533960|gb|CF679801.1,
                     gi|41540641|gb|CF686482.1,gi|41540652|gb|CF686493.1,
                     gi|41570288|gb|CF716129.1,gi|41570294|gb|CF716135.1,
                     gi|41572073|gb|CF717914.1,gi|41572081|gb|CF717922.1"
                     /transcript_id="XM_568177.1"
                     /db_xref="GI:58261533"
                     /db_xref="GeneID:3254981"
     CDS             complement(join(829132..829465,829520..829758,
                     829812..829918,829994..830153,830207..830310,
                     830374..830659))
                     /locus_tag="CNL06560"
                     /codon_start=1
                     /product="t-SNARE"
                     /protein_id="XP_568177.1"
                     /db_xref="GI:58261534"
                     /db_xref="GeneID:3254981"
                     /translation="MSNYNPLSPADEPITRSRTLFFLSIRDSNPFSRARPSREYGHQI
                     SLDDDGDGEGEGERLIGGREGWKEVGMKGLPPKWVDLSEEVEEILGRTRNKIAVLDKL
                     HAKHVLPGFTDRSGEEREIEKQTIDITRDFRRCTSLISSITPERGAPRVQVLTTKNVQ
                     RGLAQKVQEMSGQFRKKQKVYMSKLQGHQIKNKDLMVASGAITLKGTEVLDELQEDEQ
                     ASQNQLSQTQQAQSAVNIDIQRRSREITQIASSISELAELFRDLGQMVVEQGTVLDSV
                     EWNVMEAAKEVKGGEEELVVARRYQANTARRKCIFFLLLCIFALILILIYKPRSHSSP
                     SSPASSSSLLSSNSTATSSSWGKSTARVRPSHAKGSGKGGIVLPSSTGSTGKGKGRPS
                     LPRPPPLASTTGRHGSS"
     repeat_region   830496..830522
                     /rpt_type=tandem
                     /rpt_unit_seq="caccat"
                     /satellite="microsatellite"
     gene            <830868..832773
                     /locus_tag="CNL06570"
                     /db_xref="GeneID:3254967"
     mRNA            join(<830868..830997,831043..831154,831200..831282,
                     831337..831369,831416..831543,831589..831719,
                     831772..832206,832253..832773)
                     /locus_tag="CNL06570"
                     /product="ubiquitin fusion-degradation 1-like protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542563|gb|CF688404.1,gi|41542573|gb|CF688414.1,
                     gi|41552020|gb|CF697861.1,gi|41552030|gb|CF697871.1,
                     gi|41552828|gb|CF698669.1,gi|41552841|gb|CF698682.1,
                     gi|41556118|gb|CF701959.1,gi|41556123|gb|CF701964.1,
                     gi|41561148|gb|CF706989.1,gi|41561168|gb|CF707009.1,
                     gi|41561181|gb|CF707022.1"
                     /transcript_id="XM_568178.1"
                     /db_xref="GI:58261535"
                     /db_xref="GeneID:3254967"
     CDS             join(830868..830997,831043..831154,831200..831282,
                     831337..831369,831416..831543,831589..831719,
                     831772..832206,832253..832751)
                     /locus_tag="CNL06570"
                     /codon_start=1
                     /product="ubiquitin fusion-degradation 1-like protein"
                     /protein_id="XP_568178.1"
                     /db_xref="GI:58261536"
                     /db_xref="GeneID:3254967"
                     /translation="MSNACLSSSLSAISDCYAFVFDFNLRLNFDLNFTRMNHGYDSED
                     EFDHYAAPPPLPGGPAGILSHLMGGGFGGFHSAPPPSAYDDYFKAYSTAVMGGRERPE
                     VMYGGKIIMPPSALARLSALDIPSPWTFQLRNPRSPTQHITHAGVLEFIAEEGIVHLP
                     AWMMKRLNLEEGDPIRLTGAKLPKGKMVKIQAQNTDFLQVSDPKSVLESALRFYSTLS
                     PDDIIEITYNSLTFEFLIMSVVPEGPGISVIDTDLEVDFATPKGYVEPPRPEPKPIPT
                     MADKLNIDLSSNEPTGSGAGSVSGGSRPGTSMGTQTPVESFTGVGQSLSGKKVKGKGL
                     AKKIEEVDPSSKINRADGPRIINSSSLSSTNTQVPSALILPEGKFFFGFKYIPYDPSK
                     APKPSLADQQKVELQPFGGEGNTLKGGKRIGGEEGKGKEKAAEDEKEDPWAKLGSGNT
                     LKRTTTTAASSSSTPAPVSAPLEEFKARKATEQEIIDATMLDEDDFMFEDEEDDEDDV
                     IEIDSDYD"
     gene            <833037..>834267
                     /locus_tag="CNL06580"
                     /db_xref="GeneID:3254953"
     mRNA            join(<833037..833338,833392..833559,833614..834106,
                     834256..>834267)
                     /locus_tag="CNL06580"
                     /product="hypothetical protein"
                     /transcript_id="XM_568179.1"
                     /db_xref="GI:58261537"
                     /db_xref="GeneID:3254953"
     CDS             join(833037..833338,833392..833559,833614..834106,
                     834256..834267)
                     /locus_tag="CNL06580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568179.1"
                     /db_xref="GI:58261538"
                     /db_xref="GeneID:3254953"
                     /translation="MSNDWWSQTPSRYTSTPIHPTLSRSQSISQSTRTRFAGDELDPE
                     DSRAADAVKFLPSFASSQAGRVALGTSPTGGMSMSVGSPQGERRSPQGRLSGSVHESN
                     SPRHTTRARSLAQSAALSSSTANGPAPMDEDMPPTASLRDSVTESRVTTVVASNELPT
                     PPSLLPTKSTTTLYIFGPPPNILSTLQPYLSQFGPIASYRPGPEGSNWYTVEYTTPLG
                     AAYALRRHGEILGGQWMIGFKVGIGGAMEGIGSIPGEGDVQGSSSQVPPPTVGTPIRV
                     QHKEILRPKVVQPVVAKAAVKSGNEYAWDEPEGSGGWTGWVSERLFGR"
     gene            complement(834445..836848)
                     /locus_tag="CNL06590"
                     /db_xref="GeneID:3254952"
     mRNA            complement(join(834445..834763,834824..835198,
                     835260..835537,835606..835655,835709..835791,
                     835858..836130,836215..836848))
                     /locus_tag="CNL06590"
                     /product="hypothetical protein"
                     /transcript_id="XM_568180.1"
                     /db_xref="GI:58261539"
                     /db_xref="GeneID:3254952"
     mRNA            complement(join(834445..835198,835260..835537,
                     835606..835655,835709..835791,835858..836130,
                     836215..836848))
                     /locus_tag="CNL06590"
                     /product="hypothetical protein"
                     /transcript_id="XM_568182.1"
                     /db_xref="GI:58261543"
                     /db_xref="GeneID:3254952"
     mRNA            complement(join(834476..834763,834824..835198,
                     835260..835537,835606..835655,835709..835791,
                     835858..836848))
                     /locus_tag="CNL06590"
                     /product="hypothetical protein"
                     /transcript_id="XM_568181.1"
                     /db_xref="GI:58261541"
                     /db_xref="GeneID:3254952"
     CDS             complement(join(834504..834763,834824..835198,
                     835260..835537,835606..835655,835709..835791,
                     835858..836130,836215..836380))
                     /locus_tag="CNL06590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568180.1"
                     /db_xref="GI:58261540"
                     /db_xref="GeneID:3254952"
                     /translation="MSYKEDKDLEEEGGDAPQAITTLIEEVYINKYTFTEEESRSLVR
                     KLDWHILPYIWWCYIFNSLDRSNVSNAKSDGMPTDLNFPDEGYAIMLSVFYVPFCLLV
                     VPSVMLTRKIGPKWTIPGYMIGWGGMAMVNAGCKNFAGVLAVRLLLGAFEAGFAASLI
                     FYLTTFYTRSELGKRIAVFYSCNALSGAFSGLIAYGVFQMDSKLWGWQILFLIEGAFT
                     VAFAILTAFMLPWSLDEARFLDEREREVGRLRVLKDGSSKTGTKFNVREFFKPLKDPR
                     FYAFASIAICYGCAASMAGNFLTQIIGRFNYSTVKTNLFTVAPYVVGTICLLLTSWSS
                     DRFRERGFHLASSFVLVLIGCIILIAIPVSQVGAGYFATFLITAGAFTPPVLFHTWHQ
                     CNDASEDGRAFRVGSYTFLANTGGIVSANIFLDKWAPAYREPLAITVGIEALALGLVI
                     ALRMWMYLDNKKRNKAQGVNWQSKDVPTEALADGLKNPVFRHFY"
     CDS             complement(join(834504..834763,834824..835198,
                     835260..835537,835606..835655,835709..835791,
                     835858..836071))
                     /locus_tag="CNL06590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568181.1"
                     /db_xref="GI:58261542"
                     /db_xref="GeneID:3254952"
                     /translation="MPTDLNFPDEGYAIMLSVFYVPFCLLVVPSVMLTRKIGPKWTIP
                     GYMIGWGGMAMVNAGCKNFAGVLAVRLLLGAFEAGFAASLIFYLTTFYTRSELGKRIA
                     VFYSCNALSGAFSGLIAYGVFQMDSKLWGWQILFLIEGAFTVAFAILTAFMLPWSLDE
                     ARFLDEREREVGRLRVLKDGSSKTGTKFNVREFFKPLKDPRFYAFASIAICYGCAASM
                     AGNFLTQIIGRFNYSTVKTNLFTVAPYVVGTICLLLTSWSSDRFRERGFHLASSFVLV
                     LIGCIILIAIPVSQVGAGYFATFLITAGAFTPPVLFHTWHQCNDASEDGRAFRVGSYT
                     FLANTGGIVSANIFLDKWAPAYREPLAITVGIEALALGLVIALRMWMYLDNKKRNKAQ
                     GVNWQSKDVPTEALADGLKNPVFRHFY"
     CDS             complement(join(834765..835198,835260..835537,
                     835606..835655,835709..835791,835858..836130,
                     836215..836380))
                     /locus_tag="CNL06590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568182.1"
                     /db_xref="GI:58261544"
                     /db_xref="GeneID:3254952"
                     /translation="MSYKEDKDLEEEGGDAPQAITTLIEEVYINKYTFTEEESRSLVR
                     KLDWHILPYIWWCYIFNSLDRSNVSNAKSDGMPTDLNFPDEGYAIMLSVFYVPFCLLV
                     VPSVMLTRKIGPKWTIPGYMIGWGGMAMVNAGCKNFAGVLAVRLLLGAFEAGFAASLI
                     FYLTTFYTRSELGKRIAVFYSCNALSGAFSGLIAYGVFQMDSKLWGWQILFLIEGAFT
                     VAFAILTAFMLPWSLDEARFLDEREREVGRLRVLKDGSSKTGTKFNVREFFKPLKDPR
                     FYAFASIAICYGCAASMAGNFLTQIIGRFNYSTVKTNLFTVAPYVVGTICLLLTSWSS
                     DRFRERGFHLASSFVLVLIGCIILIAIPVSQVGAGYFATFLITAGAFTPPVLFHTWHQ
                     CNDASEDGRAFRVGSYSKSSFPPLPCGQPADLYGC"
     gene            <837065..838603
                     /locus_tag="CNL06600"
                     /db_xref="GeneID:3255038"
     mRNA            join(<837065..837487,837548..837640,837727..837859,
                     837934..838068,838151..838210,838307..838603)
                     /locus_tag="CNL06600"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41556792|gb|CF702633.1"
                     /transcript_id="XM_568183.1"
                     /db_xref="GI:58261545"
                     /db_xref="GeneID:3255038"
     CDS             join(837065..837487,837548..837640,837727..837859,
                     837934..838068,838151..838210,838307..838551)
                     /locus_tag="CNL06600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568183.1"
                     /db_xref="GI:58261546"
                     /db_xref="GeneID:3255038"
                     /translation="MPLPYTVASTVPLPPAAVAKLRNAFAAFIHRTDPASPFTRDELS
                     RIQVFFTTGRGPPVDSLAHVPNLQLVQLCSAGADKAIASPAMKAYVDGRKAASGKADS
                     KAVRLATASGTHVLSIPNYAVAMAIALLHQLPRQIVGARTEQRWLSEEECDMDGQAYY
                     ARKTFHRTAGLLGYGSLGRETARLLKAHGMRIIAANTSGKATLQDGYVIPGTGDKDGS
                     IPEAFYSTKDPKSVKEFLNQCDVLVASLPNTPATQYFLNKEKLEMLPKGAVLVNVGRG
                     SLIPSDDLLAVLNTPHLFGAALDVTDPEPLPAQHPLWSHPKCIITPHLSGNTQGEMEI
                     AADVLLFNVQRMKDGKEVVNEVRWDRGY"
     gene            complement(<838804..>842926)
                     /locus_tag="CNL06610"
                     /db_xref="GeneID:3255020"
     mRNA            complement(join(<838804..838971,839043..839138,
                     839212..839730,839790..840109,840172..841665,
                     841712..841893,841944..842396,842448..>842926))
                     /locus_tag="CNL06610"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541110|gb|CF686951.1,gi|41550369|gb|CF696210.1"
                     /transcript_id="XM_568184.1"
                     /db_xref="GI:58261547"
                     /db_xref="GeneID:3255020"
     CDS             complement(join(838804..838971,839043..839138,
                     839212..839730,839790..840109,840172..841665,
                     841712..841893,841944..842396,842448..842926))
                     /locus_tag="CNL06610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568184.1"
                     /db_xref="GI:58261548"
                     /db_xref="GeneID:3255020"
                     /translation="MLNAATSPPPNKSAATASSPREPEPTPPPPSLQSVSLNDLFKGI
                     QLQTSSPSVSANGSAAGVALEKASNASVAGPTIGLGHIGQHTPGTRSASQASVGSAPV
                     SSPPPPSGPAQDQRAKLLGMLSFGGSGAGTPVNVTTSGFPTPLSGHVQPESQASAPFG
                     GIKSPVIDHSNPPQPNITPAQDPAIASPPIVESNATQTPEPAQPQGQGEQPRPKSAVP
                     NFSFVSPFDAFDDPTPVAVSPAKEKKPEPEVVKHEEKIQATAPAPKEVKGKKDKVKSP
                     APSKAPELPVAAQEASLKEEPVADNALPQNQQGSGPKTTQSHITIDLSEPNLDSLIST
                     PDLLYIQPTTLLKVDVGYKKGRKVGLTRQFVAYTMSKGKIRLIDSRSGARLMLQTTTS
                     TPGPIIDIAVCPVYVAALAADRSLWIWRVPAGWREDNPPVDLTLISHTTGSAIGKAFK
                     VGWLKKNGADWVIVAGDEGVTMFDPTREGRGVKKAEETFAGKTIFRTMGNVVDFCVNN
                     TQSAMGILSSDSTFSLYSTQSLNRVWQRSIPSSSPHSPPSSAHFIESNVLIGREQNTH
                     FDLVQITVSLAVLSSIHFVAPPGLDASSHYAHAMYDPFSGLLFITPFARSSLYAFRYA
                     LKDTEPVRDAGSPNSPQVVAFDRMAEFPLTQQGSSGTGVVTIGMIAHLGRDPGPGREE
                     GDLEWFYGTAEGFASASMGKQATGLVKGGVVASAVASSAAAATSVEPKKEKEAEKEIQ
                     QPEKKERKKSAQSTPTSKTLPLPQNLPVPQPLPSIGSRTNSTSGSLVEEAGGAAAAAA
                     STGMNSRKLKKEKRKEERALARAQAAAEAESKIEAAWGAETLSAVPEAKSERAEAKSE
                     RGAAANEEALKQASRLSTQFQDLLTASISPLSAQLATIASPSFSSNIAARVERSLQPQ
                     IMSSISIELQKNLKGLMPQMVGEISNEVQREVKSCLDKVPKDLEKGLGPVVSRTVAGV
                     VQTSVEKMIQQAIRSHLLPTLTQSTSSLTDTLLTELKSEMLQIRKELTPLPPPVVPET
                     KRNVGEDELLNKLQEMSQQMEALQTAVKDIQGRNLNGINHAQSVSNLSTTQGPLPPPI
                     QNTRLPTPAQLEDTFLAALTAQTVPSTLQLVDDHLGLTDYCLPVSGKSPLSQAVLLTL
                     LHRTSIAIADIPAQHPVFPHLVTWIRRTINLLDPSDPNIKEYIVRLYPVVQTHLSNVI
                     ASVQASGNPHVQAQFLPVLKEIGDVLAAKVNV"
     gene            complement(843183..844803)
                     /locus_tag="CNL06620"
                     /db_xref="GeneID:3255023"
     mRNA            complement(join(843183..843581,843644..844016,
                     844084..844237,844546..844803))
                     /locus_tag="CNL06620"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41563163|gb|CF709004.1"
                     /transcript_id="XM_568185.1"
                     /db_xref="GI:58261549"
                     /db_xref="GeneID:3255023"
     CDS             complement(join(843576..843581,843644..844016,
                     844084..844237,844546..844609))
                     /locus_tag="CNL06620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568185.1"
                     /db_xref="GI:58261550"
                     /db_xref="GeneID:3255023"
                     /translation="MVSPAFPGLFFAFAAAVLLLFASISPPAWDQVGFLTTTAGTTKT
                     VFGVFGECVKGGSCSSKSVGYDLVINGATDVNINQTVLHNLTYAMILHPIAGFLALLA
                     LVFGLLGACAASRVATIFMALCSALGLIITLVVFVIDMVLWNVVKNHARDGGVQATLG
                     NANWFTVAALASLFLSMCTSVCGACGRFANGRMAGEKY"
     gene            complement(845976..847767)
                     /locus_tag="CNL06630"
                     /db_xref="GeneID:3255024"
     mRNA            complement(join(845976..846672,846737..846812,
                     846973..847171,847232..847335,847404..847469,
                     847543..847767))
                     /locus_tag="CNL06630"
                     /product="put. CPS1 protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536876|gb|CF682717.1,gi|41536883|gb|CF682724.1,
                     gi|41551575|gb|CF697416.1,gi|41551581|gb|CF697422.1"
                     /transcript_id="XM_568186.1"
                     /db_xref="GI:58261551"
                     /db_xref="GeneID:3255024"
     CDS             complement(join(846597..846672,846737..846812,
                     846973..847171,847232..847335,847404..847469,
                     847543..847570))
                     /locus_tag="CNL06630"
                     /codon_start=1
                     /product="put. CPS1 protein"
                     /protein_id="XP_568186.1"
                     /db_xref="GI:58261552"
                     /db_xref="GeneID:3255024"
                     /translation="MGGQLSKALGKLFGNKEMRILMLGLDAAGKTTILYKLKLNQSVT
                     TIPTVGFNVETVTYRNVRFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSGDRDRIDE
                     ARLELERILADREMRECLLMVFANKQDLPGAMSPAEVTEKLGLHRMKDRSWYVHPSCA
                     TTGEGLFEGLQWLSSNVKNLKV"
     gene            848237..>849683
                     /locus_tag="CNL06640"
                     /db_xref="GeneID:3255027"
     mRNA            join(848237..848317,848372..848424,848472..848708,
                     848763..848908,848964..849319,849378..>849683)
                     /locus_tag="CNL06640"
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532246|gb|CF678087.1,gi|41550216|gb|CF696057.1"
                     /transcript_id="XM_568187.1"
                     /db_xref="GI:58261553"
                     /db_xref="GeneID:3255027"
     CDS             join(848285..848317,848372..848424,848472..848708,
                     848763..848908,848964..849319,849378..849683)
                     /locus_tag="CNL06640"
                     /codon_start=1
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
                     /protein_id="XP_568187.1"
                     /db_xref="GI:58261554"
                     /db_xref="GeneID:3255027"
                     /translation="MPSPTRVSIRDAMELLDDRRVKIVRPLIPPQILHEELPLSLRGA
                     QTVLDGRRQVEAVIKGDDDRLLVVVGPCSVHDPEQAITYAKALKEYADKAAEDLVIVM
                     RVYFEKPRTTVGWKGLINDPDMNGSYQINRGLKIARKLLLDITEIGLPAAGEFLDVIS
                     PQYLADLFAWGAIGARTTESQVHRELASALSMSVGFKNGTDGSIGIAIDAIKAAGSGH
                     TFLSVTKQGLSAIVETEGNSSTHVILRGSSKGPNYGADDVAACAEKLNKSGLPAKLMI
                     DCSHGNSSKQHLNQIKVGADIASQLSSGPTSNAIVGVMIESNIFEGRQNVPAEGPSGL
                     KYGISVTDACISMEQTIPLLDELRKGVQARREAVKAKREGQQ"
     gene            complement(850046..850911)
                     /locus_tag="CNL06650"
                     /db_xref="GeneID:3255031"
     mRNA            complement(join(850046..850384,850449..850522,
                     850601..850651,850711..850749,850851..850911))
                     /locus_tag="CNL06650"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_568188.1"
                     /db_xref="GI:58261555"
                     /db_xref="GeneID:3255031"
     CDS             complement(join(850102..850384,850449..850522,
                     850601..850651,850711..850749,850851..850895))
                     /locus_tag="CNL06650"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein"
                     /protein_id="XP_568188.1"
                     /db_xref="GI:58261556"
                     /db_xref="GeneID:3255031"
                     /translation="MEYIGKATEVVKHFRETKLSTLKPPQEFFDHRQLSRPKNMNEAT
                     SRVTYNTRHYSGNYLIVIAILAVYALITNPLLLIALAFLAGGFAAINKFAPEPMQVGD
                     HIITQKSLYTALFVIGLPLLWIASPVSTFFWLVGSSAILILGHAVLMEPGVESEYAGI
                     EQV"
     gene            <851662..>853329
                     /locus_tag="CNL06660"
                     /db_xref="GeneID:3255011"
     mRNA            join(<851662..852383,852443..852872,852925..853016,
                     853095..>853329)
                     /locus_tag="CNL06660"
                     /product="hypothetical protein"
                     /transcript_id="XM_568240.1"
                     /db_xref="GI:58261659"
                     /db_xref="GeneID:3255011"
     CDS             join(851662..852383,852443..852872,852925..853016,
                     853095..853329)
                     /locus_tag="CNL06660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568240.1"
                     /db_xref="GI:58261660"
                     /db_xref="GeneID:3255011"
                     /translation="MANYQPLATSPTVADVVESQQHKHPVRRRWHLRTRPLLLFGLLG
                     TCSLLGILYALFFRPSSYETIIIKAADNPYFQTGEVWTHNDQVAARLERCATLGLLRN
                     TSLPLTSHERLSDEEESELVAQGCGTNETTVIILSSIYFAEAFSGASVTGETVYAQSV
                     ISTLNAYNYSYMFSSLGWWNPDMRKTVELWHKHRWNVRMVLADPEQVDVCWKLTDQKC
                     LKTENNLEGIEAWRLLAFWYWDDPGTPLGPQFTLSPSPRNSNHFLSYSIEPTCHRLPY
                     LPPSQRSDPPQAYLLAKQMHYLDDTPAFSWTLPALMGLQEEFGIQVVAGLRDDDPVTA
                     KAVEDIGLKNLGKLGVIEFYAQLSKSFVLLGVGRPRISPSPWDALCMGVPFINPILTW
                     DETDPLNRTKWHAQQWHMTDLDPPYVYSVPTHNLTALRLAVQAALLNPIESFIPPYMK
                     WEFVLEKMVEMVEGDWREKAKRLLEERVRNGGQVSFIFRLES"
     gene            complement(853694..856069)
                     /locus_tag="CNL06670"
                     /db_xref="GeneID:3255025"
     mRNA            complement(join(853694..853866,853944..854008,
                     854078..854159,854223..854316,854375..854398,
                     854451..854482,854532..854661,854712..854785,
                     854835..854881,854932..854944,854993..855095,
                     855148..855344,855393..855665,855711..855755,
                     855812..855827,855880..855923,855976..855984,
                     856036..856069))
                     /locus_tag="CNL06670"
                     /product="Tubulin beta chain, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530679|gb|CF676520.1,gi|41530691|gb|CF676532.1,
                     gi|41531433|gb|CF677274.1,gi|41536132|gb|CF681973.1,
                     gi|41536141|gb|CF681982.1,gi|41538343|gb|CF684184.1,
                     gi|41541063|gb|CF686904.1,gi|41542795|gb|CF688636.1,
                     gi|41542802|gb|CF688643.1,gi|41542831|gb|CF688672.1,
                     gi|41544050|gb|CF689891.1,gi|41544055|gb|CF689896.1,
                     gi|41548598|gb|CF694439.1,gi|41548608|gb|CF694449.1,
                     gi|41553480|gb|CF699321.1,gi|41553488|gb|CF699329.1,
                     gi|41558486|gb|CF704327.1,gi|41558495|gb|CF704336.1,
                     gi|41558986|gb|CF704827.1,gi|41560443|gb|CF706284.1,
                     gi|41560453|gb|CF706294.1,gi|41563238|gb|CF709079.1,
                     gi|41563246|gb|CF709087.1,gi|41563675|gb|CF709516.1,
                     gi|41563682|gb|CF709523.1,gi|41567017|gb|CF712858.1,
                     gi|41567196|gb|CF713037.1,gi|41568584|gb|CF714425.1,
                     gi|41568592|gb|CF714433.1,gi|41569268|gb|CF715109.1,
                     gi|41569701|gb|CF715542.1,gi|41571134|gb|CF716975.1,
                     gi|41571137|gb|CF716978.1,gi|41573266|gb|CF719107.1,
                     gi|41573281|gb|CF719122.1"
                     /transcript_id="XM_568244.1"
                     /db_xref="GI:58261667"
                     /db_xref="GeneID:3255025"
     CDS             complement(join(853784..853866,853944..854008,
                     854078..854159,854223..854316,854375..854398,
                     854451..854482,854532..854661,854712..854785,
                     854835..854881,854932..854944,854993..855095,
                     855148..855344,855393..855665,855711..855755,
                     855812..855827,855880..855923,855976..855984,
                     856036..856063))
                     /locus_tag="CNL06670"
                     /codon_start=1
                     /product="Tubulin beta chain"
                     /protein_id="XP_568244.1"
                     /db_xref="GI:58261668"
                     /db_xref="GeneID:3255025"
                     /translation="MGREIINVSVGQAGNQIGTAFWENILQEHGLDRSGKATTDDPHI
                     LDKVDVYFTEASNKKYVPRSIQVDLEPGVVDLVRSGPLANLFRPDTFVHGESGAGNNW
                     AKGYYTEGAELVDPVLDVLRQQAENSDSLQGFQLLHSLGGGTGSGLGALLLGKIREEY
                     PDRMLATFSIFPSPKVSETVVEPYNAVLSTHNLVENSDITCCIDNEALYNICVSDLKI
                     QSPEYKDLNSLIAKVMTGFTTTLRFPGVLNSDLRKLAVNMVPFPRLHFFTAGYAPLVA
                     NASKSYTASNVHELTAAIFQKRSLLAAIDPLFGKYLTVSVAYRGKLSMRDIENAVWDF
                     HNKNSEHFVPWIPNSSLTTLCTVPPLGQTAAATLVANTTAISEVFKRSHTQFRSLFRR
                     RAFTHWYTGEGMDEQEFTEAEANLSDLCIEYDQYASADLEEEEYELEGEEHVEEGENY
                     EE"
     STS             855667..856487
                     /standard_name="Hind14"
                     /db_xref="UniSTS:470739"
     gene            complement(856353..858936)
                     /locus_tag="CNL06680"
                     /db_xref="GeneID:3255021"
     mRNA            complement(join(856353..856714,856765..856797,
                     856854..857228,857295..857622,857680..857762,
                     857812..858084,858151..858936))
                     /locus_tag="CNL06680"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544246|gb|CF690087.1,gi|41544250|gb|CF690091.1,
                     gi|41544916|gb|CF690757.1,gi|41544919|gb|CF690760.1,
                     gi|41561804|gb|CF707645.1,gi|41562143|gb|CF707984.1,
                     gi|41562156|gb|CF707997.1"
                     /transcript_id="XM_568243.1"
                     /db_xref="GI:58261665"
                     /db_xref="GeneID:3255021"
     CDS             complement(join(856488..856714,856765..856797,
                     856854..857228,857295..857622,857680..857762,
                     857812..858084,858151..858379))
                     /locus_tag="CNL06680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568243.1"
                     /db_xref="GI:58261666"
                     /db_xref="GeneID:3255021"
                     /translation="MQSITVVLSLWSSIIFTTMSKLESRPSLEKVIDDEAARDSFTKV
                     EEVAEVSDYSFTKEENRSIVRKFDWHILPFVWACYLFNSLDRNNVSNAKSDGMTTDLN
                     FPDEGYSIMLTVFTVPFACLVVPGVMLTRKIGPRFTIPGYMLGWGAMAMINAGCKNFA
                     GVLIVRLILGAFEAGFAASLIFYLTTFYTRGELGKRIAAFYSCQALSGAFSGLIAYGV
                     FQMDSKLWGWQILFLIEGAFTVAFAILTGLMLPWSPSTASFLTDREKEVARLRILRDG
                     STAIDTKFNRKAFFKPLKDWKFYVFASIALCYGVAASVAGSFLTQIIGRFHYSTVKTN
                     LFTVAPYAVGTIALCATAWSSDRFRERGFHLASSLILVFIGCILLVALPVTSVGPAYF
                     ATFLITAGAFTPSVIFHTWHQCNDPTEDGRAFRVGTYTFLANLGGIVSAQIFLDKWSP
                     AYIIPLSVTAGIEGLAAILVIGLRMWMYLDNRKRNQAQGVNWQSKDVPTEILVEGPKN
                     PLFRHFY"
     gene            859153..>861298
                     /locus_tag="CNL06690"
                     /db_xref="GeneID:3255033"
     mRNA            join(859153..859312,859369..859525,859584..859824,
                     859886..860213,860284..860396,860456..860570,
                     860639..860687,860755..861019,861092..>861298)
                     /locus_tag="CNL06690"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531990|gb|CF677831.1,gi|41532000|gb|CF677841.1,
                     gi|41548910|gb|CF694751.1,gi|41559064|gb|CF704905.1,
                     gi|41559075|gb|CF704916.1,gi|41567244|gb|CF713085.1"
                     /transcript_id="XM_568189.1"
                     /db_xref="GI:58261557"
                     /db_xref="GeneID:3255033"
     CDS             join(859273..859312,859369..859525,859584..859824,
                     859886..860213,860284..860396,860456..860570,
                     860639..860687,860755..861019,861092..861298)
                     /locus_tag="CNL06690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568189.1"
                     /db_xref="GI:58261558"
                     /db_xref="GeneID:3255033"
                     /translation="MTTIDSKIAIVGAGVFGLSTSLHLKKNGYKDVTVYDYQPYDVNA
                     YDPSKGCDGASADVNKVYRCSYGDETEYQDLAFSGRAIWLEWNKQISETPADQLPPGL
                     TPDDQPFVPCGFLRISNEEKLSEYDQMCLDELEKAGLRHHQHVIKDTGDMDRLVEKEA
                     ADPSTNYATKAASLKNLEGGRLTGFFDTSAGFTVADKACAWARYLAEKDGVKFLLGPE
                     TGKFDELLVRSEGEDQKVVGLKTVDGLEHEADVVIVACGGWTPSVVPEVEGLLETTAG
                     SVCTIQLPTDRHDLWEKFSPERFPVWAYGLTGHSSPEYGGFYGFPRTKDGKIKVGYRG
                     RKWTNYQKHPKTGKELSMPKTKYTADKAENLPKKAIENVKKAVGEIFPELKSIGITDT
                     RMCWYTDSIDNSFVIDYVPGYSDSLFVASGGSGHGFKFLPVLGKHVVNALEKKPDQFT
                     PLWHWRSAAPGEHANGLEEGKGSGRDLASLEIADKVDWKWEDGLGEIAEKIEKL"
     gene            complement(861483..862963)
                     /locus_tag="CNL06700"
                     /db_xref="GeneID:3255037"
     mRNA            complement(join(861483..861725,861778..861889,
                     861940..862089,862152..862963))
                     /locus_tag="CNL06700"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41559391|gb|CF705232.1,gi|41559396|gb|CF705237.1,
                     gi|41569607|gb|CF715448.1,gi|41569616|gb|CF715457.1"
                     /transcript_id="XM_568190.1"
                     /db_xref="GI:58261559"
                     /db_xref="GeneID:3255037"
     CDS             complement(join(861514..861725,861778..861889,
                     861940..862089,862152..862403))
                     /locus_tag="CNL06700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568190.1"
                     /db_xref="GI:58261560"
                     /db_xref="GeneID:3255037"
                     /translation="MTTTRTPKLGVLQLKTTFPRPPGDVGHPASWGDIPVVIRVVEEA
                     VSTLVVGGTWGKDLVDAFVREGTKMIEEDGCVAFVTSCGFLATMHPCLANRLPFMGTT
                     SLLQVAWLQQSFFPGLNSKDSVGVVTFKKSALTVKHLTSVGAHPETPVYGLPEDPKTA
                     IFRGVLDERIPYDYEGMEKEVVDAALVLVKNHPKVKAIVLECTNMPPFTHAVEKATGL
                     RVWDVLTLGKWLYAGAVPKDYRV"
     gene            complement(863067..863174)
                     /locus_tag="CNL06710"
                     /db_xref="GeneID:3254937"
     tRNA            complement(863067..863174)
                     /locus_tag="CNL06710"
                     /product="tRNA-Lys"
                     /codon_recognized="AAG"
                     /db_xref="GeneID:3254937"
     misc_feature    864000..864088
                     /note="CT-rich"
     gene            865662..867885
                     /locus_tag="CNL06720"
                     /db_xref="GeneID:3254944"
     mRNA            join(865662..866023,866074..866425,866489..866570,
                     866618..866910,866960..867048,867100..867437,
                     867491..867885)
                     /locus_tag="CNL06720"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534708|gb|CF680549.1,gi|41534719|gb|CF680560.1,
                     gi|41537927|gb|CF683768.1,gi|41537931|gb|CF683772.1,
                     gi|41542903|gb|CF688744.1,gi|41542913|gb|CF688754.1,
                     gi|41546213|gb|CF692054.1,gi|41546219|gb|CF692060.1,
                     gi|41547275|gb|CF693116.1,gi|41547283|gb|CF693124.1,
                     gi|41549627|gb|CF695468.1,gi|41549634|gb|CF695475.1,
                     gi|41558901|gb|CF704742.1,gi|41558914|gb|CF704755.1,
                     gi|41559693|gb|CF705534.1,gi|41559701|gb|CF705542.1,
                     gi|41560149|gb|CF705990.1,gi|41560160|gb|CF706001.1,
                     gi|41561692|gb|CF707533.1,gi|41561698|gb|CF707539.1,
                     gi|41567132|gb|CF712973.1,gi|41571857|gb|CF717698.1,
                     gi|41571863|gb|CF717704.1,gi|41573652|gb|CF719493.1,
                     gi|41575614|gb|CF721455.1,gi|41575622|gb|CF721463.1"
                     /transcript_id="XM_568191.1"
                     /db_xref="GI:58261561"
                     /db_xref="GeneID:3254944"
     CDS             join(865902..866023,866074..866425,866489..866570,
                     866618..866910,866960..867048,867100..867430)
                     /locus_tag="CNL06720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568191.1"
                     /db_xref="GI:58261562"
                     /db_xref="GeneID:3254944"
                     /translation="MRSPGPSLILLAALPLASATHLSSKLQDKVYDVMENISTHSWEI
                     GTKAQAILESKYPSYSVFASTSPIPLPDDFDDDDIEDVVAVAEYTMNNRPPSNTSASA
                     HGGSTLLDDEAAGDPASLGVTILLANASTDNAQVNGVSYGDAAREELNYLLYDVPRTS
                     SGAISHRADQAQLWADSVYMVPPFLAYYGALNNNQTLLQQAYQQCKLYRDALRQSNGL
                     WIHITGGNGTSDPNLWATGNGWAAAGMLRVWATINWSTFSDQLDSQLSDLESWVREIL
                     DASKPYITGNGIFYNYINDTSSFEDASSAALMSHVGLRLSTLGITNDYVDMALGLLSA
                     ASSYVNSTGYLTQVVNPLDFSEQGEESPEGQSFLVMAYAAHTDWDDAGRAGHTKDDGL
                     GSKSGASPQIGGLGSAMVVAIGLLAMLVTL"
     gene            869685..873075
                     /locus_tag="CNL06730"
                     /db_xref="GeneID:3254939"
     mRNA            join(869685..870296,870349..870441,870496..870627,
                     870676..871202,871261..871933,871985..873075)
                     /locus_tag="CNL06730"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550537|gb|CF696378.1,gi|41550550|gb|CF696391.1,
                     gi|41557419|gb|CF703260.1,gi|41557430|gb|CF703271.1,
                     gi|41560142|gb|CF705983.1,gi|41560147|gb|CF705988.1,
                     gi|41560950|gb|CF706791.1,gi|41560956|gb|CF706797.1"
                     /transcript_id="XM_568192.1"
                     /db_xref="GI:58261563"
                     /db_xref="GeneID:3254939"
     CDS             join(869746..870296,870349..870441,870496..870627,
                     870676..871202,871261..871933,871985..872912)
                     /locus_tag="CNL06730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568192.1"
                     /db_xref="GI:58261564"
                     /db_xref="GeneID:3254939"
                     /translation="MAEDNHNEPPPPNIPTPTFPQSKTINTAFARSPTTDSEIEPADE
                     EEGDHRPFNPRTSTTDEHQTLFYQDASHFNVEHHVGRVCRSFAPLALLAIIALAFIPV
                     ASATDLDPYTSCPALPQKNTPILSTTGYVFNHVVRFIGLDDSFVGQHLANVKRNLDNT
                     SIIEACMVPVLVLLSGMFAGLTLGYFSVDQTQLQVLAISGTPKHQEYARLIMPVRKNS
                     HLLLTTLILGNMIVNEALPVVMDGLLSGVVSVVVSTAMVVIFAEIIPQSICSRYGLLI
                     GARMAWPVRIMIWIAYPIAWPIAKLLEWVLGAHHGIIYRRGELRELIKMHAAGGEGGG
                     DLDFDTVQITQGALDLARKTVKDSMTAIEQVFMLPIEAKLDYETLGHVVRSGHSRIPV
                     YQMVEVPDIDLSAPTLGPTKTKMVKKVLGSLLVKSCVLLDPEDATPLASIPINAIPSI
                     PFDEPLTNMLNVFQEGRSHMAIVSRRVRRVGPVDPEDAQSAMTAAAGGLRQRFFRRVA
                     GISGNRSFSDGDSSASGEEDLEKGEGGKKKKRRRKNAEKHDRAGSCSSDNHTIVRPIS
                     SDDDGFTEADEIKRMAKEQQEAEMKQQRGKDSKKGSLVQAAKLTQLEQSVPADAQLSN
                     DAVENFFDGLEGAPLGIITLEDVLEELIGEEIYDEYDEHGVPRSAASAFVPLEAMLAA
                     RKAALARQELAIAQSTPIPPVSDADVEQVVAAPTPGAGRRVKAKIQIPKFSLKKPVSQ
                     PGRPRTERLAANETPAATPPADPPCYTNKPDEKSTYSAQIITIPGELDEPPLACAQSD
                     SRLVNRRLSTPLDSGATATPSPQPQYSLSVPGPASAVPTRLLPAGGTVSTPAVIPTSH
                     QPSLLNEAIFIGRERKRMAASHPGQVRSQSSGPTVSSKQPTPPISVYDFGIQAAGVNG
                     ERVEGQEIVSPRPIAAQQKKIPKFKSVPTPVATPSFGFDPSAESKSSSREEKE"
     gene            complement(873152..>876146)
                     /locus_tag="CNL06740"
                     /db_xref="GeneID:3254886"
     mRNA            complement(join(873152..875205,875566..875721,
                     876071..>876146))
                     /locus_tag="CNL06740"
                     /product="uroporphyrin-III C-methyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41558618|gb|CF704459.1,gi|41558627|gb|CF704468.1"
                     /transcript_id="XM_568193.1"
                     /db_xref="GI:58261565"
                     /db_xref="GeneID:3254886"
     CDS             complement(join(873203..875205,875566..875721,
                     876071..876146))
                     /locus_tag="CNL06740"
                     /codon_start=1
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="XP_568193.1"
                     /db_xref="GI:58261566"
                     /db_xref="GeneID:3254886"
                     /translation="MSPPASQPPLWISLWMLFTTLIVSWALLNVVEIFLAIGYLYLQH
                     ISPRDKPLHAVAPLIGFVGTVMTASKTILYFLQEYFCGWCNVGHNDRRTFWMVWVIPN
                     GTWIILPTIVSIVLGRYIAVALKRDAVYSPVSTSLLRAEFLAEKLASTLTEEPTQLPA
                     ALPLTFHPRTLSVLIVGSNRLAASRALTFLEADAKVFLLTSSEEVAKEVKELEEGGRV
                     SLLQNTASDSVAWSELLTKHDISLACVTDTLISTPSRRSLASATIIYQTCLSLHIPVN
                     ISDQPHFSTYTFPSVHRFAGADGPSHLQVAVSTNGQGCRMSGRIKREIVSRLPADVGK
                     AVDNVGKLRARAKARAKISEEDDGPLNTPVPQLPTPSISRRNSEEVTQQLSDEEQQLR
                     RMRWVYQMSEYYSFEHLAKISNEEMDKALDIWGQRDEGYLPHHDVKTVNASEKKGRIL
                     LIGSGPGHPGLLTMAAHTALRTATLILSDKLVPAEILALIPDSTKLHIAKKFPGNAEG
                     AQNEMMELALEGAQRGETVVRLKQGDPFVYGRGGEEVLYFRQHGFESTVIPGISSALA
                     APLMMGIPVTQRGVAESLVLCTGVGRQGKAVQLPGYVKSRTLVMLMGVARISQIIEVL
                     TSTTATTATGRDGAAYPPHLPIAVIERASSPDQRVILSTLEKIQPALKQVDERPPGMM
                     LVGWAALALEGKGRVDVLDRSEDDEFEMVESWLAEGQEGEIKGWKVREGLNDEWRGIL
                     NGII"
     gene            complement(<877089..>877697)
                     /locus_tag="CNL06750"
                     /db_xref="GeneID:3254905"
     mRNA            complement(join(<877089..877148,877239..877289,
                     877348..877464,877479..>877697))
                     /locus_tag="CNL06750"
                     /product="hypothetical protein"
                     /transcript_id="XM_568194.1"
                     /db_xref="GI:58261567"
                     /db_xref="GeneID:3254905"
     CDS             complement(join(877089..877148,877239..877289,
                     877348..877464,877479..877697))
                     /locus_tag="CNL06750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568194.1"
                     /db_xref="GI:58261568"
                     /db_xref="GeneID:3254905"
                     /translation="MNTMNLSHKSFRSLSSSSDNSAISTTSTSSRSSTHSRAWEDMID
                     RLASHKVGPIPLSTFGSLSMDPFKRYEADINARFDLWSGGNIRLNGLDLTLTTRDAEG
                     LFKAMKTDDRFQIIHHVFFDEEKEDWKVSFIRAQPSPCSAFPSDSE"
     gene            complement(878768..883670)
                     /locus_tag="CNL06760"
                     /db_xref="GeneID:3254890"
     mRNA            complement(join(878768..878889,878961..879093,
                     879147..879427,879485..879683,879747..880251,
                     880309..880491,880567..881908,881957..882788,
                     882844..883670))
                     /locus_tag="CNL06760"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538922|gb|CF684763.1,gi|41538931|gb|CF684772.1,
                     gi|41540042|gb|CF685883.1,gi|41540056|gb|CF685897.1,
                     gi|41549773|gb|CF695614.1,gi|41549786|gb|CF695627.1,
                     gi|41560640|gb|CF706481.1,gi|41560649|gb|CF706490.1"
                     /transcript_id="XM_568195.1"
                     /db_xref="GI:58261569"
                     /db_xref="GeneID:3254890"
     CDS             complement(join(878870..878889,878961..879093,
                     879147..879427,879485..879683,879747..880251,
                     880309..880491,880567..881908,881957..882788,
                     882844..883623))
                     /locus_tag="CNL06760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568195.1"
                     /db_xref="GI:58261570"
                     /db_xref="GeneID:3254890"
                     /translation="MSTPTPSRKTSTPSRKLSAPSRQSSTPSRTPQPRPPPSLLIPSA
                     KPSSSTAFVFAQGQSEPTTQPQTPTVETEGGKNGGGSVTGTIPKRQGSASEEALSRQL
                     DGDLGGRLMGLRSRRSSAATTNTLNTLATAGTARHCSGGNGVGRDSPRTADELGTATD
                     TGSVPFVGDDERGRGRSMLASPLSTVAEPGVSNEGGADASNGSLALPTPSLKREGDPL
                     SSQGKRLGNKTSTSWLRWTSPTPTFPKQGEGKGKGKAEETVEGQSPESINEPQREPPT
                     EPAASTATNSDSPSVSQTPQPSQQATTRSEPPKSAGQILSLPPEQNPSRNSTGQSQTL
                     PLSEKEGKQGWFSSFSRNSRPSALTSLHPSQGQAIVESVKHGFKQGDEVKDAAEPSEI
                     EGPGGFGTPVQIADEIKTKEDTRKQEETDKSSPNPPLAEGEVRPDMSSLSNSNIPSHT
                     AELSAPTSISAESTDPLATVTHAQGQSQQKKTVRPQQSMASLRGFRDYLGWSGSSAEG
                     KEASSQKGEHKGSASNSGVDKQEEVRPENATQTSEETLTPPQPTETTAPTPRGQATPW
                     SSYFYSFVVPEPKQGQAQSSKTVSIAPESESNSAAAVPPAQPTDTPKSSTEPQPALLT
                     PLTTPSNTKITSRNVSPARISTTSVPAPDSTSSQPSAPSAPSAPSAPSAPSAPSAPSA
                     PSAPSAPSAPSSSTSPSTSRRPSAAGWLNYLAFRANQKKITAGSVDTGGTGEGEVMDF
                     SNDPNFPSESSIVNATVEDTSSKTSGGASGDKNRPLTAPTKSTPSAITHKPSRNLDVH
                     KHAKRLSNASSLAGNVGSLAFSASPKNKSLEDHQSPGKSSTRSLTNPKESALPHPQPP
                     AVQPNLVIPTFSNTFDRPPRSFPPLPPSPPSSPRSFDSKQPPHKGLTAATTGVAWKVL
                     GAVGSYVYGGGGVGDEVSKGGWVDTEAEQRGRKEGRKVGRELPRRIGLEHGGAEDGWK
                     DVKRVVVVGVHGWFPAKMLNSVIGEPTGTSVKFANMMGQAVKQFFAEKGIDESELRLT
                     LMPLEGEGTIELRVDKLYKAYLSNPAWINDLRRADAIFFAAHSQGCIVTTHLISRMIA
                     QGHIRTPLNAEAVARCEWAFGPIGVIPSYPRSRKFPDDFSIPGAEGGYQKVAMLAMCG
                     VHLGPMYSISTSTMIQPYLQWFENAAARELFGFQDTSSAVSVEYQRALGMVLENEVRV
                     VLLASLNDQVVPIYGSSFSTATHPLLLRALYVDGASYTQSDFMTNLLCFAFMLRNAGI
                     NDQRLVEHLSEATAGSLTGIGHSTPYEELSCYTLAVHYLFYAGRARQPMPPLQVEPFS
                     ARDARNDYELPWIMRALVDSAEVQDLFPGELRDLKEGILHWKPVTKPLKEIKRRLEPM
                     AGRQSRLRPLPNSPSSASLASTGANVETSTSPAPSKNLSAGLRKDW"
     gene            complement(884044..886854)
                     /locus_tag="CNL06770"
                     /db_xref="GeneID:3255018"
     mRNA            complement(join(884044..885782,885839..886038,
                     886089..886288,886337..886460,886515..886854))
                     /locus_tag="CNL06770"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536599|gb|CF682440.1,gi|41536605|gb|CF682446.1,
                     gi|41566097|gb|CF711938.1,gi|41566107|gb|CF711948.1"
                     /transcript_id="XM_568242.1"
                     /db_xref="GI:58261663"
                     /db_xref="GeneID:3255018"
     CDS             complement(join(884183..885782,885839..886038,
                     886089..886288,886337..886460,886515..886808))
                     /locus_tag="CNL06770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568242.1"
                     /db_xref="GI:58261664"
                     /db_xref="GeneID:3255018"
                     /translation="MRASHKKSHSTSTLSLLAGSPVSASPLSLEQNTPRQQLDRSKRR
                     QSVLPRVNEQSSNASINILNGLQGTVDDRQKDKYPGDGLKKGRGEGDVKELLSDLKSL
                     RSSGRRRMAALKGVEKVVVEACAGQQFDVLEEFLSFNPYNTLVNLLTRHTSTLSHRSS
                     HASLPAGDELALSLIPELKLVVGILQGLCLLSRGCKGLVGEGWVMEVFIDLLLLLRSQ
                     PPPHESDKPISYNILELLFCVLVDSPENARKFEKLSGLEAVVRVLKGSNVGKDVRMKC
                     IEFLYFYLLPEQQNSDVNKRNISNSSVSSTTSSELYPTSPPTLPRTKPPIAVTTSEEK
                     LGDIDVPFIPQTPVKRPRPNLGYLTPATRHLSDASANTSSSTPGLPTVPASPASPAIS
                     STIIPPSPQESNGRLRPSASTTGLSRMLDEDAPLSSHVPDARTPAMLKHRDDGGAGKV
                     GLGIGLSNLGMTTSTFKTKGGTSDDPFDLTASSKRSHSGSSGSSTVVPSTASRAISRS
                     STQPSLADLSYGGNSNKARLDAGLGRSASLRRGVSSSPSPLARSSFPIAHSSNFEKEG
                     EGEGRAQRQRGGSSGSALVSRTPRSSTSSRSRHSRAQSYASGLSLPPPTGPSESASVP
                     SIEIPPVPRLPSSVVASIHTDAHHTPNSSGITSMSNMKENKEMEKIRGVRARSKGFPA
                     KLTKGMVPSASSSGLTAMTATSSSLASSGAQIGKDGREVPLGATKRVLSRNYRDVQGR
                     ERNESDAETATGAKAGLTGRAKAETRTMEEKKEMLGMWLGNVEQLVQGVEKVSFWGSI
                     GETHKGR"
     gene            887336..889107
                     /locus_tag="CNL06780"
                     /db_xref="GeneID:3254895"
     mRNA            join(887336..887671,887739..887843,887903..888040,
                     888104..888478,888537..888717,888796..889107)
                     /locus_tag="CNL06780"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533797|gb|CF679638.1,gi|41533806|gb|CF679647.1,
                     gi|41547123|gb|CF692964.1,gi|41547131|gb|CF692972.1,
                     gi|41556125|gb|CF701966.1,gi|41556133|gb|CF701974.1,
                     gi|41567130|gb|CF712971.1,gi|41567141|gb|CF712982.1,
                     gi|41569522|gb|CF715363.1,gi|41569530|gb|CF715371.1,
                     gi|41574386|gb|CF720227.1,gi|41574394|gb|CF720235.1,
                     gi|41575717|gb|CF721558.1,gi|41575720|gb|CF721561.1"
                     /transcript_id="XM_568196.1"
                     /db_xref="GI:58261571"
                     /db_xref="GeneID:3254895"
     CDS             join(887476..887671,887739..887843,887903..888040,
                     888104..888478,888537..888717,888796..888961)
                     /locus_tag="CNL06780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568196.1"
                     /db_xref="GI:58261572"
                     /db_xref="GeneID:3254895"
                     /translation="MDKLDALLGPFNPNKMAAKSASDPLKVLVLDATGDEGFSVCKSM
                     LKDGGFNIWGLVPNADTPVARELNRLQVQIVEGELDRPDTFQSQLAGMDGIFIPSDIF
                     STPESVTCGKSLIDMCKVAGVGHIVFTALDLVPNGEGSDHPGGQILSYIKQTYTGHAE
                     HEDRPHGAHHHLHWTILYPGWKFSKLITLDLFSKVPISKLPTGSREPDAAKELEKNVS
                     RKEGEPAARLTDDDGEEWLLRVPLPDETKIPGYAVEQLGLWVKAAFLNHKKFRESIIQ
                     VCSTMVTPLEMADVLSKMAGRPVRTLGLTLEEFFSGDFKTDMGETKWERYRAAAEGHF
                     ERDPEASRKIVPEQWNFGQWARQSKELAVLFEEDRDRREEKEQHGRQNDKEK"
     gene            complement(<889491..>890989)
                     /locus_tag="CNL06790"
                     /db_xref="GeneID:3255014"
     mRNA            complement(join(<889491..890309,890414..890691,
                     890758..>890989))
                     /locus_tag="CNL06790"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41549646|gb|CF695487.1"
                     /transcript_id="XM_568241.1"
                     /db_xref="GI:58261661"
                     /db_xref="GeneID:3255014"
     CDS             complement(join(889491..890309,890414..890691,
                     890758..890989))
                     /locus_tag="CNL06790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568241.1"
                     /db_xref="GI:58261662"
                     /db_xref="GeneID:3255014"
                     /translation="MAQPVFPERPVPDVNAPSLFDLLAQEQLRDLFHPVFRYILSYLA
                     QRYPRYFLRLLNHHEEAFALLLLILEKHHLEHHNASLSEHFYGLRLVPSRAFSLSRLG
                     SLSQSQLNISPTTTNLTRKQRWGILVFIVGLPYVRARAQDYFERLSGIGNDEIQRDED
                     GEVRIQSLSKSQHIFKLLYPYFNLLLDISFLGYDIAYLFSKTTYWRPWYLLLNLHISR
                     ARFPSPPSPLDTTTFSSRSALSSFSLPPLLPPLLLALKLSQWWYSPSSPRALSPLSRS
                     GSGLQGGRGISVAEVHKGILPPRAVNILSSVSIFPFSRKQSSSHADNEDEEHKRNGER
                     TEIHIPPAKFGICPLCNKAWANPAILPSGWVICWKCGWNAVEGEKECHDEQSEDKPRE
                     EEEVSEREKEGSSYETGKSTDDREKKTERKGRCPITGIYVPPGGLRRILV"
     gene            891170..>894251
                     /locus_tag="CNL06800"
                     /db_xref="GeneID:3254852"
     mRNA            join(891170..891524,891580..891787,891845..891915,
                     891966..892248,892285..892896,893015..893446,
                     893524..>894251)
                     /locus_tag="CNL06800"
                     /product="mitotic chromosome condensation-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542205|gb|CF688046.1,gi|41543616|gb|CF689457.1,
                     gi|41545998|gb|CF691839.1,gi|41555473|gb|CF701314.1,
                     gi|41565272|gb|CF711113.1"
                     /transcript_id="XM_568197.1"
                     /db_xref="GI:58261573"
                     /db_xref="GeneID:3254852"
     CDS             join(891189..891524,891580..891787,891845..891915,
                     891966..892248,892285..892896,893015..893446,
                     893524..894251)
                     /locus_tag="CNL06800"
                     /codon_start=1
                     /product="mitotic chromosome condensation-related protein,
                     putative"
                     /protein_id="XP_568197.1"
                     /db_xref="GI:58261574"
                     /db_xref="GeneID:3254852"
                     /translation="MAVLHSKRPRMPANSQGIHQQTCINDDAAEKAKRRKSAHFHTVP
                     DHTSISNENENPKNQAGKRVISGLAIQQQGLIQKRGKRLSAVEPNMPEVRIEVKENKY
                     EEWMKLATDNKITANNTWSFALIDYFADLTLLRNGPDDQSINFQKASCTLDGCVKIWT
                     SRVDSVATETGKLLSGLAGGSAETGEDDGSEGEEDEAGEPKTTRKTVRSEATLAKSFA
                     QLQIKKFDLEFTVDPLFKKTSADFDEGGAMGLLMNHLSVDNKLREVFDAGDAVADEQD
                     LDEEKEEGGGGMIDEVVQLEKLRTSIKRELTRVTEDYIPITKFLADYSINPSLASFHF
                     SSDSSTGNDNDPAIILGLKDSFPVDEYDHYDIPMATADDYNPMDPASNRRSGEGYDFF
                     GSEDYDAVPAYGDGGFDEDGASMMGDPEDGLSAPFHNPANSNGGSLALLGPGSSHLGP
                     FDPHRQGQGHEIVLTLGEGGDIGSGGMFEYFDKGFGKSWAGAEHWRLRKVSRKDMATA
                     GTITTTNSKTKVDKTPFAIDFHTPMVTSLTSSTQALFTPASNKSSITLPSTFAPIRTK
                     NGKAVSGQRQLREERLLPDDMHFSSHQLLRLFLKPQFSLKMRPGGRNMGGMGGMIGAD
                     GEIDENFWAAAAKEREGGECAGDEFGSAPAPFESQFFQDDDDYGDMDNDVDFGPIQPN
                     VPVLCGPGEEEDDLWAGTQMELKKARPENVNFTKKAKRVDVKRLKDDIWTGLKDLVPY
                     SDKAGDTDTDDEDSTPSTPPEPSDSEPVKTFSSIIQSLRSTYPPQKMSEISTSFCFIC
                     LLHLANEEGLRIESARGDGKEGEDVGCVGIAPVGEDGEVVLGEGLNALLGMLGAGRGG
                     SEGMESTSEGVKKDRVIGELEALKVYKVRLFFF"
     gene            complement(894477..896194)
                     /locus_tag="CNL06810"
                     /db_xref="GeneID:3254861"
     mRNA            complement(join(894477..895531,895598..895694,
                     895752..895783,895875..895927,896052..896194))
                     /locus_tag="CNL06810"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41567080|gb|CF712921.1,gi|41567093|gb|CF712934.1,
                     gi|41575707|gb|CF721548.1"
                     /transcript_id="XM_568198.1"
                     /db_xref="GI:58261575"
                     /db_xref="GeneID:3254861"
     CDS             complement(join(894710..895531,895598..895694,
                     895752..895783,895875..895927,896052..896130))
                     /locus_tag="CNL06810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568198.1"
                     /db_xref="GI:58261576"
                     /db_xref="GeneID:3254861"
                     /translation="MDLSNLNASLDPDVADAERDIGDKFRAAAASITSLYRSSLAVTK
                     QGYNAGYSTALKDMLSMVQSSIGEGQDSAQTLSRLMDWADARQAAISVFAADEAEDTP
                     PPRPRSNPISRQSHLAPNRPSSAPAFDHSGANSNANSMSVFIGNSVEGSDGQSESSTP
                     HRLMDTTTYQPTPNMLSSPLNYSSGQPNPSTMASTAGSLSQSSLLVPTTKPSRGQPIR
                     YANPAPSHSSQSINPSSSSLTSSTFNPSLPSLPIISTSAPLAFSSSGPAQNYPIGSKR
                     PIVENMDVEIPSDGSNAFGPSFNSNPGLGLVRAQSQRSVKRRSMGLRDGGKEGKDEEE
                     KGGGGGGGKKGGRRHGHGHGGASAGV"
     STS             897101..897703
                     /standard_name="Sal3"
                     /db_xref="UniSTS:470740"
     gene            899295..901035
                     /locus_tag="CNL06820"
                     /db_xref="GeneID:3254859"
     mRNA            join(899295..899552,899613..899710,899766..899880,
                     899942..900053,900114..900541,900599..900657,
                     900719..900798,900848..901035)
                     /locus_tag="CNL06820"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535833|gb|CF681674.1,gi|41535844|gb|CF681685.1,
                     gi|41549738|gb|CF695579.1,gi|41549751|gb|CF695592.1"
                     /transcript_id="XM_568199.1"
                     /db_xref="GI:58261577"
                     /db_xref="GeneID:3254859"
     CDS             join(899466..899552,899613..899710,899766..899880,
                     899942..900053,900114..900541,900599..900657,
                     900719..900798,900848..900969)
                     /locus_tag="CNL06820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568199.1"
                     /db_xref="GI:58261578"
                     /db_xref="GeneID:3254859"
                     /translation="MTVEIPSSNRKARIGVMGVGRMGKRHARNIAEFAPRAELVAVSD
                     PYPEALEWAKANLPSTVKTYSSSEELINDPDVEGILIATETAFHAEYAIKVIEAGKHA
                     LIEKPISVDIELTKPVVAAAKKRPDLKVMVAFSRRFDASYQEAAKRIEDGQLGSAYLI
                     KSCTNDLYDPTGYFLNYAKKSGGIFMDCGIHDIDIGRYLLNVGNTDGLKNPAKQVSKV
                     FATGLNTVYPELAEMEDCDNALGIIEFENGSKLNIHLSRTSILGHDVVCEVFGTKGKF
                     VINAVPNISRVEIRDEHGVRTESHPSYYERFFEAFKTEVQTFSSCILDDTPVPTPPHD
                     ALEAAQIATALTHSFRTGNPVYFDDNGEPILK"
     gene            901827..903866
                     /locus_tag="CNL06830"
                     /db_xref="GeneID:3254884"
     mRNA            join(901827..901949,902004..902392,902451..902548,
                     902610..902724,902778..902889,902948..903375,
                     903440..903498,903557..903636,903690..903866)
                     /locus_tag="CNL06830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568201.1"
                     /db_xref="GI:58261581"
                     /db_xref="GeneID:3254884"
     mRNA            join(901868..902392,902451..902548,902610..902724,
                     902778..902889,902948..903375,903440..903498,
                     903557..903636,903690..903866)
                     /locus_tag="CNL06830"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540762|gb|CF686603.1,gi|41540769|gb|CF686610.1,
                     gi|41545954|gb|CF691795.1,gi|41548310|gb|CF694151.1,
                     gi|41556687|gb|CF702528.1,gi|41571499|gb|CF717340.1,
                     gi|41571506|gb|CF717347.1"
                     /transcript_id="XM_568200.1"
                     /db_xref="GI:58261579"
                     /db_xref="GeneID:3254884"
     CDS             join(902306..902392,902451..902548,902610..902724,
                     902778..902889,902948..903375,903440..903498,
                     903557..903636,903690..903811)
                     /locus_tag="CNL06830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568200.1"
                     /db_xref="GI:58261580"
                     /db_xref="GeneID:3254884"
                     /translation="MAISQGNSSGKLRIGVLGVGRMGRRHASNVAYSAPRAELVAVAD
                     PSQEALAWAKANLPSTVQYYSDSADVIQSPNVDAVLISTETSEHARLALEAAAAGKHV
                     LLEKPISVDVDLSRPVVEAAGKHPELKIMIGFSRRFDASYREAKRRIDEGSVGKPYLI
                     KSCTNDQYDSTGFFIAYSKASGGIFIDCGIHDIDISRWLLDVENPANLKYPKKQVTSV
                     WATGLNAQHPELASYGDCDNAICVVEYENGTKCTFHLSRTAIHGHDCFCEVFGTDSKL
                     IINGNPNMNRVEIRDIHGVRMESTPTYYDRFRDAFISEVQSFCDVVLDDKPVPTTPQS
                     ALEAAKIAMALTHSFRAGKPVYFDNEGEAIIN"
     gene            complement(<904323..>906062)
                     /locus_tag="CNL06840"
                     /pseudo
                     /db_xref="GeneID:3254826"
ORIGIN      
        1 taacccccta accccctaac cccctaaccc ctaaccccct aaccccctaa ccccctaacc
       61 cctaagtcac gtaccatacg aacctttgaa ggatcttcaa tcttcgaaat tgcatctgaa
      121 aaatggaaca gaaacggaaa catgggaatt tgctctattg cttgataacg aaatgaaatg
      181 agagattatg cataggatcc aagtcttagt atccagcata gcactacagg tcgtaaagac
      241 ggttccgctg ataactcatc tactgttaat ataagcacct attgtacaaa aatgggttga
      301 ttcatatgtc cgtgatttat agatcgtcct cacaataaat taatagttga taattatgat
      361 tgaaaggctg ataattatga tcgttcgttc cataggcagg ccttgtgtcc ataatcctct
      421 tgatcacctc ccatcactat tacactctga cccaacagcc tcccgaattg aaagccttac
      481 aattgcctct tgctcatagc cctcttcttt gacctgcgac aaatgcttcc gctagaagtc
      541 acagcagtgc ttgcagttga cacggcagca acgacgacta ccaactcgga actcgagacg
      601 gaactggcag cactggtggg ggtgtaccag ctaatgcttg aagagagggc tgagcttgtt
      661 gcagagaaag agggagagga ggagccatca gtgatgacgg cgaggttgcc acttatactg
      721 gcactactgg tggcagtgtc gatagaggtg gaagcagagg aagatgagga gacagtagta
      781 gcgttagtgc tgttggataa agagccacat aatccggcct tatcggcaac atcagaggcg
      841 acaaatacct gcacaaacca ttagctatca tcgaaatgtc gttgagcaga gaagaagaag
      901 ccgtcttacg aaaggctggc cggaagtcca tgtgacggta agagaaccat cgctgtcagt
      961 agtagaagta gagcacgaaa gaagactaat agttggtgag caatgtatat gaacacaaag
     1021 agcggaaata ggcttactcg atgacagaga cagagccgcc aaattgggtg tttttgatag
     1081 cccaagtgcc ggtaccagac tggccccgct aacatggatc atcaacaaag taatagggaa
     1141 aggtacacaa ataatcactc acattagtca agacaatcaa agcctcttct cgctgaaggg
     1201 caatgtcctg atcctgaatg gcaagaactg tagcaacagc attatacagc tcaccaacac
     1261 cgcccaacct attcctaatg ttattgaggt ttgtgatcct cccaaaggta accccatcag
     1321 tggcataatt attgtaattc caaagcgcct cccgattctg agggtccgta ggaccatcgg
     1381 agatgtcttg ctccaaaccg taatacacaa tcggcatacc gccgtacatg aacataccga
     1441 caatagcgtt gtaaacgagt gaagcgtcag atgtaagaga attgaatcga ggaagatctt
     1501 ggttgtcgag gaatgtgcca atgactgtag gatcaggata ggatgaggcg gcgaggttga
     1561 tgtagtattc gagggtggac attttgtcgc caccggtgaa aacgttgaca aagccgtaca
     1621 tgaggccgaa accacaaaca gagtcaatgc caccagcact ttggtattcc cccgcgtatc
     1681 tgccagtggt cagctttagt atcaagctag atatcattcg taagacttac tcggtgttgt
     1741 cacctgcgac ttcacccatg cagaacgtgc cggcggcctc gcagaaatcg tgctggaatt
     1801 ctttgctcat atgcttgctc gcatcaattc tgaaaccatc tatcccgtac tcggtgacat
     1861 acccaccaac ccagtccttg agtacgctag cgacagagtc gctttcagtt ttgagatcaa
     1921 gcagcgccac atccccgttg tcatctcctg tcacaagcca gcagacttgc tcggaagtgt
     1981 ggtttcccca gctgatatca catcgtgtgt ggaaatcgga agggtccttg aagagaaggg
     2041 taccatcggc atctgaagcg agtgcagagg catcgagaga gtaggaagtg gctgcaagag
     2101 cgttaatagc aatgtcgacc atgaggtaca ttcctcggtc gtggaccgca accgagaggg
     2161 ctttgagatc ggaagcttgg ccgaaatggg ggttgagttt agtcgggtct gctgtccagt
     2221 atccctacag ctgaatgtca ttactgcttg ctgggggacg caagtattga aacttgtcgg
     2281 atacttacgt ggtaagcttc gccatactta gtattacctt caatgttgag agcggtagga
     2341 ctgatccaga tggcatcaaa tcccatattc tggatatagt ctagcttcga gatgatggtt
     2401 tgccatgtac caccgcagta gttagtagcg cctaacggac atgttgtgtc gtcagaagga
     2461 ggtgcgaaac ggtcagtaat aagtctgctc gagggttaat acgggccttg ctggagagcg
     2521 acgtgctcac tgatagatag atcttgatcg ccattcgtcg ctggtagctc cctgagcgat
     2581 ggcgaggagt gggaggagtg agataagttt tgaaaggaca ggcattgtgc acctcttgtg
     2641 aataaatgag tgtggattga aaaagagtgg caggatgatg gagcaaagat agaggctgtg
     2701 agttattatc ggtcgggcgt tggaataaat aatggaacga aatcagcgag aacatggtat
     2761 acgacaacat cctttgtttg ttgagcatgc aaaaccaggc gccagcttct tctgccactt
     2821 ggccgtcggc ccgtgcgtcc ttttgcgttt catccgccca ttgtttacat gctgtgcttg
     2881 ccaagacggc attcttggcg ggcggcgaat gaaaattggg tgatgaccgt gaaagggacg
     2941 cgcagatcag gatggaacat gaaaccttct tcacagttac ctattgtttt ctatgcggtt
     3001 actaactgta atctcggcgc ccttttccac ccgtattacg taaatagaaa cgcgtcgcgt
     3061 aggtcaggat cgaggtgcca tcagacagcg aggaatgccc gggcctcaca aatgcttatc
     3121 tttgtccgat ttctgcttat cacatggtga gatatccgat gccgacgcga cgccgattat
     3181 ttgcacatca ctttagcctt cctttccaga ttcccaacat catcgtctag attgatgata
     3241 ttaaaaccca aagatgactt ccaccttcag gcagccctct cgtgagtctt tgttgttaac
     3301 actgaagaca ggcagtactg acatgatgcg accggtaagt attcgatcat ttccatcgta
     3361 tacccaatcc atatgctcaa aagggtttag agtatgtgac tcctggaaaa gagctccgga
     3421 agttgaagcg caaggagcaa aaggaacgcc ggatcgaaca gagacgggca catttgaaga
     3481 aaaggtcaca actactggct gagagggcta cgatcgtcgc gaagagacca gtttggcatg
     3541 atataccaga ctggggagat cgtacagact gtcccctttt caaacttcct ccggaaatac
     3601 tggacttgtg ctttggtact gaacttgaca atgatctttc ggtatgttgt cattcaacga
     3661 atagtgggct aaggaaaatc agctggctga taataagcgt tttcgatagc tacgagaata
     3721 catagcccta gctgccgtct ctagatattt ccgacagcaa ttcacttctg aagtgttcct
     3781 ggtgagtctt ttcgtctcct cactacaacc tcaacttcat caatccttac attctccact
     3841 atgctacgca ggcgattttt ctccacgtca ctggtgactg tcgggaatct ttagataaac
     3901 acgcagaaca catattttcc acccacgtcg aagactggag agaagagaaa ccccttccaa
     3961 agatcagtga atccatatat atcgcttcta tgcctcacga ccaatggact cgcgccgaat
     4021 acgaatacca cacagctctt caaaagtttt atcgaagccg gtatatggtt atgtacctcc
     4081 gaggagagat ccatcgatgc ccctccgggg gaacaaacaa atggatcggc aacgttagtt
     4141 atactcattc aaatactatg ggagacaaga gtatttacta ctcgagtact gttcctgggc
     4201 tcaaagacgg tgaaacatat gacccaaaag atcccacttg tctccatgcg gatgtcctgg
     4261 acaagagtat ttatccttgt tgctcagact ggagcatgga tacggagatt gatgaggatg
     4321 aaccagaact caacaagtgg aagacaatcg tcgaaaacta tcacgtaacg tacgagtccg
     4381 atttctggaa ccgcaaagct gaggagatat tacggaggcg aagacgaaag agatataggc
     4441 ggaaacaaag cagtcggcca ggggagcctg ctaaacgtgt agatactaaa ttagacctgt
     4501 ccagtagtga cgacagtggg tatgacactg atgacctaca gaaactcgta aatgatgacg
     4561 aactgggaaa tgagacggaa gatgggcttg atggttacga tggagataac gaggatacag
     4621 ctgaaggaaa gaacgacgag atcaactccg aagtcccgga gaaccaagaa aaacttgaac
     4681 ttatgatgct ccgcacgctg gccataaaag ctcgtgatag tcgggaagcg tatgaaaaga
     4741 gaaaggaagg ggaggagacg aaggatgaac cggaatcgga cgatggctgg gttgtaccac
     4801 tccccggaga tccagaaagg gaggctcttg ctttgaaatt tctcgagtac gttcttgagc
     4861 cggaaccgca cgaccattgg ccaagccatg tgagaaggac gattgcgcgt aacatcaact
     4921 ctcacgctgt tgctgaagat gtgagttgcc aaacttgtcg tcgcaaaaag ttccttttta
     4981 acgtaattgt atctatttac aggatgctat cgaagtttac ggagttacca aagaggaatt
     5041 atatggtctc aaacattatc atggtgccct ttgggaaaaa actgtgggtc gtcttctgta
     5101 gcaatttggt ccagtacctt tagtcttgat agctgatttt tacttggaca ggatctcgta
     5161 ctgttggtca atccagaata aactgctcca attcacttat taatattgtc gtcacgtagg
     5221 tatcctcgaa tggccgtgga ggctcttacc ttgcgatcgc acggtgggcc cctgggtcat
     5281 tacaggttca tgtacgttga aatttgatta aattaactac caagctgagc catacatcat
     5341 ttttgatgca ctagcataga cagacacgct agaaaactca gataatacca cgctctcttt
     5401 caacctcaag atgatccgag caaggacggc gggtaagcct accgattacg aacatccaag
     5461 taggagatgc gcaatatagc agagctaagg ttggaactcc tgtaactcct atagtagttg
     5521 tgagattcaa agtaggctga tgaagcagac cgaatgctgg aaccagtcaa tggctcaaac
     5581 cgacgtagac ctccagaaac tcgccgctgt aaatggctta cgaatgctcg tcacccagaa
     5641 gggaagatct aaagcactat gcatcgaaag cgcaaagaca gaagagtccg aaaactcaag
     5701 ggttccagct gcttcacatg ctataaaatt gcaagaaagc tccaaatatg ctatacaaga
     5761 gaaattacag ctcaaaactt gtcgctttac tctacaagac acgttcgcac atattcaaaa
     5821 agaacccaaa atgctagatg aacctcggca caaactactc tcttttaaaa tatatgattg
     5881 caatgtcgct acacttctct ctctgtgctt gaagatttgg cctcgttggc actttcggtc
     5941 ttggcttccc gctccgcttt ggcagcttga tttttcttgt caaaggctcc agtttttctt
     6001 aaccatctat aacaatcatc agcatatttg ccacgaagcc gattgactaa aagactcacc
     6061 tttgtcgaac ttggtgataa cttctcgtag gtacaccttt actgaccaaa tcccactttt
     6121 caccatgtat cgctacagcc ctggctagta gctcatcctc ttctacagtc cacttcaagt
     6181 atggtgacct gaccctcttg atcggcattt cgctagtgta atgccagtac ttgccaagac
     6241 cgggcacgac cttaccagat ggactcgcaa agtttccgtt tccggcaccg ggaccaccgc
     6301 cgccttcaga gataacgccg ggagtagatg taggatttat cgcagaggaa gaggcacctg
     6361 ccggaggtaa ccgctcatca agctcgccac cgggagttgg gtaaatttga ctagaggcgt
     6421 agcctctggc aggagttagg gattcggaag ttgtagatga accccgtatg cggtgagtgg
     6481 gggtttgtaa tgagggatca accacaaaat cgtctgatgc agggtgggcc ttcaaacgaa
     6541 cgttggccat tgttcgattt cgaggagtga ggtcgatagg tgcgcccaga cttgaaccat
     6601 ggcttcttgg actggagtcc ttctcgagca atccgccaaa ttggggagta gaagatgtga
     6661 gaggaacggc aggactgctt tgcactacgg agctgggagc ggtagagcta gcgacatcta
     6721 gctggcttgc ttgtgctaat aagtcgagcg cggaagccga tcctgctgaa gccgaatgct
     6781 gatgcgcctt gtgagacccg ccaccttccc acacatcacc tcgccgtctc ttcggactcc
     6841 ctcgttcaat atcactgcta tccggtcttg ggcgagttgt acttcttgta gctgaaagag
     6901 tcgataagat gggttctcca tgtacaggtg agtttggacg agtcgccatc tcggcagcac
     6961 gaaggaggtc gttaaagttg ctaccaccag gcgtcgtttg aggtaaggat gactgcccgg
     7021 tcgtacggga tttagaggga gtttgcggaa tggtgcttat actggcattt tgcacattct
     7081 tcttggtact tcgcttggta cgagagagaa gtggtgtggc ctgggatttg cttttaccct
     7141 tggttacgga cccgctagct cgctgatcga tgagcggctc ctcctcacta gcatcctcct
     7201 cgacatccga cattggttgt tcgccatagc cttccttgta acccattcct ccctctggac
     7261 caacaacgcc agctttcttc agctcgccca tggttaaacg gcctaatcgg tcgttggtct
     7321 tgcgcatgct tcggatagcc ttggcagcta acagaagatg ttcagttctg gcgtccccca
     7381 tagtcgcacg gctagatcga tgaataccct tgctattttc gagctgaggc atatactgag
     7441 ggagaaaaac gggcggcgca gaagttgcgg gtgttaattc tgtaggcttg gaagtaagag
     7501 ctgaggtgtt aagaatgaca tgcggtctaa gaagacggag ttcgttgaca agtcggtcga
     7561 tttgtctttg ggtgtcaacc aactagggga aaatcagctc tagccatcgg atgactgacc
     7621 aaacgtactc tgggtgccat caatctgttg tccatttcca gtctcttgtt cgccgcttcg
     7681 agctccttgt gataaccaac atccaaatcc aatacttttc gtttgtttga aactttttcc
     7741 tcctcttttg aaaccatgac tgcccgcatc tctttatgcc atgaatctct ctcgacagca
     7801 tgtcgttctc gctcggtagc catgagctgt tccgaaattt tggcctgttg ctgcatggtc
     7861 gcaatagtgc ttttctgcgc tgctaaacgc tcttgcagaa atggcaaatg attgagagta
     7921 agcggtaaaa gagtcttgac ctgatttcga agttagttgg caatcatcct ttgaataatg
     7981 cgagtgattg ataacccacc attcccagta gctcatctct ttgcacccac tcatcccctg
     8041 tctttccatt ggcctccaac tcgttcactc ttgactgtaa tcttgtgagc tgttccatgt
     8101 cgaatccagt ctcttcttca tccttatctt ccgcactctc aactgctctt tcctttccct
     8161 tgtctttcct ttctccattc gctgtaccca tatcaatgct ccctctttcg ctcccagaga
     8221 cgcttccttc tattctgacc tcaccaccat cgaaagtcgc tcgaggagta cgcaatacgg
     8281 ccgtcttcgg ggtctcgtcc atctgtgggg tatcggggaa agacagcgtc ggtgtctgta
     8341 tagtagtcgg cgacggtgtt gaggcttgca ttggcgcttg cggtgccagg ctaaccagtg
     8401 aggtaacggg gtgtatgccg gtaggcagaa ggcgaatcgc gggatggaga aagtaaaagg
     8461 aaaagtgctg cttggggaaa atcaacggaa gacacccacg cttgaggaaa gttcacacgt
     8521 catttccgca agtggcaaaa atcacaaaga tcgcgtttta tttctccgcg acgaaaatca
     8581 atgtggcaca tcacgttccg tgcgcaagta tgcatcatcc atccatccat tctaactcaa
     8641 tgaatgtcca ctctgcgaca taattgcatg cattgaaaag gtccaacaat aagatttaca
     8701 cggaaccctt tgggtataca aacaaatagc ttatatccta tacataacta ccagagatca
     8761 tcctcttcat cagtaaatga atacatgtat tcattaacat cattccaagg gacgtttgga
     8821 acaggaagca gctcatcttg agaagagccg tcttcatcag aagtctcaga accctctcca
     8881 ttggcaacgc gctgagcttt cctcgcggct ttggccgccc tgtgctccct ccaatcagcg
     8941 acgaaatcga tgaacgtgcc ttgataatgc cagatcccgc aatccttgtc cactccatac
     9001 ttggcgccaa tatcatcagg atcaacggta gtctgggggt attgcctcga tttcggttct
     9061 ttttcaacgt aagtgggatc ggctttgcgt ttggccgcat tggcttgtcg ggtggctaga
     9121 gacttcaagg ctctttcatt ggcagattca ctaaaggcca agtctagtaa gaacagtcat
     9181 gtattagtat ggaattgatg cttacacatg gtaatgatgg ccaataggac cgccatgaga
     9241 acgaagagca agagcttgga tggccgcaag ggagtaactg ttttgctgag tcaactacga
     9301 ttatcgttag gaagtctcta cacttacatg ctcgatggag ttttaggatt caagggattc
     9361 ggctgaaatc taatcagcac gatacatgag cccgaacaaa aattcactca ccacaaggta
     9421 gtgcttcaag cataacagct ctgcttctcc tactttgaac acccttattg catccttctc
     9481 acattatcag ctaccgttgc ccctatcttg acgcggttgt actcactgct cggttgatga
     9541 atttcttatt tgcagcttca acagctctag ctctccatgg gcttggatat gcgtcatggg
     9601 gcagtctctc tcccgtcaat ggatcatact cgaccaaggt tgcatggggt ctctttggtt
     9661 tttcctcggg aggcaagacc cagtttggat cccgaacaaa ctttttggtt tgcttctttt
     9721 tgcccttctt gcgcgttgac ctgtcgcctt ccttgccttc gtctgcttcg tcttcgcttg
     9781 aaagatcgct gaaatcctcg cccttgtcgt agttatcata cgtcctcctc aacaatctca
     9841 ttttgtcttc cagtttgtaa atcttttgcc atagttcacc atccttattg tgaacagatt
     9901 cttcccattc ccattcttgc aaagttgagt agaaattaag ctcgtcgtcg gattcttcat
     9961 catcatcatc atcatgacca tcattccctt cctctgcatg gcttgcaccc agaccaattt
    10021 ccttcccgtt ctcatccgtc attatcggaa cccccaactc attcttcggc ccctgagtct
    10081 ccccgtgctt taagccaggt actgtcgcaa gtacagttcg tgaaataccg tccacaatga
    10141 ccttcctcaa cactctcctt ttcttcatct tctccttctt gatgttcgcc ctttcggccc
    10201 tagcgtccgc ccagatctgt ctcgcttggg caattatctt atcggctcga attacaaact
    10261 cgtaatcctt ctgtgtccac tcttcacggg gaggaatgga acgcatatga atttcgaggt
    10321 ggtcaaatct tttgagaggg ggatcttgac gccaatcttt tacagcacga gtgaagatga
    10381 gctgggagtg tttgataggg gatcgacggg cacaagggcg gagcttcatg taattgggat
    10441 gggacttgag gtagatttcc tggcataatc tcgtcagcac acagacaaga ataagatcag
    10501 aattatactc actcggaaca cgtcgtccgt aaaatgaaac ctgaagtacc ttgatactcc
    10561 agctaaagcc acatagtctc gtagctgtca tccaatacac ggatcagccg atggctttca
    10621 gaagctcctc gtcatcacaa tacctccacc tacctgtagt cccaaattga gcttggtccc
    10681 aaaacacagg tcaagcactt ccgctgggag cctgaacagc ggtacgtcgg tcctatcccc
    10741 ccaatcggga atatccctcc atgtggcttc ctttgctgcg aaaggtttgc gcacccgctt
    10801 cttcggacca ggaggtggag aatcagatgt gccttccgct ttgtttttcc ccttcctccc
    10861 tttcgctctg cccttgagtc tggagtcaat agaccgaatg tcttccgcaa cggcgactgg
    10921 aggatcagca gtctcgtctt tcccgctttg gacggttcga gctcgtttcg tagtagagtt
    10981 gcgggtttcc gccgttcgct tgggctgcat tataaagttg atatttcgga gacttatgcg
    11041 tgggttaaga aaatattgat gaactgacgc agagttggtg tatggtgaag aaatcgagta
    11101 aggaaacaaa gcaaaacaga aaaatgaagt ggcgtgaagc gactgggaaa agaaggcggc
    11161 aaagaggaag attgggcgat cgatcgatgg aaggcgacta gatcggctag ccgcggatga
    11221 aggcgggaga cgtggttaag agtgaagggt gaatggcgga gtacaaaggg ggggcggatt
    11281 cagaaacgag agcaggaact ctttgatggc gatagtaaga tgacggaaga acacttcagc
    11341 accgcgaatc gccacctgtt tttggaaatg aaacagaatc aaatgatggg aagcgaggga
    11401 agcgaggatg gggcttctgt aagcgtgcct gtggaaatga gttgaaatgg cttttcgcat
    11461 aggcacgcct ctccgtcttg ccgggtgtaa gtcatataca acttatccat tggattattc
    11521 ccgtccgtcg ttcattccct ctactaatct ttcgattacc ttgtttcctt cggtcttatc
    11581 gcaacttagc ataacgctcc aatttttgca tatccaaacc agactaatcg caaaaagccg
    11641 agtaaaaagt catttgttac gctttctctg tacaagatct tctcccatcc accggactac
    11701 ttcttcatta acatactcta acaaggtttc tctaacaggg cttagaatag gtggaagtgt
    11761 gttgctaaat catatcatgt tagtgactaa cccgcgagac tgaaaatgcc gacagggcag
    11821 atacgcacct tgatgtggac agcatcaata ttatccagct tgccgtggtc caaattctcg
    11881 tgacgcctgg tagcagtaga catggagtat gaaggtccag cgtcatttag gagatcttcg
    11941 gttctgtaaa gccatgaaaa aatcagcacg aactttaaaa caaggaaaac cgatgaggac
    12001 gtacacctga agaatgtcgt ggatgagctt cctcgccaag tcaccagaaa gggactctcg
    12061 gacgacgact cggaggatct cagttttctc gcagtcggga gcgagagggt agctgtgaca
    12121 agtcaatact gggtccacaa ttgccccaaa aaaatccgga cttacttggg gacgatccag
    12181 ccgatagacc tcagctgcat ctggatccac gcctgcttca caccagggta cttcttctta
    12241 atttcgtccg taaacataaa cgacacaacg ggcaaaccct cgcaataata ctcggcatcg
    12301 tcaacagtag tcttcttgcc gtgcaaaacg gtattagcgg cgtcggcgac ggcagggagg
    12361 atgttggatt gttcggcgct gctggaggat tcggtaagag ccttggggtg gtggatcttg
    12421 gagagacaaa tgaagtagcc agagtgctcg agggctcggg agatgagacg agctacggtg
    12481 aggttcttgt ccattatacg cttgtaacct tcgaaaccga ggttcaagac tatgatagaa
    12541 ttagctgcaa ggtccacccg ccttcatccg gacttacaag tgaacatctg ggcgaggata
    12601 gggtgtgccg gtctactgaa attgagatta aatgaataat cggtctacag aaccggagtt
    12661 agaatgatta aaataaaaaa ttaggacttt atttacagca ccgagatagt gaagctcaaa
    12721 gatcaactcc ttaggaaggt actccataga cctccagatg atccatccga cacccacagt
    12781 gctcataccg tacttgtgac ccgaggcatt gatactatcc cgcttttcag caattatttc
    12841 tcttctttta acagcttctc acctatggac tcgaggaatt tggaagtccc actggtaatg
    12901 agggtatgca aatggacttc cagaaccgtt aatttcgaaa cgaccgtatg agtcattcta
    12961 aacttacgca acaaaaccac cagaagcggc atcaacgtgg atagggacac taatacctgt
    13021 ctcggcctcg tatttgtcga gctcttgagc cacgtctttt acggattcaa acgcgccggt
    13081 gtaagttgat cccaagatac tgtaaaaggt caacttggtg tacccggaaa taaaataaaa
    13141 ttaaaactta cacaaagaca ccaattgtgt tctcatcgac gtatttgagg acgtccttgg
    13201 ggtccattac ataactcgac tacttccatc agcctttaac tcacagcctt taactcattc
    13261 ttctttcgtg gcgtttactc acctcaggct taataggcac aagtctcgcc tcaacctcaa
    13321 agtatctagc aaacttctcc aaagctactt gagcctctgc acccataacg atgttaggtc
    13381 cggggttgtg gatatctttc ccagcggctt tcatcttttc ctgccatcgg cgcttgagag
    13441 cgagaccgcc aagcatgatg gcttcagagg aaccggtagt agcggtgccc atagccgtgg
    13501 cttctttggg agcgtgccag aggtgagaga gcattgactg accacatggg tcagctggag
    13561 tcattcgtcg cggctgctgt agcttacgat acatcgctcg tgaatctgtt gagcagcagg
    13621 gtattcgtcc tggtcgacca gattcttatt gatgttttcc tggacaagac ggttgcactc
    13681 atcaggaacc caagtgtgaa caaatctgta tatctcattg atcagtattc cccgactcaa
    13741 gatcgtttgc aaatggtgcg aaaaactcac gaagccaaat tcatgttggg gttcccatct
    13801 agttcccagt cagcctttaa ctctaaaaaa taatgatgaa aactcaccaa gcatcagctc
    13861 atcgtgtaag agctggtatg tagccctgcc attgacaccc ttactgggga gcctgtatct
    13921 cggaacctcg tcctcaactt cgtagcggga agtgtaggga atatcataaa gagcagccct
    13981 gcgcagaaat tagtcacgaa atggctatgt tcatggccga tacacctact tatgactaag
    14041 gtgcctcttg atagggtggt ctttgcactc ttcaatgagc ttgtcggcgt ctacgtgttg
    14101 agagagggcc atgatgttcg ttctgggaag tctgtgcggt caggtactga atctgcgatg
    14161 ttatctgtgc tttatatagc tcacctatct ttcctagcaa gagagaagag gatgacggag
    14221 gcgattgaaa tgaagactta atacgcggtt tgctgtgttt gtattaaaac cctttccgac
    14281 gttgtaagag gctatcacac gtttacgaga ctgctgggaa gtgcacatgc gggctagatt
    14341 atttataggc aattgacgac aaaagcagca gcccacaggc cagtccccgt ccctacccgc
    14401 cgtcaccttt cccacaacac gaccgacgtc atcatccaaa aaatcccagg caccataaaa
    14461 acagatccgg actatcatta catttttaaa cagtccgtaa caaaaaataa cagtcccgcg
    14521 tccttgccga gtgcgataac ttggcaggcg ggaaaaagtt atctccttcc tgctgaagac
    14581 ggtttttagt gttttcgggt ggattgcgac gagaagcatc ctcccttggc aattttgttg
    14641 gacatgcgct tggtatgcgt aagatatgaa ccatgaggga agaaattgag caagccttca
    14701 gtctgtttcg ttgtacaaca agcaatacag agcaatggaa ggaataagtt aatacaatag
    14761 agtaagtcgc catcgaaccc tgtgatgcgg ctagttcaag ctcatcctca cggtttttag
    14821 aaactgtcaa tcagtctaac agaggcgagg ccagatctac atttgtcttc catttaaaaa
    14881 ccctggttat gggattgcac aacaaacaaa caagtcaaga cgaccgcgct cttgctcaga
    14941 gatccaagat cctttttggc ggcatcaaca tgggctaact agtcctttga taatcctttt
    15001 ttctagtacc tacatctctg aaacttcaat gagagtaccg gggctgtagc caatgtggta
    15061 taaccatgac tgactatttt ctatccagat tattcacttg caccttctta cagtaaatca
    15121 gttgattgat caggaaccgc tacgatagcg aagacatctc tcgatccaaa caaaacgaaa
    15181 acaaaagtgc tggatcatca tgggattgtt ccggtcttcc gatggaatgc gttttaaccc
    15241 attgtggcac tctttctccc tcctacttac cctaatatcg ttcatcttac tcatggtcgt
    15301 cgtcttctac aatgctccga ttgaccatgc ccactcaacg ctggagggta aggttggcct
    15361 caggatgtgg ttcttgactg tcaacgaaac gtcatcaagt tttcctacct ggacaatagg
    15421 caccaaaagg tactacgatg ctggagaagg agaggtgcca ggaagaggga taggattagc
    15481 agcaccggct agaaataaag aaagggcggc agatacgggt tctggtggtg atggggggct
    15541 tcacgcttat gggtttggga tctggggatg gtgtgaatgg acaaactcca gatggacggg
    15601 tgacgcggtt tgtacgagga agactggtta caaactgcca gacgactcag acagcagttg
    15661 ggattccatt tatgaactag agttacctta gtgagtgatc tttcacacta ttaattcgta
    15721 ttttgcaaac ttttttgtct agtgctgtca cccatgtcct gtcaggtgct gccataccca
    15781 tcctcatcag taggtacccc tctgatcacc caatatctca gtatgagcta aggcacctta
    15841 gccccctttg tggtcctttc ctactttatc attctgtgcc ttgccattct attccccgga
    15901 ccttaccccc cttggcccgt cccaagcaaa tatccagcag aagtcaaaca ttaccgtacc
    15961 cgttgtgcct ggctcctacg cgactggcgt ttcaatctct actatttcct tgccatgttg
    16021 gttctgggat tgagtatgat tgtgactgtt ttggttggaa ggggaaaagt gaatactgag
    16081 ggagggggct tgaaggcacg gcccggaacc gggtttggag tgtgagtagc tcgtcattta
    16141 gagaagctca aatcgagatg ctgatttttc tccagctttt ttgcagcatg ggcatgttgg
    16201 atttgttcac agatgctttg catgtggaag acaggcatca tcatgcgacg tgaaggtaag
    16261 gaaaggacca aatactccaa aggctagatg attgcaccaa atcgacgaca ggtattcagt
    16321 ttgctagatt gccaaggttg taccacataa tgcacgatca caaaagttga ctatattagt
    16381 tcatggagcc cgctatgccg tcgatgctca tgaacacaac tgattccttt ccagtgacac
    16441 tttcgtcacc atttcttttg caaactgttg atgaaaggtt ggcaaactcc tttgactctc
    16501 ctaacatgag ggaccgaggc tgtctttcct ttctgccaaa acatcacagc tgttgcacta
    16561 acacttgttt ctctccaagc tattctagtt ttgttcatgc aatcaacatt gacgaaacca
    16621 tgacagaaaa agccgacagt caaacttccc cgatagcaca cattgtctca atcatcctca
    16681 cctctgtatc tgcaatcctc ctcttcctgg tgatccttta caatgtccca ttctcagcct
    16741 ctgacaaatc aaatctccat ggccgtatgt ggctcgtcac cgtctcgccc gagagcggga
    16801 ggagtgggga gacatacggg ttcgggattt ggggttggtg tagttgggca gacggggtga
    16861 atggagggga ctgtgtgaaa aagagttttt ggcggatacc tggggatacg ggaagtgatt
    16921 cggtggttca gtctttgaat ttgccggggt gagttgtaga ttaatgggtt gcgagattga
    16981 gctcagtacg tttcaataga tctgtcacga agtcgttatc catcgcatct ttcttcttcg
    17041 tattccgcaa gttttttttt tcacctcgtg ccctatcggt tggcgctaac aaggcacaca
    17101 gaattaacca tagctgtcag cattttcttt ctcttacttc ttacaatcca tttccatgcc
    17161 cgtactcagc catccacccg ggaaccgatc ctcttttggc ccccatctga catgaagatg
    17221 cgtactttct gtgctgtgca gttgaggaat gtatggttga gactgtttgc agtgattggc
    17281 attttagcat ggggactacc aggcattatc attgctgcag taggagcggg tgatatccga
    17341 gatggatgga aaggaaagat aggtgttggc tggggcttgt gagttctcta gctgaacaga
    17401 gaggcaacaa ctgactgatc aactcacaac gcacacagag cgttagcttc aatggtccta
    17461 ttgatagtag tgcaaggtct tatcttgttg gcagggctgt ggaacaaccc ttctcattca
    17521 ggtcgaaaga aatagacgat aacctttgtt ccttacaatg cgatgtatat gttatgagta
    17581 atgttaactc acttgacaat caccaagaca agtatatgag gtgagaactt tcgtcgataa
    17641 aggaggacgt tgagcaacaa gaatggatga gcctgcagga ctaaagaccc aaaatagacg
    17701 gtgcatttga ggaaggtgaa ggtctcacct tgcccaaaac cattgtagga tatgagatat
    17761 gcctcaaggc aaggaatcca atagggctgg ctatcgtctg gaagactgaa acctgcacga
    17821 ggagtgcgag gagactcttc ttcggcggct tcgatgcctt ctcggcaacc tccttcaact
    17881 tttcgttcaa ctcggactct ttcttgttgg ctttggcatc accattcaat gcggtttggc
    17941 ttttaccgaa cacttctttc aatcctaaca gctggcccag acctcgccct ttccatccgt
    18001 ctctccaagc tttgaacgac agaagcgcat tcaagctgga agccagagct tgagcaaagt
    18061 tgaggaataa tggcgaaggg aactaatcgc cgggtggacg atctgaaggt gaacgaggaa
    18121 ggctattaat aatacttgta acattgatta gccaaagaag ggactcgaga tggaataagg
    18181 cttggtgcca cgaggttgtg gtgtcattgg agacgaaagg atggcgaggg agatgggaag
    18241 agctcgaaag cgctgaaagg ggaaggacga tcaataggcg gtgatacgga tactgttttc
    18301 ggcatcgggg cgcactcctc atctttcaca ccatcatttt gatgatgctc ttccgaccct
    18361 agctcttcgg gcgtacctta ttgccctcca gcactttgca cggtgcctct gctagctccc
    18421 cgaatagcct cgcacggatc atctgccaaa tgccctggag acccatcaac ctcaaacggg
    18481 gcggctatcg atccatctct cacgcccatc aggcgttcct gctagactct ttttctaaca
    18541 atgcgggatg gaccgctttg ccgccgggaa gtcaagggat ggattgaagg ggcagaggga
    18601 gttcatgttc agagtcagaa gcgtcggaga gaaggtcgat gtgtgctaat cgagaaggca
    18661 aggtagagat gaaagtcgga ggtagactta gatgcgggag gcaaatgtgt tccaggttga
    18721 gaaagaataa aacctgatta ggactacata attataataa gctcatcggc atttctcacg
    18781 ctgctgggca tcaggagtcg cggacagtta aacagtcacg atttgcatcc ttctaacaag
    18841 tcccatttca aattccatac ctaaccgagt ctacatcttc cgtattctac agcttcgcaa
    18901 tgatcgtcct ttcgacatca cgcaacattt actttgcctc tttgtaaagg tccgggtgcg
    18961 cggccttgat gaaatcagca gccttctcac cgaccatgta cacaacgttc tggatacggc
    19021 aatcggggat aagagggaag actgaggcgt cagcaacacg gaggttcttg acgccgtgga
    19081 ccgagagctc ggggctgacg acaccgtggt cgatgtcctt gctgatacga gcagttccgc
    19141 agggatggaa accggtctgc gacctttcca ggatctgtcg gatcatgccc tcgtctgaat
    19201 ttcggggcat cggccagggg tagtcgccct caacaatgtc cttcatgccc tcgccgttta
    19261 tgagaatatc gtcaacaaag cggacacctt cccgaagggc gatgaggtca aggtcgtgcg
    19321 agaagaagtt gaggttgatg taaggctgct cgaaggggtc ggtcgaggtg agttttacca
    19381 caccgttttg cgagatggga cgcatcaagt caacaatgac ggtcatgtaa tcaccagtgg
    19441 gcggagtggg gaagtgccat tggaaggcat cggcgaacat cggctgtcac gttggggtca
    19501 gctttcgttc cgcgaatcgc tgtgtatacg caaaggcagg cttacgacaa agtcgatctc
    19561 aaagtgcggc tggccgtcgg gaccgaaagg gtccttgcca ccgttctgcg ccttataatc
    19621 gcgatactgc ttgtggttct ccagacgatt gtcaatacga gggaaggcga cgagctccag
    19681 tagacccgaa ctgaggggtc cattgtgatt cttcctgtag gacgaaatgg caccatcgtg
    19741 ctccgcaccc gcgcgaagga ggtgattatc gaggccaaaa ccgtccttaa tcttgaagac
    19801 atgggacagg atagggtggt cctgaaggtt ctggccgaca tgctttgagt caacaacgca
    19861 ttggatgctg agagcctcga ggtcggactt gataccgata ccggacagca tgaggatctt
    19921 ggcggattcg taaacaccct gagcaacgat aacctcacgg ttggcgtaga aatcgtactc
    19981 gcggtcgtcg ggcccaataa cggtgacacc gacggcagtc ttgccctcaa aaataatctt
    20041 cttggagatg gtcgaagagg ccaaggtgat gttgggcttg ccctcaagga acgcagccgc
    20101 agtagatcgg acacccttgt agatcgagtt gacacacttg aagagaccct tctggacacc
    20161 attgtagacg tccacggtca actcatgacc cttgctcacc cacgctcttt cgagggcatc
    20221 acgccaaggc ttcagctcgg ggaccaaatc agagtgagaa atgtcgacgg gaccaccctt
    20281 gttgccgatg cttttaatgt cgtcagggaa gagaccaagg tcgtcgtggt aagtggtcga
    20341 cttgttgaag tattccttgg tgttttccca gttccaagtg gaaccaccaa actcctccca
    20401 gtcgttgaag gttgcggccg aacctcgaac ccaggtataa tagttgagcg cagtactgcc
    20461 gcccaacacc tttccacggg tgttaggctt ctcgatacga gtatagtctg gtcggtctat
    20521 catggtcgtc ttgtacttcc agtcgtactg agagtttcgc agacccatgg ccttcgccgg
    20581 ggtggtgatg tcggtgatct cggaagggtt gctggttact gtaagtctgg atgctaatgc
    20641 taggacgaaa gggaaaactc acttcacacc ggcctcgaca agaagtacag acacgtttgg
    20701 gttctcggca agacggccgg caacggtaca accaccggca ccacctccaa gaacgatgaa
    20761 atcaaagttt ttgggagcat ctttgggatg agtagcagcg tgaaccatat tgctgatgaa
    20821 taatagtgta taagtgcaaa gactgtgggg ggaatgggaa atccatcgac ctggcatccc
    20881 agctttaata cgaccatctt ctagttcact tgacgtcagc aggcagaact tgggacgaaa
    20941 agcgttctaa aaacgtcctt gcatactcta tctcgacctt cgcaatcttc gctcggatgc
    21001 gccatgccca ttgggctaac ggagcaacag ataacccaga aatgtgcacc gctcgtgtcg
    21061 aaaataactc gcgaagggac aacccacgcg tctcgtgcaa gattacgata tctctcgctc
    21121 gaaacttgga agcccgggcg ggtaaggggt ctggagcgga tcagttcagt tttgtggctg
    21181 agtacaccct cgtcttagcg tacgtccgtt catgtaaaag aagatcctgt gatattccct
    21241 cgagccaatg cagatccatc gaccggccat cccagttgta atacacccat ctcctagttc
    21301 acttgacatt acggggtgga acttgggaag agaagcgttc ccacaaacgt tcttacatac
    21361 tctcgctgaa acgcagcatg tccgtgctgt aaggggtctg gagcggttca actcagtttt
    21421 gtggcggaaa caccctcgtc ttatttctcg ctcattgacg aaaaaaaggt cttgtgatat
    21481 tccttcggcc aatgcagatc caccggcaag gcatcccagt tctaatacgg tcatctccta
    21541 gctctcttga catcacgaag tgcagcttgg gacaagaagc gatctacaaa cgattttcca
    21601 tactctcgct cgatcttccc ttaaatgcag catatccacc gggctaggag agcaaagata
    21661 tagcccagaa atctgcactg ctcgtgtcga aaataactcg cgtggggacg actctcgcgt
    21721 ctcgtgcgag attgcgatat ctctcgctcg aaagttggta agcccgggcg ataagaggtc
    21781 tggagcgggt tcaattcagt tttgtggctg agcacacgct cgccttagcg tacgtccgtt
    21841 cacgtaaaaa aaggtcctgt gatatttctt cgagccaata tgatgcgata aggggtgtgg
    21901 agcggttcaa tgcaattttg cagctgataa tcactctcgt cttaacaacg caagcccatt
    21961 gacgtcaagg aagggcctaa gatatttctt cgagccaatg ataatgcccc tttatcaaga
    22021 cagcggtgcg agatgggatg gaaacggtct atattaaacc tgggtacata ttctcctttc
    22081 agaactttat tgaatcacac atttggcgat ttgacgaaat cagcaatcaa tcatgactga
    22141 gaaaacaccg acgtacaccc tgtccgaagg tccgtcggat cattccagcc aaaacgctat
    22201 ggttgctgac cagtgtagga tgccctatcg cggatgctac gaccgcccag cgtctgggca
    22261 gttgccccgt taagggcctg atgttgatgc aggacaccca gctcatcgag actctggccc
    22321 acttcagtag ggagcgcatt cccgagcgta ccgtgcatgc ttctgccgtt ggtgcatggg
    22381 gcgaatttga agtaactcac gacaattccg acatcacttc ggctgctttc ctcaatggga
    22441 ttggcaaaaa gtccaaggtt cttatgcgta tctccactgt gggaccggag gctggcacag
    22501 ccgagactgt tcgggatgtg aggggctggt cgatgaagat cttcactgaa gagggcaacc
    22561 aagactttgt cttcaacagc attgtatgtg gccgactccg ttctccatgt gctggttgta
    22621 tgggtgctga agttctctag ccggtgttct tcatccgaga cccaatcaaa ttcccctctg
    22681 ttaaccgatc tcacaagcgt catcccgcaa agcataccgc cgactcttct atggtgagtg
    22741 gttgaacttc cacgtttgtt gccccagctg attattatgc agttctggga gtgcgtttcg
    22801 ttttacatcc acgacatggt gaccatactt acagtttagc tttcacaaca acaaccccga
    22861 gggaactcat gccatcatga tgtattttag caatcgaggg ctgccgtatt cactaaggca
    22921 aatcaactcc tacagtggtc acacttacaa gctcaccaaa tcggtttgtg cctcattttt
    22981 tcaaaactag cgaatcattg actctttctt taggacggct cttttgttta tgtcaaactc
    23041 cacttcaaat ccaatcaagg tgtcaagggc atgacgcagg ccgaaggcgt acgcactgcc
    23101 ggcgaagcac ccgatttcca cacgaccgat atgtgggatg ctatcgagcg gggcgactac
    23161 cctacttgga cgttgtatgc tcaagtcatg aagcccgaag aggctgaaaa ctaccgctgg
    23221 aatatcttcg atatgaccaa ggtttggccc cacaaagact tccccctcag accacttggt
    23281 aaattgaccc taaaccgtaa cgtgagtgtt atctgggatg ttgtctggtt catagactaa
    23341 tcaatctttt tctgacgaat agcccgaaaa ctacttctca gacattgagc aggctgcctt
    23401 ttcgccatcg acaatggtgc cgggcgttgc gccctccgga gatccaagtg ggctgagtcc
    23461 tttgtttaaa gtactgtatc cgctgactcc aataagtgct gcaagctagg atgtttgcct
    23521 accccgatgc cgctcgatac cgcctcggtg tcaactacca gcaacttccg tgcaatcggc
    23581 ccgtcagtga ggtttatgcg ccctaccagc gtgacggtgc gatgcgctac atgaccaatt
    23641 acggaggtga tcccaattat gtgcgatctt ctctcaagga agtcaacttc aagggtcaat
    23701 tgggcgcaaa aggccattcc actgggggca acgagaaaca caatgaatgg gtcggtcgag
    23761 ttgcggcgta cacatccgag gtaacggatg aggattacgt ccaagctcgc atgttctggg
    23821 aggttcttgg caaagctggc gaccaagagg acttgatcac caatgtctcg tgtcatctaa
    23881 gcaaggctat cccgtcggtg cagaaaggag ctgtcggtaa gtggtcaacg gagagtgttt
    23941 tgcggcacga gatgttaacc tgattacaga aatcttcgcc aaggtgaatg ttgatttggc
    24001 caagtccatc gaagaccgtt tggctgagct caacaaagga aagtaaaggg aaaaacattt
    24061 gacaaggtaa aagccatgtg agaagcctga caatgataca tatttgaaat gaatattgcg
    24121 atgtcaccgt tatgaagcaa tcagtgcgct cggaaatttg tgtctttgtg attatttcat
    24181 ttgtgcaccg cactctccat taaaaagatg ctgccgatgc gaatcaacac gtgttttcgg
    24241 atggcatggt tacgtatgtt tcgttcgtgc gctcataccc tttcaacgaa tgtcgatttt
    24301 attgccaatg tgaaggtttt caaacggact aagaaatgaa ggcaggctgc aatacatgcg
    24361 tatcctgact aaaagaaatt ctgtccctga tagcgggttg atgacaactg actctctgtg
    24421 ggcgggtaaa gtccgaaaag atcagtttcg ttacctggcg gaacaatcat ttgcccaggg
    24481 gctatctctg cttcaccgct atcggttgat tccggcatgt agttgctaca taagacggat
    24541 agataagcga agatttcatt caatcagaga gggcacactt gcctggtcgt aagagaattc
    24601 tggatagact ggaaaggggg atcatttgat gtcccccaag gtatccagga taaggcatcc
    24661 atatcgtttt gccaatcttg ctcgttaaga gctgcgactg ggagcggaat agacgaggta
    24721 gacgtagcac cagattcggc gtaactgtgg cttgatgagc gggatattgt gcgatcaaat
    24781 gtcactctta cctggtagga tgggtcgtag agtcggcaat agcttcgcca ttttgcggca
    24841 tagggggtgg gtaggaactg gttgcggtat cacttctgtc tgcagaatgc ccagccagat
    24901 tgccggtcag ccaaaagtcc atggagcctc gatgggccaa cccatcatca cccttttcat
    24961 cctctgccca gaacagcgta tggtcgtatc ccaggtcgtg ccacactttt gcacgcaatt
    25021 tttcgaggac agtccatact tgttttgcac ccgttaacga gggcaaagac tgatacgacc
    25081 cagggctgac tagcctgcca gcaggtccca gtaacgagaa tactctatcg atgagctgca
    25141 tgctgagcat tttgtcggac gagtggggat gtgctgacag atcagaaagc aagacagcgc
    25201 atggttgtag cggttgatat gagcctggat aaagccaatg aaatggccgg tacgacggat
    25261 tggtagtcat ctccaaaaac agagccaaaa agtattgaaa gtgtggtaat gccctacaag
    25321 atgctttagc gtgtatggcc attctatgac tgactgggat gcaaacctcg atcgaagatt
    25381 tgcccaaatc accttgtctg acatgaaggg ctgatacaat atacagtatg ctttaaccgt
    25441 cgtgagatgc aagagtgctt gattccattg ttgaatggct tttgaggctg tggtgggcgg
    25501 cggaggtcga tgatcagtaa agtcgtcccc cccgacacgg accgagagct gatccaatat
    25561 ttcctgtaat gatgctgaat gggcatgtag attgacgctc tctagacgac gggactgacg
    25621 ccggcgtagg tcctcaatct gcatctccaa gggggcgatg tcggaaagag tgatattcgg
    25681 tgcttcttgc agtcgctcta gaatggttcg caactgggtg ctagcttcat agcgtccagc
    25741 cgcaagcacg tactttggtt cgacccacag ctcacgatca agcgagtcgg tgcttttgat
    25801 cttaccaata agttcgtcct tcatctcgct gattacttga gtggtgcagc gtgaactcga
    25861 catgatgcca ggtagaccct gagctatgct tgtcatggta tcgagatgca taaggtgcca
    25921 ccatacacgg cgacgctctt cagtcgatat agggtcgagc tcgaattcgg tgccatcgcg
    25981 atggaaaccc atcgactgtg caacccttag agccacggcg acaaatgagc aagagctaaa
    26041 ggcgtcctct tcgcggatca gggtcgagtt agcgagtatg taagccatca gagagtacac
    26101 cgagggatag taggggaaac cgattactcg aagggcttct ggcatcaggc cgcgcagttt
    26161 ttggccgact cgatcgctcc atggttcgtg aattgtgatg gacccagcag ataaaacact
    26221 gattaaaaga gggagaaagc taggattcct gtggaggata ctcaacgaaa tgttttgagc
    26281 aggacgtgtt aaacgccaag accaaaactc gtcataggcg gattcgaacg atggaatgtg
    26341 cattagaggg atgagaggat gaatgcagtc cataaacgct cgaaagaggc ggtcgcagac
    26401 gagtttcggg ggaaggggtt gaagtaattt tgctagacga acgggacccc agctgatgcg
    26461 atccggcgag gttccagtgg acgggttcgg cacacttgtc gccgccccgg gactgctcga
    26521 aaaagctggg ggagtaacca ggtcgtctgg gccgccggtc ctcgggaaaa gcgggaggtt
    26581 gcgcagaatc cggtcaagct cgaggccctg gcagccagtt gtcaactctg gacaaacgat
    26641 gggtcatgta agtggctgct cacttcggca tccacacatg cccagaaggt actttccgta
    26701 taccgtgatc tgcccccact attaagcacc agatacccgg gtttgagctt tcctgtctcg
    26761 agtggcgatg ggctgcgttc cgaacccgac gacttgttcc ttcgaggcat cttgtttgcc
    26821 gagtcgtccg taatcgggtc tttgcgtttt tgcgacaggt tagactggta tacacattgg
    26881 gcttggttgc ggacacagtt tccgcacttt gggcgcgcct ggagataaga ttagcagggc
    26941 tcgaggcggc tcggctatag cttcaggagt gttctgacct gatcgcaccg taccctccgg
    27001 tcgcggcaga cttgacaaga gtaagacgga cgggaccgcc ggatgtccga gaagcgttga
    27061 gtgggaactg acatgctgcg gaaaacttat tgctgagctt ggcagtcgaa aatgcggacg
    27121 ttgtacggtt ccgttgtgag aatgacgaaa acacacaaaa tggtagattt acaacgaagg
    27181 acgactgtgc cacgcgacca cgtgagttcc aggtgacaac gcgcctcagg cttctgtatg
    27241 ccatccataa tcttgatcta cgtatgttct tctttgacca ctatacttat tttctccaca
    27301 cacaggcgcc tactactttg aactcctatc tctagatcta aggcaactta gcagtggaag
    27361 aaaacaccgg cggataaatg tggaagggtt tattcacgac gtacgagtta acatcgaagt
    27421 aatgttcacc gaccactaac acgatttgcc ttctgggtat tcgtagataa cttcttcttc
    27481 taatgtaaca gtctccaaaa caactagtac tgattcttcg aacaaccctt ctcactcagg
    27541 ccgaaaggaa tagataacct ttgttcctta caatgcgatg catatgccat gatgtaacac
    27601 tctagaatat ggtcagtctt tcttcgcttt cttcattaca tccttccttt tcatcccagc
    27661 ctcgacaccg ataccagcga acacaacgcc cacacccaac cattgacctt ttgtgagcct
    27721 gtgctcaaag acgacgacac taaggagcat ggtaaaaagc ttccttgtga cggtgaccat
    27781 gacgagggta agggagccaa agtgctggat agtttcaaag atgaagagct gacccaagcc
    27841 accaagaagg gcgtatgcaa agagaggcgc aagagcggaa ggatgggaaa gaaggaaaga
    27901 gatagattcc aatgccgcag gaggggagaa gctgagagta gaggttggca cagaagagcc
    27961 aaaaggcgga ggtaaatggg cgagaagaga tattgggttg gtggggagcg gaaggacaag
    28021 gagaggtaat aggataattt gagtagtgag cgccattgtg aacatcatct gctggccggt
    28081 gtatgaagga tatgatgaga agatttggtc ttgggtcgag tttgtcaggc catcgataag
    28141 aaggctattc cggtatgagc ttgatgcggc gactccacgt aatgataact cacttgacaa
    28201 gtaacaaaac gagtccccac atactatcac ttccaccctt cttctttttt gatgtttcag
    28261 cgaaaagcat gaacatacta atgccgacgg taacgagtgc tacgacgata tacttatgag
    28321 gtgagaactt tcgtcgatag agaaggacgt tgagcaacaa gactgggatg agcttgcagg
    28381 actaaagatg gaattagaca ctacattcaa aagagtaagg agtaatcacc ttgcctaaaa
    28441 ccattgtagg atatgagata tgcctcaagg caaggaatcc aatgggactg gctatcgtct
    28501 ggaagaccga aacctgcacg aggagtgcga ggagactctt cttcggcggc ttcggtgcct
    28561 tctcgacaac ctccttcgtc ttttcgttca actcggactc tttcttgttg gctttggcat
    28621 caccattcaa tgcggtttgg cttttaccga acacttcttt caatcctaac agctggccca
    28681 gacctcgccc tttccatccg tctctccaag ctttgaacga caagtaacaa agcgcactca
    28741 agctggaagc cagagcttga gcaaagttga ggaataatgg cgaagggaac ttatcgccgg
    28801 gtggagggtc tgaaggtgaa tggggctgtt ggtgaggatg agggtgcaca gagggaaaag
    28861 gttttgatac tttgcatctg tatcagcgtg aagacaaagg aatccagaag gaaggactga
    28921 caccgttctt gagcgatggc ccacagtaaa aaggcagcgt atacacccga gatacacaca
    28981 gctaaccttg aagacataat cagtttttaa cgcagcattt ctgcttgcgt cagatggaac
    29041 ttacctgagg actcccattt caacagaagt taccttggtc tagctcttca gaagctaagc
    29101 caacgtagcc ttgtaaagct caaatgcgat tgagtatcaa atgaaagctt tgccaaattt
    29161 cctcttaatc aatagagggg ggtatcaatg cgtttcagat cttttgagat cccgttttat
    29221 agtcgattgc caacgaaaaa gatggaagaa cagatttcga gaagcggtca atcgaacgcg
    29281 tccgagcatc cacatcttcc acgtcgcaag gtaaacaacg gacatcgccc agctccccgc
    29341 ttctcggtgt cccgatctcc tcttaggaaa gaaagagacc accatcatct cttctgcata
    29401 gatgatgtac agacaaatac gacgtattct agcaataatc cctgtcatca gataattgaa
    29461 ataatggcta accgaattga tcaccaaagt ttggtcttca ttatgaacac cacatcgtca
    29521 caatcagcta ctacatacta ccgatacaaa taacaacaag tacgcctctc aaggctgcgt
    29581 tcctgcgtcg atcgacctga caccacgagg ctgctcagca cacatcaccc acacatggcc
    29641 ctatcgaagc atttttactc acaatacctg actgcagcat cacagataat gtcgagtgta
    29701 aatctggcgg gtcgacctct ccaggtgcga taccaacccc cgcacgctct gtcatacaaa
    29761 acctcctgca cgaccgatat tagctcttct ctcccgaagc agattatttg ctacctaccc
    29821 cacgcttatc acactttctc cctcttgtgg gtgcacgaga ctcttgcgat agaggcggaa
    29881 acatttcgag cagaagtaat ctctctattg gaggagatca tttgcggagc gtattcacat
    29941 atctctcatc gggtcgctca tgattataat tgaaaggctg taaaaaacgc gaagggaatg
    30001 atgaatgtgg atgtggttgg aactggagcc cgtttgggga ggaccgtata ttactatggc
    30061 gactaagact ccagcgaacc tctggcattc tatcaccaca tctgaagccg ccgcaattaa
    30121 ttctcttaaa gcttcttatg gcttcttaga aaggtattgt gaaataatag gcaggaccaa
    30181 tcttcccctc ttttgattac ggtgaagtta ttgttggtct cgttcggtcc gagccttcca
    30241 aacttgggtg attgatggaa gcatcctcgc taactcgtca tgatcttacg cgcgtaaatc
    30301 ggtcgacact cggcagtgtt ttgcatcagg aagcactgaa aggctgatgg atgatggggc
    30361 atgacaacat cacaaattgc atgacgacaa tgaatacaac ctggcgagta catatgaaag
    30421 gtccaacagc agttaccaca acaaaacatc ggagctctcc atcacaccac gcggctcttg
    30481 tgtcaccgct cttgtgtcat actgctcccc atatagcctt ccattcagac aaccccagtc
    30541 ccaatgcctc caacggtgcc agcacaattc ttccccacgt tcctctcaac aacagcatcc
    30601 caataatcat ccaccaccaa tctttatccc atcttctata tttcgcgact tgcttcgagt
    30661 acgtgccggg cgttgccgca gagcgaacaa gaccctcggc ggggtttctc ctgttaggcc
    30721 caggagtata aagtgaggac gagcagtaag gttgggaaag ggacgggata cgtagacggt
    30781 tcaagcctag agctctttca acagaatccc tccagctctg taactttagc atgaaaagga
    30841 acaagagcgt cttgacaaga tcacgtttcc tgttacgagg atatcttggc ctgatagagc
    30901 tgccaaattg cactactgga taaccgaaga aaggatttga ggtggagtaa ggctggatgt
    30961 catgaggttg tggtgtcatt gcgggagaat ggatgggaga cggtgacgga gatggctcaa
    31021 gagtgccgga aggtgaagga ggacgatcaa taggtggtga aacggatatt gttctcggta
    31081 tcggggcgtt ttcctcttcc tcatgtttta cgccgccaag cttatgatta tcttccagtc
    31141 caagctcttc cggagttccc ttccatccct ccagccactt tgcatgatgc atctgcaatc
    31201 ttcccgaata gcttcgcaca ggatcatcat ccgccaaatg acctggaagg cccatcaacc
    31261 gcaaagcggg tctattagtt cttttctcgc gctcgtcagg cgttcctgct aggctctttt
    31321 ccagcagcgc cgggcgaagc actttgcgac gaggaagcga agggatagaa ggtggagggg
    31381 gaggctcatc ttccgaatca gaagagtcag agagaagatc gatacgcgct aatcgagaag
    31441 gtgagagata gagatgaaag tcggagaggg atttgatgcg tgagaccgct gcggacgagg
    31501 gagctcgagt aggtggttta cttcttgacg tgagggtact acttgccctg gataaaatcg
    31561 gttgtggatc ttccggttcg gtcaaggact gtgttataag acccgtcatc gggcctacgg
    31621 cggcaacatc agatgcagat atgactctgg tcatctcatc ctcttcatcg ccatcatcat
    31681 ctccctccac ctttcgggat ctctcatcac gactcttggt cattctcaaa tcatttccat
    31741 accccgctcg aaacatggct ttcatcatac cacttgaagc gctattctgc ctactaatca
    31801 atggagacgt tcggcggctc ggaaaaggcg tgttgcgcgc tgtgtagtat acgtctgcta
    31861 tagaggtgca tgatgtgctt ctggaaatgg aggcaataaa cgaatgactc gagtggcggg
    31921 aatagtatgc gtaaatggga ttattagagg gcgagaatgt ataagggctg tcgccaccgt
    31981 atgctgtgta cagcgttatt gaagatcaca caattacaag ggacactgct atgcacatac
    32041 cttgtgggat cttgtccagt tcgaagactt cggctagtga ttctttcgtg tccaggaatg
    32101 caaccctttc taaagcagat ttggggagca aatgcttgac aacggcccac atgcttcgcc
    32161 ctgtccatcc aacgttgata acgtataccg cctcgaggag gcccggaaag ctgttatgtc
    32221 ctacggaaag tagtgtaggc agtagatcaa cctcctagaa acaggcaatt gcttcaattt
    32281 ataatgcccc tggcatgaat ggatacgtga cttttattgc acttacaagg tttcgatatc
    32341 ccgcaccggc tgcatcaacc aacaagacaa tcccttcccc tccttcgccc ctcgccttcc
    32401 cttttcccct cccataccca tccaccccac ttccgtccca catcccttta ctccaccagt
    32461 ccttagatgt cctcctacac atttctaaag cccaccatat ccattctttg acatcatcta
    32521 gcattccttg ttcgtcccta acaatttcgc gcgcggtgag aacgacaatt ggtctgttga
    32581 gtttatcggt gtgtgaaggg agggggagga tgtggaagag aggggaatcc gagtatggta
    32641 ggatagaagg gatagggccg tgtaaagaga gagaaagacg agtcgacagg actgagagga
    32701 ggaatgagtg tgtcttgttt tggtcatagc ggtttctctg caatgtcgca ttagtcaagc
    32761 ttagatgata cgaaatcaaa ctaagactta ctcttaaagc tctccatata cttcccacat
    32821 catcaaccca ctcttcaaca ccattccacg tatcttcatc ccagccttcc tgtacccgaa
    32881 gttgttcggc gtcgtctcgg agatctcctt ggagttgctg tgcaagcggt agatattctc
    32941 tatactcttg tctagccact ttagttcgtt cttgtagttc ttctttgtct gccatacttg
    33001 ttctttaccg tctcatgttc aaatttagta tcttatagaa gcactccaac aaagaaaagt
    33061 aaaaagacat gacgaccagg tgggccaacg ggcatctgcc gaattgacca tggcggcaaa
    33121 agtgatacgg ccataaccgg tgttagccac gtgtatttga ttccgttcaa ttaaggaaga
    33181 ggaagacgcg ccttcgatga tgcgcgaacc gcccaccgtt cgttttttta gcaaagccca
    33241 catttcgtcc tgacctcatt tctaaactgc agacaaataa tgctccccac aaccctcttc
    33301 ttcttactga cgctagcctt actaggcgga tgcttggcgg aatcgcttta taacgtttta
    33361 ggaggtcagt tttctttttc tttaagcgga gaaatggagg agtaaaaagt ggaggtttcc
    33421 acgtcgacgt ttacgcgttt ttttgcagag aggtgacata ctaatggaga tgtgttgtag
    33481 tgagaaagga cgcttcagac gctgatatca agaaggcgta ccgggtgagt atacatctag
    33541 aggccgtatc tcagctgtga atgataggtg agagcatgag agctgaattt cattgcagaa
    33601 attgtcaaaa aaatatcatc ccgatatcaa tcctgacgag gcggcccacg aaaaatttat
    33661 ccaagtttct aaaggtcaga cgatatgatt aatgtatacg cacgttctgg ggcttacggt
    33721 gactgtgtat agcttatgag gtcctgtcaa actctgagac aaggacgatt tacgacagac
    33781 atggcgagca gggtttgaag caacatgaag ctcaaaaatc tggcggaagc caagatccgt
    33841 ttgccagatt ctttggagga ggttagtctt cattcgcttt gctatgggaa gaggattagt
    33901 aaggagcggc gtgaacgagg tgatggggtg agggggggcg attgatgccc tttactgtgg
    33961 gggacgattt actgaccttg ggattcgtag gtgctgcaca agagcagaaa ggtcctggat
    34021 tgatcacgaa tgttgaggtt tccttggcgg acctgtacac aggcagaacg ttggaggtac
    34081 gttctccttg aaggaagctt tttgaaataa ttgctaatgc ttgttgattg cagttccaaa
    34141 tacctcgacg agtcatttgc cctcattgtc acggatcagg agcggagtct gagaaggata
    34201 ttcattcatg taacaagtgt ggaggacaag gagtggtcgt ccagcgacat caggtcttcc
    34261 ccggaatgtt caccaatgtc caaatgacgt gagtcatcgc aaccaaccct ctcagcaggc
    34321 tcatccacta atgcttttgc ttgaaaggtg ccctcattgt aatggtaaag gcaaacaaat
    34381 cacccgctca tgtcatgtct gccactctga aaaaactgtt caaacccagc acactctcgc
    34441 tctacacatt cctgccggtg cacccgaagg atttgaggag gttttccatg gagaagcgga
    34501 tgaacagatt gatatggaag cgggcgatgt agtggtacgg gtgaggagta agttgaacga
    34561 gggtgaaggg gcgtggagga ggaaggagaa tgggattttg ggaagggtaa cattgagtgt
    34621 ggctgaggta aatccctgtt tggtggaaac agaaagaact tggctgaagc gttattttcg
    34681 gacaggcatt gcttggattt gagagacgct tgacgcatct tgatggtcgt acaattacat
    34741 tgtcacggac aggaacgacc cagcctggag aagtagaagt gatcgaagga gagggtgtaa
    34801 gaattctagc accctaattg ttttgcgaat ctgatctatt gttattagat gccatcgtac
    34861 atggacattc cgccggggga catgttcatt gaatattctg tcgttttccc cacagcagta
    34921 tcctcagaga ctagacagag taagtcaagc attttccgca tgcatgtcaa ccgtattaat
    34981 cctctgtaga actctccgat atattaaagt atgcgccacc tgtgcaccac gacgagctgt
    35041 aagatgagag aggccataga gatagtagat accaagcgtc tgatcggatg catacgtaac
    35101 ttcttgttgg atccaccttg gcggtgccaa tctgcggtga tcgaggtgaa atgccgagcg
    35161 gtgcctggtt gatagccctg accccgcggg gaaatgcgag cccggccgca accgttctgg
    35221 tcttgtgacc cagctgcggc acccgatctc tgctgttgtg atgtgacgac agcagatgac
    35281 ctatcgcagc tcgactcgat aacttggccc tcccatgtat atatatacgg ccgacaccgg
    35341 tctgcgatcc ttcctgtctg cacctcttat tgctttctca caacatcact ccaaccagcc
    35401 aataaacaca acaactactc tgacgcctgc catcatgact aggactgagg tgagttttgg
    35461 ccgctccacc gcccgagctg gtgacgtctc catctcaata ccgcagtgga gctgcatgcc
    35521 aagtttggac caggctaaca actgtccttc cgcttcgtct ccaatcctac caatcactgt
    35581 ttgtctgcct gtcctctatg cgctgtggac cgctgccctc ctacggcctc acgtaaatgt
    35641 gccttcacca tggtatcttc atctggaatg tcttttacca ccgtgctgcg cccttattgt
    35701 atgtccccgt gaccgtctcc tgtctaaccg gactactcca ctccgcgcct atcttttctt
    35761 cccatcttgc ttttaccctt gtttcgtcta cgatctattc cccaccattc cttctcgctc
    35821 cacctatccc atctttccat gtcaccccac tacgcactga cccaacagcg caaccaatac
    35881 cccgctgccg tcctcaagga ccgtcattcc cgcactggtc tcgacaagac ccagtggaac
    35941 cacaagaacg gcgatggcgc ccataactgg ggatctaccg cccgtaaagg cgatgacgaa
    36001 gcttccggcc gtcttgacgg tgaggccgag gctgaagccg ctctagacga actcccgtct
    36061 tccgacgttt ttgacctcga tgaagagatc aatgatcctg tcggtgcgat gcctgtcacc
    36121 gactctggca atgactttaa gccgatggac cttggcaaaa gagggagtat ccagggccag
    36181 agtaatattg ctaccagccc caccgatagt atgagcagcc ttgactctgg cgacaggcct
    36241 gggatgggga ggaggatgag tgcggtgagt gatgaagaga gagagaagat gaggctctat
    36301 agggagggtg tcctccacaa gaagcagggt tggttttcat atccatctcc gcttttactt
    36361 atgctgactt gtccttaatt gcaggcgtcg acttggccca catcgctagg tcctcgcacg
    36421 gtatcgccat gtcgcctccc accaacagct acctcggccc tgtcagccct tccaacacca
    36481 ggtatggttt caattttgta agtgttcaac tttagcacct ctttactctt attaatacaa
    36541 tatagaacaa gtaaaatgtt gtatcattat atatgtcgag ccggtactcg accccaccaa
    36601 tgtgcattta gtcttttgat gttgtgtccc cgcgctcaga aaatgttgat tagcctttat
    36661 atcagaaacc ctcacgttgt aggatagtca gtcgcagcaa tgccggagcg tttgtagtaa
    36721 atgtgaccag gaaagattta cagaattcat acatgacaat agtcttgctt cattatcaaa
    36781 cttcgactaa gatagcacaa cagcttacta ggacgcattc atcctttcct ggtgcccctt
    36841 ctttaatctc taaagacagc atactcaacc ttcctcacga ctttcactat gcccagtgcc
    36901 attcctcgcg accaattcac cactcttcac agtcctgctc cgtaccgccg ttctcgcacc
    36961 ttgtgccgct cattgttaat tattatttca tttactagct tactcagagt atcttcaccc
    37021 aagatgtctg ctgtagttcg agggaaatcc agaatagcat gaaaggatat caaaggcctt
    37081 agaacctcgt ggtgtatcgt gatttagagc aaatcgagga tcaacaaagc gcgaagaggg
    37141 cttcctttgt aagctgtaag atgtaatcgg cctgaacata tctcatgaag gactaccgct
    37201 cactatccga ccgacgcgtg cctactgata tgccgacaga ttatgctgtc tacttctgag
    37261 aagaattatt tctcctttca gtgaaatcct aaagaggccc tggccttcta aaaaaggcgt
    37321 gtcggcagat tgaccagtaa gagaaagggg aggaagaacg ttgcattcca gctttctagg
    37381 ctgagtcgat aagttgtcgc agcgaggtat gcagatggta ttaaatggag ccggtagaga
    37441 tcctgagcta gtgtcgccca caggaacagg aggactggcg gtgaccgtta ttgaaggagt
    37501 aaatccaaaa tcgagtaggt gcgagggttg gagaagatga attagagtag ggaatgaagt
    37561 tgtggatggg tggattggaa tggtttttag tcgtttcggt tgctggatat ggcgtttggc
    37621 attatggatt gatcgcaggt aggaataaag gcctacaatt tgcttgataa atgtctgttt
    37681 atagacctga cgaattcatg tgaattgata ggtcgacaac gcacttattg atatctgtga
    37741 attgcggtcg attgccgacc tttatcaata aatggtactc tggttgttca ataatctatc
    37801 gctgttagaa acaataattt ccgactgcca acaaacgagc atgtggtggg ctcaacggac
    37861 attcggtgaa aggcggaact gcatttcttc acgtcggccg cgctactgtg ctgagtctcg
    37921 tacagagttt ggtgcagatt caggtgcaga ttctgagcag cgagcagaaa gctagatgat
    37981 gtattgctga gccgttgttg gcagaaaggc agatccagct gtagtagtag tggcgtttcg
    38041 acacagaagc ctattgatgt tagaagttga atctgaacag atctgagtca gcggtcagca
    38101 agatgtctgc agcacgagat atatattcta gcaagattgc ttgatgaact gcacttattt
    38161 caccactgcc ggtattgccc ggcgtgaaat gttttgacag ataggagcgc tacagcagcg
    38221 ccaggcccca gtacccagta catgccacaa cggcgcccgg aaggcagagc agggatgcac
    38281 agtatttatt ggataccaca tatcgtcgcg aagcgctgaa aaggctgtac ttgtggggat
    38341 caacttgtac ttgcacgcag ttcagtgata taaatgcatg catacaagga tgagaaatgt
    38401 gaatgcaagt cgtggctgag tggggatgac gtgtctgcag tatatggggg tggtttttga
    38461 gcggcattgg cgagatccga taattagtgt tactcagtct cacggctgcg agtcctccta
    38521 ccgtcctacc gtctcctatt ccatccttcc ttccaaccgc tgcaccccct cgccaccgct
    38581 ctctacgccg cagtccagtc aaccgtacgt cctcctttct cccttcctca caaacgacac
    38641 ccagcgcagg cggtgtcgtc ataggcatcc cgagtcgaaa accaacgcgc gctaggaaga
    38701 cacgctctac cacaacgctt ctcccacacc tcttatggtc caaccgctct atccacaact
    38761 gctgactgct tttctcccca gaagtcaaaa tatccactct gcatccgcag cttcttccca
    38821 catgtcgtcc ttattcgagg ccgccgcggc cttcgaagaa gcggctgcac atggggcgaa
    38881 ccccgtcata ctcgaaaggt caggtaaagg acactcccct gtggtaagtg ttgcaagcat
    38941 gtggtggaga tatacttgct cacctagatc catcaacgca ggtcactatg acagacatga
    39001 gcggtgcgag ttcccgtgct ccgacatcgg ctgagattga tgctgtcatt gccgctgcga
    39061 tagccaacgc acctccacca cctccttcag actttaactc tgacagtgag ttgccttctt
    39121 ccttcagtag acgacgggag aaacagcatt aatggcagac tcattagtaa accgttctgt
    39181 aacgccactc atgacaaatc ttttgccctc ggcagttggt agtgacgggc gagtcaacct
    39241 tttcgtgggg aacgtaaatc tatttacttg ctgcacacct aaagttgcta actctgtgtt
    39301 agctcccgta tagagttcga tggcaggatc taaaggatct tttcagaaaa gcgggaacag
    39361 tattgagggc ggacgtcagt ttgggaccgg ataataggag tagaggatac ggtaccgtct
    39421 taatgggcag cagggaagat gctgcacgag caataggtac gttggctgat cctcgtaacg
    39481 ttccatacta atccaaacca gatcgctaca atggctacac ttggcagaca agaacccttg
    39541 aagtccgacc tgaccgtctc ccgccagagt atgagcccca gtcccatccc attcaccaca
    39601 acgccaaccc tcgctccgcc atgtactctt tccataactt ccctggtccc tctcatacac
    39661 ctttttccat cccgggccac atcacccctc aatccggcca aggctggctc cctggacaaa
    39721 taccgagttc aaggccgttc tcggcggccg gtggcctgat acccggaggc atgggtgtcc
    39781 catcgagttc aagtgctgtg ggtctgacga gctcgacgcc gatacctggg gcgcaatcgc
    39841 ccccttctgt cttcggagct cagcctcttc cactcagcgt gcaaaatacg ggtctgaatg
    39901 ctttccactc gcttggacag tcacctcttg ctggatctct cacatctggt actggagctg
    39961 ctatgcctgc aggtgttagc gcagttcgcc gcgattctct cacacccttt ggagcgtccc
    40021 tcacaacttt tgattctgca gcggcccctc tctcgagtac gtcacctaat atggccgttt
    40081 cacggcctac atcgagcagt ggtagcgtca agcctccttc tcctggtgga agccgcgctc
    40141 ctccaccagg tacgcttggc ccccttcctc cttccttgtt tgccggtata aaacctgcgc
    40201 cagctgttga tgcgatagca cctacgattg caggagatgt accagcacag agtccaaatg
    40261 gaggagcggg gagattggcg gcggcgccga ttcctcagtt ggaaggattg gccaaccagg
    40321 gaatgggatt aggtcctcct agcacgctgc atgaccgagt gatttttgtc tcaaacgcaa
    40381 gtcaatcatc tttgaaattt caccgcagac gctgactgaa tgtcgcagtt acctttgtcg
    40441 atgcaatggc aagatctgaa agacatgcta aggcctgcgg gaaccattat tcgagcagag
    40501 taggtttcca tttttcattc gtgaagagta cctaggtgct gattcaagta aaagtgttgc
    40561 caccgatgcc cacggaaagc ctagaggatt cgggactgca ttgttcgcta ctgaagccga
    40621 tgccacaaga gctgtacttt tgttcaacga gtgagtggcc caaagcttca acgcagatca
    40681 tagctgacca gccgttagcc gcgagatcgg tggtttccgg attcgtgctc acttggagag
    40741 ggacatccac cccgaagttt ctcagcgtag tgccagaaat tctgtatctg gagaggctac
    40801 ttctctgggt atccaggacc acctgactgg cgtcccggaa ggcgtcaagg atatgctcca
    40861 aagcaatggc attactccga tcgacacctc tgttccttcc accaagccta gtagcacttc
    40921 ccccattgcc aagctccctt ggagtctgaa cacttcttta cagactcaca ccgccccagg
    40981 gcatggccaa ccccctcatg gcgaaccatc acccacctct cacactcccg tgttccgtca
    41041 cccccaccat cccggtccca tatccatgcc tcccttccat atggaacacg ggaatcccat
    41101 atcaccactt cacactcgcg gtctccctcc tatgacacct tccatgcctg gattcgtttt
    41161 caattatccc gagacgcctc ctcttcacgg gcacgcctct cattttatgt ctcctgccgc
    41221 tggaccattt tcaccaggca ttcctgtcac atcgcccggt gcattccagt acaacccttt
    41281 cctcaaccct gctcctggag ctcctgttaa tcgcttccct tctactcctg gtaatcaccc
    41341 acaagccggt tcagctgcac tgggcacacc tacgacgcag gcgtttccta atgggccgat
    41401 tggatatggg cagtatgccg gtcccccagg tggggcgtta cagggcaaat ctgagaattc
    41461 accgcaagcc aggcagggac aggattactt tgccaacgcg atccctcctc aacatgctac
    41521 ttccacagct ggaaatagga cgttgggcgt tggtgctttg ggcgggaaag acaagttgcg
    41581 aagtagtcca ctgagcgggg gggatggtca gaacgattcg gatgaagaga cgagagcgcc
    41641 gtccgcggtg ggtgatgagt tggcgaagat ggcggaagaa ttgacagttg atgacgagaa
    41701 cgaggatgga gagccaggga ggcagagttc gagtggattg agcctttcgg gtttgggttc
    41761 aagtgcggca gttagcccac gtggtggaag ggctagtatg gacgatggaa agctgggtag
    41821 gcactagtta acatttctct cttttttttt ccttgtttcc ttttcggtga gggttagtga
    41881 agaagttggc ggccagaagt caaatggtcc tgggtttgag ttgggaaaat tcattcttag
    41941 tctttttctt tcgggcaggg aggtctctta aattcattca tttctttcag gtatatatat
    42001 atatagtctc ttagttctgg ttagtggcgt ttcatagaaa agaaaaaggg attggaattt
    42061 tagcatttga cgaataaaag gtgggattca aagcaagagc attataggga atttcattcg
    42121 ggtagaagga gaaaaaagtg ttttatgcat agttcttccg agcttttctc gtttcggtca
    42181 taaataaata tatgacgctt gtcaccactt gaatcatttc cctggcacat tcatttccat
    42241 cgctactcta catgtatagg ccccgtctaa tatatgagtt acagtgttac tgttatgcta
    42301 tgtatcccgc cgctagtcag agactgcttt ttcagtgcct tccagcacgt tcttggcttg
    42361 cgtctttcac taatcctctc attagtactg ctggttcaaa gattccaatc actgacttac
    42421 gcctatgtgc tggttcccat cccccttcca cactttcgct tttcaacaat gggttcggta
    42481 aagtatttgt cgttgaaccc aacgatgtgt aaccttggtc atacagtata cagtacggca
    42541 cctgaagttc aaggaggaag tcccatacat ccgagtatgt ccaatgaaga atagggtgga
    42601 cgcggatgaa ctgaggccag gaagggtcgg tgggtgctat tatgtccacg gctgcgcgct
    42661 tccgttaatg actgcgcaga gtgagtagat gagaatgaac tgaccatcat tgggatcacc
    42721 ctgcctcgta ccgaccaaaa cgccttttac tccccttcct cctccacatc ccagccattc
    42781 ctccaaagca gccttcatac cccctccaaa tctgtacaaa tccagtccat acagcttggt
    42841 ggatgaaagt acaaactcgt cgagttcagc aaaagggttg ggagctgtta tatatattga
    42901 acggattggt gggtacggaa gatcggtcgg tgggtggtgg tgggtggagc gaggatgtga
    42961 aaagggtggg gacgggttgg aggctggtgg ggtgatggaa ggaggcgtac atgctggcaa
    43021 ggaaggtgga agaactggtt ggggcgaaag aggttcttgc ggggtacgag atggcagcgg
    43081 agggatcgtt atctttggag aaggcttggg aaatagatga ggtgggaggg aaggggtatg
    43141 tcgggcatac aggacagcag catagagatg cagcaatacc gtacctggaa tgaattgccg
    43201 acaattagcc ttgagaaagc aatggcagca agcagcttgc aggtagacat acaatcttta
    43261 cctccattaa aagagatcgc cacagtttcc tctctgcatc catccgccat cagcagtcga
    43321 tccaaattgc acaaactaaa tacgcaccca aggatgtcga tgacagactc gattaggacg
    43381 agggcttcga ttatgagctt gccgagcgaa tcttgctttt gagctctttc cagaagagcg
    43441 tgcaaagact gggatatgtt cgccatggtc ccgatagctg ctctttgggg cctctgagga
    43501 gattcgaagc gctgaagaag gcagcgtggg cgagcgactg agaatacgta gtagccgcga
    43561 agagcgcgat aaataagtcc gtcctctcgg atctcatttc ggtgatctcc ggttttaccg
    43621 aaaacaaaag gcgggtaaaa gttgaacaaa aagcacaaga tgttaggcat gcgccaggac
    43681 aaccttgtgt agaaaatgtt gaatgatcgt tgaaagcgtt caatagtgtg tagctaaact
    43741 aaaaatgaca gagaccaaag taatggagaa ttaggatcta attctttgat tagcacatgg
    43801 tggaaaagtg gcaggacagg tgtcgagttc agtgagatgg actggtgcaa ggcgtcagaa
    43861 ttaggagagt aaaaggttgt caacgagaga atgagcaagg atatgcatcg aaataagcac
    43921 agagttagta gccgttatta tatccaaggt tatagagtat gaaatgatcc cattccagcc
    43981 tgaacgccta tatccagcct gcaaataaaa gccctactgg caccacagac accatcccca
    44041 acatcttctc tctcgccgtc cgccaccatg gcctacgaat agtagcccca ttaatcaccc
    44101 caacaggtcc tccagcgccc gtcagattcg agttcgtttc cgcctgctgg gttgtcactt
    44161 ctgcatccga ttgttggtac actttgatgt aattgatgag catgaccgtg ttattgaggt
    44221 tgagtgggtt ggagacatat tcgggacatg tgccagggca gtaagggtat tctagaatga
    44281 ttttgtttgt gcatgtcaga caaaagtaat ggggtggaga cgaaaaggga gaacaaaggg
    44341 cttacgatcc cacacactgt tgatccagtc gccgcagagg ttgatattga gcaccaaaac
    44401 ttgggctttg aagaaggact ctagatcgca gatggatgcg tcccagatag ctgttggtag
    44461 atcccctaag gtccttccat gttagctaat gatcaggtga gaagaatgct caacccacaa
    44521 gcgtcgggat caggcgtctc cgcagtgatg ctacttttga tcagctttct taaaactaaa
    44581 ccaaatagcg ttcaagaacc caactgactc ggatggtatc tgtgctctat tccagttccc
    44641 taacgcccac ttagcttgat ccgaaaacaa aaaaaaaaaa caaagttccg atatgggact
    44701 cacacatacg aatcccatct gtatcccatt tcattgcgaa tacgccccca ccagccgagt
    44761 tgaatggcat cccgtacgac gagttggaag cggaaataat ggagcagcca ctgccgcctg
    44821 taatcacatt attagattgc acacacagtt tgtggaagaa agatgattaa tgacctgtag
    44881 atgaatcaca atcttgattc ttcaaaaaag aggtcaatat atatattcaa aaagaaagag
    44941 aaacagctta cagtcaaagt gcccgagtac agattgctgg tgctgtaatt aatggagcat
    45001 cctggcatcg tatgtctgtt ttatccgctc agttctacaa tccacatacc cttaggggca
    45061 ctactcacat agtcatttga ctaaggattg tagccgctca gctaggatat ggtcgtgaaa
    45121 tacatggcat cacaaagcta ctcacttgtt agtgtttgac tgaatcccct cgataatgtc
    45181 aatttctccc ttccggtatc atcagtattg ggcccaaatc tatctccata tgaaaaccca
    45241 ctgtctcagg ccaagtccct tcatatccta acgtccaaac ttattaacca aggtaattag
    45301 cacaccagta catcttgttg accattacat cagaaccaaa aggcacttac acgccggcca
    45361 aacgccacaa ccccacggca tcagagccaa atcgataatg aagagaccac cttcaaataa
    45421 tgatttggta gtgattcgga cagagtttct gttggcgccg acggctgtat cagaccagtg
    45481 atctacttga atacctggta ttccatcgct tgtccagaac gcaagaccat ccttgaaagc
    45541 tgttgcgtta tcgacatagg tcacgactaa ggagtttgag gtcaatattt ctttgtttct
    45601 cattttaatg aaatatcttg actcacggcc atgacttgga tctatcgaca agcaaccttt
    45661 agcaagactg ttcagattca agtcacgcac ctatcattgt gaaccagtcc catccatcaa
    45721 aaaacgtctg tccttcatat gcgatttgaa gttcccaatt caacgctctt ttcgcttctt
    45781 tatcccaccc tataagctca gattgactat acatccgccc aagaggcttg gtcctgcggc
    45841 ttctatggct gagagtaggg tcgtctctaa taggaaaaag gtgaagcgtt gtgtggtcaa
    45901 gagaggggac atgaggagtt cgatagggta gtaaaggctg gagggttttg gaatgggtcg
    45961 ggggtcgagg ggaggggctt atagcaccta caatgccgag aagaaaggta attagcagta
    46021 tgtgtatcat tgtgcttgtt gaaattcggc aacctcgact tgatgacaag taaggtcagg
    46081 attcagtctc ttattgtatt caaagtccct ttaacacgtt gataggcctt cttgttcttc
    46141 gtctttgtgg tcttcttcgc tacttggcgt gatgtctctc ctttgcctgt tgtcgcccag
    46201 gtcagtagca aagtcgaaac gattgatgat tggcatatca ttatcatctg tgactgtata
    46261 tggcttttat cttgtcgtct tgcagatgcg tcctcgaaaa atcactgcga agccgtggcc
    46321 aaaggaccct cgacacgttt ttttcctgcc cacgcttcca tcagttcccg accatccatg
    46381 cgtgtgctgg aaacaataaa attggatgat ccggccaaat ctgtcaatat gggtggtact
    46441 atagattgag gctgagcttg ccggttgcag ttgcgaggat agccacgggt atccaatgga
    46501 aaagttaaac aaagcagcgc attttgttgt tccatcgaag gacacgcatc gggtagtgct
    46561 ttgtaggcat ctgtctaggt cggcgggcag gggatgtaga acttgaatgt ctgatgggtt
    46621 tgatttttcg acttgaattg ccatatcttt gaaatacgtg caaaatatgt gctatcaact
    46681 cacatctaca tcttatttaa gtgtctccgc cacaatgcct tcactcagct caactgcgac
    46741 acgaaagcgg cgtttaccac ttgaagaccc atatcaacat acattttcag ttattcatct
    46801 aaaacaaccc caacaaatca tcttgagccg ccgcctgctg ttgttgtttc tggctttgcg
    46861 gagctccggg ttgcggcgat acactctgcg gtgggctaga cagccctgcc aatccattta
    46921 acccgcccaa accccctgaa ctctgagctg acgtttgagc ctgagctgca ggctgaccag
    46981 gttgaacgac tggtgttgtc atgctagcag tggagaacaa gtccattaat tcatctaacg
    47041 ggttcgtgct cttggctgcg ctcgcaatag cctgagaaga gatgcccaaa cccgcacccg
    47101 gagcagggat ggaagattcg ccgttggtag gagtaggttc gtcgtcaaag tcgagcaggt
    47161 tttcggcttg gttaccggca acgacagctt gaagagcctt ttcgcgtgag acatcgtcct
    47221 cggcactgtc cagcataggt taggtcatca ctataaggac tgaatgagag atagacgtac
    47281 tccaagctct tcttgtgcat ctcgtctgca cccaaacgac ctttgcctat gaacgtagcc
    47341 gcaggcttgt ggtacacact cgccaatgtc gagatttcgc caataagctc ctcaaggatt
    47401 gcaggagcga cagtcgtttg aggaagactg ataggtggtc tgactgacaa aacaacagac
    47461 tatattacat ccattagaat ttcgcatgaa gcaagaggtg gatattgact taccttggca
    47521 gcggcggggt cggatgacag caatctccag tatatgtagg ccctatctct gacgtctggg
    47581 ctgtcacagt cctttgtagc agcttgaagc actttttgga cgatagcctg gctttcatca
    47641 ggtttcttga ggaacagctt gacaatcgca gtaagggttt gaagttgaac ctgcagagat
    47701 gatgagtcaa cgagtgaatg gtgaaatcat gatgagtcgt acaggatagc tttcctcact
    47761 gaaagtctcc aagaacgctc ccagcaactc gtccgcattc tcaatcttct ctgcgtactc
    47821 gccgatgagc caaatcaaag aggccttggc ctcaggctca tccaattcct caagattagc
    47881 acagagcgcc gggatgatac cttcgtatga gtgggggtat tttcggaaga tgtcctgtca
    47941 aagaattagc ctcatccaga tatacccatg cagtgaagct taccttgacg acgatgacag
    48001 cctcctgtac gacatagctg actcttgtct cgatcagttc catcaatact tcgacacatc
    48061 gcccggcagc ctcatcgatc ttgatagcaa cttggccaac cgccctgaca gccttgcgaa
    48121 caaaatcgac atcaacttcc gacgcgtatt ccttcagctc cccaagcaaa gtgtccacat
    48181 tcttctcgtt cgccaatcta accataatct caagtttctc caccttgacg taggaaggat
    48241 cgttatattt gcagaagaaa acgcgcatct cgctggcaag gatatcggga cgtttctgca
    48301 agaggaggtt gatgttacga agtgcgaccc attgcacctc gggcggtgag gagataaggg
    48361 tgactgttcg ttgttggtca aaccattcat ttttgaatta aaaataaaaa ataaaaaatg
    48421 ttgaactcac ctaatggagg agccattttt cgagtaagag acttcaaaag gtcttccttg
    48481 gtgacatttt tcatatgaat catgatcacc tttaccgcac ccaacacaac tgccgcattc
    48541 acgtgctgaa actggggcat cactctttca cagatatgtt cactctcctt ctcgtcattt
    48601 gtcctatatc tcgccaaggt ggtgaggatg gcaatacgac cccattcaga acattcgttc
    48661 aaagcgacaa ggagtttggt aagggtagcg gggtcaatga tgaaaaggga ttgattggga
    48721 cggacactgc taggagattc atcgtcattt ggcgagccgg gctgagaaga aggaaggtta
    48781 agagaagcct cgtgaatatc cccgagtgcg gcaacggcat ttgcaacaac ctgtcaattg
    48841 atcagacatc ttcgtacgct catcattgca tgacatacca taggattacc atcgccgata
    48901 agatctctca aagtttcaat gaacccgtat tcgatagcca gctctggctt caaatcaaac
    48961 actttggcga cacacagagc agcagtcttt cggacgtagg ggttctcatc tttgaggcat
    49021 cgagataaag gtgaagcgag gtaatcgagg attttctcgg cgcgaaggat ggacatggtg
    49081 cggatggcaa gagctctaac aagaggattg gggtcggcag tgtcctttaa taaagcaggt
    49141 tagcagaaga gatggaataa gtcaaactca aacccacctt gacgaaagtg ttgacagcaa
    49201 ggataacgag ttcaggttgt gtcttcgcat agttcatgag atataaatat acgagtttct
    49261 tttgctccag atcatctgtt tgctgcggtc agaacatcag ctcttacctg tactcccttg
    49321 ctccttgact ccagcaaaga gttattaaac actcaccata ttcttgacga catcgggaaa
    49381 caagccacta cagtccttgc caatggtatg gttcgcaatg actctcttga tagcatctgc
    49441 ccgcttatcc ctgtactctg agttcagctg ttggcgaagt tcccagttct cgcctgaaga
    49501 ttgcatggtt agcgaataca tgtgacgtga attagggatg gggctaacct ttgcggggcg
    49561 gggccatagc cattttgaac gttttttgtc agggattaaa tgtgtgtgta agggatatgc
    49621 gatagtactg taagtggtgt gtaagctgga gattgaaata tagcagatgc gagctggacc
    49681 agtgtaaaat aaaggatgtt atggagagat ggacgattcc agagagtact tgcaaggtgt
    49741 cgcgcgcatc gtcatttaat ttccaattta atttctcaga ggggggtcct gtctttattt
    49801 ggcttgttct ttctaccctc taatagtctc cacttctcct gtgctcaatg tttggccata
    49861 ttacgtatgg ccaaaagaag taaactattg gatacaaaca gcgttaatgc atgaccgccc
    49921 catgctacgt tacactgata atacggacag cccaaaacgt tcctggcctc ccgcaaatcc
    49981 ctcttctaca ttttacgcca cattctcctt cggcttcttc aacaaaacca cgtcctcgtc
    50041 catctcatcc tctgttgtct cctcactttg cgcctcgaac tttccctcag accactcact
    50101 tgaaacacca ctagagtgaa caccacgctg gcggagggcg ccactttcag agatgtcaag
    50161 ttgtatggag tcaccggcgg gaggctgagt ggtatttcta gatatggggg gtgcaagagg
    50221 gacttcagca gaggtaggga tgggggtaga ggatgaaggc cctggttcag atatttctcg
    50281 gagagcgtga agcatacttt cgcgagtgga ctcggcaaga gaagtaacgt cgtcaacagt
    50341 cagaccggtt gtaggaattg gggggagcac taccacagtt gtcagttata tagtccagtg
    50401 gcggaaggct tttcttctta cctcgaatct tgagaacacc ggactcaaac cttgtgcgtc
    50461 cgtcgaagag tctgtgatag ttttcacaca cgatagggac aataggaatc tgagcttgga
    50521 ccgcaaggtg gaaagcaccc tttttgaaag gaaggagggt aggttcagga gaagacgaac
    50581 gtgttccctc ggggaagatc caaagagaga cctagtctac ttgtcagtgc gttaccaata
    50641 tgctaaaact gacgtcaaaa cttacgccct tcttcttcat gtcctcgcca gcaattgcaa
    50701 gggccttaac tgcatcatgt ctattttttc tgttgacaaa tacagctcca gagagagaca
    50761 ctattaaatg ttgttagttt agaacaagct ttgataggcg ccgcactcac tgaattgacc
    50821 aagaagagga gtccacttga gctctttctt cgccataatg gcggcctgct tagggaagat
    50881 ccttccgata taaagaatgt ccaagaaact atagattcat tagcataaag tctgcttctc
    50941 caatcaacct ttcacccacc tctggtggtt actcagaagc acagctccct ggtgttgccc
    51001 atccctagcc gtcataagcc cctcaagatg ctcctctcct tcaacctcaa atttgatccc
    51061 aagcagagga ccactgagtc catagagtga tctagccaca tagtagttga tgtttaatct
    51121 ctatatcgcc atttgtgagg taaataatag cacgttcttg ccaccttcta tccacacaca
    51181 atgcaaaaga agcacgtacc tgaccagcag cagttgccaa aatactaact actacccccc
    51241 agacactcat gagacctaaa gtggagacat agatggtaag attgaagtag aatcgcgcac
    51301 gttgatagcg ccttgataag acaccaagcg ttgaaagtgc gacggtagat acgagggcaa
    51361 cgggtttgag gagccaggag atacccatgt tggctgttcg aatgcagatt cagggttgct
    51421 ggcggacgag cgagtggttc tatggccctt gacagattta tctatagagt ataagagcca
    51481 gatacaatat atgcgaaaat cgtgttaaat gtctccgtgc ccaagcaagc ctgcagtcga
    51541 cgatcatata ctataaattt gatcccgttc aggcaccgtg gtgacgtcga gagctgttga
    51601 gatggttaac agcaacatca ccggtgcagc aacatgatga tacgagcacg acagttcaca
    51661 tattttccat acgaaattca attataggag tattagcaaa acaatggcga gtgtttcgca
    51721 aaagacaagg gtatatactg accttttttt tcagtcacga acggtcgata tccctcagga
    51781 cgtcctcgac gctctcaagc agttccgatt caagaacagc aaggggacca ctgccatctc
    51841 tggcaagttt gcccacattt tctgataatg atcatgtcta atagaaggct ggatgccttt
    51901 tagtcaagat catcaagaac agcttgacca tggctgtgga tgaagagttc gagggtcaat
    51961 ctatcgagga aatcgctgag ggtaagttta cggatgattg acatgtcatc ccgtaactaa
    52021 cggctctgca gaactgccag agaatgcccc tcgatatgtc ttactctccc acgaacttgt
    52081 gtgtaatgac cattaatgat tgtctgtggt gctgattaaa ttgaattctg cagaaacaca
    52141 aggatggccg gatatcatat ccccttctgt tgatcaactg gtaagctggt ggctttcgca
    52201 gtgcacatgg aaaatcgctt acagatccat agggcaccaa ctacttcgcc tattgagctt
    52261 atgaccctcc acgcttcttc cctcagctac ttccaacaag tttctgaaac tgcaaaagta
    52321 tgtcaacgct ttagtcaaac tatgtccata cgctgatgat tactccaggt ccttgaagcg
    52381 cgcgatggtg ccgaggggtt gaccacggaa gccgtcgatg agaagttgct ttcccattag
    52441 ggcagcctat ccctttgcaa caaacgattt gaaatgcaca gatgtaactg agacaaaggg
    52501 gttatcaagt ccatggcaag tcgtaactga catttaaaac gaaattgtac aggacgtaat
    52561 cgtgacatta tcaccggaac atgcgatcaa caacatttgg aaacgatttt tgacatttag
    52621 tgactccctt tttgcaccag cacaattctt tggcgcagag tgtgagcact ttacgtgtac
    52681 aatagccacg cggccttcgt tcaatgtcaa gccgttcgga aggacaattt gaaacgtacc
    52741 atggcaacca tcacacggta taccccgcct ctggccaact ttcttcttgc aagcgaagca
    52801 tttatcgccg ccaattgggg atggactaat tttgagactg ggaaagagat gcggaggctt
    52861 tagggggaag gaaggcgttc gcccacatcg acctcactgc gatttactca accacgccga
    52921 atcgaggagg acaaatctta tgactggaag ccagcttgcc gccaaggaga ggaactgcgt
    52981 cgctatcaac cagcgtaaac ctgtggatgg cgtacttgtt cgctagctta gaatcaagcg
    53041 gattggccgg tatggttata gcagacgctg gagaccagtt ttatcctttt tgtctgtctg
    53101 acccaagcca tcgttctcga atgttccagt aatgatctcg gacgcggact tcggttgttg
    53161 tctctgacag gagctgaata ttagacccta ccgatgtcat tgaaaaccac atcatcgaat
    53221 caatgtaccc taacatagga tagaaatgct acgtaaatgt atggaagttc ataataatat
    53281 tgactccatc gccgacccct cggagcttca aacaagttca gattctagca cagaccctcc
    53341 atggtcttat ctcgttcttt ctattcttcc tttcttcttt ggatgcaaca aagtacgcaa
    53401 tcgacctgaa actagaacaa aatgaacgca aaaagaatta acccgtaaat catcaatcac
    53461 tgaatatttt taatctatgt agaaatcatt caacgtggaa gagaaacttg caatgagcac
    53521 gcagacaaaa aaaaaccaaa tgttgtggtg ctaaacagtt tcattccgat caccaggcat
    53581 gtgtcgaccg cttggcaaca acccgtatgg tttaattgta aacccgagat ttggcattgc
    53641 gtgtagcctt aatttctgag ccgccacgca tgtcggatca aaaccgtgta catgatctga
    53701 tagcaagaat cattcccaac aatcagttcc cctgcctttt tccaagaccc ttctcaactg
    53761 gctaacctcc ctaaccaagt cctttacagc cttctgtaac tccgtggtat ctctgtgtat
    53821 accactcaaa gattgaacct gtccgctatt gaacatggaa gtgaagaaca cccatacaaa
    53881 gacggctatt accagcaaag ggatgtattg gccgagatcg agtttattgc caacgccttg
    53941 ttctctcttg ggaggaagta gaggctgctc ttcttcaata tgggcacttc gagatatgtc
    54001 agctgttgcg ttgaaatagc ttgaggagat accaacgatt cgtcttcgga aacgtttggt
    54061 gaaagaccag gcatcctaaa cgaatggagt gatgtgataa atagaatgag aaaacagtca
    54121 aatcaatggg acggtcggtg aattctgaaa agaataacaa aaacaacaat aaagaagaag
    54181 gagggtggta agaaacgaaa caggatgata tataaacatt tgtacttgtc aattcagcct
    54241 ggacctatta ttatacattg cactaatacg ctctaatacg ctctacgtag tacgaacgcc
    54301 acatccgcac tgcatttact caagtagtag tcttacttat tagttattaa ggaagctgtc
    54361 aatagtatat agaccgtgtt tgcggttcga ggaataagct tctggcttcc ggcttaggac
    54421 caccatgtca gccggaactc ggtttctgcc ccactagcgt acttctgctt tgtatttctc
    54481 tgatcatcac cgtttcacca ctgatcacca tcagtcctct cggaaaagac cgaagatagt
    54541 tattatcgct tttggcttta cgtaacagac atcctgccct ctcaccctcc tcacaggtcg
    54601 ccgacgattc acaccacgca attgttgtca ttcttttctt cgtcgttcat tgatttccta
    54661 cctccattga accgggcaga aacgtacaga aggcacctaa gagacatatc aaagggaaat
    54721 tccgggctgg gatttgcaag ctgacgttca acatgcctac aagactcagt caacgttcgg
    54781 ctctggcccc tactcgcatc ctcgaaccta aacgacactc ctctgaccag tcttttggcg
    54841 gcattaaact tcaaattcga cagcgtgtac cgcaactgag catcagcaag gataaatttc
    54901 gcaatgaatc gctgaggacg aagacattgg atcagcagga aaaggaggac ggcgagtttt
    54961 attatcagca ggaggatgcg ggcatgccat cggaggccta cgtgtgcgag aagaacatag
    55021 caaagaagcc ttccaggcca tttgtttcga aggggtctca tcgtgagtct atgattggtg
    55081 atggtagact gacgagcgct gcttagagct caaagtaata gcttcattgc cctctatctc
    55141 cactagccct tctgcgttct cctttcctga gcagcctctc cgagaaagca tttcaaaatc
    55201 gattgacctt tggtttgatg acttcaaaac agactctttc atctcgacat cgactatcga
    55261 caatccacca ccaacgccac cgcccaagat cacaattgag tcggacgagc agccgactcc
    55321 caaggctaca caggtcgctt tcaatatcgc taccgctgtg cgggaagctc cttctatcaa
    55381 tagcttcact gctaacggat ctttcctggg ccttccagaa gaagcggaca tgttatatag
    55441 gagtaatatt gtttggggcg accttgacca cagcgaggat caacaaacgt ctcacaagaa
    55501 acttgccgct gcgcagcact tgtctcccgc gagtgcaggt tcacagaagc atataaaagc
    55561 tgccgattta cgatttgaag acgcagaatc ggaggctagt agggcaagaa acgagggaag
    55621 ttgcgatctc aacgacaata cggaaaaatc ggagccgttg gacaagcctt tgccccattt
    55681 gccagatgac agtggacctt cagaatacag tatgactact tattctcaat cgtcagcaat
    55741 catctcaaag acagctgaat cacctgaagt tttacactct ctgaattctc agcctctccc
    55801 acagtggaaa tcatcaacac cgcgcagact caggcatcac actgtctcaa ctaaatccta
    55861 tgagcattgc gacgaacctg agcaaggtga agaggaacaa ggcgcggccg tccgtaatca
    55921 gacgcgccat agttcgtctg gatgggaacc tcccagacag gatggtgagt gtgcccaggg
    55981 ggaattatgg tatcgtcatt cagcttatgt ctcgcgtagc tcaagttaaa ccagagtcga
    56041 ctagagctag gcatggcaaa gcaggatcgg tatcgtctac agctacagcc aaaacgatcg
    56101 ggcaaagcca ttatccggct ggaagtactt tgacaaggaa tcacatccgc gcagtggccc
    56161 ctcaggaaac ctctcgttta gtcatcgacc acagcattgc ccccgccaag cccattatgg
    56221 atacagtgac caataggatc aatagcgcaa agggatccaa atcaactcgg ggctctttcg
    56281 agctcaacga tcacgcagtt gtccgtgcta gcaccgctga aaatcagacc atccactctt
    56341 tggtagaaga tgacgatgta gagataattg gtgatttcac ctttgcatct tctcgccgac
    56401 cttccgtatc ctcatccgtc aagaccatgg gaactgtcag tttcgcatct gccacggctg
    56461 cccgagcccc tcggatttct ctccgctctc cgcatgatcg caacacgtct tctcaagact
    56521 ctccggcaca gcacccagtt cgcgcgcgct ctcaatcgga ggatcccgta ccgcgctgca
    56581 tctttggaat ctccgctata ttttcccaat caaagccagg accaaatagg aaagggcacc
    56641 gatcaatcct cgacccgttc tcctctttcg atccacacgt acctattgtt ccatgcaaga
    56701 ctgtccccaa cgacaactgg atcttgatca ccaacactgc ggaagatgac atacttcgac
    56761 cgggttggaa agatgtagaa atgcgatggg tggaaggtga gagctttggg gggtggatga
    56821 tgaggaggat tcggggagag tgttggaata cggtagtggc gagagagaaa agggctgatg
    56881 agcagctcag aatgatggag ctgagggatg gtaaaggagg atagaattac gtagaagctc
    56941 attttacatt ttgttgacac acaagcgtcg tttgtaattc tcttagttcc cgatttgata
    57001 tcatgaatgg acactatcat cgctatatga aaattgcatg agcacattgt tcatgatgca
    57061 tataatatgg aatatgtgtg agggattgaa tctccccccc ctcaaaaaaa tgcaaaaaga
    57121 aacttcctgt cggagaatcg aactccgatc tcccgcggac gcagtggata tgaatcctcc
    57181 agtgacaagc gagcatacta gccgttatac gaacaggaac ttgttattga gcatgtgaag
    57241 ggtacaatta taatctcttg caaaaaaaga cgctttcgtc ttccatcgaa tattctttcc
    57301 cctcctctag ataaaagtat gtgccctgcg aataaccact tacgcattcg tgtattttga
    57361 gttgtcaatg aacaatagcg cgacgtctgc taagacccat aaacctttgt tggtcggatc
    57421 actatcgttc cgccttttgc ttatcgccac caataactaa ataattgacg atgataaatg
    57481 aggagtctat ttcttccctt aaacttgatc cgatatgtgc attattaggc tcttccaaag
    57541 tttttttctt tattacttat attagaatat gtctgtgaat attctgtact aattagtgca
    57601 cgtcacagat tacgtgtttt ttgctacaat tgtagcagaa aaggattata catgttgtca
    57661 cgcggtcttt tcagctcgtt gttccgccaa cgctttgcgt tccagctctc tccaccactc
    57721 aatccttctc tcatacgccc ttgatccagg ccctgggctg gctacaatcc tgataccttc
    57781 ttcttccaat tccaatcccc tcccttcatc acctcggatt ttctttctcg cctctctaca
    57841 ttccctgatt accgtgtcaa acccaaccca cttcctctca tctccatcag ctgctatcac
    57901 tcgctcccat ccccaacgag ccttgtacgc cactccgaca ctacaggcat tccaatcggc
    57961 atctttccat ttcccatcaa gatactctac attcttacac acctttgtcg ataatacatc
    58021 cgccatcaaa ctcaagatag tacggttagc gctggctccg cccgtggcgt ataccttggt
    58081 caaacgaggt aggaaagcat cgacattggg agaggaaggg tcgtatgggg tggaagagtc
    58141 gtcaaggatg acggaggcgc gggaacggta attgaaaagt tgggattcga ggagggcgag
    58201 ggcttcttgc ctgatgtctg ggaattggtc gaccttttta gcagctggta cttcgaagag
    58261 cgtcccagca gtaggttcgg ttatgtattt gtagatacca tgtgcaccgt gtggctacgc
    58321 tcgttagccc tgtatagcaa gtccattcat gtaagtggtc attgtgaact taccacgata
    58381 tctgggagaa gccaccagaa ggctgtacga gaaggaaggt cgatgactga cttggggcgt
    58441 agttcctcaa ttgccgcatt aaacttgtcc catgatccat caaagtagag atctcgcaca
    58501 tgttgtcggg taagagagcc atctacgaaa tatcagtatc ttgacttcaa gagcgaacaa
    58561 gagcatctgc tcactcttat aaacgatcat gttgaaatat ctcagaggtt ctgctccttg
    58621 tctgttttga tcgtcttgct cactaggagg tgctatctga gccgggtgaa agaatgcgtg
    58681 gtagtcggga tcagggtggt aggcgcttgt ggaaatgagg acaacatcag aagtgccaag
    58741 agagactaga ccttcacttt cgcgtacttt aggcggtcag cgatgtgaca atctgcgaaa
    58801 cagtgtggac ttacaagtca agctcaaaaa tgtagctgga ttgtccccgg tgccagggaa
    58861 cacacagcat tctgaactga acccgtaccg atcaacaaac catttgccta tacgccccac
    58921 aaccctacct ccatccgtct ccactgtccc tagtttcctg gaaagctctg ccgccccatc
    58981 atcaccagcg attgccttca gcaattcctg attccaccct cgctgttttc tgttcatagt
    59041 ccacagattc atcccgcaag catcactttc gtcgatcccc ttgacttcgc catccaagca
    59101 gagcagagtg gtcactgagt tactgacaag gccaattcgg tcagtctgat cgtatgcgac
    59161 aggatcgacc cgcttgaaac gcatgatttg ggcaccagtg aatcgttcat atgctcgaga
    59221 accagtaagc tgtgcaagtg cagctgggcc accaacggcg gcgtcgagtg cctgacattc
    59281 ggcagtggtg gaggaatctt gccagttggg gataataggt cgagaaaagg cttcgacgag
    59341 ctgtgaagat aagggcaatg aggaatttag agaagcaagg atctttgggg aagttttaga
    59401 ccagtaaacg gaagcatgtt gctgtggttt tatcagcgat gatcaaaaga ctacttagca
    59461 aagaaaggac ttacctgtcc ggcggctgcg acgcctcgaa tatcgtcgac tttccagccg
    59521 gcgattttga tcttgtcaaa aagcaaatcc atcgctccga ccagcatcat tactggcgaa
    59581 tgaacttgac catctgagcc gaaatgtaca cctccttttg taccgaattg aggcaagtcc
    59641 gagtcaaagt ggatggcaca ttcggcgact acatccaggt tgactgagag tagcgaagct
    59701 ttgagggatt gcgtggatgc gtcgaggcca aggaacagag gagatgtcat ggtgatttgg
    59761 gcatgagaaa gctaatgatg agttttgatg gtttcaagaa tcaagagttc agaaaatgtt
    59821 tatatatcgt tcaaatttcc gcattcagca gatgaaccgg cagaggaagt ccagatgagc
    59881 cggagacgcc atggggtggc ttgccctcga agagatgagc gaaaatgtta atgagggatg
    59941 cctttcatgg agtatccaag ggatagatac agttttgcgg gggcagaaca tactaacgag
    60001 cgtcaaaatc tattggtgta actcagctgg tgtttcggac gccgcggcac accctaccgt
    60061 tatccctgtc acttttggca aacggttttt gtctgaagct gaggtatgaa gccatgaaga
    60121 gggacggtgc aatgttcgac cgcaacaatt ggacactgct gtttgatggc ttcaagccag
    60181 tgccttgttc tgacgccgct tcattcgatg gttaaaaata tatgacaagg catgggagcg
    60241 gcccggtgtt tgggttttgt ctggatttgc agcggatgag cggagaggag ataaggccgc
    60301 ttgagtaggt agattagaat aatggttgca tcttatggac attgcttctt gcccggcatg
    60361 gtcagtttac catttttggt agcagggcag ctgcatatat gaaaattcat cgaaccggca
    60421 gcgaatgaac gaaacagacg atggatttgt ttggtacatt aggcgtgcga gaagagcaga
    60481 catttcttcg tgcctaatga tacactctcc agaagcactc tcggtgtagt cattttgtct
    60541 tggcctttgt ttctattatc tctttccatt cctcctgtct tgcatattcc cactacggcc
    60601 ccatctagct ccctccatcc tctcgcgcta tggatcatat tgaattatag ggtatcaaga
    60661 gaggaacaaa ccatcgtagg ctggtccgct ctcaaaaatg gcttcggctc ccattgcctc
    60721 ggcatcggaa cagcctttga catccacaaa cccccaacta ggaccagagc catactttac
    60781 ataccccacg cccactccag atcaactaga agaagagctt ccgccttatt ttgagaatga
    60841 gaatgtttca ttagggttag ttctggatcg gttcgctcga aaagggaacc atgatctcag
    60901 agtgctcctt ggcgaagtgt aagtggagcc catctttgcc ttcccattgt atattgatct
    60961 attggatgta gtcttcctca actttccatt cgtgaacgac caaaacctat aatagaatat
    61021 gctaaaacca cccgacaagc actcctcaaa tatctcgctg tccttcgatg gaagacctct
    61081 gtcgacattg catctacaag caccggatca tccgtcgcga acacagcagg tccagcatct
    61141 tttcctacgc cccattccaa taatgatccc aatgacaact ctccagatgc cttcgcagga
    61201 aaaggcaaaa gcaagactca agcggatgaa tcggtcatca agggcaaagt gacagatgca
    61261 aaacgaattg cgcactttat ggaacatcaa aatcagcaac atgaagtagc aatcgagcat
    61321 gtcaagcatg tcaccaaagt agtagaaggc ttgcgtgaaa ggaaccccga cctccttaca
    61381 gccttatccc tcctcgctac cggcacctac aatcgtcttc ccgcatcgct tgtcgaccct
    61441 tacttaccca aaccagtttt aacaaattct gccattctta aagtcctccg tcggctcaat
    61501 cgtcaaatca gataccgcct tcgctgcctc gactatcttc ctccagagct cattgttgaa
    61561 gatataaaag atggtcggat gtacgcccga ggggatggat ggagagcgga acttacagtt
    61621 gtcggatttg aggatactag ccgatggtgg ttgacaggag tagagtgggg ctggaaggca
    61681 aaggagaagg gcgtggatga ccctggaggc agggtcacca agaaatttac cggcgaagaa
    61741 agacaaggga tcttagatat tgcgaatggc gaagttttac ctcccagaga attacctgag
    61801 aatgaaatgg aggtggatac ggtcataaca gaggatcccc aggtgaagaa gagtgaagtg
    61861 gtcgaagtag tcaagaagac tgttgatgcg ccgttagtaa gggtatacaa tttgcttcgt
    61921 gagtgttcct ttcttctttt ggaaagagta actaacagca ttacagaaca cttgtcatta
    61981 tcatatcggc tagaagtgtt gttcacccaa gcaattgctc ttagtcaggg caagtggaga
    62041 gggcaactca ttcctgaaat ggatcgcgag gataagactt tacgattgaa atactggctg
    62101 taagtgccga tatgcaagga ggtttaactc ttaatctgat accttttaaa gccgtgaaag
    62161 acccatgcaa gtacagcgtc aagactccac ttccattaaa cgtcctcaag caccggcaac
    62221 tcttcccgca tctcgtcaga caatggtggg cggcatcatc cacattactc tggcggaaaa
    62281 gacgactcct cgttccgaat tggataacct cctgagcgat atagcatgcg gtggactcgt
    62341 tccaagcgag agggtgctga gattggaatt aaatgtcaaa tgggttgttg atgaagctgg
    62401 tgtaggcgga ggattaaaat ctggtgacgt tatggacaac agcatgcttc atttggtacg
    62461 tgatcgttgt aaatttcatc tcagctacta acttaacggc aggatcccga tgctctaagc
    62521 gtcgaagatc tgcttcacgt ctgcacccgt acccatgcct ctcatcttac ccgctcccat
    62581 ggcacctccc tcctcacatc gccccgcttc ctcaatgctt cttccgttca accttctctt
    62641 caagaatcca ccgatccatc cgcccgtccg cttactcttc gagtaccttt accttcccgc
    62701 tacgccgttt ctcatctgct tatcggcgtc tcttccttca gtgggctgct ggaagtcgag
    62761 gatgaaggtg caaagggaaa tgatgctaga gcagaaaggg cggctatgag catgaagagt
    62821 gtgaacgagg gcaagacaaa gctggttgat gatatcacca ggctgacgac tgccgtaagt
    62881 tcggtcaaca aatggttcat aaacgtcaaa tactgatctt cacggataca gattgttgta
    62941 gaaaacatcg aggctcaaat gagacaactg ggatggaagc ctacccgcca aattgcttta
    63001 cgtcttaaag gtatgttccg cgttgtcatt actattcaat ttggacattt ctgacatttt
    63061 tacagatctt atcaaagcag accttcaccc agtcaccaca gtctttgttc ctttggcctc
    63121 ctcgcccaac cactactttg tcaccaaagc cgtccagaat gggatagttt ttgagcttct
    63181 caaggttgcc aaagtaccca acgagaatgg gttaggaatg aaatatatgg taggagatag
    63241 aacgatgatg gatttaggta agttgaaggc gagaagaaaa agtggagatg ataaactgca
    63301 gcggtctgcg tgagttgcct cgcgttaagt gccatactcc ctgctgacat tcattgtagt
    63361 tttgaggtcc aaaataaaga cctaaaggac ctattcatcc tgtccaagta agttgcgcat
    63421 tgaactcctc atcttcaaat ctaacgcgca cgtagcgctc tcgttgccca gactatcgtc
    63481 gaacagcaac tcaaagatcg ctccatccct tacatccaac agttcccacc gaccgccggt
    63541 cccgcatctc ccaagtctac ttcgcctctt gcgggtatgg tccccaccat ttgcgtggat
    63601 gtgcgagact tacttcgtgc cggccgtgga ggcggaagtg cagcgatgga agtggctatg
    63661 cctaaagtgt ggttgcaaat cgaaggatgg tgggaaggcg ggaagtgtga ggtggttacc
    63721 attgtggtat tgagacatca accatcgact gtggctcctg ggactgtgtc acaggagggt
    63781 gaagacgaaa aggacagggg ggaaagtgca aaggctgaag ggatatcgtt cgacccaaaa
    63841 tcatccattg taagatttag agcgaaggat atctcaagat gtgtgccagc atttttggag
    63901 caatgggaga ggctgagcaa ggtcattgtc gttgctggcg aaggtaaaca gattatttcc
    63961 tgcagtgcaa accaaccact aaaatatgtt cccttagtga gccgcctaaa caaaacggaa
    64021 tccttcaaag atgtcaagat actttccttc gacctccgta cagcaactct gcagtatgct
    64081 ccaggtcaca atgcgtcaat aacctatagt ccaacagacg actcatatcg catcacattc
    64141 ttcctctcat ccccgtcttc tgacaccgac agaaaccccc acgaactcgt tgctcccctg
    64201 ctcagcgcca gactcaacga gctcacatcg actggtattg ctggcgaaaa caaaccaaaa
    64261 ggccaagtag ggagggagtt tatggggctg ctaaaaaata cactgcccgt gttgaagatt
    64321 ggcaaaattt tggaaacaaa aatgggttgg ggtgtggtcg tccttggagt agcgaaatat
    64381 aggctgatta aggaccataa cggtaaaagg ttagtatcat gtgcattgtt gcatcatgga
    64441 accgagctga ttgcggggta gattctcagt ggatgttaca cttttacctg atctggagca
    64501 ttaccttatc caagacgggg cgacccctcg aggtccagat cacgtcgtag acgtgtacac
    64561 cggacccctt acttccctag agatggacaa ggttgtccat gcagtctttg atgccgaaaa
    64621 gagcgtctct cttgcagaaa ctggtgacga gaagggtcaa ggcaaaaaga gacacgtacc
    64681 accagtgatg aagctcgatc aagggaagag tctcgtatgc gaggtggcca ggtttgaaag
    64741 ggtacttaga aaggtgatgg aagaggccag caaggtgatg ggtcttggaa ataacatgga
    64801 aatggatagt taattgggta gaaatcattt gtttagaaca gttcagtgta cagataattg
    64861 catgggcatt gcggatatgt atccaccgta tggaatcagg tcagcagtca ttcactttta
    64921 atccagtgac gcaatggaag ttctcatatc gatattaacc caaggcagaa gaagacgtgt
    64981 gcaataataa tacatcttat ctctacatta ttactgttgg aaagggtttt cgatttctaa
    65041 atgattgtcg catgttaaca cttttgcttt ggccgtttcg gatggattta agaaacgact
    65101 tgcctgatga tccgtccgtt gggctaacaa ggacaatatt ggggccacgg agaacgacta
    65161 atccaagact tcgtgtaggt cggccatcta gacagcgttt cactcagcaa ggcgttcaca
    65221 catcatagat atgtccactc accctcatac tcctcaacta catcatccat gaccaagttc
    65281 ataagttggt catagccttt caagatacca gtagctacga atccaccata ttaattacac
    65341 ccctcagcat ttcccagaaa atcattgagc ggcccacagc cccgccattc tattttccac
    65401 aattccctct tggtgaagat tatgactcac cttctcgtcc acccataaat ttaactctga
    65461 tactcttgtc gacaaactga gccaagttga gaattgattc tcgcttcttg cgttcacctc
    65521 cttggttacc accaccacga gctccgcctc ggccacccta aagaccaaag tatcagttaa
    65581 ggctcattca cgctgtgctc ttcctcggaa agtcgggaaa gtcgacaatt gtcgcctata
    65641 tatttgagaa tagctactca ctcttgaaga cataatgggt agattatgag ggtgatagga
    65701 agtagagaaa gagatatggt tttgttgacg gaatgagcac tgtggaaaga gaaggatgga
    65761 tttgccatta atcaggctca ttaattccgg aagttatcag ggtcattttg tatatcctct
    65821 ttccacgcac ctcatgccag ggtcacaata caatttctcg tcttaaccta tacttcttcc
    65881 tacccgtata acaatgtcta cggatcaagt cgacgtctca ttcaagggta ggttctacgc
    65941 tgtactgtgg caagtgttaa ctattttgaa gtcctcagtc tccttagcaa agagcgcgcc
    66001 gtctacggct tgcgaaatgg tgaccatgag cgatacaggt aaatcataca gttcaagcac
    66061 gaaattaatt cctaatatac aacagacgac actgctccaa caaggtccat cgacttcgcc
    66121 aagttaccgg taccacttgt gggaaaaaga catacaaggc gccttccaaa atagaagtcg
    66181 agagcgtcaa ggatgttcgg tatgtacaca tccgctgtca tccactcgct cgctaacgat
    66241 catccagtca acttcagctg ttgttattct tagccgaacg agctctcgct cactctcacg
    66301 agcttaaaaa gaacaaaaac cattcaaaga aggaccagct ctcttggctc agacaagcct
    66361 tcaaagtctc tacccagctc tactttttgg tccaatctct ttccgcgtca tcctcagacc
    66421 ttcccggtcg cgtggatgct aagactctcg gggagatcac tatctaccat ctcaccatcc
    66481 gttcggaatt gtcatttgaa aagtctaact ggatcgagtc gctcaccgac cttgcctgcc
    66541 gccgaaagct gctcacgact cttggagaag gcgccaagga ctcttatgat gaagctcttg
    66601 ccaatgagtt tatcgactcc cacgatcctt tgattaggta ttgcgcctac aagctcggtc
    66661 gagcggagtc tcacgatatt gaaggtgtca tggccgatat cgagcccgaa gtcctcgagg
    66721 aggctcttcc tgggatgtcg cagcttcttg aaagtttgag gacggagact ggtgtggagg
    66781 agatggagga aggtaggaga aagctggagg atgtcgagtt tgcaggtgaa aaagtcgagt
    66841 tgcgaaatgc ggagattgta ggtgtgatgg tgcgtgtgca ggatgcgctc tccaaattgg
    66901 gcgatggtaa aagtaaaggt gctaggggta tgaagcgatg ggatcgcgtt cttagtgtgc
    66961 ttggagaggc tgagggcgtt gctcgaaaat tgctcgagga taacgaagcc aacggtgcct
    67021 cttcttccct tcgatcaacg agaaccgcgc agtccctcgc ccttgcccac cagtacatta
    67081 tctatctcct ccttacccac cggatccgtc gagatcttgc tttggtagaa accctttcct
    67141 catctcctgt gcccaaagac ccgactcagt ttaaggtaca gggcggaaag gctaagttgg
    67201 aagaggctgt taagactctt ggagcggttg tcaagcttta tggcactatg ttgcagagcc
    67261 tgaaacaggc ggccgagctc agtgtggttc aagagaagga gggtgtgaga agcggtgttg
    67321 aggggctgga agcctacttc catgccatca ggtatgccgt tttgctgagc atgattgaac
    67381 agagctaaca tctcatcaga tgctacaacc tcgctcgttt acattgcatc caccccgacc
    67441 cttcatactc ttccgctgtt cagctcctct ccaatgcttc cctctctctt cgtcaagctc
    67501 aagatttcct cgcttctccc gtcgacgaac ctatcgtctc cgtccctgcc gaagaccttt
    67561 cttctctctc caagaacatc agcgccctcg aaaaggcttc caagagggga ctcttcggcc
    67621 ggtctgttga aaagcccgtc tttttcgata tggctttcaa ctatattgac ctccctattg
    67681 atgaactgca gcgcttggcg ggtaatggag aaaaggtaca ggtggctact gtaaagacgc
    67741 aagagaagga ggtggagata aagcctgtgg agaatatgaa gaagagcaga gatagcaggg
    67801 agacaactcc tgcggtggat agtcaagaag agaagcagga gggcaagaag ggctggttgg
    67861 gcggttggtt cggaagaaag tagtaaaaaa aagagtatct cgggatatag taaatgcatg
    67921 gatgtaatat attattaaca cgaaaaccct cgaaatggat tgacaacata atatgacaaa
    67981 aatgaatgga gagttagtcc catttaacct gagttgatcc ctcgtcaact actagaaaca
    68041 actactgagg accctaactc acctcggggt caagcttgaa cttctcatac gcctctcggt
    68101 tgaagaacga caattcagtc tcattttctg acaaagatgg taagaaatgg cggagatggt
    68161 aagagacggt aagtacaaag gcagttttga gcaaacaggt caactgacga gcaccaacct
    68221 cctcgagggt cttgctagga tctaagatcc actcatcgtg gtcgaggtta atgataagat
    68281 tttgtgtctt cggtcatcat tcagcatata ttaagattag atataggaga gggaatagac
    68341 cttgtggcca tgggcaacag tgtagagctt cattgtgtct acgccatgtt aatttccctt
    68401 cgactaaaca cgtaacatca atgacatacc aaggacaagg tttctgtaag gcttgaaccc
    68461 agcacctttc ttgacctcta catttccgtc aacgttgtca ttcatagcca accttgaaag
    68521 ctctcacctt ccctaacgag attcattaaa gcctcaacag tcaacgtcct gagatccaag
    68581 ttcttcaaaa caacactctt ctgagtacgg aactcgaagc tcttgatgac gcggacggtg
    68641 agggtagcgt ctgagatggg gtgaagctct gtggcgagcg gttcatgatg ttcaaggtag
    68701 gatgcagggg cggacatggt gtatgggatg accagatgct gcgttacaga gataatgaag
    68761 agggcgacga aggacgaacg agagagggaa atttccgggt caacactccc caggcaccac
    68821 cacagttccg tcatcaatca ccacgcaatc atccttttct ttctatcttt tttctatctt
    68881 tcgttgtcat ttgcatacgc agcatccgaa cttgttatat tcaaaatatc aacctgccga
    68941 attaacaacg tccaatatat cttatcaagg tcgaataaaa aataaataaa tgtacatgaa
    69001 gcccaaaagt aatagagtcg attgtgatga cgagcatcat tttgggcctc ataaaacgac
    69061 gttcgcaaca ttaggtggat cgagctcaaa gtactttgga ttaatgtcag aggatatggt
    69121 tatggatggc acagtgaaga aagcagaaac gcatcctata atatctcatc actcagctca
    69181 atattttatg agaagcacca aacttaccaa ttttagagac tcacacttct aaactaacag
    69241 aaccgggggc aacgatctcc cgccacaaga ggactagtgt tgtatagttc acagctaggt
    69301 gcgtatctca aaggcgtcag cttggaagag gaattggacc gcaaaggttg ggattgccgc
    69361 ctggggacaa taccgctacc acaacgctcc atatcacttt cagatgatga ggctacgatc
    69421 ggacaaacgt tctttttgta ggttctgact ggatcgtctg gcaattcctt gggacattga
    69481 tccttcggat catgcttggt atatagggct aaaggaaagg taatcaacag aattttgaga
    69541 attgtcaggg gtgatgatga tctccggtat agaactggta gaatcgtccg atccagtggg
    69601 cgaatctggg ggcaagcggg gattatccag gaaatagaag gccgtatcaa gagtagtatg
    69661 tagtcggagg agagtcgtag ggttaagtaa agtatttgag gtttcattgg gtgaggagat
    69721 taacgtagag accattgatc gatccctgga gatgagttca tcttccgaca tgtggccgta
    69781 catggaaaag aatgacgtga cggaatccgt cttggcgtgt taatctgccc ttgtgtgctt
    69841 acagcttgaa gggttgatcc caccaaataa gggaatggga tgatccttgt caagcacacc
    69901 ttcttgagtg ataaaagaag atctatcagc gacggtatca aggccaacag tcggaattga
    69961 tgtatcagac tgcgacttat tgggtagata gtgagcagag agtgctttca tgcatggcct
    70021 tgtcgaaaat gaatactatc aggtctgata ggagggagcg acttcaactt gtcggtgacg
    70081 ccaagataat tgaacgtacg gacgacttgg accttggttg gtgagatgta aaaatggtcc
    70141 tccacgtgag acgtatggga agtggtgggg gtgtttggtc ggtgaaaggt ctgatccgat
    70201 tctccggtga tgctgtccgt gtgggaaaca ggtggggagg atgggtagga gcaagtgtta
    70261 acttctccgg cgaggtgcga gttttgaata gtttcaccac ggacgtaaga cttatggtca
    70321 atgtttatgc cctttgaagg agagtaaaca gataaattta ctttctcacc catcttgaca
    70381 tccaatacag ctcatcagcc catactccaa atgatctgca gatgcggcac tcacctgttc
    70441 actagggcca aggtcgagca taacgttcaa caagctgacg tccttcttca tcttctccac
    70501 gtcactaaca gcagtaagat gggccaacat agtagcctta aggttgagag gaggggtgtc
    70561 cttctataac agggagataa aaagaaatta caaggcccaa aaatgcagaa ggtatacata
    70621 ctcattcggt attatacagt gtattgattg acttgttggg ggttatgaat gaaatgcttg
    70681 aatagcagtc aatcatcgtc tatgcattat gaacatgagt caaataatta ataaagatgc
    70741 ttattactct atttagcggg ttcattatgt ctcccatagc tttgcaactg tccgtaatag
    70801 tacgtttcag atgtccaaac agcaactcca aagcgcaaat agtaaattga tcaccccaca
    70861 tattctcatc actttcaacc ttcttcaagc actgatcata gtctgagaca taaccgtgca
    70921 tggggttcag actctcgctc atccgacatt gatgattgta gctaacagca aggatagccc
    70981 tagcatcagg ctgtctcatc ctgtctgcca ctttccttct caactgccaa acatcgtcat
    71041 ctgttgcacg ccccatgtag gccatcagga atacccggta cgggcaatgc ccatccctag
    71101 cagtccaatt tgttcttgct atgggaggag tggtgtccag ccacgtgcat tgaccattag
    71161 ctggtcgact gaacattggt gggtaccgca ggattctggc cagtgatgtg tggggattgg
    71221 atgacaaagg ttgaagagaa tgaggcagga gggatgaaga ttgaggagaa tgagacggga
    71281 gtgactgagg ttgaggagaa tgagacggga gtgactgagg ttgaggagaa tgagacggga
    71341 gtaactgagg ttgaggagaa tgagacagga ggggaacaga aggggtaacg gctggttcag
    71401 cgatggcaat gattgaggat ggttgctgaa aattaaaaac tgtatcgtca tcaggcggta
    71461 atcccaccaa tgagcggcac agacgacctt cctcaatcag gtgtgctatc cagtattggg
    71521 atggtacaag ttccattgaa attttacact tccggacctt gcaacgcaac cggaatctca
    71581 ccttccctcc tgcatttcga agcccatgcc attcactgga atcacccacc agacaaggaa
    71641 tttgaatccc cccttccttg aaactgcgca tcaattcgag cattctctgc agagtcgggt
    71701 aatagagccc tggggacatc cgccaaactg gttgaggctg gagggcgaga cgggtcatac
    71761 tgtacttggc gattgggctt cttgaagtct tcagccttgg cgtagagggc ttcccaaata
    71821 gtactgtcag aacggcactg tcagaacggc tgatcatgtt gaactggtat tcactcagca
    71881 ccttcgtaca aatagtctca gagagcagtg tacaagatag tgatgaggaa agaccagaaa
    71941 gccacaaaag agaagattga agtagggtat agaacctgaa cgaacaagac cacgtagtca
    72001 tctatctaga cgagcagcta gactaaccct atcagatcaa tgctcggcca atgagactca
    72061 cgtttagcaa gctgctcctc ggtttcaaag ataaagacac caagcttctc gagtggactc
    72121 gagttggtca agaatcctcc cagctccccc aagtgtcgat atcttttata ttgtccgaat
    72181 taccgagcct cgagagttgg tcaggtatgg taggtctatg ttctttctct actcctctcg
    72241 aacgttgact catagatgct atgtgacaga tagcgtcatg tcaaacgaga cgagtaacag
    72301 tctcacaaca tctcctatct cgctgagcag aggtggcagc aggaagcaat gcataggtta
    72361 caaaagagag cgctaaggaa cagacttacc tttatcatag ccagctcaca tgcccttcta
    72421 ctcggtatca tgccacccat tgtgcttatc ctgcgctgtg cttctataac atcatatatc
    72481 taatgtttgc gccgccattg aaagtcgaac aaatgggtcg gtgaagtagg cgaaagtaaa
    72541 gatggtagtg aggatgatga aagaataggc gaaggagtgt ggaaggtgga gaaggtggag
    72601 aatgagcagc ggtgaaccta tacagtcgtt agcactattg caaccagtga agagataggc
    72661 tatcaggctc acgatagaag agactgcgta tatgtgagtg ttgtatccgg ctaggaggat
    72721 aagtatggcc ttacctgcat atttccctcc attcacagcg tatgccctcc acaccaacac
    72781 ctaaggtcga tatcggcata accaggacca ggtccgccta cccaaaaata tttgagaaaa
    72841 aacagttggc gcatgtccgt tctatagctg tcctctctgg ttgcatcata gcacagggca
    72901 tcgaaaagtt tctcgcaaga ctgttttttc cactcaagcc tcgtcggcat atactcgcgt
    72961 tcaagcaggt ccccgatacg ctgagcacga tgttcgggag cagggagtgg tggacgattg
    73021 gtttgcgacc caagaggcat atcggtggct gggcggtgag tcaaggccaa atagagaggt
    73081 attcctgaca gagcacaaga gcaagcggat aaagggcgga gaggtttgac gcacggaggc
    73141 aaaagaaagg ttgaagaaga gagtcgttgg gtggcgaatc gcggaagtaa aataagtcgg
    73201 ccgcgttatt atgggctcga cacaagcccc tcgacggaca ttgactcgtc tccgactggc
    73261 ggggaccgtc ggggtgaatt tggccttttt cgaccatttt caaacgacca ttgtttgtgc
    73321 atatggaggt atcaaggcat aacatttcac aagacgatac tgaagaatca agtctttatt
    73381 cctagggatg aatatttgac ctttaaatat cccagtttca tgcataacgg tcataaagtt
    73441 ggtgttcatc tcaaatttga ttccgttttc cccacgtggg taaaaaagag cggcaggggc
    73501 cggctcactt ccatcacaaa tttggttccg cccgttaaaa tcattacaca cgattacaac
    73561 ttgttacaaa tgctagatcc gccagaaata taaagatgca caaaagccag ttcgatcggc
    73621 ttgacgaaga aagaacgata gtcattaaaa tacatcatgc tgatttattg ttacagtccc
    73681 ggaaataact tgtttatgaa aaagtaaatc taaaaatgtc aggtatcatc cttaatggca
    73741 aaataatgtc ctcaatccct ctttcttcgc ttccgtcctt ccccttcagt ctgactctgc
    73801 gctgccttct ccctcttcca ttgctcctct gccgtctcca cccctctctt cttcacgttc
    73861 tcaactctat taatccaatc aagcaaccac cttgagactt tggtgttggc gaaaacattg
    73921 cccacaaaaa cgtcatgaag ctcttggcgc aagtcgccta ttgattgtgc gagttgggag
    73981 tatgaaagtt gatgcatgtg gacgaagatg aggaagggaa tgaaccatga ttctgtaagt
    74041 ggcgagaacg tatacagggt cagtaaggga tgctatgagg aagacgatgg atggggaaag
    74101 ggacggaccg acgggagcga cacgtctgga tattgtatcg aatgcggcag cataataccg
    74161 ctgagcaatg acgagccata ttgacatggc catatccact tcatccatta aacgtggatc
    74221 aggctatact catgcacatc aaatcagcga cacacagtca caaaatcatg tagaaaagaa
    74281 gacttacagg tatattcgcc tcaagaagtc ccttcaaaga catccagccc gtcgatgatg
    74341 attcccttcc ttccttttta catttggcca gataaacaaa cccgaccaca ttctggaaac
    74401 ttttcgctcg cttgatatcc cacgagagga ggtcacctaa tgtattgggg gcggtgatgt
    74461 atttcttctc cagcttggaa caccactgtg cccaagggga ggagactgcc tggagttttt
    74521 cggcggaaga gagagcgaca cctagctgga cacgttctat aaaagcattg tcatgtcagc
    74581 aacacaaacc ttacagccgg agaacagaca gcagaaacgc acggaagata tccctctgct
    74641 gttcatctcc caattcttta tacgtcaccg ccggtaaatt cacttgttca aaatgtctcc
    74701 gtaagggcat tggtaacagc tttctttttc ccggcccgtc cttgaaccaa agtttttcct
    74761 tggtacctgg tgagataaaa gggatttcgc cgtccatgaa gcgtacgatg gatgtacacc
    74821 gctgctttcc gtctatgcag accatttttt cgtttataag tcggagattg ttatgagaga
    74881 agattaatgg gggtacataa tatttctgca ggatgtgaaa gggaaagaaa gagcagaact
    74941 gttaggtatg tgtatatctc aatctgatta ggagaggagt aggggcgtac cagcatgaca
    75001 ctttggatta ggcatatcat ctttgttgtt gtccagacca cgtctcgttg ataatcaggc
    75061 gacagatcta tataatcact cttgatcaag tctgcacaac catctcgtca gcgctctcct
    75121 gttagtctcc tcacgacact ggccgggggg cacagatccg tggatcacca gatgggatag
    75181 gagtggcaaa gagagaaccc atcataaagc tttttcgtat ccataacctg atgtacaggc
    75241 gcttccagct ctccttttgt gatcttgtga atatagtcct ggagggcaac aggatcatct
    75301 tcccccggtt ggggggacgg tgtcggagag ccgtacgagg cgagttcgtc gaggagggag
    75361 tctgaatcgc ctggagacgg cgggtatgcc tctggcatct ggtattctga aagtgtgaca
    75421 ggtgctgatg gcgatacgtg ggggaaataa atgggcgaat gaagaatgga tggtttcaag
    75481 atttagtagt aaataagccg tgaaagacaa caaatacgta atgaagcaga cgatgatatg
    75541 tttattcttc tttattttat tgctccttcc gccgagcagc gagcggcagt tattgcccca
    75601 ctctatcttc acaggccaat aacatgcatg gcacccaaaa atgactggtg atgttttaca
    75661 acgataggaa gcaaaaatag atctccaaag ctactatggt aatttttttt ttgctcctct
    75721 atacacatta agactttgaa tcactccttt tgccgcaagt tgccaccctc cacttcccac
    75781 ttcgtaccgc gacaggaagg gtgccaacaa aactgtctaa ttttccacct ctttttcgca
    75841 atccactaca ctgagccgag ccatatttct actcatcgtc actctcacca tcactcatac
    75901 tctccttgag catctctagc aactcatgcg cctcactcaa ctgcgccacg agaatcgcct
    75961 gaccttcggg tatacttcca tcgtccgcat aaaacttgcc gtccttgcgg agcgagtcaa
    76021 tctggtgcag ggcgaggtgg taagggtaaa gatcgcgcgc ggtgtagggc ccgccgtatt
    76081 tgaggacttc gttgagacat ttcttgattg tggagagttt gtttgcctga taagttgaaa
    76141 agcgagataa aaaggttagc ttgatgtgag ttgggaaata ggaggggact tgcgatgggt
    76201 aagagttctt ccgaaatggg ttcggattca gacatgaggc ggtagatgag accgtaacat
    76261 cgtcggagga ggaacatgag tgcctggacc aaaacgttta gcatacttgc tgatccagta
    76321 agtaatgaat agactaacat attggccttc ggccttgtta ccgtcggcat cgacaaactt
    76381 gccgtctact cgcatagcgt caatctctcg gagagccatt gcatagctgc attgggttag
    76441 cttttgttaa agaaaaggtg gtgaggatga atgacctact tgtaaagatc agtctctctc
    76501 agcgtccatc gatgtgtcag tgctgcaaga acggggttag caaaacttga atcatacccg
    76561 acctgtactc actcatttga tccagctgat tcttcatctg cgataaccga tcatagatgg
    76621 gcttcaaact cggcccaact tcctcctccg cctccctcgc cttgatatcc tgcgtaatct
    76681 cgaagcaggt ttctagcaaa ccggaaagca acgcctgtcc ctctggtaca ctcgacccgc
    76741 ccggacctag aaacttgccg tccacccgtt tggagtcagt cttgcgcagt tcttcgagta
    76801 tagccttgta ttcggccttg ttgggtttcg gttcggcagc gagggctgcg agttctttac
    76861 ggagttggac gaggcgttgg tggataggga cgagttcgac ggataggacg gtgagtgatt
    76921 ggaaaagttc gtctagttgg cgttctaaaa gagttttcgg atgagaagat ggacgaaaat
    76981 actttaggaa tcaaagggag gagacttacc gacaccttcc agtttacgaa tcatcagtcg
    77041 tacaatgggt tcaggatgct tgccttccag agagtcttgc ttgataaccg atcgcaactg
    77101 gtctagacgt tctcggaaag gaatgaggaa ctgttcagtg tacgcccctg attcatccat
    77161 gtgcgataag atttgctgca aaagttgctt agcaaagtaa ccaagaggca tatcggctgg
    77221 acggagatgc ttactcgcat ggacgcaatc tggcaataga tcgccggcgt ctccctgctc
    77281 tttccgaccg tcaagaagaa gagactcagc aggccgaaca catcggctag aagctgatcg
    77341 actcgattag cctctggtgg aggcggcggc tttgtggacg agccgggagc agggttgagt
    77401 gcagagtgtg attgctgctg ctcgtcgcgg atagcattga ggcgcgtgat ctgtttcacg
    77461 accgagttgt aaatgggcat gacatctggg gcgcggatga atttggtggt gtcctgcggc
    77521 aagatgtgag ttgcgaggcc tgtgaaggag ggcaaaggcg gcataccttt ttgagggcgg
    77581 tgagcctgtt gcggatgttt atgagtgctt cgaggacagg gagttcttcc tgcgggggtg
    77641 agtcctgggt ggctttgtga gagactcacc tgcgggactg ggaccatagt tgtagacatt
    77701 ggagaagtgt tatggtactg agaatgccgt tgcaaataaa gccagtcttg tccaaggacc
    77761 gaacgagcga ctcgcggctc gggaaacgcc cggcgtgcct aatcccaatc ccggcgccct
    77821 atgacgacac tgcctcaccc gcaaaccccg aaatgccgtg gctgcaggcg cggctcctgc
    77881 ccggtccctc tggcgggcgc ggtggacgga ccctctccct cgctcgctca ctcaccgccc
    77941 ttccccgcat agccacttgc gtccttcctt ccttccttct tccatcttcc acccgcatcc
    78001 atctcccact ctagctgact caaccactct caacccagtg agtactcttc cttcctccct
    78061 cccctctctc ttcccgccac ccttccaacc tctgccgaca aacactccac ccgtcgccca
    78121 accacaacac cccatttccc acctttctct actcgtcccc ttggatccca ccgccgtctc
    78181 ctttgtccac gccttgcgcg ttcgcaccgc cgtctctcct gcctcgtgct ataaagaaca
    78241 gctaaagctg acgtcgtctc gccgcattgt tctctgtccc cgcacctggc aaccgcctgt
    78301 tattactcca tccatccttt tgttgtccac gcgtacaaaa cagtccttct aacacattct
    78361 aatcaacgtg agtgcatgtt tcagttgtac ggctgcggag aggcgggcga ggatggagga
    78421 cgagcaccat accgggaacg acgcgcattc cccattcccc accgcaccct ttccgcgtcc
    78481 gtgcgatcga cagctggatg ttgtgcgact ctacccagac attccatcca catctatacc
    78541 gctcaggccg gtcatgcccg gctgcagtac acgcggtctg cagcgtaaaa acatgaatat
    78601 ccggtatggt cgcgcgatac gcactagtag aggcctatcg ctacgggata tgtggcgcgc
    78661 gcagcccatg tgggacgatg ttatggggaa acggtctctt ctttttcatt cttcgccatc
    78721 cgctgcctct tatctctcgt gttgccatgt gatgctaacc agacgcattg atatgctctc
    78781 ctttccactt tttacctgtt gccgcgctcc acactattca tcatccagat gtctaaccga
    78841 gaagactctg tctaccttgc caagctcgcc gagcaggctg agcgatacga gggtacgttt
    78901 tatcactcta cgacacttgt gtcgacgcac tgacgcgctt ttagaaatgg tcgagaacat
    78961 gaagtctgtc gcctcttccg accaggagct caccgtcgag gagcgtaatc tcctttccgt
    79021 tgcctacaag aacgttatcg gtgcccgccg agcttcctgg cgaatcgtct cctccatcga
    79081 gcagaaggag gagtccaagg gtaacgaggc tcaggtggcc atgatcaagg cctacaggga
    79141 gaagattgag gctgagcttg ccaagatctg cgaggacatt cttgaggttc tcgacaagca
    79201 ccttatccct tctgccgctt ctggcgagtc caaggtcttt taccacaaga tgtaggtatt
    79261 ttttgagcgt gttcaagata aactatggct gactgtttat aggatgggag attaccaccg
    79321 ataccttgcc gagtttgcta ccggcgacaa gcgaaaggac tctgccgaca agtctctcga
    79381 ggcttacaag gctgcttccg acgttgccgt taccgagctt ccccctacgc accccatccg
    79441 actcggtttg gccctcaact tctccgtctt ttagtaggtt gttttgcgta gtgcaggaag
    79501 gtgcgcgggc taacccgtgg aacagctacg agatcctcaa ctcccccgac agggcttgcc
    79561 accttgccaa acaggctttc gacgacgcca ttgccgagct cgacaccctt tccgaggaat
    79621 cctacaagtg cgtatcaagg catggcgaaa ataaacgggg ctgacttttt ttttcaggga
    79681 ctctaccctc atcatgcagc ttcttaggga caaccttact ctctggactt ctgacatgaa
    79741 cgagcctggt tagtagattg gttgtttaca tttagaaacc cgctgacact gttgtcaaac
    79801 ttgcagagaa ggaagagaag cccgaggaaa caaagcagga ggaggttgcc cccgcggctt
    79861 agacgagttt tgtagatagt tgagagaagc tcagatattc cgccgctatt atcgttcggg
    79921 tgttatgggg cacacttctt ttttattgac tcgtttgcga aatatttaaa ccacaccaca
    79981 ccatcccctc aacaattaag ctcttttttt tctgtgatca tgaattcgct ttacttttgc
    80041 gcatgtggtg tgggcgggga ggggatagtt gttactttct tgatgatgaa atcgcgtgca
    80101 tggagatgaa atcgagtgcg gagaagtggg cagtttaatc atgtgtggtg cataacaagt
    80161 cggagcgtct acaagccctt ttgcgcatcc tcgggcacct ggtacacctt gagccagccc
    80221 tcccagcgat ctctccatgt cgcaggtgtc tctggcttga caatctccca tccttcctcg
    80281 ctgcccttcc acctgagctc ctttttcagc ctctccgcct ggatatcctg gatccgctcc
    80341 accttgttgg cctttttctc ctcctcggtc atctcgcggt cgccattctc gtacgccctc
    80401 gccaggtcga tacgggactt gatcgcctcg tagtactctg tccgcgactt ttggagccgc
    80461 tcgggcagct gcctggccgt cttgttgtac cagctctcgc tcttctcttc ccagtgctct
    80521 gcgtcctccc tgtgcatgtc cctggtgggg ccctcgatga gggcgagcgc agactgtgcg
    80581 ccttgccgca ctttggcgcg ttcgttgaag aagtcgagga tcatgtacgg cagctggagg
    80641 aagccgaggt ggttcgtgaa cgggaggagg aggagggggg gagtgggcgg gagcggggag
    80701 ggcggggtgt ggaggtgggc ggggatggcg ggagcgccgg gggtgacggg cgcggggcgg
    80761 gcgaggaagc caaagttgga tttggggacg gcgtcggcgg tgggctcgac gacggtctcg
    80821 gcggtctcga cggcgggctc gacgggcgac tcgactgact caaacacccc gtcgcccgcc
    80881 aacgtcttct ccacctccgt ctcccacgcc cactcgtcca cgccgcactc ccagcccctc
    80941 cgcagcccct ccaggtactc cttcaggctc gcccgcccga cgaccaccac gccgctctcc
    81001 acctcccgcc gcttcgcctc tgccgggtcc agcacgccgg ggagagagag cggcgtcgcg
    81061 gtgggcgcga ggccgagtgc ttggcggcgc tgcagcagga tcgcggcgtg cagctggcgg
    81121 gttatcgagc cgtgcagagg gacagacggc agcgtgtagt ctatgccggc agcgacgagg
    81181 taaggctgcg cgagagatcg ttcagcgcct tcttttcccc ttcccaagca cggccacaca
    81241 gcactcacct tgacatactt gcggaaatac cgcccagctc ggtcggcatc gtcgtcccct
    81301 ccccacctcc cagcccagac cacgacccgc ctcggctcac cgagactccc accaggcatc
    81361 ggctcccgcc cgtacttctc cacacgctcc accacctctt gcttgatccg cttgcattcc
    81421 gcgcggtcgt agtagtaggc gtacgagagc gacagggaga cggaccagaa gacgagccag
    81481 ttgcgtgagg gaagacgggg tttccacaga agcacgccgt gcgggatacc ggtgtgcgcg
    81541 agggctgagc ggaagcctgt aagctctgct ggcgcgggtt tgcgtgcgcc gggtgtcagg
    81601 tcagccatcg tttgttgcgc ttttttggtg ctttgcgacg aagaaaatgt gttttgccga
    81661 cgacgaaaaa agttgatcaa cgtaacgtac gagcagagga attttccaaa atacaaaata
    81721 caaaaaaaaa acgctttcgc gcgcaagtcc cccgagacgt atctgtcttc aaactcgatg
    81781 tatcctatct ttttggcaat gcattgattc tacagactat atcagatcct tttctaattt
    81841 tcatctcaat ttgcgtcttt gaaaatcttc tccttttcgt cttgtttccg tagttacacc
    81901 cattcccgtg cgttcatgca agatacctca ccgccaacgt cttcgcgata gcctctatcg
    81961 cgacaagaag acatggaaca aggaaaagaa tttggatcct tgagactctc gattcgttcg
    82021 tcagaaaacc atcaaacgta gaaacaatcc cgagtgtcat cctgtcctat cacttttctt
    82081 ctcgctcgcc ttctggccaa aagatctgaa cgtgggagaa ttgaaaaccc cctagaccca
    82141 tctcttacga gccgctgacc cagccttgtc cctgcccgaa acccctcgtg ccatcccata
    82201 tcccttgccc tgccccatcc cttccacttg cgggtactac tccacccact ccactgatcc
    82261 cacccgcccc cgcgggcgtc gctgcacctc caccaaacac tccaggccgc atataatacg
    82321 gtactgctgc ctccccttca ctcttgggta caggcaacgg gacattggac atgcccatgc
    82381 ccatgcctgt accccccata ttcatgttgg acaagccccc ccaagtcccc gaagggttgg
    82441 ccgacggtcc gcgcggttga cgcgtagggt gttggacttg gacgggggtc tgtcgcgctg
    82501 gcgattcatg gtggagcttg gggatagagg ggggccggtg tgtcaggttt ggaggcgcaa
    82561 cggctccagg cgaagagcgg gggaaagtgg cttgggcctg gagagtagca gaagcagtgg
    82621 ataaccccat gtgctggatc ggcacaggcg cttgaggttg aggctgatgc atctgcgtcg
    82681 ccaaaggttg agcaatctga ggtgcttgag ggattccgaa accaggagga ggaggagggc
    82741 cttgggaagc aacggaacct tgctgacctt catcaccccc tacccaaccc atacctgggc
    82801 ctgtgccagc gccactacca gctctccttg cgcgaccttg ctggctttct tcacgagtca
    82861 tagtccaaat actattcccc tgaggtccca tgaagagaga aggtacctgg ccgggattct
    82921 tggcttgtcc agaatgctgt acaggccgta cagattgcgg aacaggggct gggccgagta
    82981 taggcaggcc ggggggcatt tgcgtattat ggggagaagg aataccagca ctaggtccgc
    83041 tcatgtttct gttcatgccg ggaaatccag tctgagtata agacggggac tgatgggcat
    83101 acggtgaaga agctacaaga gcaggcgaat tgttgcccga cgagtgcgcc aggggcgggg
    83161 tagactgtag gagatcttgt aaaagatcca tggctgtttg gctttgctga tgttgaaggc
    83221 ggtgcttggg aggagggacc attggggccg ggagctgagc aggaatggtt tggacctgct
    83281 ggtatacgct ggtatccacc gcattctccc ttccacggct ccacacaata acctcctcgt
    83341 catcctcgtc ttcctcacca acactctcaa cgccaagact tgcacgcata gcgaggttga
    83401 ccggatcatc ctcagtgttg gtcgagattg actgcagatc atgttccctt tcatgttctt
    83461 ccacccgcgg cacgtttggt aactctgttg cttcggggat ggcaaaggtt ccggtggtaa
    83521 aggtatgaag aggatcagta aaccccaaac tctgaccgat caacaacccg tccacttgta
    83581 tatcccccaa cctcatcaga tgctcctcat tcgggtgtac ctccctcccc tcttgtccac
    83641 catccacatc tccctctgca tccgctgaat ccgtcgccga ggtcgcacca gctgcaaaag
    83701 agtccatatc agctgtcttg cccttttgga gaggcgcgaa tcctcgcata tcaatatctt
    83761 cttccagagg cctcgtgatc gatggaagac gttcaagaat gaagagtctg gaagaggatt
    83821 ggaaaaaggc gttgtaagtg ttccagaaag aggatatcgc cgccctgagc tccggcgaag
    83881 agacttgatc gttgcttgat ggcgatgcga gaccagagag gtaggtagtg tttagcttga
    83941 gccatttgga gatgatacgc agggaaggaa ggatacgtcg caagacggcg gaaatcagtt
    84001 gcggcatctc atccgtttcc agttcttctt catcttcatc atccaacaat gcactatctt
    84061 ccaaacctct tcgcaagctc gctctagcct cgtcgatctc ttcgcgcgcg atttccagat
    84121 agatcttcca tactcctaac gcgacctcga gcgtcttgcc ttcggcttcg aaggaacgtt
    84181 tgagtaaatt tgggtcttgc tccaggccag aggtggagcg ggcgcggaag tgagagccga
    84241 ggaggatgga agtgagctga acaatagact cggtggggag ccgtcgttca gataaaaaat
    84301 ctttcagcga agtgaggaga ggtgggagaa tagtcgggat gtatgtgaat ctgtaatctt
    84361 gtcaacatgt gtccaacgaa acggaaacag gcggctcacc cagctttaag atagaggatt
    84421 gccatgagca caaccatctc ctctttccac ttttccacac catctcccac ttcaccacct
    84481 tcttcgccgt caccgtcttt tctctttgct cgccacttgt caaagattct accgaagaat
    84541 ctctgcaaga ttccgtcggc gccttggaaa gcattcttga ctgcgagagc acgatagtag
    84601 tagtacgtgg tggaatagtc gttgtggacg tatgtcgaga tgactgcgag ctgattccat
    84661 gccgcacctt ttatacattg tcagttcatg aaccaagttg taaagaggaa gcaacaaacc
    84721 atcgtcaggc atcaagcgcc aagctgccaa gtaatacttc tcagcgactt caaatttatc
    84781 cgcttgcctc tctcgctcct gcgcatggcg gttattgttg acaggctgtt tgtattgctt
    84841 cttgtaccgt tccaagtcac ctaggcagat caggcccttg tagagtaagg gaatcttgtc
    84901 cttcttctct tgcaacgagg caaatcgcgc ggcgtatgac gacgattcat cttcgccgct
    84961 gtcattagtg ggcatgtact ctgttgggag cttgacggcc ttgagagtct catctacgcc
    85021 tgaaatttca cctagattgt agaaacgtac gagccgagcg gcgagcgaac gatagaacgt
    85081 ctcttcacta gcgagcacct gtctgaacct cgtaagcgcc ttcttcagct ccgagttacc
    85141 tccgcctcct cctcctcgtc gacccttgct gcccccgttg ctattcgagg cagcaggtgg
    85201 gaaacgttct aaccgggaga tgaggtcgcg gtaagcctgg ataaggacgt atgtggtgtg
    85261 aagccacagc gagtcgaggg attgcgaata cggtgagaat gggtgggaga agaggagcgt
    85321 gagatgggcg ttacgacatc ttccagcgca tgcatgttag ctggatgggt ttggttgcaa
    85381 gaggcaaaga ctgactgctg gcgatggagc tctacttctt tactccatgg cggctgcgac
    85441 ccgaggacat tacgaaggcg gtctgactct gacttggcct cgctgtttcc atgcataagc
    85501 gcccctcttc tctttcacgg tgcatgcacg agcagggact cacctgtcaa gggcagcagc
    85561 agcccgcttt gcagtgttcg gactctgcat aatgcgcagt tggggatcga gaaaggtttg
    85621 tgagattctt ctgcgcgttt tgggtggaga ggacacgcag tcggtgtggg tggaagaagt
    85681 ggagtggatg gaggatacac agaggttaga agagcatgtt tattggggag agcgcaagtg
    85741 gaacggggat gcagtcttca aaggaaacag caataaatgt accgcagaca gacagggata
    85801 gaattctcgg cgtcaacatt ctcaagccgc caaaccacgt cattctaaca gcaaatttat
    85861 caaaagatac gctcaatcca catgcaacat gcaacagcca tttgtcgaaa gaatctgcat
    85921 agaagaggta caaagcctcg cccatccacg ggcccactgc ccaacatccc atccccactc
    85981 cgactccact gcacaactaa ccagtcgctt aagcgttgtc gacgttcttg ccctgggtac
    86041 ccctctgtaa ttgactgcgt cagatgcatc caatgccttg ttacaatgca gacttacgag
    86101 aagaccagtc ctcctggcag caatgagacc ggctttttga ccggcgggag cgtcgcgagc
    86161 catggtagag gcgtgaccaa tgtgctaaac aaaagctgtc agacaacgta atccaaacat
    86221 taaaaacact acttgcctgg tggttaccac caccgtgagg gtggtcgacg gggttcatag
    86281 ccacaccacg agttcggggc caagagttcc tcttagcacg catagcgtgg tacttcctac
    86341 cagccttgag gaagggcttg tcaatcctac caccaccagc gatgataccg acggtagccc
    86401 tgcatcggga agagacagtc ttcttggagc cagagggcaa cctgattcgg gtcacaccac
    86461 tctcactgtg gccgatgatg gtggcgtagt taccagaggt tcgggcaagc gctcctcggt
    86521 cgccaatctt ctcctcgacg ttgcagacaa tggtaccttc ggggcactgg ccgatgggga
    86581 ggacgttgcc gacgttgagg gtagccttct taccgcagta gacgaaagaa ccggtggaga
    86641 gaccctcagc agcgaggaaa gtctcctttc ggagcttgta tcggtaaggg tcacggaaga
    86701 caacggtagc aaggggagca cctctgtttg gaatcagcgc ctgtttctcc ccagttttct
    86761 cagacccttg cagccctgct tcctgtccac cttcgtcctt ccgctcattc acatatttgt
    86821 gcctccaata ttcttcctct cttatgttcc aaactccccg atacagtcca ttaaacagaa
    86881 cccaactcac cgcccagcgt cgtggatgat gtccttgaca acacccctga tgtaaccgtt
    86941 cttctcggca aagtcgaggt tcctcaacct agcggggttc ttgttgtggt gggtgtggga
    87001 cttgaagata cccccggact ttcgctgcgc gcggatgact cgacccattt ctgctgtggt
    87061 gtcagtgtga gctggggatg ggaaaagtgc gactgactga aggaatataa attgacggtc
    87121 gaggaaggaa gacttgacgg aggaattatt accacttttc tgccagctgc cagtcgcggc
    87181 aggcggggca agtgccacac tcggtgttac cgccgtggac tcaaatgtgg cacttcggga
    87241 aacaccctta aagccgacaa tagcgtgggt gtcccgatcc aggatcttct cacccaagct
    87301 cgtttgtgcg tcatcggtcc ttcattcatc caccatcggt ggatgcgcct tgattagaaa
    87361 agatcggcct agtgggtgca attgaggagt ttttcgcgca acgattgtgg tccatgacat
    87421 gcacccacac agtcttgtaa gaccagacac aatataccat acattacatg cacaattacc
    87481 tacttgctaa acttcttacc cagcccaaaa ttcagccgta tctttttgcc catatccttc
    87541 aaccccttct ttccttcccc cgtcgtagac acctcactct gcatagccgt atctcgctca
    87601 tcgtcctttc cctcttcgcc ctttcctgct cctatcgccc cgcctccact cgctgcactt
    87661 gcggcgacag tcgctaccgg ctgcggcttg gcaccaacca acaaccccgc aaacccgcct
    87721 tcctcttctt cctcttcctc ccgacgtcgc ttttcccgca ttttagcctg cacgtctccc
    87781 agatcttctt ccagctctga tgtgttcttc tccttttcgg cgactgcctg cgctctagag
    87841 actgttcgtt caaggagaga tgtcgtggtg gttaacacag gggtggaaga agaagagtgt
    87901 tcggtatgtt gtggtgtgga gactggtgat tctgggtctg aattatcgtc ataatccaat
    87961 ccgagcgcac tgcccgttcg ctgggcccgt tttttcggtc caccgccact ttgcagcctc
    88021 ttcctctttg caggcacggc tccttcctct ccttcttctt cccctatcac attctccgta
    88081 tcgtcgacca ccgtcctatc cgtttcatcg tccgatccgt taaagtaatc atcctccttc
    88141 ttctcctcgt tcacccagcc gtcttctccg ccgatcgatg tagctgatgt agcagcgacg
    88201 aggggcatgc ttggtgtagg ctcgttgttc atctcccagc gtgatcgaat tcccatcatg
    88261 ataccccgca tgagcggccg acgcgaaagt gcttcgagac ggggtgtata gttttcaaag
    88321 agatagttga tgacagtctt caaattgtcc tgtatcacgt ataagcttga caagggctat
    88381 acaacggacg atttatttac cttgcggatc tgctcgacga cttccataca ggcagaactc
    88441 atcatattat cccttaaact ctcctcctcc agtaacatca aaagaggtcc taacagatcg
    88501 ttcttgacaa aatgtcgatg aataaagtga ttgggcgttc tcagacaagc cttgaggaaa
    88561 cgcagagcgg ctaaattttc aataacaagt caatgcccac tctgaacact tcagaagaag
    88621 aaaaacgaac catgtctcaa aggcttatcc cgaatgtaca ataatgcgac gacctttttc
    88681 gatatcggat ttgacaatat aaagtacgag cctttatgag ggtgattcag aagacagtac
    88741 gataagagtt caacgagatt ttgaagaagc gaagtatact ctctagttaa ttttgctata
    88801 cgtcccgtca gctgagactt tgatttccaa ataacagtga tatactcgtg ggctgttcag
    88861 ttttgtaatc tgggatatcc aataacggtt tgaagagata cgtagcccaa gtctcataga
    88921 aatgagtcat gaactgttcc gccagaggcc cttccttctt cgccatgaat gactatagct
    88981 gtgtcaatgc catttcctaa tcaaccttac ggaaagatga tcgacaaacc tcattatccg
    89041 ggggaacctc caacatcgtc ttcagcgtat ccgccatctg tcccattaac cccgcattcg
    89101 tcgttttgtg caataactca ataatctcct tcaccaacgt ccgctccttc tgctcctgct
    89161 ccttgaaaac ataacttctc accgacgacg catcatgctc caccacaagg gtcaacatct
    89221 ccgcacccgc atgtaaaatc tttgcttcag gacggcggaa agaccattcg ataacgcgta
    89281 aaagtccgcg gtcgaccagg gtccgataga gttgtaaacg tggaggaagt tgaattgact
    89341 tgcccatcat gacaagttga tggaggaaca tgactgtgtc acgtttctta tcatcgagcg
    89401 gttctggagg tgtatcttta ggaggagggg gaggtaaggg atcacggaag gcttcgaata
    89461 attgcgtgag gaagccatcg ctctgttgga tgtagttgat gatatccact tggttgaaaa
    89521 agatgaaacc attaagaata ttgaatgctg aatcatcaag tacacgggca agcacgacgt
    89581 ctttgagaaa taagaggcgg tatgtctgat ggaccttgtt gcagataata gggtcgggga
    89641 tgggaacgac ttctcggaaa cgagcgtttt cttgaaaata ttgacgatag gtggctttga
    89701 gttcggggaa ttcgggatcg tctgccgcgt tagtcataat tatgctatta gaactcacat
    89761 tcaagcattc caataacacc gaggaataca tcatcctgaa gaatatattc gaatatacca
    89821 ttgtcgttaa acaatactga ttcacgtcag ctttgccttg acaggagaac gacggcactc
    89881 acagatcgtc tgcatcaagg aacataaagc gtgcaaatca tccaagcttt ccaagtcttc
    89941 cgcttgctcg agaacattga tcaattgctt gatataatcc tacaacaaga cgtcagagca
    90001 ttcttgctgc ggattacatc caacttgcct cgttcaggat atgctccatt gctctctccc
    90061 gacccattgc cgacttggcc tgtgctctta tgcaaaactc ttgttccctg tacatccgtt
    90121 aatacaactt tattttccct gtcagaaacg agatttacct aatgtttgcc aacgtaggag
    90181 gctgccacgg tagcttgtgc tcggcattga ccatgtgcgc gttggcaacc atcattggag
    90241 aaccaccaat gggcgatgaa gatgatggca cctgcgtttc atcctctttc aaaccgccaa
    90301 aagataagca ttagcaacgg taacatattt cctcagtgaa aaaaacgtac cgacgctgat
    90361 gaggtgcttt tgaacttcac atataaattg ccaagtatcc tcgcatccat cggcgtcctg
    90421 aaaggaaaga gcaatatcaa gtttcgattc tggatccgtc caaactatca gagtatctac
    90481 cagatagatt gtcagactcg gaacgcgtac ttgcaggaaa caaaccttgt tgtttgccgt
    90541 agatatcatc cctttcaaca ttggaattca acaagatatc tttggtcaag aatcctccag
    90601 gctcatcttc attctcctga acttgaggtg attcagcctc cactaaaatg actgcatggc
    90661 catccgcatt gatcatccca cgacaaatgc ctgtccctcg gtcgaaccat gactcgtcac
    90721 gaagctcgta cacctgaatt ggaacgccac gaacatcagt tattatgcaa gacacagaat
    90781 ggccagcgtt gttatacgag taagtagaga cagaagaata cataccttaa cgcgtttccg
    90841 ctctctctcc gtccgatacc tcaagttctc gtattccatc tcccccgtaa ggtcttcaac
    90901 gtcaacctct ggctgtgaat caagaatgat ttggtctccc attccttccg attctccttc
    90961 tggaacctct tctaccaatt caggtgcttc tgcttgcatg tcccctgctg atgcgccggg
    91021 taggggagcg tgagaggtac taggggatgg ggaagcggat gggtcgggca ggagggtgga
    91081 tccggagtgc gtatagctgt gtggggagtc gaggtgtata tctgaagatg aaactgtggg
    91141 atgtagggct gtcatagcca tactacgatc cctgggtata tagagtcgag tcgcagtgga
    91201 agagaacggg ttatgcagtt gccgctggtt atgttatttg ttgttgtggg tggagtgtgt
    91261 tacgtaattc ccctcaactc ttgactttga atttgtattg aggagtctag ttattacgga
    91321 gtgtgcatct ctctcgtttg ctctaatcgc tgcttccgat gtcctcacaa ccaccaaagc
    91381 gaccacgctc ctcagacgta cagctcccaa gcccaaaaag atcacgcata gtaccatata
    91441 cacgtccaaa gcagtccaca aatcaaggct tcctcagcag gactttcggg gtcatgtcaa
    91501 acttgttggg ttggggaaca cgtaagtatt cacccactaa gcatgcagct cgacctgaca
    91561 atcacagcac gagaacaaga atcaaattcc agcgatgacg gacaatcctc ttctcattca
    91621 cgcgcctctt ctccagaccc gttagattca ataccaagag gttcctccca cgatccacca
    91681 tcaccacctc ctccagcgga aacccgccgt ccccctatac ggcctaaccg ggatgcttat
    91741 tcttcccaag catcgccatt tacttggtcg gcaacgatag atggtcagag acggccttta
    91801 tgggtggata gggatacgga cacggaagac agagcgagtc agagagtgat ttccatgttc
    91861 tcagggaacg taggtgcttt aaatcggagg agaacgctta gaaaaggtgg gtatgaaagg
    91921 attcgttggt ggataaaggt actgacaatg gatggaaagt cgatgatagg ctagcgggta
    91981 tacggacggt tctgcgcaac gatcaagcca ccaagtcatt tgacgaagtt gtacaatcaa
    92041 aaccgcagca agaggtttac aaacctaaac aaaaacggga aataggcgtc aaagcccaag
    92101 agcaagcctc caagtcgtgc gtccaaaccc gccacctccc cgcaaagcta ataacctacc
    92161 gtatagatcc agttttgaat tcgtctccat tctcaagaac ctcaaagcac tgcagctcgc
    92221 caaagaaaag gccctcaaac cttccgtgcc atccaaactg tctcctcaac aagaatccaa
    92281 agttgacgca caccttcgaa atcccaaatt caaagtcact ctcaacgtct ctgaagtgga
    92341 agctggaagt ctcaggaggc tcaagcctag tacgtggttg gatgatgagg tgatgaacgc
    92401 gtactgcgat ttgatgtgta gtcggttcaa ggatgggaag gcggggagaa aagttcattc
    92461 tttgaattcc tttttctatg gcaagcttgt ggatcagggg tacgccgctg gacggttgaa
    92521 gcgatggact aaaaaagtga gcttgtgccc tatgctcgtc ctgtccatcc cgctaatcct
    92581 ggcacgctat ttcaagatcg atatcttctc gctcgatgtt ctcatcttcc ctatcaacca
    92641 aggtaacatg cactggaccg catgtgccat taattttgcc aagaaacgga tagagtacta
    92701 cgactcgatg ggagattatg ggaatgcgag gaaacaagtg tttagaaaag tgagaggata
    92761 tgtggaggct gaacacaagg aaaagaaagg aagggcaatg gattgggaag gatggcatga
    92821 ttacttcaac aaggtgtgta tcgccaaatc ttaccaatct catgcgccat cagactcatg
    92881 tttttttctt ttctttcttt ctttctttta gaacacacca caacagaata acggttcaga
    92941 ctgtggcgtc ttttcatgcc aaacattaga gatgatcact cgcggtcggg atattgtcac
    93001 ccagggtttc gagtttactg cgaaggacat gccgttcatg aggagaatga tgatttatga
    93061 gattggggaa ggcaaattag agaagaggac ctggggttcg cctgcgttat aggttgaaga
    93121 ccgtggtgtt caaagggtgt cagtttcaca attaggtgtc tggaaaatgt gtattatccc
    93181 tagggacctg tatttgtatg acttattatg gacttcttta atcgcacgac agtccaactg
    93241 tgttgattgt aaagctccat ttttttgctc ttcaaaaggt cacctttagc cagacactca
    93301 agaggagact tacgtgcgac tgatgtatgc tctgctaagc ccttcacttg tgcatggact
    93361 ccatgtccca ttcgccccat ctagtatggg atagtagggc atatcgcgtc agtcatcaga
    93421 cacgatcttc ttacactacc ttcttactct ttcctacaca gtctcaagat ccatcagctg
    93481 ctcataacaa aatcaattag catgtcccag gaaagccaga actttgacca ttgctctgta
    93541 ataacacagt ctcaccatca gcttcatgaa cacctagacg agaaaaaaaa acaccggcat
    93601 cgaaagtttt tggtctagac agaatcttac tctgggctgg gtgttaatcc actattacgt
    93661 taggacgaag gatgatccaa ggtgaaaatg gcgctctaca gcttggccac ctcaagttgc
    93721 tgaagcactg atcatcgtca tccgctcacc ataaaccttg cttatcattg ctgcctctta
    93781 atccggggcc ctgaacaaca catggacatt ccattcgtaa gtttctcact atacgcgagt
    93841 gtaagcgggt gtggaggctt attggtagag gcgttaggag agcagaagtc ttcgttcaag
    93901 aagattgaga gtttagagag aaatagatgg catgttggtc atcaagtcta actactcggt
    93961 cttatgtacc ttttttcctt ccccgtccgt ccagcggact cgtactacgg acaagactaa
    94021 tctacataca tgtgtacgta cgacggactc agtccgccat cctggtctcc tgcctcctca
    94081 tccttcttca tccgtccatc ccatatcctt acagcgaggt cagtcgcgaa aagtaaactc
    94141 ttgttaggag caacaacacc tttgatatca gtaataggaa gggttaccag ctggcggagg
    94201 tctgctaaag atggtcagga ggtaggtgcg gaggctatag gtacgcggcg gtcatacgag
    94261 aattcatctt ctcgcaatcc agtatgcatc atttgatatg ataacaaagc ctcgtctcat
    94321 cttctcactc accgcaagtt gactcaacct ttaagcgtaa cagacgcctt gacctcatgt
    94381 tccgcgaagc atcgccgaga tctcatctcc cgtcgcagat ccccgaatgg cggatctgtg
    94441 aggactgtga cactcaccgg tcacatccta gcctgtcact tgtaacaact atccgctata
    94501 ttattataca tgcttacctt acggccgaac acagaccgtc tgtcgtttgc ttttcccgtt
    94561 actttcggcg acacggcgat caggaatcag caagaaggta aagacgtcat aagatgatga
    94621 tggtaacctg cagcgcgctg atagtattaa ttatgatgag ataagattca gtgttgccca
    94681 ccgctttccc tgttcaacaa ttattattgt tcttttttat cgtcattagc ttcggccatt
    94741 gcgtcgacat gtattgaccg aggtaccaaa ttcgttatca aagaagacga ggtggtccat
    94801 aataagggac aaaaagaaga cggaagcccg cggaggccca gttgggcccc agacctgagt
    94861 agtcgccgac catattggcg cttcttggca ttctgtcttc ggcgcactcg gcaaccgttc
    94921 attgttggcg aactagaggc tgttcctgcg atcatgtctg tgcgctatga tgctaatgtg
    94981 gggtgcgccc tttggccatt acgcaatcag cagcatcccc ggcagaagcg ctgagggcga
    95041 ggaacggcga agcggcgaag gatgccaaga ataaagttca gggctgatgc ctttatttcc
    95101 caaacggacg ctgcggatat gtccgattgc agatgttgtt gtggtttgtg ggagatggtt
    95161 ataaaaaggc gccaaagcag ccagatctcc gtctccgatc tccatctctg ttgccacttt
    95221 gctacttaac atcgccgctc gaacaccaat gtctgcccca gcccccgacc acaacaagcc
    95281 atccatggac ggcacaacga tcaacttcaa caacagcgcc aagggccaca acgaaccgct
    95341 tcccgtggcc gaggagaaca acgagctcga ccgctatgtc acagacgact tgcccaggca
    95401 gccgaggatg gctgccaagc cccaaattcc agacgctatc atggtaaatt tagcttgctc
    95461 tgctggcact ccacgggaga tgctaatcac agccgatcta atgtaggccg ttcagccctt
    95521 gaggaagaac gagatgcaac cctcttatgc tcaagacctt ggtaccggca ctattgatgt
    95581 aagcttctca catctcgcgc gttctacgcc atactcacca cgctcacagc acggatgcta
    95641 tggctccatg atgaacgtgc ttggtgaatg catcggtgct ttgggtatga tcccttgctg
    95701 cccttgcccc aacccgttca acaacatctc tcagggtgcc gtcggtttgg tctcccggtt
    95761 tggtcagttc tacaaggtga gttacgtccc attgtaacca gtccaatgct tatttcggct
    95821 gcagtctgtc gatccaggtt tggtcaaggt caatgtctgc actgaggatg tcagagttgt
    95881 tggtgagtaa accagtttag ggctagtttg aggcagaagt gatggcaagc tgacaactct
    95941 ttcagatgtt aagatccaac tcacttccgt tccccgtcag accgtccaaa ctaaagacaa
    96001 tgtttctgtt gaagttgaca gcgtaatctg ctggcacggt aagttgggtc tcgatcgccc
    96061 aatatcatcg ctgcttgacg tgtaaactga cctggttgct gtagtcatct ccccttaccg
    96121 agccgcattt ggaatcaacg acgtgaggtc tgctttggtg gagcgtgccc gtaagtgaaa
    96181 tgcgaggaaa ttgaattgta tctgactttc tcatgcagaa actacccttc gtcaggtagt
    96241 cggtggaaga gtatgttttt atatattctg ttattttatt tgccagtcaa tcggcgctga
    96301 cgtcctgttt taggtccttc aaagtgtaat ctccgaccgg gagggtcttg ctcatgaagt
    96361 tgccgagatc gtaggtattc tcctcccgta acctcgttca gatgctcatt tcttattcag
    96421 atcgaagcta ccgccgagaa gtggggtgtc gccatcgaat ctatccttct caaggacatc
    96481 aatttctccg tcgaattgca gcaatctctt tctagtgctg ccactcagaa gaggattggt
    96541 gaatccaagg ttatcgctgc cagagccgag gttgatgccg ccaagttgat gaggcaagct
    96601 gccgacgtga gtacccgaag ctgtggtaaa catcgctgac ttgtgattca atagattctt
    96661 gcatcgccag ctgctatgca gatccgtcaa ctcgaagctc tccagaacat ggctcgatca
    96721 tctggcagca aggttgtctt tggtatgtta ttctgatctc gtctcatgat atttgcaatt
    96781 gctgatgtct ttcgatagtc cctatgaacc tcggaacaat gggtgcagcc ggtatgaacg
    96841 acgttgcaca ccaaatcgcc gcctctggtc acgacgagca tgcagatcat gggccaagta
    96901 ctgcaaccaa cgctggtatt atcagctcta tggccaacgt ctaacccatg ggaagaagag
    96961 aatctgacta atatcatcta atgggatcaa ctgtggatat aattcgagct ttgccgtttt
    97021 gtcaagctca aaagtgtatt atataggcac gtaagagtaa aatagtgaca tgaatgtatt
    97081 taatgcagaa tctgcgacta ttctgctctg ctcttggcaa tgattagaag acaaacgttt
    97141 aaacgtgaat agagtacgta gcagaaggca gatgagagaa ggaatgcgga aatcatggtt
    97201 tacgtaaatg gcggcatagc tcagttggga gagcgcacga ctgaagttca tcgagaatca
    97261 aatcgtgcgg tccctggttc gatcccgggt ggcgccaaca tttttgtctt tttcgacttc
    97321 ctttcaaatt ctgagaagac aaaccatcac aaacgaaaag gggtgtaagg ctgcatgccg
    97381 tataatcttg aggaaagaag gactatacac actgccttgg cccttgaatt tatgtttagc
    97441 cgctttcatg gattgaaagc agattttgtc cgattgctcc acaaatgagc tggcatcccg
    97501 taaagctaga aaccgatttt catttttctt gaacagtggc cacaggtata aaagaaacat
    97561 gtcaggtaca gatgtagtat gcggatacat ggcccaaaaa tgctaataaa gatgtcgtac
    97621 aatttacttg cgcttcctgg caagctcctt ctcaaaccta gcctttttgg ccttgccgct
    97681 cgtagagcca gtgccgctga ccctcttctt ccctcgctcc aaagcatctc ccctctggcc
    97741 aaacttgccc gaaacaccat cccagactcc cttgtctcct ctgtctccga gcaccccttc
    97801 caattctgcc tccaaaccat ttcttcctct tctacctctg cttggcccaa caccgaagcc
    97861 cattgccaaa gcagcctcat catctcttct tctcttggct tccctcttgc tggttaccaa
    97921 tcgagtcatg ttctcttctt cgaattcgtc gatcctcttc aactctgcag cacgcttagc
    97981 gctgacagag ttggaatact tggcagcagc agacgtgacc ggacgaacgg agagaccaga
    98041 ggtagattca agtaagggcg cagagtccat ggtggcggcg aactcggaca ggagtgcggg
    98101 agcacggcgt tctctttcgc ggccctgggg agcagcttcg gaatagggga cagcagcgac
    98161 acgcggggga cggtagactc cggatttctc gtcgtctgaa ccagtagggg atccgccgcg
    98221 ggcggccttg ggagatgtcc gggaggtaat agcagatgga ttgggtcgga atgataatgg
    98281 atctgtagat gggcaagtta atttttttta atttttttgc tcttgcacag acaattagac
    98341 aaactcacct tcttcaacgt cttcgacaac atccttgccc ctcttatctt cagcctcggc
    98401 aagcccgatc aacttcttaa tctggtactc caacttgttc tccagccctc tcactttgtc
    98461 cataacttct tggttcatta ccaactctcc cgcgatctca ttcaacacat tatcatctgt
    98521 gagttccggt cgtgaacggg ggttcggaaa agggatggaa agggctgtgg aagtggatgg
    98581 atcgggagca gcctctgttg aggatgtcaa ccgtaaagca agcaggataa cgagttggtg
    98641 aagggatgac aagaggaggt gagggcggag attgagaagg gaaagaccat tggcaaaatc
    98701 aagatcctcc tctttgtttt ggactctaaa gaagcttatc agctgtcttg cagcatagac
    98761 ttaaaagcga gacaagctca cttgtttaat aatggaacag aagaagaagt agttgcatca
    98821 acagctgtct gaatagtccc aaataatttc agaacctcat ccgtagaaag aataacctcg
    98881 gcgtcactgt ccatcgtgct atatattttc cgtgacgacc tattgacagc atgtcagcgt
    98941 ttgtcccaag ttgatcactg tgataaagtg gatggcaatg gagaatcctc agtcgcgagt
    99001 tttctaggct cgctccaccc tcctaaggtg gaataggcgt gtaatctgta cacctctctt
    99061 ttggaggtgc tcagtgccca gtgcggtagc atcatcggat cctccatatg cttgtacagg
    99121 cgaaagaaag acttacgtgg ctgatgtggt tttcacggtt tgtggatgtg aagaagagaa
    99181 aaaagacgaa agaaaaagga aatggctgaa aaattgttgc agggaatttg atgtgaaaaa
    99241 gtggtgacat caacgtatgt tctgccggct gccgaagagc cgcgcatagc agcgaggaca
    99301 ttcaacttat tcgtacattt ccatttagca tctacacatc tacctcttca agcgaatatg
    99361 tcgccataat gtctgtcgcg catatagcag acagcaaagg cgtccaggga cccgcaaaat
    99421 ggtcggctgt caagaacgca gtgcagttct ctgctgctgc caaggataag aacagaagaa
    99481 accaaacaga caccttgcca gtgtcgacca cgtctacctc ggtttctgcg gcctttgcta
    99541 gatctttggt gctttttacc ggtaagttaa tagatgaggt atgctgaaag tgtcctgatc
    99601 cggatatata ggctttctat ttaaacggcc gtcaaaactg ttcagaccaa acagaggtac
    99661 tgccgttgca ctgacgtact aattggcttt gctgactcaa ggaattatag tggatacctg
    99721 gttgggtcta aggcaattag ctctgtcaac tgaacaaact atatccccag ctttcatcag
    99781 atcccttctt agacaaaaag ctggtataat tgcggtgacc ctgacgatcc ttcctccaat
    99841 gctggttaac gcaacgctag gcttcctgct attcacgtcc cattccctct tcactctggg
    99901 gctctctcgg ttatcattct tccagagaaa gatcgaaatg gaagatggga cggaagtcga
    99961 cgaggaagaa gatatcaatc tggaaacatt gatcaggggt ccttcaatca ttccaaatca
   100021 tccgacgatt ttgtctgcga ttgctggggc gggcgcagga ctcgtgcagg gtgctgcctt
   100081 tacgccagta gagaatgttg tacggtaagc aaaccatgat cgttccatgt ctgccatgct
   100141 cattcattgc agtttccttc accaatctgc cacatcttgg gctacacttc tcgcccgtct
   100201 tgtccatttg cccgtacccg aagtacccaa tgcattcgaa gggaaacaac cggcaacgcc
   100261 tatgcaagcc atcaaaaact tgtttgcaag tgaaacttgg aggaagaata ggaattggtg
   100321 gactggatgg cgatgggtgg tggctcgtga cgcgtgagag ggcctttcaa ctcatttgta
   100381 aacgaagctg atagtttcgt gggtagactg agctatagct gtttctttgc cgcctttgat
   100441 gttacgcgcc gcgtggctct acgagtaaaa gccctgtttg ggggtaatat tgagcatggt
   100501 tgggaaaaca tatttattat cgaattccca gacgatcatc cgcaaagtgc atccccatca
   100561 atctccaact ctcctgccaa ataccgcccg gattccgatc agccccaagc gcccactatt
   100621 gcccgtgtcg cgcaagcaac aaccatcgtc actgggggca ttattgcgag ctatctcgca
   100681 cagatggctg ggaggccgct taggacttgt caaaggatca tgatgcttga cgaaagggag
   100741 aggatgcgtg ccgaaaaagc acaaggacga gctcaagctg gcggagcagg aagcgtttcg
   100801 agctcaaata gcagcaatac tttgagacgg ggcaaacctc atccaatact tgaagttctc
   100861 cgaactaagg gtatccgccc cttcattcat tcagaaggac tgttgcagtc agcaccgatg
   100921 aaagaggctt ttcagcaaga gggcaggctg gtgaggacga tgaaaagtgt cggatggaag
   100981 atggccgcca tgggtccgtg gggttttgga ttcctagtgt gggcttgggt tggtggagaa
   101041 gtatgagatc atcaattgct acaaatcaac attgcaaaac gataccctgc agaattatac
   101101 catgcactga atgctcgcat ttacgattct actacttact tatttctatt aaccgcttag
   101161 catctcttgt tctatctgac catggaaggc agcctccgct tccaacactt gctctccgaa
   101221 ttctctagga acaccacatt tggccaaaac gcccataagg ccgccttggg actcggtagc
   101281 ttgcatgagc gctgcctcct gttcggggga gcgaacaagc atcataccgg cgtaaccgag
   101341 ggagttgagc tcaagaggcg ggtggggtga aggaagagga taggaaggga gggtacgggg
   101401 gataaggtgg aggtgttcac tgtgtaatgt tagtgtacaa tttaatagaa gagtaaacta
   101461 ctcacagggt catcaagatg ttccatccac cgtccttgtc cccaccacct ctgcgagcag
   101521 cgtcaaacgc catatccaag agtctcatca acgcaggagc gaggaaatca ataagttgtt
   101581 ctgtcgattc ggaagtggga ggtacgggca tttgagcaga aggaggcaag gggtggacga
   101641 tgtgaaggta agggaggttc ggcaggatta caggtttgtc tacgagcata agatatcagt
   101701 attgcacatg cgcagaaaga ttgtttaata gatctcacca agtctgtcaa attgcacctc
   101761 ctgtacccat tcttccacag gcgcccttcc tcctggagct tcgacaaact gcaaatgcct
   101821 ccatttctgg ctcgctccag caccttcgcc gccattgtag aacgcgagca gcttgctagg
   101881 ccgaatggga tgacgggaag cagcgaggag gatgttgtac gcaagagcga gttgaggagg
   101941 ggtaggagga aggtcttgag gttggtaagt gaaagggcaa aggaggatgt gtcccgggag
   102001 aagggagtac tatgtcaagt cagcctggct gtagatgaac agtgagataa tggacgctaa
   102061 ccttgttaag ctagtaaatt gttagcacat agttactgaa gtggccacag aaacttgctt
   102121 accaaaatgg acatgccctc ctcgccctcg aatccctcca aagatccaac aaacaattcg
   102181 gggacgtaag gtggcttgaa aggttccagc tcattttgct tgttcacaag ctcgacttta
   102241 tcatcttcat tagtcacgcg aggtcttttc ttgtctggag atccatcctt ttcggcgcga
   102301 atagcagcga gagcatctgc tttggccttg gccttgtctt ggagggcagg gcagagacgg
   102361 acgttgaact gccaaatgtt agagtgtgac ttgtacatag tatgtgtatg tccagaagct
   102421 acgcaccctt cgtccttgag agattacatc ctttgcttca ctagggaagt aaaagagctg
   102481 tccggaggat cgagcctcgt cgaacttttc cggaagcttg gataagaggt ctgtgggatt
   102541 ggagtggttt atggggtaag ccattgcgtg ctgtcttcta agctgttggg taactaggcg
   102601 ttttgtcgtc cttggggctg tgatgaaaaa actgcgggtt gtattcatag atatacacga
   102661 aggcaagaaa gggaaaaagg aaaagaaggg aaaagagatg acatggaaaa gaacgagtag
   102721 ccgcatctct cgtctccatt tcaggcacca ctccatagcc gacaacgatt ccttctttgt
   102781 cactatccag cagaagccat tttttgcgca gaagagcaat acatcacatt agatatatgt
   102841 aatcaccgga ggaatgtaga cccttgatac atgaaatcca acaatgcgga cttagccttt
   102901 cagcaggcac gagttgtcta gccactctta acgatcatct tcttctctat ccagcgtaca
   102961 gggtcccgtc ccggaagatg atagtcttgc agcatacaga gttaaataaa ccttagataa
   103021 caacgcgtat ggagagacat tgagggtacg attaaagaca gcatatcttg cgcattggca
   103081 gctttgtcgt gtacaactgc cgtactgtct actctattct caaacaagaa cgaaggcaaa
   103141 catcgtcttg atcaaagcaa ggtaatacta accaaagtgg ataaaaattg gtgaataact
   103201 ggcagataat tggtagacga aatcctgagg cttgaatgct ggtaacaagt gagcgtctaa
   103261 aacttcgcat atgaatatgc ccatccttaa ccaaaacgca aatggtagca gaaaggctag
   103321 agaatagtca gtaaactgct ggcaattgtc cgaatttcaa gttagagcag catatttcag
   103381 ctgatttgac ggtccgccgt ccaataatat catttattat acagatgcat gcctcctaat
   103441 ctgaggaagc acaacctcga caacctatat caccagtcag ccttgtcggc agaggccacc
   103501 ggagaaacaa aactcaccac aatgaggaca ttcgacaact gtgccctttt tcaactgcgc
   103561 cttgggtact ctgcagatgc aggtcgatcc ctgaaagttc atatcgcggg tttgaataca
   103621 tcgcacacag cacagcttct cgtaaccatt cttcttccac tttgctatga ggttggcgtc
   103681 ggcatatcct tgttttaaaa gccagtcgta gagttctcgt gagataagct cgcgcttgta
   103741 gtaaagatcg tagatgtatc gggaacgagc atgtgatagt cgcataatcg gccttaaact
   103801 gcattagctg atgatttcct ttatcgcaag gacttaacct accacacagc ctcaaccttt
   103861 cgctttcctt cgtgcgattc actctcagca tctcgcatct tcttctcata atcttcgagg
   103921 acatccctgg gtagggaagg aattgttagc gtccggcttg agatatggag caatgactta
   103981 ctggatgtcc tcgaatccct caggaggagg ctttgtacgt tgtgttctta tcttgggcat
   104041 gtttttaggt atacagatgc tgatcaatgt tctatggcac agtctgttgt agaatagagc
   104101 atggagatgg gtggcgggaa caaatttata tgggggatga cataagtgga ggttgttttt
   104161 gttgttcttc tcgttgccgt cggtgttttt tgtcacgagc aagccatcat cctcttacga
   104221 gttcctcatt tacccatcca ctctatacaa acaagccata atgggcaaat ggcaacaatc
   104281 aaaatatgat actgaacttg tatcaaaaat actcaggcta ttgtgcgtgc taccacattc
   104341 acctcagtag gccccaactc acgcatctta cagcgaggcg tcagagacaa gtcagcacag
   104401 ttcaacagct caaagaaatc aaagtagaga accgctttcg gacaagaaat ttttgtcgtt
   104461 cataaaaaac ctcaatccgg atagtgcact tgttcagcaa tgcttcagtc aactacttcg
   104521 tgctgtacac tctgaagtca agggcatgcg tccttccggt agtgtttcac cgcacagtaa
   104581 cccatttgca gtacccagta tcggccaaca gcttttttca gtacagccac aaccattcgc
   104641 actcgaactg accgacatcg aagtaccttc tgccagcagg tttccttcac cagagcggag
   104701 acatcgaatg gccgtcaatc tgcctccacc tgtctttgat tcttcccgtc cttggcaatt
   104761 ccagtccttt agctcacaaa gccgtccgga atactcgaga aatcattcag gcgtttccga
   104821 ctctgctgct ttggcagcac aaccccagcc gaccagtccg cagcaagagt ctgtagcgcc
   104881 tccggctttg cgacaaagtc cgctgtccag cgctagccgt tcgtggctgt cgcagtacac
   104941 acactctgcc cccgcatctg aacctcggcc tgtgagaccg ctgcctcttc gatcaatcgg
   105001 gagccggcga ccattgtcgt tttcgcggtc cactcgtgat atcctcaaca acgcccctcc
   105061 gagtacctcg ccgctcgttc cgctgggaga tcgttcgtcg agtctttatc cacgagcaca
   105121 atcgttggtg gatggtccac gaagtacttt gacaccaagt tctagcagtc agtctttttt
   105181 cgagattcgt ctacagactt tgtctgattc acttgctgca gctttacgac ggcgccgaat
   105241 gcgtgatgag cttggtaacg acagtaccga ggagcgttct gcaaaccgtc agagaagatt
   105301 cgacccttca agtgaaattc aacgtgtctg gcaggaggag aacaatccgt ggaacgaagc
   105361 ggacccttca ggaagagata caaggcggga cggcatcgtc tttgatgcag acgtgtatct
   105421 gacacagggc gctgatttct tggaatcaag tcctgaaggc gcttttgggg ctagggatga
   105481 tgatgattgg gtgactgttg ttccttccgt gactgtgcct gacgaaattc cgggagacga
   105541 tgcgtggttt cttcccccag caggtctttc aacaaatggg gttcccgaag tccaagaaag
   105601 aaatcgtgat tcgcaagaaa caacatcagt cctctaccca tcttcccatc tgccactgaa
   105661 cgaaaatgaa tgattattcc cgcagtcctg tttacattgc aaagtcctac cacccttccc
   105721 attcttgatt gtatgctcgt taatatggac aggcagcatt ctgtcattag tattgtcctt
   105781 gtgcattata tcatgttgta atcagctgcc tatattacgc ggttacacgc atcactgtat
   105841 acatatagtc attagcattg tgctctagaa gacctactta ctactttgtt tcatgctgcc
   105901 ttctcggtag accctcgaga tggatgtact ttaaagatgt catttacatg cacacaaagt
   105961 ttggcgctgg catatgtcag cgctgataat caatgggcag tgggcagtat cgtaaaggtc
   106021 ggtaaaatac aagaagaaac agtacgataa aggatagcct ccactctatc attaagaacg
   106081 cgtcaacagc ttcttctgcc tccacttttg cagtttcgga ggcggacaga aactaaaaga
   106141 acaccagtca cccgtccgtt ctttcatctt tttgcgcaaa cctttcaaac acataccata
   106201 ccaggatcat taattctgaa ctgtccgggc accatggcag ttcaagtcga catacccaaa
   106261 tcagaggcgt ctcgcgccga ggtgtgttcg aagccaactt ccggcccttt cctactgaag
   106321 acttgttttg tatgttcaac tgacagactt gattcgtagg gtaatacggc ttttaaaaag
   106381 ggcaaatggg ttgaagctat cggtacgatt taacccaatg cccatgtcca atccacaagg
   106441 tacatttact tactgtggaa tatttcaggg cactacacca acgctgtcat ctacaacccg
   106501 gaagatccgg tagcgtactg caacagagct caagcgttcc tcaagttaga aaagtgagct
   106561 taactgttac tcgcttgatc atcaaacaat tattgactag aattgtcatc aggtatcatg
   106621 atgctgaacg ggattgtaca tctgctctcg ctttacccaa gggtaagagc aatatcaagg
   106681 cgttgtatag aagaggtctt gctaggaaag gcctggaaaa gattgaagag gctctcagcg
   106741 gttcgtaata tcagttgatg aataagtggc actgacataa gacattggaa acagatatgg
   106801 aggaagtgct gcgattagat aagagtaata cggccgtcaa gccagagttg gaggagctcc
   106861 aggagatgaa gactaaaatg gatcaagaga agaaggtagc gcccctctcc attatgtcca
   106921 gctctagata tggctgattg cgctacagaa gccctctcga cgacccctca cccctccaat
   106981 tttgccaaaa cccctaccga aaaagtccag caatccacca aagtcggaag acgtatctga
   107041 tctgacgaat cttactcaag accttggact aaagtctaca tcttctcgat ctccggagga
   107101 gaagaaagag agttcgttcg cggctatacg taaatctcgc gatgggaaga aaatgtcttt
   107161 tgtaggcgaa agtacttctc agctatcaaa acaaccccaa gataaagaag ctgctacaga
   107221 cgctgctctt tccgccatct ttcctccatc gaaacctcgt gtcacgtcca cctccggatc
   107281 caaaaagccg gcagcctcaa caatcaacgt aaactctaca ccaagcactt cagctttacc
   107341 cccactgccc acttctttgg ataccacttc aacatcccct ggtgccggtc tgagcttact
   107401 ccgttacttt acgtcgtcac ccacctacaa cttttcactc ttatcactct atccagcaga
   107461 aaatatacca ataatcctgg gtacattgct ggaacccgat accttgggtt ttctgctgct
   107521 tgctttggac gaaggtgcaa gtaaaggaac cgaaacggac aaagaaaatg tcaagaagat
   107581 tttagaaggt ctgagacaga cgaagaggtg gaagatgaac attggaatgc ttagtacgga
   107641 tgagaaaaag gcaggggaga atgcttggaa atcatgcgga gggatcggta gctggatata
   107701 atgaccattt gctcgtcaaa catggtatgc agtatgccgg taatgggctc gaacacggac
   107761 gttatccttc caagcaatgt tgggtgctgc cacccagacc gtactgatag tgcagctgta
   107821 gggatctgct agcatctact tggttaccct cgtaagaatg tgagcaccgc atcatatgcc
   107881 agaacagttt tttacgccgt gctcatcgag aaggcatgca cacgctccgg aagaatgaag
   107941 gaggagcgaa aggctatttt tatattgcca atcgataaaa attacatata gagatccgac
   108001 ataaacagca ggactccgca atcgttccca tgatggggtt ggctacttga gattttcaga
   108061 gatggatcgt ctcttttgcc cggcacgacc agctggaagg gacttgaatt ggtctgtatt
   108121 acaacttata gcggcaacaa tcctcagatc tcgaggagca gctttcggat gccatggtat
   108181 gcattagtag gttgatatat actttctgca gataaaaaat ccgagatcag gaactggatg
   108241 cttgtagtag ttatctgtta tgtctgtcca tctgtcacct gaacactgat gcactatttt
   108301 atatatagtt acctgagtta gcttgttccg cctgcgacct gagacctgaa cctcgcctga
   108361 agggacgaga tgggatggga agatcagtaa ctggaccctg aaacccaaga taagaagacg
   108421 ataagacaac ttgaaagaag gaacggccct gtgattctgc atgatgcttc tgtctgcggt
   108481 gacaactcac cgatcataac aatcttttac atgcatgatt gtcattccta taccgcttaa
   108541 tagtttgcga cagcggttgg atcaatccac attcataatg tggtggtggg cattccgcgg
   108601 cgaacaccgc gggtttttga gtaacatcct ccctgctact atttatggac tgcgtcgtta
   108661 gggcttttca agttttaaga ctgcttccct ttgtaaacct cgcagataaa gaaatggccg
   108721 gtatgcatcc aatatgttgt ctttgcgcat catgaaaagc taagtatggt acaagtgacg
   108781 ctcagcaaga aaaaaaaaat cagccaaaga cttgacttcc tctattcttc ttcggttcgc
   108841 cattcacaat aacacttgtc cgactttagc aacgaaaagc acctgatccg acagaatcat
   108901 gagaaaatgg agttcattgg tagatccctt ctgtcagaag gggcaacagc aagtagctct
   108961 catcattgca tgatatcgta tcgtaaagaa actgtctaat aaatctgatt tcaatgtgga
   109021 aagtgagctt tgacaatatg tgggaagtta actagtactg ggacaagatt ggcactgatg
   109081 ataaggctga agacgtatat agctatctac gcgcgtgccc ataagcaccc gaggtcgggc
   109141 tccgcccacc gtaggcggaa gccgaaagtc cgtaagaccc ttccctcgag tgcgcagcaa
   109201 agctgctttg catggggctg tacatgtgtt ggctatgttc aggggcgata ctaggagaat
   109261 ataggctgtg gtgcgagtat ggcccagagg gataaggcat gccacctgtg ggatacctat
   109321 acgggggttg ctgatggacg ctggggtaag aggcgtaagt gggtgtgtaa ggctgagaaa
   109381 agaaggattg ctggtgtgca ggaggtaaag agccagcagc agagtgtcca ttgacaggag
   109441 atggtacgcg actggatgtg gcagattgag gctgagtcat agctaccccc gggggaagag
   109501 ggtatggagg aggatagcca tgctgctggt cgtacatgta ggcagcgtac gggttaggac
   109561 ctggattggt ggcatacggt gaagggaaat ggctagcagt cgctgaagtg ggcgtgccgg
   109621 tcgcactttt tgacttccgt ggttgtcgag aggaagagga tttcaacccc gctgcctcca
   109681 tcgcagcgtt caccgccgcc cgagccgctg aaccagaccc tcgacggagg gtaggagaca
   109741 gatgggttcg gtagctaaga gttaatgaat gatcagcgac gataagatag acaggaactg
   109801 tcctatgcgg tgatttcaac gtactgttgc tgcaaattat cttgccgact ggttcttgtc
   109861 tcgcatccag gaaaaggaca cttgaacgct ttcacaccag tgtgaatcct atgatgtctc
   109921 tgtagatgtc ctccagtagt aaaccctctc tggcagatag ggcacacgtg cggtttcgcc
   109981 tttccctccg ctggtcctgt ggcgccattc ttcccctttg atgactggga tggttgacct
   110041 gctacggcag aatgatcact cattgagtcc tccgtcttga tcgaattgat tgatagatct
   110101 ccggtaaacg ggtgggaacc atttgcggcg tcaggaagag aaggggcagg attgggcatg
   110161 cgaggaggct cgttgggggg aagagacgcg gggtggtgag ggtacgacga gggtagatgt
   110221 tggctttggt gaggtgatgc ttctgtagac attttgaaaa aaacctgaca ataaaacaca
   110281 atggaaaaag taaaaattta cagtgtaagc aactgtggct cagaaagaga agaaattgat
   110341 tttccacact cacgattcag ctttgataat agaatgaaga cctgtagtgg tgcctgttac
   110401 tccataaaaa agttgtgcga aatgcgacac tgattttggt ttatgcacac gtcacacgtc
   110461 accacctgca gaatggtcga catgcagtat ggtcggtgat gagtggcggc gcgaggggtg
   110521 atagtgtccg tcgcagagac agggaaaccg agtaacaaca ttgggtaaac cagtacgatg
   110581 agcgcatcca ttgaatacgg gagagtcaca tattcatttg acatgaataa ttcaaacgat
   110641 agttgatggg gtggtgttgt tggacgaggg cgatggcgaa acaggtcatg gcaaggagag
   110701 caaagacgga tgatgcggca aagcgacgcg tggaagcaat gatggtgaaa gcatgcagtc
   110761 agcttcggcc cttggagcaa tgaaatgata tcgacacagc gaagagcgga aacgggatag
   110821 tacgattgat aagagtagtg ggcaggcacc tccgattggg cgctacctgg tatttgacag
   110881 ccccgcacgt agggcagcag gattgcctca ccatgcaacg gatcacggaa acaaatagac
   110941 gtggtgagac agcaccctgg ggcagcatgg aggcaaagga tagggtgtgt ggagttgccg
   111001 tctgtgcggc agatcagggg agacaggggc agaggattat gacggatcgg caagcaaagg
   111061 aaggatgtaa ataacccttt ccaacacatt gcaaagccat ccatatctta tcttctcctg
   111121 gcaactccca tacgccatcc ggaccacttg gatgctccac cgcaccagaa tggcagtttg
   111181 catagcagcc accacaccgc actggcccat cacatcacca agacggttgg ttttctgcgc
   111241 tccacgtctt cgaaaccaaa ggacgctcga cttacagtaa tcctaatatt tttttcggcc
   111301 agagatcaaa atgctcctgt ggcctcaacg agtgatattg gggtataatt gtcgaaagtt
   111361 aagaacgatg aacaaacaga gttacgtgtg tctgttaacc tctggctttt ttccgctctt
   111421 ctaaacccag cacacgcgtc ccctattggt tggcgttctg aggtcaactt tgaaggtcta
   111481 tataatgccc ttatgcttga taatagcacc ttgagtgtcg acaggtggtt attatgcgga
   111541 atggtgtatg tacaagtaac cagcaacaat cgtatgtaga tatgtcaaaa gacgaaaagg
   111601 gtcaaaaaga tatcaatcaa gggctcagaa ggggatttgc taagggaatt aaggaagaaa
   111661 ttagggcctt attagggatt ggtgcgtcgg tggtgccgta tggtgccgtg gtcggcgaat
   111721 aaaattgtgg ggaccataat tttacagatt tcatcgtctt cgggcgggaa tcgtttcgat
   111781 attcggtatt cggtgcgtgc ggtcggctcc accctgtttg tccttttcta aaatttgaca
   111841 tgatcatatg tagctgttat gctgaggcag aacccaacaa tcaatacgca ccatgtactg
   111901 aagaccagcc atctgtgcag caaagataca gcacttagcg tagagtcaag caggtagact
   111961 ttaagcaaga catctaaaag gcgaggtagt cgtcccatgt cctgtttcat atgacgactg
   112021 tgtccggaca tcaactcttt ccaattattg ttcggcgcag catctagttg caatgtgatt
   112081 gcgtaagcaa accccaaaaa ggcggaaatg atgacgtccc gaaatttatt tattttcaag
   112141 tcacgtgatc caccctacat ttgctggatc caaagaaaaa ttaagaataa aattatttat
   112201 ttttactttt gatccatttt aaagcgataa acaaaacaca aacgtaacaa ctggcagccg
   112261 cgcccacatc cgagatcttc cagtctccgc tctattcgtt cgtctatcac tcactgtcat
   112321 catcgccgct tcccttatac catcacattt gtgtgtcaaa acaatataat tatgtcttct
   112381 aaagttggtg gcggtaaagg tggaaagtcc aagacttcct cagaagccaa ggttttgacc
   112441 accaggtcat ccaaagctgg gctacaggtg agttatttca tcgggttggt gaccatatat
   112501 acgcatatgc taatattata cctctctgaa tagtttcctg tgggccgtat ccaccggtga
   112561 gtcatttacg acgcgtgttt gaagttcctc ttgatgtttc ccatcatacc agtcgcgcca
   112621 atggtactga cagcaacctg ccatagattc ttgagaaaca agaacgccaa taacgttcgt
   112681 attggcgcta aggcagctgt ttatgtggca tccatcatgg aatacctgac tgccgaggtt
   112741 cttgagctcg ccggtaagtt ttatttgagc catatgctct cgagagctaa ttgactttgt
   112801 caggtaacgc tgccaaagac ctccgcgtga aacgtattac tcctcgacac ctgcaacttg
   112861 ccatccgtgg agacgaagag cttgatctac ttattcgagc taccattgca ggtggtggtg
   112921 ttttgccgca tatccataag gtaagcgatc acactcactt tggaatccca gtgatactaa
   112981 cccatttcgc agtctcttgt cgcgaagaac gcccccctca agaagccgaa ggctctcgat
   113041 gcttagtatt tgcactgttt catattttat atcttcgatt tgatgttcgc tagccagcca
   113101 tctgatatct ttttcgaaca gagatgtgct gaggttttta cagtagtttt ggagaatgta
   113161 ttaataatga tatcacgatt tgttagcgct gcaagaaggt tattcatgcg atcgtccttc
   113221 tactacaatg gtatttactt catgattgag atagcaaaat acacaagatc tttcccctga
   113281 tcctgtagct cacaccaccg attagactat gtcatatgct ataattatag cattctggcg
   113341 ctcgtgtcgg gattattgct agtattgaaa caaagggttc agtcaactac caatgtggga
   113401 tccatccaag cacgtagcct tgagacagat tctgtagatt ggtagcttct ttgatcaact
   113461 cctgtacctg cttgctgaca ctgaatggct gttcagagtt agtgttgtga agacctgtgg
   113521 caaatgccat atgttttcag ttagattata tattgctgaa agccaatctc cactaaccga
   113581 ctagttttcg ttctatctga gtaagtacct aaaccgattc accaattcat tagcacaagg
   113641 tgccgtttga agtctgagaa aatgtcttac ttgcagcgcc ttactgttcg tcatttcagt
   113701 actggaaact cttgccatat acgagtcagt gcgaaggcaa gtggatgtca acgagttatc
   113761 cagttgctca taggggagcg aatcttcttg tatcgacaga tctttggtct cgccctgttg
   113821 tgattgagtg ccctgggaag aatctttctg tccagctttg gactacgtaa agctttgtta
   113881 acttttgatg gccattaaat ggactgattt acctttaacc cttccaaaga ggctccaact
   113941 ttgggagctt cgcgaagaac tatatcatcc atcaactttg cctactcctc gaaaaagatt
   114001 ttgtttacca gcttcttcta atctggtcgt acctgagggg ttgttctgac tcgactattg
   114061 caaattaatc catggcccta aacatatcga gtagaaatgt tataaaaacg ctgtacttac
   114121 tgtccacgaa agcaaagggt catacaagaa agcttccaac attgcaagta atgtgctcct
   114181 actgccacgc aaaacgtcca ttgttatgaa agaagcttgt ttgaatgttc ccgctgaccc
   114241 aggtgtttcc aaatcccctt gcgatgcaag ctaagattag gaaaagcagt tagtcttgtt
   114301 tgatttcatg gagaaaacct tacttcaaat gcattagtca tcattcgggt gagacggaat
   114361 ggtacctttt caggcaagaa ggatctctct tgagcaacat tgaatagctg tgatactgtt
   114421 aatcatcgtc tgcgctagta tactgcggga atgttaccta catcaccaaa atcgatatga
   114481 agtgcgcccc atgttagctg atcaaccaaa atattgctcc catgcctgtc gcccaatcca
   114541 atgatatatc caacaaaacc taattgggta gcaaatgagt aaagccttgc tactgttgct
   114601 ggaaaagggc cggaaggctc acttgcaact ccaactgttc tagcaaagtt ggtcctcctt
   114661 ttgatccaga tatcagcact tgggcttctc tgccacaaga catctttgat atcaccttgc
   114721 attggagatt agttataata aaaaaggatt gcatgattgc tcactttgat tcgaatgaga
   114781 aagagctgct ttgagccgct ggacttttat aagtaacggc agtttgtcat atttgcccat
   114841 ctcagctgtt gcatccagtt ttggattatt aggattaaac acatctggat catactactg
   114901 gtcataagcc tctgctgcac gccattagac ttcactcacc cctaatagcg agcccagctc
   114961 ccggttagta agtgcatttc gtttgtgctt gtctcgattt gcttgaatca tcgattgcag
   115021 cctgttatta acctgggtta ctcaggtcta ctagtatatc aagccaaaga ctcactgttg
   115081 agtgttggat acccagctga caagacctgc cgacggcgaa agaggtacta cttcgtaagg
   115141 caaaagatgc aaatttcggc taaaggcatc tgaacgatga tttagaagag tattgatgag
   115201 attgaataat tgcataatac gttcgtcacc tcgaagatct tcgttacctt ctgaaagatt
   115261 agctggatgt atctggcgta aatggtcaca catacccttc agcaggaacg tgtgatcaga
   115321 aagatatgac tgaatgagaa gttttcgagg aagctgcttt gaggaaagaa tgtggactac
   115381 cggttgaaag ccgtcgatga atgcttggtc gtcaagcttg atatgtgggt catagagccc
   115441 tgatatagca tgtttagagc aggttcaaca attaagggaa atggagaatt gtatgtaacc
   115501 taccaggtac tgttaaaatg cagtctcgca aactgagaag ccgaggagca gtgcttgcta
   115561 agtgaagttt catgcctggt aatctccatt gattcagctg tgcttcaatc tctccataaa
   115621 gcttcatccc tgtatattag catctcgtga ttcttattgt ctgcttgaat aaaattctta
   115681 ctcgatacaa cgtgctgtat gcgttgttaa caagattgag ctgtctgctt gaattgtacc
   115741 ggatcagggt cttgtcgacc aggtgtagtt gttcgccata ttgcaaaaca aactgatgct
   115801 catctggagt ctccgggttc tgattcgagg attagaaaaa cgccgcaccc ttgggttacc
   115861 tagacgtact gttaacattc tgagatcttc ttcccaaatc tctgggatat cttgccactt
   115921 tatctccatg aggtcctgcc tggggagaaa accatcaata atacccctcc atctgatcag
   115981 cacatcatta tcgttagtcc tcttaatcaa caatttgaac agattgagaa acttgctttt
   116041 ccaaccacga tatagaagtg cggatcaact ctcttccaac taattcggct tgatcaacta
   116101 aacgagtgcc atcggccatg gtgcagatat aatccataat aaccctcgcc gcctcttggt
   116161 gttctacttt gcgagtttga gtagcagtca agagaggcca aataacagca tgcgggtaat
   116221 gagaggatat agttcttaat agcttaatca atgtacactg gagatctttt tgaggggtac
   116281 ctagacgagc aatgagctgc gggatagcgg ataaccaggg ttcaacatcg gttatgttga
   116341 gttgattctc cacttccaca agcacggctt gactctcccc aaatctgaac caaagcgtga
   116401 ctaatcgcaa gagtgcttta ataatgaact ctgggctttc cttggtacgt gcggcttgga
   116461 acaagcctat acagaacgat attagagctc gagacatact gtttcccatg tgacagactt
   116521 acctctcagc gccgggacga ctgagttgct ggatgtaagt ttggggactt ctggagatat
   116581 gaatgtactt actatagcta cctaccgcca ccccatcata ccttgagaat ccgttactct
   116641 caaacagtgt aacagaccgt tcagcgagag aaaatgctgc ctcatgccta cacaattcaa
   116701 cttagtttct gaggtgtgca ataatcaaag cttaccagga aacatctagc tttgccgcta
   116761 aagacgtata catgagaact gtggattctc gatccttcac ttgcgtcagt catgtgagag
   116821 gaatagatga tggatcagag agttatatat atatacctgt agccattcag acccctgcaa
   116881 aacagacgtc cattctccta gacggtagta gcgtctggca attacctttc gttcaagcgt
   116941 actaagattt tcagttttgg agagaggctg caaaccgaga gcagatgctt caagctcatg
   117001 tttgttgacg ttgatatatt caagatatcg acgcgtgtga atgtaaagcc tttctaaagc
   117061 atcttccatt ccattctggt cgtgtctttg aaatacatct ttccatcttg attcagccga
   117121 tattagcaaa gttttgatgg actctggtga gggctactta ctgaaatctc aatttcgtat
   117181 attccacttt gcaaccctag atgagcgtgg ttgaccaatt gagcataaag cttggctaat
   117241 caatcatctt tttacttact ggaagggtta cctctggagt tatacgctta attatggatc
   117301 gagcagcttc atgcattcct gcactttcgc atagttttgc agtcttgaga aagcaatcct
   117361 gcagctcaaa agtttttggt gagcacgcaa gtgtccatat ttcaaggcgc ttcaaccacg
   117421 aattagcatc ggcatggctc cgtttgaaac gtgttttcca agtggcaaga atggttgggc
   117481 gtagctccgg ttgagactta tactgaatcg cctcctgtaa ttcaaccaag aactctgttt
   117541 tggctaaact cttcagcgcg acttgcagcc cagctcccaa ttgcatctgt agctcatcgt
   117601 aagagagact ttgagctttg ttgatgtgat ggaaggccga agcatactgt tcattgtgta
   117661 catcgatgat agccttgtac aaagatttac ttgtgcctct gggatgaaac gcaaggtgat
   117721 ctgccattgt atcaaaatct ccctgaagat atcgtcagag aggtttctga cagctaatat
   117781 aggatatctt accatatgcc atgcagctgc ggttgcccag tgcgccgtgt ttcgtcgttc
   117841 attgtcatca agaccttcaa agaagttctg agccaagtca tagccttttt gataattccc
   117901 aagggcatgg tctgacgata catgcggtca atgtaaatca gtgcaggact gagatcctac
   117961 tcacagcaga tcattcgcag gttgaatgaa gaatacatag tagcttgttg atttttgtcg
   118021 attttgtctt gagcgctgag agcctgctgc cagtgactga gtgaggtaat ccacatcggt
   118081 tgaggctcaa tattccaatc attctccaac cataacaagg tactccatgc ggcatcatag
   118141 cccccagttc cgactctata tgtccatata gtcagtgcat gcaattaagc agtttttcaa
   118201 tggctggttt tgtaagatcg gactacactt acctgatatt agcttctaca aggttagata
   118261 tgctttccgg agtaggaagt gcttctgctt gttgctcaat gtaccacaag atcaccccag
   118321 gcagtgtctg attcagaccg ccgtggaagc attgtaaggc acacattttt gcagcctcaa
   118381 agactttggg actaaaataa ggcgttgtat ctttcgtgca aaaggccaga agatccaaga
   118441 acatgatcaa aatttctttg ttcacagtct tgtctgacaa cagagagact atcgcttcat
   118501 caacgaccgc ctgggacata acatgagtag taatcttttt aatacgggaa gcctaccttg
   118561 aacgcagcat catcctctag ctgcaggtaa cacttggcaa aggccgtctg gaatagttcc
   118621 gcgttgataa gcggccccaa ctagaataag aaccatcaga agacgaattg tacaggaaat
   118681 gatattacac tactctagac gtgacagtca tttcggggat gttactggcc tctagggttg
   118741 cctgatacag attgtgaagc caaagtgaag gactatcatt gggagaagaa agaagcgtat
   118801 ttgtccatgt gtgctgaaca cttcgtggct ttggtggtaa gttgtgtgca agaatttcag
   118861 acaataaggg gtgctgtggc ggctcttgcg tagacaaatc tcgggccaat tcagttcgat
   118921 tgtcacgctg aaaacatgtt actcatgtgc aattctcgag gcggatgcct tagtagtatt
   118981 acgaacacac ctggttaggg gcatcactac cgatagcatt gtttttgcta tcccaaactt
   119041 tgataccgag acagttcaca actaaaatca actcttccgt tccagcaagg ttagcaactt
   119101 ttgcgagaga gcgaagaggc ttaatgaggc agcttttcat gggctcaagt gtgtccgcgg
   119161 cttcaataag cagtctgagg gactccaata taattccttc cgatcttgtc acctccaaac
   119221 ccttcaataa cagaggaagc catatcgaag atgtgtgcgg tagcgcatga cgaagttttg
   119281 ctgaagatag tagtcggagg ccctcgagcc acactgtttc atcgtcggga gaagtgatca
   119341 aagcctgaca tattagaggg acggtccgat ggaggatgcg gtgttggatg ttcccagaca
   119401 tgactgtgtc ggtatagggc gcacgcagcc ttaaagcggg aacggtggac gacttgagat
   119461 acgattatca tgatatgtaa tatatctgac agggtcaaac gagtagcgat cactcctttc
   119521 tatgggatat aaaggaagag ctttgattga gaatggcgac attcgcttcg acataaagct
   119581 cgcgtcgccc ggcatggagc tgagttggtt ctcatcccaa ctcctcatga cgtaagtact
   119641 tttcgtactt agcacaagta tagtagtata catctgacgc tcgtacgtat aactattcgt
   119701 atggtcagct tcaaggccaa accactccta aactcaacat ggtaagattc gcttttgccc
   119761 catccattgt gcaatagctc gcttactatt gcgctcactc tagtccttgg cgtatcttga
   119821 acaagataca acgcaaggta tcttttcttg tcctcgttta tactctctgc aggcaactaa
   119881 ctcctcatta gctctcgctg attccatatg gaacgtcagc tggaacacgg ccaaccagct
   119941 cgttacagcg tctgctgatg gccatatccg agtgtgggat gttgaagagt tgagacaacc
   120001 ggtccacgat attgattcac atcctcttgc gattacgtct ttgtcagtgg ccgataaaaa
   120061 ggctttagct tccagtctgg atggcactat agtactggta gataccgtga atggggaaca
   120121 actaggcaaa gttaattcag gacgggtgaa agtatcggcg gaaggaccag gtgagccacg
   120181 ttctggttgc agtgagcacg cgttttttga gctcatacat gccgatagaa atccctgctt
   120241 ttgcctgttc tctgcatcct caaagtgctt gctgggcgtg gtcagggcgc tcctctaaag
   120301 ttgtcatccg aacgatggtc tccgacgacg ccgaccccac cacacaagga ccacttggcg
   120361 gggaaagtag cattatggac ggtggaaaag ggaaatttgg tatggacttg caatttgtaa
   120421 ggttccaggg ccttatgtac ccctgacata cagtggataa ccttcctgta gtcccctgat
   120481 ggtcgctcac ttgcccttgc taccgatcaa ggtcaggttg tggttttcga caccgaaacg
   120541 cgagctacta ttgcaaccta cacttcacat aacaaggccg tcagaaccat tggctggtct
   120601 cctgattccc aagtaggtgg atatgataaa tatacaattc atacaagaat aaaagtgacg
   120661 cttggatctt ctagtggcta tactctggtt ctgacgacca tctgattgtc ctctatgacg
   120721 cccgagctgg ctcccaatcc ggagctggtg gcaagggtga aggggcagtg gctatgatgc
   120781 aaggtcatca aagctgggta ctcagcgttg cgccatcacc tgatggtaga ctcttgggta
   120841 gcgggtgagt aaaaaaaagc cggtcagtaa aacaaaagtg ttatacactg atgcgatcgt
   120901 ccctagtggc gcggatcatc ttatcaaact ttgggatatt ggacagcgaa cctgtgtttc
   120961 gacgtcatcg agcaatgcgg acgtctgggg atttgcgtgg cagcctgaag gagccggcac
   121021 ccttccccct gggaagcaat ttgcagtggc tggagatgat aaggtcgtta cgctttatag
   121081 agctgcagga gctgtataga gcaactgaga gaataccaac atgcatttta tatttcagaa
   121141 ccattcattg acgaactctc cttctttctt tcttccttct atctatcctg agtgctctac
   121201 aatctctgtg acgagttttc cgtcgactac ccttgacttc atctgttcag gcacaggcct
   121261 ttcgacgaaa tcgccatctt cgccggtagg aacagaaatg ttgatgctac tggacttgct
   121321 ggtaatgatt tcgatcactt ccatgcaatc ctttgagaga tacacctggc cggagtcagt
   121381 ggtgtcgact tggatggtgg gaatggagcc gatgatctgg acttcaaatg agggggacga
   121441 agtgatagag aaagaggata cggcagagtc taggacgaca gaggtcttct tacatccggc
   121501 tgcaagttgt atcagctata tgcatatgcg ctaggagcat tggctatact tacccatggt
   121561 cacagcgttg attttgccgg agatctgaac cacagagttg acgcaaccaa agatgtgaac
   121621 agtgtggtga agttcagtgt tgtcaatttt aatagaccta ttgtcctctt ggttttcctg
   121681 ttatacgtca gccacaaaac gagattatga aaggccaaaa aaaaagacga acaatgatcc
   121741 atttattccc atcttcaagc tcgaccttgg caggcttctt tgcaggcttc gcgcccggct
   121801 tgggcttgag aggcgggccc ttctttccat tgtcagggac aatgctggcg gaacgaagtg
   121861 aggggttctt atgtgtcatt tgggaactat cgacctttcg caatccagaa gtggcggcgc
   121921 caccacgatt caaatcagcc aaaagggcag cagctccaga agcagcggga gtagaagcag
   121981 cctgtgctga gctagaagga ggtggaggag gtgggggagg agcagatgtt gatgtcttgg
   122041 gtatagaaga gggggctggg gaaccctgtg agagttagcg acgctcggaa taagcagatc
   122101 ttaccttagg gttccagact acaccagtaa catgccattc cttaacatag gattcaaggg
   122161 cagcaatcaa cgcaatgaat gacttggccc aggcaactac cgatgtattc ctaaaacggc
   122221 catcagctca ttgtaccatt agctgatttt caatctgctg acgtttcttt gtactgcttg
   122281 atcacgcggt cggaccagaa ttgagcggcg ttcttcatct catgaatgta aggggcaggt
   122341 gtaggttcct ggacattagc ttccaagaca acaaatacaa ctcaccatct gtacccagcc
   122401 ccaagcgggg acaccttctc ccaatacatt aaagcagaca ccccactcgc gaccttcttt
   122461 ggatcgactg agcttgtctt tcgtctccat gaccgcttca atggcctttc cctgaggttc
   122521 cagcaatggc gccagtgcat taggagcaga gggctttgcg tgatttgacg caaattggag
   122581 gaaagataac tgcgcttcac ataggaggcc tatgagagcc gactgcaagt cagtagccat
   122641 ctatgggcaa tttgactcac gtgttcagct accaagcctc ccacttcctt ggatttcgag
   122701 aggaagtcat tgagagcacc gttaacgatt tcgtcctgat agaccttgga ggccggggac
   122761 agagtgggct gagtcatttc tgcggatttg ggagtctccg gcgcaggtgg agcaacgccc
   122821 gtcggagtat caggagtggg ggcaggcgac ttgacagagc tgccgtgaga tgtctgcgtg
   122881 actgcgatgt cttccagacg acttgtgaca gctagaaggg gatgagtgaa ggtgagaggg
   122941 aagcggacga ggactactac ctaccctcca agcgcttgct agagggacgt gagacggggc
   123001 tgtgggcacg ggctggggac ttacaggatt gtgctgatcg agtgtatgcc ctgggatgtg
   123061 gccatggtgg agcaatgagc agcggtggca gtccaagtac agccactcgc gaacacatac
   123121 gtacgtagtg agaccaacag cgcagactga cgtcgggcac cccatgcgtt acgtaaccca
   123181 tatttcgttt gtcttcgaca acaacaaacc cagtggccaa gcttcgccta aaaccttttc
   123241 gcaagtcact cgctgctaca taaagtgcac ctttacttgc ccaaactgtt gttcagccgg
   123301 tcccacatct tttaacgtcc agccatgtcc atacctacgc cgaatatcgc tcatttcaca
   123361 gagtccgatt atgaacacat ctacgaacct gcaggtaaag tagctcgctc tctctcacag
   123421 ctggacaccg gtgacgaccc gtcttagagg actcttttat ccttctagat gcccttgaat
   123481 tagatgccga agatttgctt cgaatgaatc catctgtctg cgttgaaata gggtcagcag
   123541 tctccaaact accaatcatt ctagagggca ctaaagcact gactgatttg ctgcttgaat
   123601 ttctgaagag ctggttccgg ggtcgtttca gcattcatgt ccaatttgct cggtcacgaa
   123661 aacagctgta cgtacattgt atgtcgctta cacattgaga ctaccattga cccctgaaaa
   123721 tgcatagtcg tcatatccac tgacataaat ccgcacgcat gtcaagcaac cattagaacc
   123781 ggaacggcga acaacgttca tccatcattg ttgtcaccgt tcagtagctg actatcgatg
   123841 gtagacaatt ttggatccaa tacgatgtaa tcttgtggac cctcttcttc ctcggctatc
   123901 cgaaaaggtc gacgtacttc tgtttaatcc gccatatgtc cctacagata accaggagtg
   123961 agcagtgatg tgagatgttc atgctaactt gggtcacagg ctacaaatga ctcaggagtc
   124021 gcgtgatatt ggcggagcct gggctggtgg tgccgatggt atggccatca caaacatttt
   124081 attacagcag cttccggtca ggcatgtcgt atttccgtgt gttcaaacag ctgatgcaaa
   124141 gcacgtgtca gagtcttctg tctcggggcg gccgtctcta tctcgttgcg atacatcaaa
   124201 ataataccaa ggatattaat gcgcgcatgt tatcgcttgg gttgcaatca caagtatgta
   124261 tgattttatt ttacctgccg atgagacaca atccaaggct catttgttac aaaggaaatc
   124321 atcaaacgac gagctggtag ggaactattg tctgtcttga ggatttctaa acctatataa
   124381 tggagcatta tgtgacaggt tgatgatttc aaacgaaaaa aatgataaaa atgttttcta
   124441 gggctggacc agcttaattc tgcgttgccc catgatgctg aagattattt ttcttttggc
   124501 caatgctaat atcacaaagg gcatcgtaaa acggagtagc atgcacttct cgcagaatcc
   124561 gacgtaaaaa gtcactttat actctactaa cgataaacgc ctctattgaa ggcgcataga
   124621 ttttcggggg cgtctagcca atacaatatc gtcttttcca tcctccttta cactatcgac
   124681 cgccgagtcc atcataacgg atgcgtcaat gttctcattt actggggcgt tatttgtcct
   124741 atcaatactc tccgaacctt caccttccga gtcaatgcta ttagccctct tttcatcttc
   124801 tagcttgcgt ttttgttgtt ttgaaagaga tgtgggtgat gtcgacgtag gagcagacgg
   124861 cgaaacggcg ttgaccgggt taccagcaac acatggagag acaagtgata ctggggtgtt
   124921 gatgcctatt gcagcgcttg tttgtttgat gcttgccttt ttagagggta tattgcatat
   124981 ttctggagta ttgagatgca atttggtcat cggttgagag aaatcgtctg acccctcaaa
   125041 accacttttt aaccttgtgc tagagaccgt ggcgggcctc tgccagtttg cgcttccagg
   125101 accatagtta aagtcaggtt gtaatgaatc gaaagattgg atggaccaca tagaatcacc
   125161 gccaagaccc atgcgttgcg actcaattgg ctgcgaagag ggctcagaaa gccattcatg
   125221 atccaaggct tgggccatcg tcatgcgctt ggcgggatct ttgtccaaga gcctcaaaat
   125281 gaaatcgatt gctgggccat atcaacaaat gcggaagtcg aaaaaaaaaa gggaacttac
   125341 cttgctggct cacgtttcgc tgctccaaca gggacacatc aggtggttga gtaaaacggg
   125401 ctcgaatccg ttgcttaaca tatgattagc gtctcagaga actagaaccc aaaatccaga
   125461 tcggtacata cctccacagg aagtttgcta tcttcgtcaa atggtaaagc cttggtcatc
   125521 atgctgcaaa caaaactgtc agatgatagt aaataaatag cgtggtaatg acaatgaatt
   125581 acctataaac tattatgccg acagaccagg agtccaccac gttttcgtat cctggttgct
   125641 gctctgtttg catgacaatc tccggagcca aatactgcgg ggttccgacc atggatacaa
   125701 gcatagtgtt tgtgtggact aacatcatat ttagctcatc acaaaaccca ctagaaatgg
   125761 cacgcactca tcttagccaa gccaaaatct gcaattttga cgattcgagc accttcatgt
   125821 tcttttgtca aaagaatatt ctgcaattgc gtttgtttgg tatcatgggc atcgtatggg
   125881 cacatgggat gaaacttacc tctggcttca agtctctatg agtgatgcct tttgaatgct
   125941 agcaattgtt gagcttgggt cacatggaca agatcgattt cagtatgata ctcactgtgt
   126001 aggccattgc acggcagatc tgaactgtga gttcagcagc gtgttgctca gctagcaatt
   126061 ctcaattaga cgatagttca aaccaaaaat aaagtactgg taaagcacgc acggagaccg
   126121 ccttgctctt ctggccagtc catgatgtaa tccaaaagat cacctccatc tacatactcc
   126181 agaacaagac agatatgttg agggtcttcg taccagtcaa tcagccgaca tatgttttcc
   126241 tatgagttcc atgagcatca tgattggaaa aataatggtt ctatcaccta cgtgctccag
   126301 acttctagtg atattgattt ctcggtgaaa cagctgaaga gtcttgtcgt tgccggcaaa
   126361 gcgatgtttg acgatttgct acgctttgtc agactctaga tatgacgatg aaggtgtcat
   126421 gttttttctc actttgatgg ctcgcatatt ccccgtttct acgtccacag ctttgtgaac
   126481 ttccgcaaac gtccctttcc ccaagctgga tcgatttatg agtatcagct tagaatcccc
   126541 cagaaacgca atccccacga cttaccgatc gagtaattga tatttctcgt aaacctggcc
   126601 tacaggttcg agatcgccac tattgcttga ggcttgccca ttctttaatc tcttgccccc
   126661 aacagaacga tatatatatc gaacgtcgtg atagtcaaga gtgcccgcat gacctagtga
   126721 tatctcatcg ccatgccgta aaaggcgcct ggtgttgata cgagcgccat taacctgcgc
   126781 ggtttagtct accagtaagt tgctgtaatt taagaacaac ccacaaatgt cccgttactg
   126841 ctcttcaaat cttctaccca tacttcgggc tcaccctctc cttctttcca tgccctggcg
   126901 gtgtcattag acggttccag attctttgca ttttgcatcc cgagagtaaa gcgacagtgt
   126961 gtgttggaga ctctcttttc ggggagtata acatcatttc caagagtata cggtcctctt
   127021 cccagctgaa tatagggctt gctccagggc acttttagga tcccgcggtc cgagtgggtg
   127081 gagatgaaga tcgcccctga aagtattgaa cagatcaagg aaacgatatc agtcaatggt
   127141 cgataatgac tactttcact tacagtattt tctgcgtggc tcgacctgac tgctgatgaa
   127201 cgcctgtgtg ttttgagttt ggctatacgc cggctgggac agctgggtgg gctcaaagac
   127261 atcgtcactg tgtgggggct gttgggaagg agtttgcgac attgcaaggg tacgcaggga
   127321 cgtggggtga aaggtgcgga gatggcccga ttccagcccc tgtggaggtg agttgggagg
   127381 cggggtggca gaagtgggtg gagagcagcc tgaacaccac tgaggaacgc gccgaaatgg
   127441 ccattgcact acagcgcgtc gcctttgaag aaagtggagg tatgtgttac gtaaaatacc
   127501 cacgacatcg ttgtgttact ctgcgaattg aatagcagct acgttcccac gtactgtatc
   127561 acccaatccc ttgatctgct tcaccatgtc agacaaccag catctgcaag gccaatctag
   127621 tgtcccagaa acgcccgcaa atacgtcaga agttgataca tcgggcgcgc cggccgcagc
   127681 aagcagcgtc gggcccgctt cgagcgaggg gacagatcaa caggaccctg tcgtgtcgac
   127741 ttcttcttca aaagtacaag atatactaca gcaaagcatc aatcgcgaca actttcagga
   127801 agaagttgga caggtgatgg gcaccataaa cagttggtgg gggggcgtca agaaacaagt
   127861 acgatcccat cctactcagt agtgtctatt gtgctgatca agtccatgtc tagtccgtgt
   127921 ctactttggc gactttaaag gccgatatag ataaaacagt gacccaagcc caagctgact
   127981 ttgaatacct caaggcagct aaaattgaag tggtacgcaa agacgccact tccgagccca
   128041 ctagagtgtc agccaaggag gatcaagata tcagtgcaga tactttgaaa gaagaaccga
   128101 taagtgtcca aaacgatcag gacaagggaa aagggaaaga aacggcacag tcatcggcaa
   128161 cgaatcagac gagcccccct gctttcttta cgaaactcgc ttcttcaact agtcaacttc
   128221 agcaatcact cctatccgct gtacagttta cactcgatgc cacaactgcc aactcggcac
   128281 tgtccaatcc aaatgccttc cgtcagcaac ttgtggataa tctacgcctg gcctccgctc
   128341 gagagaactt gcagctttca gtcaaacaag ctgaaaaact ggctgaagaa tatctgcgca
   128401 aaggagacca gtgggtcaaa ggtgctgaga agtggatgga agaggctgtt aaagtcgtac
   128461 ctccagaggg agaagagact cacgtggtca acatcggctg ggatggcgga gattggtact
   128521 ccttttcaac ttctgataat acccctctgc acatatcaac gattgacaat ggtgcccctg
   128581 gtccctcagc tgctggtacc caggtcaagg ttctggccag ctctcgtaag gatgcacttt
   128641 tgaagcgcct tcgagaagat aagcaacttt tgttggttga tcctgaaggt gaaggggaaa
   128701 ctgagaaaag gaaagcagag ttccgtgact gggttaagac acaatgggaa gcacaaaaga
   128761 caaatgggcg actggaggat gagggtcttg tgggtcatat taggatggag cttggtaagt
   128821 gacttccatg ttgggatccc tgagaatatg atacttatat aaatgtcttc ttacccacta
   128881 ctctcatcag tgcctgagta cctcacagat gagcaattct ggcaacgtta tctattccac
   128941 aaacatatga ttgaagagga agagcagaag aggaaactgc tcttgcaaag tgagtgagca
   129001 gtattcctgt catgctcctg ttgctaattt ttttttcttt gggtagcttc tcaacaagac
   129061 cagtcagatg atttcaactg ggatgatgag cctgaagaaa ctacccccct gggtgatggg
   129121 caggcatccc atggtgtagt cacccctaag gtcagcccag ttggcaaact acctagttca
   129181 gtgttcagtc actcaaaggc aaaacttgct actttggact caacaagccc acatgactcg
   129241 gaggagagct atgacctagt cagtgatcag ggagggaaga ctgccagggc tgcccctcct
   129301 gtgggagatg atgattctga ctgggagtga caatgattag ttctgccact tgttatttgt
   129361 tgttgtatat actagccaaa ccaagctcat gtcaaatatt ttacagatag gaaaagacta
   129421 tgataaaaaa agtttcagat agaactgatc ccttggatgt tttttgggtt tcctagctga
   129481 agatgcagac atggtaacaa tttacttgct catgagactg aaacttatgc tttcagaata
   129541 ttgcaatctg tgtaagaggt aggacatgtc ttaaatggcc cacacccttt ttaggaccca
   129601 taaagctgtt tgcatatgaa gggatggttt tccctcaacc agaaatgtga tggggcctgg
   129661 ggagattggc atcatgcatg atatgttctg ccatcattga tggttgtaag gatgtagagg
   129721 gacaagatgt aagggcagag ccctcaccac caattgtttt caatcatggt aggatttatt
   129781 cctatgcatt gtttggatga catttggtag gtgtaatttg atgccgaggt gcagcagcag
   129841 actccgccgc gatctctgtt ccatgcatgg taattcactg tgaataattt agtccttaca
   129901 cggaattccg ggtaggacaa atgcttctgt aaaggtcttc tatacagtct ccacttaaca
   129961 agtaaattta attatcctct agtaggggta gacaaaatgc agttcatttt tattttttta
   130021 tttctgtaag ggaagcaaag ggagacctga tttcagggtg gtggctcagg aaatgatgac
   130081 agagagtcta gaataggccc atagaaatta atgaatttgc tttgtgatgc aagtgatgac
   130141 cttgacagag acacatctgt ctttgcaaca tgataatcat gcctgttgca ttctgaatcc
   130201 tatcctcttc aacatccagc actccgagag cagtttacca ccctacatca gcaaacctga
   130261 caagctccaa tgtaacacaa tcacaagcaa tcatgccttg ttttgcctga tcatgcaaaa
   130321 tcaaatccca tattgaaagt cactgtgatc agtaagagta gccacctaac aatgtgcttg
   130381 aatgttgaga tcatgcccga tcatgttatg tggttgcctg atcaaaggac ggaatgtatg
   130441 atcatgtaac ttaagagaca tgatcatatg ggcaaaatgc aagattggat ggctgttctg
   130501 cctgatcatg atatatatga agcatgatct tggaatgtgt gcattatgat cagtaacaat
   130561 aaatgcatgg tcaggcaata ggggtcatgg tcaggcaata ggttatttga tcatgcaatg
   130621 gggcttatga tcatgcaatc cctgatctga tgcctggggg cgattgttgg ttcattcagt
   130681 attatccatt tatgcatagt gttacaactc gtccccaaca aggtccggcc ttggaggaga
   130741 cgagatagaa agccgtagtt taactaagca atgagatata tgtatgatat acctcttgac
   130801 acttgtctgt tggcatatgg tatagggcgg aggtatattc gcttgggaag atcaggcaag
   130861 cttatatact agtggagtaa gtttatggcg aaggtggtgc aaggtaagac gagagtgagc
   130921 actgggagct caaggacctt tcgcaaagta acttatgaaa tattgatctt cgagggaaga
   130981 agatcaagat caaggacaga gctccccttt atatacttct acagaaatct atttatatcc
   131041 tttgaggtcc agctggacct tcttatctga acggatcttg ccttcctatt acgtaactcc
   131101 ctcctatgat ctcttatctc ttcttctttg tgcaggctcg tgacacatag caatttcatt
   131161 gatgcagtca gacaagatgc atgccatact ctgctcttat aaatacatat gcttaaagca
   131221 gacaaaggta caaaatggag tttgttaaac tccaaacatt gtccagcggg tctgagcatt
   131281 atgatctgcc aacctacctc tctcactatg ggacctgcgg cggcttaatt taaacttttc
   131341 tatccctttt tcggcttatt ttgacaatta ataatggctc gttttaagcc tttttgaggc
   131401 ttgcatttta taagaccatt tcgggcttgg gctggcaatc cgatttaggg cttgtttcaa
   131461 gcctttattt acaacttgca tatacgtcat cattttttgt ctcaaaaggc ttgtactact
   131521 gaccaaatat tacatatggc atcatggcat agagatgcat tctcatttat ttccttcttc
   131581 gtcttctgtg gtcttttcca cccccagatc ccacccagca ctaggaacat catgcataga
   131641 gacattcgct ctaaaaagga gcccaaacta cgagaaacta aacaaagaag aggctagaag
   131701 agagaatgat aaatgaagaa aaaatataga agagccgtga caaaactgag gtaaatcgga
   131761 acagaggcga aagaagagag tggccgtgac agaggtaaag taaatagtaa cagggaaggg
   131821 atggtgggta actacaggaa agcaagtcgg taggtaggaa tataagtgac aagggtgaag
   131881 atgaaatgaa tttgaatttg aagatgatga agaagatgaa gatgaagatg aagatgatgg
   131941 aagatgatgg aagctagaca caaagacaga ctcagttgaa cgatggactg gggacagaca
   132001 ctcaactgca cggggcctgc cacacccatc ctccactcaa taaccccagc taacgcttta
   132061 gctgcccatt tacacttaca ccaaagacac gcggctgtag ggcgtgcccc tgtcaattat
   132121 ataggtcgtg ccaggttttg agatactctt aacccttcca accagttcat tgacagaggc
   132181 cagatccacc atctcctccg cctggtactc tttataatag ctccattcat ggttgccaat
   132241 atagtgctta tgtgacacca ctggtttgat gtgggcgaag gcgagagtaa caggaggggt
   132301 gtcggaggat ttggggtgat gggggaggtc aatggtgatc aagttcagga gctcaccata
   132361 acataggtgg tcctcaaact cgacatgcct ggttggatgg cgcctattct ggtcgataga
   132421 caccatatac tacaaccaac atttcatcat caatttctaa agttctcttc agactaaata
   132481 gagtctaact caccgagaca aaggaggcac accttctgtc ctcctcagct gtatccatcc
   132541 tcgacacacg aatggaatcg ccaccattca acactcgaac acggttccac accctcaact
   132601 tccctttgac actaaagctc taagctcaac agtcggtggg atatcgtgtt gggtggtcat
   132661 tgtgttgatg agcttattca tcaggttgtg tcggatgaca ccttgggcgt ccttggtcgg
   132721 ggaggacaaa gcataatgtg catctgagca ggcatcaatt ataaatcaag cgctatatga
   132781 tatgacttgg acttacatga cggcaagacc gtctcatacc gcttaggagg ggcttcatca
   132841 tcactcaccc ttcctctacc tccccagtga aggtcgtatt tgttcgcaat gtgttgtaga
   132901 tgactcttga ccaaaatccg ctgggacatg ctagcataag ggtgtcgcat attccttaga
   132961 tttcggccaa gatcaccaca ataacattcc attgcaaact gccacgatac ccaaatgggc
   133021 cccatcatct cgataattag accgaagtga aagactgaat gcacctgagc cgaacaaaca
   133081 tggagatggc taggcttgtt cccgtggtag agactaaatg aaatcaatgt ctaagaagag
   133141 ttcataatgt aatctgaata tgcaactcac cggtaaaaat ccacacccca cttaatccag
   133201 tctgtcttca gacccgcaag gcgttccctc ggcatctcat aggccaggca ttctctgaca
   133261 aggctcgaaa accgcataaa atgcttgtag aaccttgatt caagtaatcc atccagcaaa
   133321 actggtgcaa tatactgcag ccaaaaagac catgtgtcag ctgtgcatgc ctgcctattc
   133381 ttgacgaagt ccggtggtct agcagcaaat gatgagggga ttgtcgcacc ggcagcagca
   133441 gttgattcgc caacagctgc ccactgacga gtagtaagga caaagtcctc atcagccaag
   133501 tccttgacag cccctgagag aaggttaact tgaagtttga ggatgttctc aaaaaggttg
   133561 tgcattgcat caacggggaa tgaaagagga aagtcgatag tggggagttt ttcaaggatg
   133621 gacagaccct tgataccatg tttctgccca agtctttctt tctcagctgc gctagatgca
   133681 gcagccacct ctcgggcttg gcgaatgaac tggtaatggg tgtgacaagg taggttatag
   133741 ggatcatggt cgggtacagt cagatcggtt gcagatgatt ggagggggag gtacagttgg
   133801 ttggggttac agttttggga atgtcggact gaggttgcgt tgcacatccg acaggggtgg
   133861 aagcttccag tgcccttcat gtgcatgatc attgatacag caggcgtatc ccctgaaaca
   133921 taaaggagat gcgccctgag tgtaaaaaaa cttcccagat cggcatccca tgtatgcact
   133981 ccaactgtga gttgcaaaag ctcctccact aatgggtaga tgaaagaatc aaaatcttct
   134041 ggctttttag ggcctgggat gagtcccacc gacagtatct cgcgggtatg gaccctttct
   134101 tctggtggta ggttgagatt gaaaagcacc agaggccaac acgtccctga gccattgtca
   134161 aatgggcaga acccatccga tgagaatgag agagcaatat ctctgtcatc ggcaaagtac
   134221 ttggttccga gctttcttcc atccacctca atctcttttt ccaagagtat tctgtacata
   134281 ctcccatcaa atatgtcttg gatattggag ttatcgtatt cgcgggtgct cttgtctcgg
   134341 tacatgagtc tttcctttgt tgatgggtgg ttgtacatct tctgaagcct tggaataatc
   134401 ttgatgtaca aaaacctttg gaatggtttc ccgtttcggt cgaatctgtc tgcaccacac
   134461 ttggagcact tctgatcttt agcataaggg ccggcgaagc aaagacaaga gtgcttgcac
   134521 atgtcataat aatcgcaaag ggtgtctgaa taattgtcga ttagagactg tgcctctttg
   134581 agggagatga acggtatatt gttggcatgg tctggaagac tgttgtatgc agctcgtgag
   134641 atgttgtgat cgaccttcca actatatagg ccaatcttat caatgtcttc ttcgctcatt
   134701 gcatacacta tcggataatg agacaatgag ttggtgaata gaaatcctta tgaaaacaga
   134761 acttacatct cggacctgct tccctctttt ctctggcgac agcctgctca tcccatgatt
   134821 ccatatcctc ccttctcccc cccacgtcta gatgggactg cgcatccctt aattcttcct
   134881 ctgactcagt gccatgctct ccagaaacag atggcgctgc tgaatcatct tcgttgtccg
   134941 acactgaaat ctggcactgc actctggaaa gactgttgtt gatgaatgtc tgaaaagcag
   135001 gattggacac tgaagctggg gaatggtcga caaagatgct gctctggggt gtggaaatgt
   135061 cagtgtgcgt tggccgaaga ctcacctcag acatttctgc atctccgtcc ccttgtgctc
   135121 caccattagt tccctctgct tcccctggca tgacggaatt gttactggca tccccctctt
   135181 gcgcttgttg tagggtcctc atcttctcaa ggtgtctggt tcatgtgact acagtaactc
   135241 gtcggtcgca gtacgacagt gtacagttgc attcgatgat gcgtgctttg tagtctgttg
   135301 tgggcatatt tcttgcgata gctggttgaa agagtggaca acgagaaacg aagatgattg
   135361 gatgatagca acaatcatgc ataatagaag atgatgaaat gacaaaagat taaatttggt
   135421 gcattcatct cacatgactg atttttggca atggcgctta attacactat aattgtaaca
   135481 aggtcaacct cgctcatctc tcttctttcg aagtgcttcc attgaatctt ctatttcttc
   135541 ctcttttttt ttaagattcc cctcaccact tcatcagcca aaaaaatgtc gtcagggaca
   135601 taacgcattc tcactatagg tcacaggaga tgctgtggtg aggaaagtgc agggatgata
   135661 tcatatgaga tcagagtggg attttggagc agaagcgcag caagcatagt tagagtggca
   135721 aataatgcag tgagtgcatg tagtacttat ataataagtc catagtcctg gctttacagt
   135781 gtgatgccag aaagttcaac acaaaatctc actaaatctt tcacaacctc actttctatt
   135841 tctagtcatt ctacctacaa tgccccgccc aaccaggtcc aacactcgcc cagtctcacc
   135901 aacaccatcc agtcctcttc ttgcatcttc atcaaacggt gggcagagaa gtggtggcca
   135961 aagaggtgta aaccgctttg taccgtattc tatgggggag tctcactctg cgcaacccgg
   136021 accctctcaa acccatcttg atgtcccctc ccatcctcat ccaaggagga ctcggagtga
   136081 ccaagagctg atcgatggac tcttggccga atcccaggaa tatcaacaat cccagagaac
   136141 aggtatgata catcttctgt tccttcctat tccccttgtt gttgactagg ttgctcatgc
   136201 attgactcct gcctcttgca gctgatgtcc acggtgtcgc cgccgcctcc tccttccaca
   136261 acaatgcctc cttctctcct gctcgaactt ctccctcttc accagaggta tccccccccc
   136321 ctggggctct ccattttgac cctgacatct cctaccccat ctcagatccc aaatcctcca
   136381 agccgcttag agcgataatg ggactggggc atggggtgaa tgacaatatt tggaggaaga
   136441 ttctagtgag tagcaattga tatttcattg gataagctcc caacgctttc cttaggagga
   136501 tgtccgccga agcgctgttc gagcctttgg tgataaagtg ggcatggaga catggaaggg
   136561 cacagactat gaggagcatg tgctcttcat gggtcttgtg agtgacattc ttttatatgt
   136621 tttggatggc cagctaacct tgttgaaggt cgccgacaag catgtcgacg tctttggtgc
   136681 tgcccagtgc aaaagcaagt ggcctatacg gtcactgggc atgcagtacc tcaaaaataa
   136741 ggcccaaact gctaggaaga agagaagctt gtgctcttcc tagcggatgt ctcgattgtg
   136801 tttttgtata ttgtacttta atgattctat tttttgtatt tttacaattc gatgcatgta
   136861 attcgaccaa ccaaaccaag ggttagctac aggctcattt caagctgcta aagggatcag
   136921 aacaacccat ttctcagata aaaacaatac tgaaaatggc ttaaaagcag ctgttatacg
   136981 gatgaaaaga agctgctaaa aggatcagaa taacccaact catggataaa aataatgctg
   137041 aaattggctt aaaacaagct gctaaaaggg tcagaataac ccatctcatg ggtaaaaata
   137101 atgctgaaaa tgggttaaaa caagctgcta aaagggtcag aacaacccat cgcatggata
   137161 aaaataaggc tgaaaatggc ttaaaacaag ctgcaataag aattagaata acccatgttt
   137221 ccaatacaaa taatgctgaa aatggcttat aataattcgg caaatggctt attttaaagc
   137281 ccaaaaaata agcccagaaa agtgctcaat taagccacat tgtggcttgt tttgatccta
   137341 aatggtaagc cgaaaaatcg ataaaaagac gcaattgtgg cttattttaa gccgaaacag
   137401 ttatggctta aattaagccg ccgcgggtcc catagtgctt ggacaccaca cccgccgcat
   137461 tcgatgcatt ctttcacctt gttatcagtt accaaggcat tcttcatgac ttcgaggacc
   137521 ccctcagcga cgtggacgtc aaccgccggc tattggacgg tgtcgatgcc ttggttactc
   137581 accgcaccaa agctgctctc cgcgcacatg gcaaaacagt gctctccgca acgtcggccg
   137641 acctgtatga gatcatgatg gacgtcatcg atgacgccat gcttgaggca cgtttccttc
   137701 aggtgccgac acgcccccgc cacccaccaa ccgtcgccaa cgtcatcgct cccgtccccg
   137761 cgcctccact cattgccaaa ctcgcccccg ccccctccac caccacgaag ggccacacta
   137821 cgcaacagct cgactggctc gaccccgcca aacggctccc cctcggtgac gccggccgat
   137881 ccgcccgcgc ctatcttcaa agcatcaacg cgtgtttctc atgctgcgtt gtcggccatc
   137941 accgccttat ttgcccaacc cgccccccct ccaccccgcc caacgcctcc gcgtccgtgc
   138001 cggtcgctaa cctcgtctcc cttgccgacg acgatgagtc cgaccaccac ggcgttttcg
   138061 ctgtcgaccc tgtcacagac actctagtac aggatgcctc gtctgcgctc gctgggtcag
   138121 tacctctcat catggtcaat tgccgtttca aggctgacgg agacactgtc ccagcactcg
   138181 ttgattgcgg cgctggcatc aacgtcattg accgggcgta cgcagagcaa cagggatggc
   138241 aaggacggcc gattataccg gtggggacca aaatggcaga caatcgggcg ggtccagtcg
   138301 tagaccagga gtatgtagtg gatgtaatca ttggtgacac tacctacaac gctaccccat
   138361 tctacgccat ggcccttggt ccacgatacc gccttatcct cggtttacag ttctgtcgtc
   138421 aacaccgcct atttgatggg gcggagcgtt taaatcacct cctcaatgca ggggggtcat
   138481 cctatacatc gcttgtgcaa ctacaactca actccatcac accagtcgaa tccccgaccg
   138541 taagcactga acgccactcc cactctgacg ccatcctccg tgaatttgcc gacatccttc
   138601 cagccaatat ctctgacgtc tcccactacc cgcccatttg ttcgtccacc tcccaagtcc
   138661 gccaccgaat aaacattctt cctgatgcga tgcctgtcgc tcgagctgga tttcgagtac
   138721 cgttagcgtg gcgcgacacc cttcgacaag aaatcgagaa acactgtacc gcaggccgcc
   138781 tccgtccatc cagttcccct tgggccgccc ctgctttcct cattaagaaa gaaaatggca
   138841 aattccggtt cctctgcgat tttcgcggcc tcaatagtgt cacggttaaa gatcgcaccc
   138901 cggttcccaa cattgacgac attctccaac gcgccgcccg tggcaaggtt ttcgccaaac
   138961 tcgaccttac cgatgcattt tttcagacgc tcatgcacga gcccgatatc gagaaaacgg
   139021 caattagcac tccctggggt ttatacgaat gggttgtgat gccgcaaggc gcgtgcaact
   139081 ggccggcaac acaacaacgc cgcctcaacg aggctttacg taacctcatc agtgtttgtt
   139141 gtgaagctta tgtcgatgat atcatcattt ggggtgcgac cgactctgac ttagcgaaaa
   139201 atattcgcgc ggttctcacg gctttacgta acagcgggtt tgtttgctcg cctagcaagt
   139261 cgaaattttt cgtcgactca gtctccttcc tgggccacgt aatctccccc aatcacattg
   139321 ggccagatcc gaagaaagtc gaagcactac gcgcatggcc atctcctggt tgtgtgaaag
   139381 acctccgatc ctttcttggc cttctccaat atttacgcaa attcatccca cacatcgcca
   139441 ccaagacgtc cgttctcacg gctcttctcc ctccgaacaa gacagcagag aaagcgtatg
   139501 aatcccgtaa acgtcaactg gctaagggcc tcccagctga gcgattagaa tcactgagtt
   139561 gggtatggaa gtggacaacg tcggcgcaag acgcgtttga ggcgctgaag gaaatggtgg
   139621 cacgtatcac aggtctgtcc cccctttccc atgaagctat cctcgcaggt caaaccaatc
   139681 tctacctttt caccgacgca agcaacaccg gcctcggcgc ctggttgggc acgggtctat
   139741 cccccgacaa cgctcaacct atcgcctacg attcccgctc tctcaccgcc gccgaacgaa
   139801 attatccggt acacgaaaaa gagttatgcg ccatcatcca cgccctcaaa gagtggcggc
   139861 ctctacttct cggcgtcccg gtgcacgtca tgacggacca tgcgactctc aagtggttct
   139921 ttcaacaacc aaatctgtcc gaacgtcaga agcgatggct actagtactc gccgattacg
   139981 acctccagat ttcccatatt ccaggggcca ctaatgtcat cgccgacgct ttctcctggc
   140041 tccgaaactc cgatgcccac gtcaacgccc tcaccatgat ggttctctca ccaaacacag
   140101 ctttcctgga tgcagtggct gaagggtatg ggcaggaccc agtaatgagc atttggaggg
   140161 aagtagaccg ctgccatccg ggtgtccgca cagccgaagt caacggagca cggggggtca
   140221 ggacggtgct gacatacgag gaccggctct gcattcccga cgtactcacc ttgcgagaac
   140281 agtgcctaca ggaatgtcac gatgcgatgg gccatttcgg ggtggagaaa acacttgaac
   140341 tattgcgttg taagtacttc tgggatggta tggctagtga cgtaaaggac tttgtcagca
   140401 cttgcccagc ctgtcagaca tccaaagcta ccaccactaa gcctcccgga ctactacact
   140461 cattaccagt tcctcccgcc aaattctccg acataggcat agatttcgtg gggccactac
   140521 cgcaatcaca cagcttcgac tatctcatcg tcattaccga tcgcctcacc ggctgggtcg
   140581 ctctcatacc aacagtcatg acgctcacgt cctccgcttt tgctcaactc tactacgacc
   140641 actgggtttc taaatatggg gtaccacaat ccatcgtctc agaccgcgat aagttattca
   140701 ctgctgcgtc atggcgtcgg ttgaattcac tcctgggcac taagctaaag atgtccacag
   140761 cataccaccc ccagaccgat ggtatatcag aacgatcaaa caagacagtc atccagatcc
   140821 tgcgaacctg gactgacgac caaggccgaa attgggcagc caacctacag cgggtcgcct
   140881 tcgcaatgaa caacaccatc cgacgctcaa cccaccacac ccccgccgag ctcgttttcg
   140941 ggaaacgcct gtcactcact ccgccgcttc tcccctcaac atcagctacg gaccagtccc
   141001 tcgcccaacc tacagcctcc gaatgggatc tcgctgccca acgcatggcc ctcgaagagg
   141061 gcatcgctcg tgacgaactg cttctcgcta agcatcggca aagtgttcaa gccaacaagc
   141121 atcgtcggcc ggacccggtc taccgcccgg gagacaaagt ctacttgaac acagctgagt
   141181 tccgtcacga atataagaca gccactaacc gttctgcgaa gttcatgccc cgttgggaag
   141241 gccccttcac catcctcaag gcctttcccg agcaatcact ctatgaattg gatgttcccg
   141301 tcacctcaac acagtcgacg cctcgccgcc atgtttcgcg cctcaagcca taccgggagt
   141361 ccgaacagta tcaccagcac gcggttcctc gcctacttga ccacccggct gtttcctcgc
   141421 cacgcatcct ccaaatcctt gaagaccgca ccctcacccc caagggaaat catccaaagg
   141481 tctattgtaa gaggctagcc tccgacccag tgacccacgg tcaccacttt ccccagcttc
   141541 taatttcgag ccacgtttca atttgcttcc gcttcttcct ccaagttgcg cgcgtcaaat
   141601 tgcatccgcg ctccctttcc caggtcacgt gctttatttt tcccctgttt ctccgagccg
   141661 cgtctcaatt tactcccgct cctttcctcc aagtcgcgcg cgtcaaattg catccgcact
   141721 ctccctccca ggtcacgtgc atcattttac ttccgctttt tctcttcttg ctttctcttc
   141781 catttctcgt cctaagtccg agtttcttgt ccgatttttc atgccacaag ccccggtgtt
   141841 taccgggctt tggtcgtgac tggtttcgag agcgaaggca aagtgcatgg aaaggttgac
   141901 acacaaattc ctttattctt ttatccttgt tgtgttcaac ctttccttct tccgacttta
   141961 cagtcacaag taccttgcct tctcctcttg ttcctatcaa ttcttcatct tgtctccttt
   142021 actagtcgct gataggacat aatcagcata tgcatttggg atcttgtttg cttctctcca
   142081 gtccgaagtt aagcctcgag ccctgccagc cctaagagcc caccagttct ctccaagcct
   142141 tgtccctccg agctagcccc aacagtacag tgaaggtcta ttgtccggac cttacacttt
   142201 ttttcaaact cattacccaa atcaattcac accacactcc accacaccaa catacatcat
   142261 ggcgtttgat tctcagggcc aacccatcat tgcgtacgac gaggtgactt cccgtcccat
   142321 catcgggcat caccccactg gcgttcccat cttcggcaca ttcacggacg accacctatc
   142381 gtccgcgggc tccggagaaa atttggcttc gcccacaact tcaaacgcgg tgccttcggt
   142441 gcctgaccta cccgacgaaa agatggtaaa ctacgcaacc cctgtacacg ataccacggg
   142501 tgcaatctac cgaaagaccc cgggcctcac cactgccttt tccggcccgg ccgttcctga
   142561 gatcgacgag cttaaatcta ttgttgccgg actccttcgt tccacccaag cgctagccga
   142621 tcaagccacc acaggccacg accgtcacgt ccccccctcc acacgcgggt cccgcccgga
   142681 caagatctcc ccgccgcgac ttgggactca ctcctccgcc gacccgttcg cgctccagcg
   142741 acatctcctc gccttggaga cctatttccg tgacgccctc ctacactgga gccccggccc
   142801 ggctgagcac gcgtggaaga tttcggtggc aaatacctcg atctcccaat cgggcggccg
   142861 gttcaccacg tggctcgagc tccatggcaa acacgccgaa acttgggatg catggcaagt
   142921 ctcccttaag tctcacattc tcgcccgcgg ctgggagtcc aaactccgcc accgattcat
   142981 gcagcttcgc tgcttggaca ccacacccgc cgcgttcgat gcattctttc accttgttat
   143041 cagttaccaa ggcattcttc atgacttcaa ggaccccctc agcgacgtgg acgtcaaccg
   143101 ccgactattg gacggtgtcg atgccttggt tactcaccgc accaaagctg ctctctgcgc
   143161 acgtggcaaa acggtgctct ccgcaacgtc ggccgaccta tacgagatca tgatggacat
   143221 tatcgatgac gccatgcttg aggcgcgttt ccttcaggtg ccgacacgcc cccgccaccc
   143281 accaaccgtc gccaacgtca tcgctcccgc cctcgcacct ccactcattg ccaaactcgc
   143341 ccccgccccc tccaccacca cgaagggcta caccgcacaa cagctcgact ggctcgaccc
   143401 cgccaaacgg ctccccctcg gtgacgccgg ccgatctgcc cgcgcctatc ttcaaagcat
   143461 caacgcgtgt ttctcatgcc gcgttgtcgg ccatcaccgc cttatctgcc caacccgccc
   143521 cccctccacc ccgcccaacg cctccgcgtc cgtgccggtc gctaacctcg tctcccttgc
   143581 cgacgacgac gagtccgacc accacggcgt tttcgctgtc gaccctgtca cagacactct
   143641 agtacagtgt aagtgcagag cccttaccac cactcgttct caccatatga taggatttat
   143701 ccctatgcat tggtcgatgt tggtaggtga gatttgatgc cgaaacgcgt ctttcggact
   143761 tcgccgaaac gcggcatcga gctctgtccg gccttatcct atgcatgata tttattctca
   143821 tgcataggac cggcaaattg cttccgaaac gcggcagcgg acttcgccgg atctctgccc
   143881 cttttttcga tggacttctg tttgtttcct catacattca tatatatata tatattggta
   143941 catagttata gttctccttt tacctagcaa acttaatgca tattcccgtg ctagtttgcg
   144001 tccattcaga caactataac tatcttacac ctctatgaac gctctcctcg aacgctttct
   144061 cgaacctcat ttccccttcg aacgctcaac gaaccctgtc cgaacgcagt gaggcaccca
   144121 cagtgcctac actttttttc aaactagcct ttcccacgaa tcgcaatatc tatgatgccg
   144181 ccgaaaccca ctaaaggagc agtggaggac tcaccttccg aatcccctac tgcagcgctt
   144241 ttggagtgcc ttgttggccg tgcccagaag caggacgaca cactcgcact ccttaccgag
   144301 ttactgctca aacaacaaaa acagtcaacg gttaaagatc ggtacaatcc tcggggtctt
   144361 cctctaccta agccctcaga cattccccgt tttcaaggtc ccctggggaa tgcagacagc
   144421 gtattgactc atcttcgtcg actacaacaa ctacttcgaa caaacggctt attgactcct
   144481 tctgatgatg aggagctgga ggcgcgaagg cgaattactg taattgagtt ggccaacaat
   144541 tcgatagact gtgctggctt agttggttgg gtcgaacatg agggccgccg tatggaggag
   144601 gatgggagga gtacttggca agactggtca gttgctttca aagctaaggc catgccttca
   144661 cactgggagt atcgggagtc tcgtacctta ttccgtctct cacttcaaga gatttctccc
   144721 gatgcgtggc gaaaattcga cgatgctgtt attcttcatc gcagccatct tcacggtacc
   144781 caccactatc ccctcgacca cgaaattgct cgcctttacc gtgctgcttg tcccgagcgc
   144841 ctttttctcc gcctagtgga tgagcccgga tttcacacga acgatttgga tggtctacgt
   144901 gtgttgatga gcaatcatat tgaacgaatc gcacatgaag atgcagcctc tcaacacgta
   144961 ccgcgctcta ttaagactcc tgcttcttcc gcctctcgat cctcggactc tgctcaactt
   145021 cctcagccgg tcaattacta ttatgatccc gcccacccgc tcccttatta tcgttcgcca
   145081 gccggtcggt acattcgtaa tgtattccgc caagagaacc gttgtttcga ctgccgcaag
   145141 attggtcacc aacacccaca atgccccagt cgtacgcacc atactcagcc taaggtgaat
   145201 cagctggaga ccgagttaac tgctggggat accacttcgg cgtacctcgc tcttgcgcaa
   145261 actattccgt cagccgccga acctattcaa gactcttcgt acgccctttt ccaccctctt
   145321 cttgctatat ccgttccgat cccggctgat gacctctggc cagctcgtct cattaggctc
   145381 ctaatcgaca caggggcgtc cacgaccttc gtggatccaa agctggcagc gaggctggga
   145441 tggtcggtga agacaagtgc cgtacggatg agagttaggt tagctggcgg aaaggcgggt
   145501 cccatagtca ccgatacggt tatcggctcg ttttctctag gcgacaggat gtatcaaata
   145561 aacggtgtgg tgatggattt gcacggaatg tatgatggta tcttagggct taacttcctt
   145621 gctcggcacg gtttattggc ggatacaacc tcccttgttc acctattgga ggctggaggc
   145681 gcgaacctat ctgcgttagg actgcgaaag gatgacgcgt ccccttcgga gcttgtctcc
   145741 gctactaggc tacaccacac ggagatccac ccggcaactc cgcatgcgac cgcggccgca
   145801 gattctcaca gtctgacaga cgtcctgcgt cgtctccagg ccgagtttca cgatgtcttt
   145861 tgtgatgacc taggcgatgt acgaaacttc cccaccatat caaagaccag atcgggtatc
   145921 cgtttcgaaa ttaatctcaa acatggtgcc actcccaaac actcggcgcc ttaccgcgta
   145981 cccgaagccc tgctccctcg tttccgtgag atgctgttag agcatctgaa tgcaggtcgt
   146041 cttcgctatt ccagttcccc ttgggcctcc ccggcgttcc tcgtgtccaa aggtaatggc
   146101 aaattcagaa tggtctgcga tttccgcgct ctgaacaatg tcacggtccc cgacatgtac
   146161 cctatgggga atgtccagga tatcctccac cgtgccgcca ggaagggcaa gattttcgca
   146221 aaacttgact gtaaggatgc ctttttccag acgctaatga aggaggagga catcccgaaa
   146281 accgctatca ccactcctct cggtctccta gagtgggtgg taatgcctca agggatccgg
   146341 aacgcgccgg ccgctcaaca gcgtcgcatt aatgaggcgt tacaaggttt aactggggaa
   146401 tgttgcgagg cttacgtgga cgatatcatc atctggggga aggatgcgaa ggacctgcat
   146461 gataatattg tgagtgttct ttctgcccta cgtcgaagtg gtcttcgctg ctcgcgtgag
   146521 aagtcaaagc tgttcctcga cgaagtagcg ttcttaggcc acatcattcg ccccggacag
   146581 attctgcccg accccgccaa aatcgcacgc gtcgagcagt tccccctccc ggtcaattct
   146641 caccaactcc actcgttcct tggtctcgtt aactaccttc gcgatttcgt acccaacctg
   146701 gccgaccaca ccgccgtgct tcacgccact cttcctccga atgcggcggc tgagaaagct
   146761 tactacaagg ctgtcaagat gcataaggga cacctccccg agggatggac tggttggaga
   146821 tggtcgttcg gccctgcgga gaaggcggcc tttgaagcga ctcgacgcgc ggtgagtact
   146881 gtcccctgtc ttgccgttat cgattatgat gctgtcaaag cgggaaagca gcaggttttt
   146941 ctattcaccg acgcttccaa cacaggtact ggcgcttgga ttggtgtcrg tacctctcgg
   147001 gagtccgccc agcccgtggc ctacgattcg cgcactttca atagtgcaca acggaactat
   147061 ccggtacacg accgtgagct gctggcgatt attaatgccc tcgatcattg gcgccctctg
   147121 ctatacggca ttccagtcca cgtctactgc gatcacttta cccttcaatg gttcctaggt
   147181 caacgtaatc tctctccccg tcagcttcgg tggctgagta ctctgaagga tttcgacctc
   147241 cgcatcgaat atatcaaagg ggagttcaat actctcgccg attacctctc tcgtcatgct
   147301 ccttcggacg ccgccgaacc tgccgacccc tctctggatc aatcaccggt ttcagttcat
   147361 gccacaatga catacgagcc cactttggat ccggacaccc ttcgcgcgat tgtgcagggt
   147421 tatcaaggtg atgtattatt caaagaatgg cttgctgatc cgtctactgc tccaggtgtt
   147481 accctccata atcatgatac acaccaactc ctccttgttg acaaccgttt atgtatcccg
   147541 gacgttaata cccttcgtga ggaacttatg cggcaagcac atgagggaac tgctggacat
   147601 ctgggtgtgg agaaaactat ggagatactc aggagtggat acttttggga gacaatgtcc
   147661 aaggatgtcc gtgagtttgt ccgtgcgtgt cacttatgtc aacaggcaaa tgcccctacg
   147721 acgaaaccgg ctggtcctgt gcatccgctc ccggtcccac gygataaatt cgatgacatc
   147781 gctatcgatt ttgtgggacc actcccttct tccggcggac atgactatct tctcacgatc
   147841 acggatagac taaccgggtt cattgaattg gttccatgtt ttaccactat taacgctcgc
   147901 gacctcgcta tcttggtttg ggacagatgg gtttctcgct atggcctccc gctctctatt
   147961 acgtccgatc gcgatacact atttacctca cgattttgga cgaccctctg ggagcagcag
   148021 aacgtcaagc tcaaaatgtc cacggccttc catccgcaaa ccgacggcgc ctcggagcgt
   148081 acgaacaaga cggtagttca actccttcgt agctgggtgg accgacatgg caaatcttgg
   148141 gttaagtacc ttcctcgtgt ttcccaagcc atgaataata ctgtcagacg ttccacaggt
   148201 ttctctccgg cacaactggt cctgggccgc cgactacgta cccttccaag ccttccccga
   148261 cctccctcct tcatccaggc gtctcttcct acgcgggctg aatggactct cgctgcggat
   148321 cgcactgacc tctcgctcgc cgacgcccgc gataacctca ttttggcgaa acatcgtatg
   148381 gccgtccagg ccaatcgcca tcgccgtccg gaagtagtct acaaggttgg ggattgggtg
   148441 tggttggata cccgaaatag gttgaaggaa tttcgtgctg gagacgggga atatcgcgct
   148501 gctaagttct tcccccgctt ccaggggcct taccaggtac aagaagctaa ccccgccctc
   148561 tcagtttacc gtcttcacat gaatgaccgg acatacccaa aattccatgg tcatctcctt
   148621 aagccttatc tgtcatcgcc taggtttcat caaacatcac cggtaaccca ccaatcggac
   148681 actggacgtc gcagcattct tcaaatcctg gatgatcgag tgtatcgcgg tcatagacaa
   148741 ctccgggtag tactcagcgg cgacggtcct aatggtcaat ggaggaatct cgacgacttg
   148801 cgtacacacg atggtttccg ggccttatat gatgaatata taggcgacga cgaactggcc
   148861 ttgtgagtcc ccttcctgtt tgctcctgtt ttcctttgta tcagtgtctg ggggctgctt
   148921 gcgtttctct gtgggttttt tggccattat tggttttttt ccctggcttg cgctcagcaa
   148981 gactaaatta acaggacttt ctcacagagt gttctcctgc ccagtccttc caacgtggat
   149041 ggatttggaa agtaacgtgt tgacaggggg gcgctggcag tccccacggc ctggtgatcg
   149101 ttcgttcttt tgcccctatt ctcttctttt caattttacg ttcctttgcc ttatctctta
   149161 attccttctt tatctctttg atccggtcga gtcttcccct ggctctcatc tgggcggggg
   149221 agagtgtaag tgcagagccc ttaccaccac tcgttctcac catatgatag gatttatccc
   149281 tatgcattgg tcgatgttgg taggtgagat ttgatgccga aacgcgtctt tcggacttcg
   149341 ccgaaacgcg gcatcgagct ctgtccggcc ttatcctatg catgatattt attctcatgc
   149401 ataggaccgg caaattgctt ccgaaacgcg gcagcggact tcgccggatc tctgcccctt
   149461 tttttcgatg gacttctgtt tgtttcctca tacattcata tatatatata tatatattgg
   149521 tacatagtta tagttctcct tttacctagc aaacttaatg catattcccg tgctagtttg
   149581 cgtccattca gacaactata actatcttac acctctacga acgctctcct cgaacgcttt
   149641 ctcgaacctc atttcccctt cgaacgctca acgaaccctg tccgaatgca gtgaggcacc
   149701 cacagtgcct acagatgggc gttcgtggta taggtctaga gggcgttcgg atgcgttcga
   149761 ggaagcgttc ggtgtttgtt tatagttata gtggtctact ggatgcgaaa ctagcaatgg
   149821 ttgatatgca tgagtttcgc ttggagaaag agaaaactat aactatgtat gagatctata
   149881 tatatatatg tatggacgta tgcagaaaca aacagaagtc catcgaaaaa aaggggcaga
   149941 gatccggcga agtccgccgc cgcgtttcgg cagcgattgc cggtcctatg catgagaata
   150001 aaatatcatg cataggatga ggccggacag agccgatgcc gcgtttcggc gaagtccgaa
   150061 agacgcgttt cggcatcaaa tctcacctac caacatcgac caatgcatag gaataaatcc
   150121 taccatatgg tgagaatgaa tggtggtaag ggctctgcac ttacactctc ccccgtccag
   150181 atgagagcca ggggaagact cgaccggatc aaaaagataa aagaaagaat taagagataa
   150241 ggcaatggaa cataaaattg aaaaggagag aataagggca aaagaacgaa cgatcaccag
   150301 gccgtgggga cagccagcgc ccccctgtca acacgttact ttccaaatcc atccacgttg
   150361 gaaggactgg gcaggagaac actctgtgag aaagtcctgt taatttagtc ttgctgagcg
   150421 caagccaggg aaaaaaacca ataatggcca aaaaacccac ggaggaacgc aagcagcccc
   150481 cccagacacg tatacaaagg aaaacaggag caaacaggaa ggggactcac aaggccagtt
   150541 cgtcgtcgcc tatatattcg tcatataagg cccggaaacc atcgtgtgta cgcaagtcgt
   150601 cgagattcct ccattgacca ttaggaccgt cgccgctgag tactactcgg agttgtctat
   150661 gaccgcgata cactcgatca tccaggattt gaagaatgct gcgacgtcca gtgtcagatt
   150721 ggtgggttac cggtgatgtt tgatggaacc taggcgacga cagataaggc ttaaggagat
   150781 gaccatggaa ttttgggtat gtccggtcat tcatgtgaag acggtaaact gagagggcag
   150841 ggttagcttc ttgtacctgg taaggcccct ggaagcgggg gaagaactta gcagcgcgat
   150901 attccccgtc tccagcacga aattccttca acctatttcg ggtatccaac cacacccaat
   150961 ctccaacctt gtaggctact tcaggacggc gatggcgatt ggcctggacg gccatacgat
   151021 gcttcgccac aaggaggtta tcgcacgcct cagcgagcga gaggtcagtg cgatccgctg
   151081 cgagagtcca ttcggcctgt gtgggaaggg aagcccgggt gaatggagga ggacgagcca
   151141 gactaggtag ggtacggagc cgacggccaa agaccagttg tgcgggagag aaacctgtgg
   151201 aacgtctgac agtgttattc atggcttggg aaacacgaga gaggtactta acccaagagg
   151261 tgccatgcct atccacccag ctacgtagca gttgcaccac cgtcttgttg gaccgttccg
   151321 aagtgccgtc agtctgcgga tggaaggccg tggacatctt gagcttgacg ttctgctgct
   151381 gccatagtgt tgtccagaat cgcgaggtga acagagtatc acgatcggac gtaatggaga
   151441 gcggcaaacc ataacgagac acccatcgct cccaaaccag gatggcgaga tcccgcgcat
   151501 tgatcgtggt ggagcaggcg accagttcga tgaacccggt tagtctatcc gtgatcgtga
   151561 ggagatagtc gtgtccaccg gaagaaggga gtggtcctac aaaatcgata gcgatatcat
   151621 cgaatttatc gcgtgggacc ggaagcggat gcaagggacc agccggcttc gtcgtgggtg
   151681 cgttcgcctg ttgacataaa tggcacgcac ggacaaactc acgaacatcc ttggacattg
   151741 tctcccaaaa gtatccactc ctgagtacct ccatggtttt ctccactccc agatgcccag
   151801 cagtgccttc atgggcttgc cgcataagtt cctcacgaag tgtattaacg tccggaatgc
   151861 ataagcggtt gtcaacgagg agaagtcggt gggtatcatg atcatggaag gtaacacctg
   151921 gagcagtaga cggatcagca agccattctt tgaataatac atcaccttga taaccctgcg
   151981 caatcgcgcg aagggtgtcc ggatccaaag tgggctcgta tgtcattgtg gcatgaactg
   152041 aaaccggtga ttgatccaga gaggggtcgg caggttcgac ggcatccgaa ggggcgtgac
   152101 gagagaggta atcggcgaga gtattgaact cccctttgat gtattcgatg cggaggtcga
   152161 aatccttcag agtactcaac caccgaagct gacggggaga gagattacgt tgacctagga
   152221 accattgaag ggtaaagtga tcgcagtaga cgtggactgg aatgccgtat agcaaagggc
   152281 gccaatgatc gagggcatta ataatcgcca gcagctcacg gtcgtgtacc ggatagttcc
   152341 gttgtgcact attgaaagtg cgcgaatcgt aggccacagg ctgggcggac tcccgagagg
   152401 taccgacacc aatccaagcg ccagtacctg tgttggaagc gtcggtgaat agaaagacct
   152461 gctgttttcc cgctttgaca gcatcataat cgataacggc aagacagggg acagtactca
   152521 ccgcgcgtcg agtcgcttca aaggccgctt tctccgcagg gccgaacgac catctccaac
   152581 cagtccatcc ctcggggaga tgtcccttat gcatcttaac agccttgtag taagctttct
   152641 cagctgccgc attcggagga agagtggcgt gaagcacggc ggtgtggtcg gccaggtttg
   152701 gtacgaaatc gcgaaggtag ttaacgagac cgaggaacga gtgaagttgg tgagaattga
   152761 ctgggagggg gaactgctcg acgcgtgcga ttttggcggg gtcgggcaga atctgtccag
   152821 ggcggatgat atggcctaag aacgctactt cgtcgaggaa cagctttgac ttctcacgcg
   152881 agcatcgaag accacttcga cgtagggcag aaagaacact cacaatatta tcatgcaggt
   152941 ccttagcatc cttcccccag atgatgatat cgtccacata agcctcgcaa cattccccag
   153001 ttaaaccttg taacacctca ttaatgcgac gctgttcagt ggccggcgcg ttccagatcc
   153061 cttgaggcat gaccacccac tccaggagac cgagaggagt ggtgatagca gttttcggga
   153121 tgtcctcctc cttcattagc gtttggaaaa aggcatcctt acagtcaagt tttgcgaaaa
   153181 tcttgccctt cctggcggca cggtggagga tatcctggac attccccata gggtacatgt
   153241 cggggaccgt gacgttgttc agagcgcgga aatcgcagac cattcggaat ttgccattac
   153301 ctttggacac gaggaatgcc ggggaggccc aaggggaact ggaatagcga agacgacctg
   153361 cattcagatg ctctaacagc atctcgtgga aatgagggag cagggcttcg ggtacgcggt
   153421 aaggcgccga gtgtttggga gtggtgccat gtttgagatt aatttcgaaa cggatacctg
   153481 atctggtctt tgatatggtg gggaagtttc gtacgtcgcc taggtcatca caaaagacat
   153541 cgtgaaactc ggcctggaga cgacgcagga cgtctgtcag actgtgagaa tctgcggccg
   153601 cggtcacatg cggagttgtc gggtggatct ccgtgtggtg tagcctagta gcggagacaa
   153661 gctccgaagg ggatgcgtca tcctttcgca gtcctaacgc agataggtgt aaggtctgga
   153721 caatagacct tcactgaact ggtggggcta gctcggaggg acaaggcttg gagagaactg
   153781 gtgggctctt agggctggca gggctcgagg cttaacttcg gactggagag aagcaaacaa
   153841 gatcccaaat gcatatgctg attatgtcct atcagcgact agtaaaggag acaagatgaa
   153901 gaattgatag gaacaagagg agaaggcaag gtacttgtga ctgtaaggtc ggaagaagga
   153961 aaggttgaac acaacaaaga tgaaagaata aaggaaattg tgtgtcaacc tttccatgta
   154021 ctttgccttt cagtctcgaa accagtcgcg accaaagctc cggtaaacac cggggcttgt
   154081 ggcatgaaaa atcggacaag aaactcggac ttaggacaag aaaaggaaga gaaaataaga
   154141 agagaaaaag cggaagtaaa ataatgcaca tgacctggga ggaagagtgc ggatgcaatt
   154201 cgacgcgcgt gacttggagg aaaggagtgg aagtaaattg agatgcggct cggagaaata
   154261 ggggaaaaat aaagcacgtg acctgggaga agggagagcg gatgcaattt gacgcgcgca
   154321 acttggagga agaagtggaa gtaaattgaa atgcggctcg aaaattagaa gctggggaaa
   154381 gtggtgacct catgagatgt gggtcaactg ggtcagaggc tagcctctta caccctcccc
   154441 ctcctggatg agactgagta tgtgggaaaa aaaggggggg agaagaatga gctagaaaac
   154501 tgtagaagct gggcttcaat gaggggccag gctgagagac aatccatgaa acatgttgta
   154561 agtgcagagc ccttaccacc acttgttctc accatatgat aggatttatt cctatgcatt
   154621 ggtcgatgtt ggtaagtgag atttgatgcc gaaacgcggc atcgagctct gtccggcctt
   154681 atcctatgca tgatatttat tctcatgcat aggaccggca aattgctgcc gaaacgcggc
   154741 agcggacttc gccggatctc tgcccctttt ttcgatggac ttctgtttgt ttccccatac
   154801 atacatatat atatagatct catacatagt tatagttttc tctttctctg agcgaaacca
   154861 tgcatacaac ccattgctag tttcgcatcc actagaccac tataactata atcaaacctc
   154921 gaacgcatct gaacgccctc gaacgccctc gaacgcttcc tcgaatgcaa acatcaaaca
   154981 cttatccttc tcaaacgcca accgaacaca gtgaggcacc acagtgccta cacatgttga
   155041 ctgagggaaa cccccaccac gaaaaaactc cctggccttt tggctttttt tcagattctt
   155101 tgtctgggga taaaaaaaaa ggggggtaga gaacctcttg tctgtcttca ggcctgtgag
   155161 gaaggggggg agggaactgg aggagaaaaa aatggacgag agaaaaaaat gaggtaaaac
   155221 actgcacgaa ggaaaggaaa aaagggggga acggaattga aaacctggat gggggtgggc
   155281 ttgggacttg atgggggggg tggtttggca tctgtgtgaa ggggtcagcc gggtctgagg
   155341 ggtagatgag ggaaggaaaa aaaggtgtta gggaatgtgt atacagctca caatggagtg
   155401 tggcaatgtc aggactgtta accctgggtg aacatctgag aaacatcagt agtaacgtcc
   155461 agtacgtcga gatgtagctc atcttcgcca ataaagtctt cccaagcctc ctgccaacct
   155521 gcatagtcct gcgctgtgtc gcgactgagc caccgagcct tggggccttc gccggcgagg
   155581 cgggcacgca cttgataaac ctttggatga tttcccttgg gggtgagggt gcggtcttca
   155641 aggatttgga ggatgcgtgg cgaggaagca gccgggcagt cgagtaggca aggaaccgca
   155701 tgctggtgat actgttcgga ctcccggtat ggcttgaggc gcgaaacatg gcggcgaggt
   155761 gtcgactgtg ttgaggtgac gggaacatcc aattcaaaga gtgattgctc aggaaaggcc
   155821 ttgaggatgg tgaaggggcc ttcccaatgg ggcatgaact tcgcagacca gttagtggct
   155881 gtcttatatt cgtgacggaa ctcagctgtg ttcaagtaga ctttgtctcc cgggtggtaa
   155941 acagggtccg gccgacgatg tttgttggct tgaacacttt gccgatgctt agcgagaagc
   156001 agttcgtcat gagcgatgcc ctcttcgagg gccatgcgtt tggcagtgag atcccattca
   156061 gaggccgtag gttgagtgag gggcgggtcc gtagctgatg ttgaggggag aagcagcaga
   156121 gtgagtgaca ggcgtttcct gaaaacgagc tcagcggggg tgtggtgggt tgagcgtcag
   156181 atggtgttgt tcattgcgaa agcgacccgc tgtaggttgg ctgcccaatt tcggccttgg
   156241 tcgtcagtcc aggttcgcag gatctggatg actgtcttgt tagatcgttc tgatatacca
   156301 tcggtctggg ggtgatatgc tgtggacatc tttagcttgg tgcccaggag ggaattcaac
   156361 cgacgccatg acgcagcagt gaataactta tcgcagtctg agacgatcga ttgtggtacc
   156421 ccatatttag aaacccagtg gtcgtagtag agttgagcaa aagcggagga cgtgagcgtc
   156481 gtgactgttg gtatgagagc gacccagccg gtgaggcgat cggtaatgat gatgagatag
   156541 tcgaagctgt gtgattgcgg tagtggcccc acgaagtcta tgcctatgtt ggagaatttg
   156601 gcgggaggaa ctggtaatga gtgtagtagt ccgggaggct tagtggtggt agctttggat
   156661 gtctgacagg ctgggcaagt gctgacaaag tcctttacgt cactagccat accatcccag
   156721 aagtacttac aacgcagtag ttcaagtgtt ttctccactc tgaaatggcc catcgcatcg
   156781 tggcattcct gcaggcactg ttctcgcaag gttagtactt cggggatgca gagccggtcc
   156841 tcatatgtca gcaccgtcct ggccccccgt gctcctttga cttcggtagt gcagacaccc
   156901 ggaggacggc ggtctacttc cctccaaata ctcattaccg ggtcctgccc atacccttca
   156961 gctacttcat ccaggaaggt tgcgtttggc gaaagaacca tcatggtgag ggcgttgacg
   157021 tgggcgtccg agttgtggag ccgggagaag gcgtctgcga tgacattagt ggcccctgga
   157081 atatgggaaa tctgaaggtc gtaatcggcg agcacgagta gccaccgctt ctgacgttcg
   157141 gacagatttg gttgttgaaa gaaccacttg agagtcgcat agtccatcat gacgtgcacc
   157201 gggatgccga gaagtagagg ccgccactct ttgagggcgt ggatgatggc gcataactct
   157261 ttttcatgta ctggataatt tcgttcggtg gcagtgagag agcgggagtc gtaggcgata
   157321 ggttgagcgt tgtcggggga taaacccgtg cccaaccagg caccgaggcc ggtgttgctt
   157381 gcgtcagtga aaaggtagag attggtttaa cctgtgagga tagcttcatg ggaaaggggg
   157441 gacagacctg tgatacatgc caccatctcc ttcagtgcct caaacgcatc ttgtgccgac
   157501 attgtccact tccataccca actcagtgat tctaatcgtt cggctgggag gcccttagct
   157561 agttgacgtt tacgggattc atacgctttc tctgctgtct tgttcagagg gagaagagcc
   157621 gtgagaacgg acgtcttggt ggcgatgtgt gggatgaatt tgcataaata ctggagaagg
   157681 ccgaggaaag atcggaggtc tttcacacaa ccaggagatg gccatgcgca tagtgcttcg
   157741 actttcttcg gatctggccc aatgtgattg ggggagatta cgtggcccag aaaggatact
   157801 gagttgatga aaaatttcga cttgctaggt gagcagaaac aagctgcaat aagaattaga
   157861 ataacccatg tttccaatac aaataatgct gaaaatgact tataataggg gtagacaaaa
   157921 tgcagctcat tgttattttt tatttctgtt agggaagcaa agggagacct gatttcaggg
   157981 tggaggctta ggaaatgacg acagagagtc tagaacaggc ccataggaat tagtgaattt
   158041 gcttcgcgac gcgagtgacc tcgacagaga cgcgtctgtc tttgcaacat gataattgcg
   158101 tctgttgcgt tctgaatcct atcctcttca acatccagcg ctccaagagc agtttaccac
   158161 cctaagaaca acgtagtgaa tatgccaaga cgatcagcta agtataaagc gacagcacga
   158221 gccagagagc tctatcgaat ggcgactatc ctcaatcata agcagctcaa ggccagtctg
   158281 tccattccgt atcatgctct caggacatct cgttacctca atcgtccgaa gaagtatggt
   158341 cagcttcgta gtagggatgc tgttgccaga attacaagca ttcatgagat accagatgag
   158401 gatttccgcc gcaaactgcg cgtcaaccat acggaatttc gaaagcttct ctgccttatc
   158461 aaggaccatc cagttttcgt ctctcatggt ccaagaaagc aggcgaaccc ccttttacag
   158521 cttacagttg cgctctatcg actgggacat tgcggatgtg ctgcgagcac ttttgagata
   158581 ggagagcagt ttggggtgtc aggtgagtgc ccacgccaca ctgcatccag aaacattaaa
   158641 ccgtttcttc gagattgatt gttatccatc agagggcacg tcggccatat ggacgactcg
   158701 ggtaatcaag gccatcctgt cattggagcg aaacaacgta tactggccag atgaaaatga
   158761 gaggaaggct atagacaggc actttgaaga ggaggaggac attcctgatg gatgtgtggg
   158821 gattatcgac ggcttccatg ttcccttcgc ttacaagcct gctcgccatg atgctgtcga
   158881 tttcttttca tacaaagggc gctacggctt caatatccta ggaatttgcg accatttgaa
   158941 gaggattcgg tacttccagt acggttatcc tgcttctgct catgatgctc gtatcttcaa
   159001 gaactgttct ctctttgaag aggctaatgc cgacgctcag agtaacagag aagccatgtt
   159061 gcaaggccga gctgttcatt cagaaatgat cagtcaaggt gaatatcttt tggcagattc
   159121 ggcatttcct gctggggatt ggtgtgtacc gcttttcaag cgtcggagag gtcagaacga
   159181 ccttgatcgg ccagaagtaa gtttatttgt ccgcatatct catgtataga cctacatgct
   159241 catatataca acaggccaag ttcaataaga agtgttcgag tgcccgagtc aagattgagc
   159301 atgcctacgg aatcctcaaa aaccgctggc agagtcttag gagccttcgc gtgaagattc
   159361 gcaatgtcag agatgaaggc gttgcgacat gctggatccg ggcctgtgtg gtattgcaca
   159421 atctgctcat tgacacaggt gattggtaca atcgactgga tggtgacgct gatgaacctg
   159481 atgattacat cgacatcgaa aggatgcaag aaaggatgga gagggtgtta gagcggcaca
   159541 gggaagaaga ggaggatgag gcacgtgatg caagagatgc ttcgaatctc acgcgaaaga
   159601 gggtgatgga gcgaatgcag gaaatagagc gcagggatct tctatgatca tatctgcagg
   159661 ggagaggaag agacgactga gaatgcatat cataattata gagagggagc tccaggctca
   159721 ggccccacca taactttcgc ctcctcccaa cttttcccag acctcatcag catctccatc
   159781 ttcctgttcc aactctccgc caacatcttc atcttttctg tcgccgcatt ctcccgtgct
   159841 atcgtcacat tctcctgcgc gatattcatc atgtctgcat gatgtttctc ctgcacggag
   159901 attttccgtt cttgaacggc caatagctcc tgatgccgcc gatcgtcgtt gccctcctgc
   159961 ctcatgacca gctcatccat cttgtcatct gccgagacag cctttgcctt ggaagacctt
   160021 atggatgctc tctggctctg ggtttgggct cggattggtg tagacactga gcccagcaca
   160081 gatgaggacc gtgcaggttg agacgaagag cggctctccc tgcggatagc tgcaatgatt
   160141 ggagcatctg cctctgactc ggtctcgcta gcctcacctg caccgtcccc aaagagacca
   160201 ccatcctctc ctgacaactc atcttccgag tcatcagcag ccatttcgcc cctttggcgc
   160261 tctatcaaac catcgagggc agcgagatct ctgtcgggac gattgagaga ggcgtggagg
   160321 gtcgaagagg cgtggtgggc agtgacggag gccctgtcgc caaggacagg taaaaggatc
   160381 tcgtagaagg ggcaaacctt ctttcgttga gctattaatg ttcagttagc cacgacgtgc
   160441 ccatgctgcc tgccaaagta cttttacaca ccaaggagac tctcgtcgtc gatctccatc
   160501 gccccagcac cagtcccggt ccctatctgg gatgccttag tgaagctctc gacaatttga
   160561 ttgatctttc atcatatcag cgctcatgag cataccaaaa acgaaaaaga catatttact
   160621 ttgagagcaa cactttgaaa ctggcgtcga ctgtcgcagc cattgtcagt aaggtactgt
   160681 agacactttc tcgaccaaaa atccttcttc tcatgaccag ttttccagtt atgaaagttg
   160741 gggagccttc cattctcagg aatggttgac aaccatacag caacgtgctc ctctgccgag
   160801 acaccatcgc tgttggtatc tgtcgcccat tgcttgttgg agtttcgctg cttcttctga
   160861 gtcgcctcag acgcttgatt ctcgttctcg ttctgccttt tagggggcat gattggtgat
   160921 tgttgagatg aacggagtct gagataaaaa taagtcaatg gtggaatgtg taagatttct
   160981 aagagaaaaa aacacgttac gcgtcttgaa atcatgcatt ctgaagcacg aagagcgagt
   161041 ttgaattgtc aaatgaatta aacgacctcc agaggccgtt taattcgaac ggcttttttc
   161101 aagttatttc aagaggaatt tcctttcatg gtaaatccaa ctcggacttc tgccaattca
   161161 attccagggt ttttacgcca caaagggttc aggaatgtca ttttccctga gggaattggc
   161221 agctcgttca tcaattcaga attatcatcg aaatagcatg cattttgtct acccctaata
   161281 attcagcaaa tagcttcttt tgaaacctaa aaaataagcc cagaaaagtg ctcaaataag
   161341 ccatgttgtg gcttgttttg atcctaaatg gtaagccgaa gaatcgataa aaagacacaa
   161401 ttctggctta ttttaagccg aaacagttat ggcttaaatt aagccgccat gggtcccata
   161461 gtggtaattc tcttttgtct ctgttaatct tcaattgtct ggtcttgtga aacttgtgat
   161521 cattatagaa aggaaggaga agtataatga cagcaccctt cactggctta cgatgaatga
   161581 caggcaatct gcgcttttga aatccctcaa tgatgccgct atccacagac actatgggac
   161641 ctgcagcggc ttaatttaag ccataactgt ttcggcttaa aataagccac aattgcatct
   161701 ttttatcgat ttttcggctt accatttagg atcaaaacat gccacaacgt ggcttaattg
   161761 agcacttttc tgggcttatt ttttgggctt taaaataagc catttgccga attattataa
   161821 gccattttca gcattatttg tttggaaaca tgggttattc taattcttat tgcagcttgt
   161881 tttaagccat tttcagcctt atttttatcc atgcgatggg ttgttctgac ccttttagca
   161941 gcttgttttc atccgtataa cagctgcttt taagccattt tcagtattgt ttttatctga
   162001 gaaatgggtt gttctgatcc ctttagcagc ttgaaatgag cctgtagcta acccttggtt
   162061 tggttggtcg aattacatgc atcgaattgt aaaaatacaa aaaatagaat cattaaagta
   162121 caatatacaa aaacacaatc gagacatccg ctaggaagag cacaagcttc tcttcttcct
   162181 agcagtttgg gccttatttt tgaggtactg catgcccagt gaccgtatag gccacttgct
   162241 tttgcactgg gcagcaccaa agacgtcgac atgcttgtcg gcgaccttca acaaggttag
   162301 ctggccatcc aaaacatata aaagaatgtc actcacaaga cccatgaaga gcacatgctc
   162361 ctcatagtct gtgcccttcc atgtctccat gcccacttta tcaccaaagg ctcgaacagc
   162421 gcttcggcgg acatcctcct aaggaaagcg ttgggagctt atccaatgaa atatcaattg
   162481 ctactcacta gaatcttcct ccaaatattg tcattcaccc catgccccag tcccattatc
   162541 gctctaagcg gcttggagga tttgggatct gagatggggt aggagatgtc agggtcaaaa
   162601 tggagagccc cagggggggg ggatacctct ggtgaagagg gagaagttcg agcaggagag
   162661 aaggaggcgt tgttgtggaa ggaggaggcg gcggcgacac cgtggacatc agctgcaaga
   162721 ggcaggagtc aatgcatgag caacctagtc aacaacaagg ggaataggaa ggaacagaag
   162781 atgtatcata cctgttctct gggattgttg atattcctgg gattcggcca agagtccatc
   162841 gatcagctct tggtcactcc gagtcctcct tggatgagga tgggagggga catcaagatg
   162901 ggtttgagag ggtccgggtt gcgcagagtg agactccccc atagaatacg gtacaaagcg
   162961 gtttacacct ctttggccac cacttctctg cccaccgttt gatgaagatg caagaagagg
   163021 actggatggt gttggtgaga ctgggcgagt gttggacctg gttgggcggg gcattgtagg
   163081 tagaatgact agaaatagaa agtgaggttg tgaaagattt agtgagattt tgtgttgaac
   163141 tttctggcat cacactgtaa agccaggact atggacttat tatataagta ctacatgcac
   163201 tcactgcatt atttgccact ctaactatgc ttgctgcgct tctgctccaa aatcccactc
   163261 tgatctcata tgatatcatc cctgcacttt cctcaccaca gcatctcctg tgacctatag
   163321 tgagaatgcg ttatgtccct gacgacattt ttttggctga tgaagtggtg aggggaatct
   163381 taaaaaaaaa gaggaagaaa tagaagattc aatggaagca cttcgaaaga agagagatga
   163441 gcgaggttga ccttgttaca attatagtgt aattaagcgc cattgccaaa aatcagtcat
   163501 gtgagatgaa tgcaccaaat ttaatctttt gtcatttcat catcttctat tatgcatgat
   163561 tgttgctatc atccaatcat cttcgtttct cgttgtccac tctttcaacc agctatcgca
   163621 agaaatatgc ccacaacaga ctacaaagca cgcatcatcg aatgcaactg tacactgtcg
   163681 tactgcgacc gacgagttac tgtagtcaca tgaaccagac accttgagaa gatgaggacc
   163741 ctacaacaag cgcaagaggg ggatgccagt aacaattccg tcatgccagg ggaagcagag
   163801 ggaactaatg gtggagcaca aggggacgga gatgcagaaa tgtctgaggt gagtcttcgg
   163861 ccaacgcaca ctgacatttc cacaccccag agcagcatct ttgtcgacca ttccccagct
   163921 tcagtgtcca atcctgcttt tcagacattc atcaacaaca gtctttccag agtgcagtgc
   163981 cagatttcag tgtcggacaa cgaagatgat tcagcagcgc catctgtttc tggagagcat
   164041 ggcactgagt cagaggaaga attaagggat gcgcagtccc atctagacgt gggggggaga
   164101 agggaggata tggaatcatg ggatgagcag gctgtcgcca gagaaaagag ggaagcaggt
   164161 ccgagatgta agttctgttt tcataaggat ttctattcac caactcattg tctcattatc
   164221 cgatagtgta tgcaatgagc gaagaagaca ttgataagat tggcctatat agttggaagg
   164281 tcgatcacaa catctcacga gctgcataca acagtcttcc agaccatgcc aacaatatac
   164341 cgttcatctc cctcaaagag gcacagtctc taatcgacaa ttattcagac accctttgcg
   164401 attattatga catgtgcaag cactcttgtc tttgcttcgc cggcccttat gctaaagatc
   164461 agaagtgctc caagtgtggt gcagacagat tcgaccgaaa cgggaaacca ttccaaaggt
   164521 ttttgtacat caagattatt ccaaggcttc agaagatgta caaccaccca tcaacaaagg
   164581 aaagactcat gtaccgagac aagagcaccc gcgaatacga taactccaat atccaagaca
   164641 tatttgatgg gagtatgtac agaatactct tggaaaaaga gattgaggtg gatggaagaa
   164701 agctcggaac caagtacttt gccgatgaca gagatattgc tctctcattc tcatcggatg
   164761 ggttctgccc atttgacaat ggctcaggga cgtgttggcc tctggtgctt ttcaatctca
   164821 acctaccacc agaagaaagg gtccataccc gcgagatact gtcggtggga ctcatcccag
   164881 gccctaaaaa gccagaagat tttgattctt tcatctaccc attagtggag gagcttttgc
   164941 aactcacagt tggagtgcat acatgggatg ccgatctggg aagttttttt acactcaggg
   165001 cacatctcct ttatgtttca ggggatacac ctgctgtatc aatgatcatg cacatgaagg
   165061 gcactggaag cttccacccc tgtcggatgt gcaatgcaac ctcagtctga cattcccaaa
   165121 actgtaaccc caaccaactg tacctccccc tccaatcatc tgcgaccgat ccgactgtac
   165181 ccgaccatga tccctataac ctaccttgtc gcacccatta ccagttcatt cgccaagccc
   165241 gagaggtggc tgctgcatct agcgcagctg agaaagaaag acttgggcag aaacatggta
   165301 tcaagggtct gtccatcctt gaaaaactcc ccactatcga ctttcctctt tcattccctg
   165361 tcaatgcaat gcacaacctt tttgagaaca tcctcaaact tcaagttaac cttttctcag
   165421 gggctgtcaa ggacttggct gatgaggact ttgtccttac tactcgtcag tgggcagctg
   165481 ttggcgaagc aactgctgct gccggtgcga caatcccctc atcatttgcc gctagaccac
   165541 cggacttcgt caagaatagg caggcatgca cagctgacac atggtctttt tggctgcagt
   165601 atattgcacc ggttttgctg gatggattac ttgaatcaag gttctacaag cattttatgc
   165661 ggtttttgag ccttttcaga gaatgcctgg cctatgagat gccgagggaa cgccttgcgg
   165721 gtctgaagac agactggatt aagtggggtg tggactttta ccggtgagtt gcatattcag
   165781 attacattat gaactcttct tagacattga tttcgtttag tctctaccat gagaacaagc
   165841 ctagccatct ccatgtttgt tcggctcagg tgcattcagt ctttcacttc ggtctaatta
   165901 tcgagatgat ggggcccatt tgggtatcgt ggcagtttgc aatggaatgt tattgtggtg
   165961 atcttggccg aaatctaagg aatatgcgac acccttatgc tagcatgtcc cagcggattt
   166021 tggccaagag tcatctacaa cacattgcga acaaatacga ccttcactgg ggaggtagag
   166081 gaagggtgag cgatgatgaa gcccctaagc ggtatgagac ggtcttgccg tcatgtaagt
   166141 ccaagtcata tcatatagcg cttgatgtat aattgatgcc ggctcagatg cgcattatgc
   166201 tttgtcctcc ccgaccaatg acgcccaagg cgtcatccga cacaacctga tgaataagct
   166261 catcaacacg atgaccaccc aacacgatat cccaccgact gttgagctta gagctttagt
   166321 gtcaaaggga aagttgaggg tgtggaaccg tgttcgagtg ttgaatggtg gcgattccat
   166381 tcgtgtgtcg aggatggata cagctgagga ggacagaagg tgtgcctcct ttgtctcggt
   166441 gagttagact ctatttagtc tgaagagaac tttagaaatt gatgatgaaa tgttggttgt
   166501 agtatatggt gtctatcgac tggaataggc gccatccaac caggcatgtc gagtttgagg
   166561 accacctatg ttatggtgag ctcctgaact tgatcaccat tgacctcccc catcacccga
   166621 aatcctccga cacccctcct gttactctcg ccttcgccca catcaaacca gcggtgtcac
   166681 ataagcaccg tattggcaac catgaatgga gctattataa agagtaccag gcggaggaga
   166741 tggtggatct ggcctctgtc aatgaactgg ttggaagggt taagagtatc tcaaaacctg
   166801 gcacgaccta tataattgac aggggcacgc cctacagccg cgtgtctttg gtgtaagtgt
   166861 aaatgggcgg ctaaagcgtt agctggggtt attgagtgga ggatgggtgt ggcaggcccc
   166921 gtgcagttga gtgtctgtcc tcggtccatc gttcaactga gtctgtcttt gtgtctagct
   166981 tccatcatct tccatcatct tcatcttcat cttcatcttc atcttcatct tcatcttcat
   167041 cttcatcttc atcttcatct tcatcttcat cttcatcttc atcttcatct tcatcttcat
   167101 cttcatcttc atcttcatct tcatcttcat cttcatcttc atcttcatct tcatcttcat
   167161 cttcatcttc atcttcatct tcacccttgt cacttatatt cctacctacc gacttgcttt
   167221 cctgtagcta cccaccatcc cttccctgtt actatttact ttacctctgt cacggccact
   167281 ctcttctttc gcctctgttc cgatttacct cagttttgtc acggctcttc tatatttttt
   167341 cttcatttat cgttctctct tctagcctct tctttgttta gtttctcgta gtttggtctc
   167401 ctttttagag cgaatgtctc tatgcatgat gttcctagcg ctgggtggga tccgggggtg
   167461 gaaaagacca cagaagacga agaaggaaat aaatgagaat gcatctctat gccatgatgc
   167521 catacgtaat atttggtcag tagtacaagt cttttgagac aaaaaatgat gacgtatatg
   167581 caagttgtaa ataaaggctt gaaacaagcc ctaaatcgga ttgccagccc aagcccgaaa
   167641 tggtcttata aaacgcaagc ctcaaaaagg cttaaaacga gccacaattg tcaaaataag
   167701 ccgaaaaagg gatagaaaag tttaaattaa gccgccgcgg gtcccatagt gataatagtt
   167761 ggatttggat acacaaaact agcatggtgt agtgcaatga gccttcggcc tcatagacta
   167821 atgccgcatc acagtcagaa gctactgcca gtgacagtga gaagagagat agagaagaga
   167881 gagagagaga taaggatata tcagggatca gaaagtctta taggagaaca aatgagagcc
   167941 tgtgacaata actacccctt ccatgggtag ctgccaaaca gcttacagag attcaagtac
   168001 ataggtacat aactgttagt tatgctcatg gagcctatat tgctatattg tttgatgcac
   168061 acacaacaca caacaactca acatgagacc tgagttcaat tataccacta cacaacctaa
   168121 tgacctatca tcagtatcac tactaggtag atcgaccacc aacagccaaa cttaggaaag
   168181 ctttgtattc catagaattg gtaccaagaa gccgatattc tgttatctgc tgtgggtggc
   168241 agtggaccag aaccaactgg atcgtttaac caatggagac ctgggtattt ccctacaaca
   168301 ggttgaatgc atacattttg cttaggaaga gaaaactata actatgtacc aatcaatcta
   168361 tacatataca tgtatgtgtg aggaaacaaa cagaagtcca ttgaaaaaag gaggcagaga
   168421 tctagcagag tccgctgctg catttcggca gcaattgcca gtcctacgca tgatattgcc
   168481 agtcctatgc atgggaataa atatcatgca taggacaaag gctggacaga gcctgatgcc
   168541 gcgtttcagc atcaaatcac acctaccaat gtcatccaat gcataggaat aaatcctacc
   168601 atatggtgag aacaagtggt ggtaagggct ctgcacttac actaggctcg acacaagccc
   168661 ctcgatggac attggttctt ctccgatgag gcacgaagtt ccaaggaagg gcttgtgtca
   168721 agcctacact tacacagttg ctaatttttg agctgctaat tcctctgatt tgcagtcatc
   168781 actgttatca ttcatcatca taataattaa gataattaag aatcttgcac accatcatcg
   168841 caccatgtca tgactaagtc acaatggttc atctttcctt gctcacatat tttaccatcc
   168901 aatgatatct tcagtacctc tagcagctgc cattctctga aaaagcccag caatatatcc
   168961 cagctcaaat atgaagcatc aaatcttatt gagctgcttc tgatcctggt cctggtacaa
   169021 cagttatatg ccaccttgac aatcaatttg accacactca aaaaggtttc tctcagcatt
   169081 tggtgcggac tctcatgatt ctcaaagctg catgtatcag agtgaaacca tggatagaag
   169141 tggttgtctt gctttcacca caaaggacat ttcatcttct tcaagcactg tccagcttca
   169201 tagccgattg tcatgggcgt catgtcagtc agcgtagctg cctggcactc aactcggatg
   169261 atgtagaact cgacaaatga aagtgaagga ttcacgccta gcagagccgg acggaagaat
   169321 tgccaggctg acagaacaga agctggactt agaggaagga atagccaggg cctgaaggag
   169381 caggagctgg actaagggct gactgaagcg acttaaaagg aaagaatgct tggaggcaag
   169441 gtagtgagaa aggacaacag tattgatttt ttgaggacta tgaaaactac gaaagactat
   169501 ctccttatat acctttcctt tccttctgct tactcatctc tctcgggaga aagttatggc
   169561 taactcgtgg cggggacaga gctgtcggac cagggggaaa tgaacactga ccaagtgttg
   169621 gggaagaaga ggagagtgct gaccaggcga aacgaaagaa gaggcaagcc gaaagatgcc
   169681 tcagttgatt ttgcaagaat caggcgataa atcgcggtcg tctgaggtgg aggtttgttt
   169741 ggttactttg gggacatggt ggaataatat cccattgccc ggttatagac gccgcagagt
   169801 gtgattcttg cataacatca tgacactgat cttggtggct tgcactattt acactgccct
   169861 gtgaagtatc aatggcgaca aaggctcggt gaaggtgtac aggcgatttt aatgaatcaa
   169921 acaaacctgg atttcaagcg aaatgtgagt ccaggatctt aaagcctgcc aaattgctga
   169981 tttctttttt taggcatgaa tgactaaggc tgttacgact cgtccccaac aaggtccggc
   170041 cttggagacg agatagaaag ccgtagttta actaagcaat gagatatatg tatgatatac
   170101 ctcttgacac ttgtctgttg gcatatggta tagagcggag gtatattcgc ttgggaagat
   170161 caggcaagct tatatactag tggagtaagt ttatgtcgaa ggtggtgcaa ggtaaaacga
   170221 gagtgagcac tgggagctcg aggacctttc gcaaagtaac ttatgaaata ttgatcttcg
   170281 aggggaagaa gatcaagatc gaggacaaag ctccccttta tatacttcta cagaaatcta
   170341 tttatatcct ttgaggtcca gctggacctt cttcgttatc tgaatcggat cttgccttcc
   170401 tattacgtaa ctccctccta tgatatctta tctcttcttc tttgtgcagg ctcatgacaa
   170461 aggcaagctt cataaaacta tacttcattg tttgcaccca ccttgtgttc accaacaggt
   170521 cacagaatcc ccaggagcat gcagcttttc agctttatgt tatgttggtc cgattgggct
   170581 gtagaggcat tggtcatcac aaagagaata tgaagtgggt gaaaagatgt gtataagctg
   170641 taaataagtg atgtcaagat gtgcaccaca aagagccaaa taactaacca ctcatatagc
   170701 tgagacatct tttttgtata ctcaatgctg tatcaaagct ctccatgaaa cacttcttaa
   170761 caaaggtttt ttgcactggc ctgatgctga agagcagaga ctcattcagt gtgaaattgg
   170821 ttgctactct tatattcagc aactgtgttg ggctgtgaga tggttctcaa attgagctgg
   170881 agtatatccc tggcagggac ataaattgct gttgtatggg agaaaggata aatatggatt
   170941 caacatcatg gtggtctgtg attaccagca taaaattcag tacattcata cagccatgca
   171001 tgatggctgc atgtcatgat caaaaggtca acaaggtgac ctgagtgagt ctgcatttcg
   171061 agactatgac catagttagc tgaaatacag ctgtagcttt accaattgcc tgagtgttga
   171121 agtggagggt atctgcccta tgcatcccta cgtattcggc gatagcctgg tgcgcctatc
   171181 tttctctttt gttcttcgta cctttctatt ctcttttgct cttaggcatt attgcccata
   171241 ttccttattg tacagaggaa ttcttttctg acaggcagga cctccttgct gacagtggct
   171301 atgctgcaaa cagctataat ataccttacc aagttttaaa tgtgttgggg gtagaggtgc
   171361 aagaaataat gcctggcacc ctcccatatc aacttcaatg attgtgtgaa gaaagtataa
   171421 gtggaagttg agcatactat tgcttactgg aaagcatgct tccaaagcat caagcccatg
   171481 tcaacacaga taaagtcgac gtcttccaac aagcatattt tgcaagcatc caaatgaatt
   171541 catgtatgtg gtatgtgatt attttgtagt tccttctgat gttgtatgac aggtatgaca
   171601 gagttagtct agcttcttaa ttagatagat gactatgtag tcttttttca gtcagactct
   171661 ataccatata ttcattttcc cttttgtaac tttctggtct ttctcatctc tatcttgtac
   171721 actgctctcc gagtctgttt gtatgaaggt gctgagtaaa gaccagtttg acaaggtaac
   171781 cactctgtta cataattttg tactatctga aaaaggtttg gatgatgaag atgttattga
   171841 ctgagcagaa ctacaacaga ttatggaaga agaagctgaa aatcaatgct gactcttcac
   171901 cgcagcctca gatctgatgg atgaggaaga tcatcaagca aatgaccgac agtgaagaga
   171961 agttttgaag gaaatcgaga ttctacactg gggcaaaaaa ctgtatacca gaatataaat
   172021 gatatttaaa tgatattcag aacagtcgtc gagactccct atcaaagtga ggaagtgtgg
   172081 aacttggaaa tgtagatttt gatcctacat aaccaaacat ttctgcattt cagatatcaa
   172141 atctagaatg gcctttcatg accagcaatt tctatatacg cttgcttttc aacttcgtca
   172201 taacttttcc ctaagacatt ataccttttc caagtatcca aaagctggac catccttttc
   172261 ccgatcagct tgattttgct ggccctggaa ttctgctcag catcttcctc atcctgcttt
   172321 ctcttggcat cctccacctt ccatatctcc tcttccctct cagtctgctt ccttcatgcc
   172381 tcggtgtctg cctccaattt gcattgctca gccgaacgta ctgcggcttc caattgcaac
   172441 aaagcttcct tgacatgaag ttctgccgaa aatcagctat cttctttctc ccactgtaag
   172501 agttgtcatc tgccttcact ttggtaagga cctttttggc attggttgca gatccctggc
   172561 cagcctcgcc taaaattggg gatttttctc tatctccatc accactttcc tcttcctcat
   172621 gatttccctc ctcctctcta tatcagcagt ctacttctgc aagtgcatcc aagctgtctg
   172681 ggttgttgat ccttgactcc atgtcccctg cttcggtaga aggtgaagca gtgtggttgg
   172741 aaagtgatgt cagtccaaat aagtcatgta cagagttccc atctgagaaa tcgccaattt
   172801 tatcacacaa agcagggtat aatgagtgat aatatttgca ggtttctaga agtttatctt
   172861 gagtgacaaa agagtcagaa aataagttgt cttgatatgt ttgaatagaa gatcaccaac
   172921 cattccaggt atgaatgtct ctcttgtgat ccttttcaga cactccctcc ccagtgttct
   172981 taatgagggt attcgctgcc ataaatgccg ccttaatttt catcatctaa agatcatcag
   173041 tccagaacat ccctgattaa ggcaccactc acttgaccat tgacagccat tggcatcagt
   173101 agtttacaag ggatcccatg gcactcgaga aatggtagca tgtactgtgc aataaccccc
   173161 aatttgttgc ttgaattgtt ccatttctgg tatgattcag ggtctgccat atagtgaatg
   173221 agaatttctt ctgctgaacg accatcgtgt gcccagaagc cctctctgct aacccttgaa
   173281 accttgtata tgacttgtca tgcttattct ttttcgtaat accctgactg acaggagtat
   173341 gagcatggga tggggtgaca aagggttcat gtttatccat tttgtggact tgcagagttg
   173401 taggttttat ggaaagaaac agtatgtctg ttgttgttat caatgttttg ccatgactta
   173461 agtcctcagc atgcagacat gaatagttga ggcatgaatt tatttgcaat tttcccaaaa
   173521 aactgggatt agaataggaa agaagaatta gaacagcaca aatcatgggt ttcttgtttt
   173581 ttggtgcttg ctaatttttt ctcagccaaa actagggaac agaattaaaa ttgaaaaaag
   173641 aattagaatt agccctgaaa aataagaaat ccatatttga aacgtactat tctctgctga
   173701 aggaatattg gccagtgaga ctgttttgtc ctccactttc tcacagatga agtcgtgtct
   173761 catgtcaatg tgttttgact tctcatgatt gactggattc tttgagagtg caatagcacc
   173821 agcattgtca ttgacaagtt gcaatgcttg gtcccttagt ccaagtccta tatcctccaa
   173881 caaaagtctt agccagacag cctgttttgc tgcatcagca gaagccatgt attctgcttc
   173941 tatggttgag agtgccacag ttggctgtct ttttggtttc caggcaatag ttccaccata
   174001 aaccttgaag atgtagcctg tagtggatct ccttgtatcc atatctcctc cccaatctgc
   174061 atccacatag cccagtacca ctctcttgct taagtgagca tcaaatgtta ccgaaaacgc
   174121 tgccaattcc ttatcaagta gctcggctat agtgccgaac acaatagttg ggaacctgaa
   174181 accgctttat aaaatgcttc agagattgtt gatcagtaca agtcaacaca ccaattatag
   174241 gaaatcaagt tcatagtaac atacatttta ttttgatatt tattgaaatt gtggtcaaaa
   174301 gaaaagagaa agaaagaaca atctacagac aggtcaaagt tgaaacagac cgaaacaaca
   174361 ataagccatc taagagttag tattagtaaa atatatctgt agtagtttat agatcttgtt
   174421 tttggccgtg agaagaaagg cgaatcaatg gaaaacacac ctagattaag agaagaacag
   174481 aaaacagacc caccatacag ggcctactcc tcggacgact catccccatc accacgcttc
   174541 ctcttgcgcg acatacccaa cgccacctgc agttcctccc gaaacctccc ccgcatctcc
   174601 tgcctccgga cttccagcac ctcctcctcc atgaggtagg caatgattgc ctgttgtaca
   174661 ccctcgaata caatggaaat gctggtctca ctacattcac acattagcac gtgaataccc
   174721 acgccttgca aacaagccac tgcgccattc acctcgcact cgagataggt gacgaaacct
   174781 cccagcctgt cgactaccct acccatcagc tggcacactt tcaatcaccg atcaatcact
   174841 cgccacatcc aaagccctac ccccgctggt gttacgcgaa cagcgaacac ccttcactgt
   174901 acactgacca caagtcgagg acaacaagaa ggcccgacat tcagcaccaa ccccatggca
   174961 ctggtcacaa ggggcaacca ctggtgccct ctggcgttct tcgaccctac gcctcctctg
   175021 gtcccggcgc agggcctcct tacaccatca gctcctcaat tgagtcacgc acaaacccaa
   175081 acggttaccc tcacctgatg gcgttgagca tacccctcat ctgaggtctt ctccctctcc
   175141 ttaaccactt cgacagcccc ctccacgcga gcaccaaaga gtaattccgc accctgcaaa
   175201 cgtggtagtc gcggatccac aggtcgagga agcgaagccg agagaacaga atcccccact
   175261 gtctccatcg gtactccact atcgtgcgtc gctgtggccc atcccataga tgggaaggcg
   175321 aaatcctatt caacactcag catcagcacc ttacaaacac gttgatcaaa gaaaaccctg
   175381 atgcagttgt cagaactact cggcgacaca gcagatgcgg caaccaccga taccccatta
   175441 tccgttattt atcacatcat cagctgtatt atttaggtac tttcaattta acgttttggt
   175501 cggaccaaaa cccaaaattc acattttacg taagtaccaa aacgcgtttt ggtcgtgtat
   175561 cgtgtttatt ttggtcgact tctgggttcg accaaaacaa gttttccccg ggccctcttg
   175621 cgtcgtcatg cgacttgtcc acctacatta ttattatctt cattattcat ggtcaatatg
   175681 agatgcgaaa gtatatgtgc ttgggaagat caggcaagct tatatactag tgaggtaagt
   175741 ttatgtcaaa ggtggttcca ggtaagacga gagagagcaa tgggagctcg aggacctttc
   175801 gcaaagtaac ttatgaaata ttgatcttcg aggggaagaa gatcaagatc gaggacagag
   175861 ctccccctta tatacttcta cagaaatcta tttatatcct tcgaggtcca gttggaggtc
   175921 cagctggacc ttcttatctg aacggatctt gccttcctct attacataac tccctcctat
   175981 gatctcttat ctcttctact ttgtgcaggc tcgtgacaga tgatgagaac aagagttaga
   176041 tttatataca taagctaatt ccccatacaa accttaaaag ttaaaaacta agaccgatct
   176101 tagctaacta agtcaggtct taacttttat atttgaaacg ggctattgaa atgtaattga
   176161 attgttgctg actcaattcc ttgcttcaac accattatca gaactccaac taaaacagct
   176221 aactcccagc ctcagtctaa tattcagttc ttgccaatat agatattttc ctttatccta
   176281 caagtaacac atttatcaat acataacact tcaatgaatt ctcttccctt tgcccatcaa
   176341 agtgctattg ttcttccgct tctgagaaga cttttgtcca gctgtagctt gtgctatttt
   176401 ccttctggcc aagtatagaa tcctcttttc tcctagtcta acaacagcag cagactcatt
   176461 tcttcccaaa gaagtcactg gtttatcatc agccccatga tatgaacttc tcactacttt
   176521 gagatcatgc taaaaaatga agacacatta ttaccagtaa caatcagcaa gcaagctgtg
   176581 ataacatgac atacctctat gttttgctta tactgggcca gcctttgatt aataatttca
   176641 tgcagaacat cagccactgt ttcatcaatt atggcacgcg gcattctgcc cttcttgtgt
   176701 gctctatccc aatctgagtc atgaagtagt aaacggatga atgagattaa cccatcatca
   176761 atatcgtgtg agaagttcag aggaaatata ctaatcatgg ttactaagga aagcaagcca
   176821 atataaaatg cagatcactc actcctcttg cccttcttca agccaccaat caatgcgatc
   176881 ttgcagagtt gccttcatgt gtgctccacc caactttgtg gtcacacacc ccacaatgag
   176941 atcgccctga agcaacactt catctccagg atttccataa ggccatgaac ctaattcggt
   177001 ctcgttgagt aagtctagca tatctgatgg caaaggcaga acatcaacat gaccatattt
   177061 gcgaaggagt tcagagttag gaggggaatc ataggtgttg tactgttgcc agatcatatt
   177121 agtctctcat caatccaaat cttagcataa tgaagatggc ctactatttg ttctgattgc
   177181 tttactaatt gagtagactt cattacaact ccttcatcaa agccctcaat agtgtcctca
   177241 tcaacataca gatgggcatt atccttcccc caggcagcat tcagcatatc ggcaaaggga
   177301 atcatgacaa ccatctcctc ctcatcttca tcatcacttt ccttttcact attaccatcc
   177361 gatctagact gtgagtgtga tcgtccaaag cgatggagag gtacagtgaa ggaacgagaa
   177421 agaatcctag atccttgaat gtggaaggcg tccatagtta tatggggtga atctacaggg
   177481 aatagatcag gatgggccta atcgtccgtt acatgtttga gcatgatcag tttaacatct
   177541 gagggatgaa ctaactttga taaatggtgc caatacgcta gtatattcag cttctgcgtc
   177601 ctctctcccg atacgatcta tgtaaatcct gtaattagta ttatgatagt atcgtggaaa
   177661 ggcagacata cctgcaatgt ccgtccccga tagctgttct ctctgccgtt cagtccagaa
   177721 cattggagtc tcaaacaaca caggcatatt tgctgataag cgtcagaccc aacagcacat
   177781 gatattacca aaacagactt accaagatac cctgcccagc gactttttga tcctttgata
   177841 gtttcccaca tcatcactag tatgagttgc gcccatcctt tattgagctg atcccactca
   177901 gaggcatcga gatgatcttt cagatcagaa gtataagctg acaaaatgag gtcgtcgggt
   177961 acatggaaca aaggagttcc ttcctgtaat gatatacatt cagttgtgtt ccctctgcaa
   178021 tccatatcct aagatgatcg tacctcgatg tctttgacag ctacagcacc ataccccata
   178081 cctggaaccg aaacaatgtc tactaattct tcgttatacc atcctccaga ttccttgaac
   178141 catgttaaga atttttgact ttcgaaggcc tcagcctgta taagagcttg cgaggtcatt
   178201 tgtatttcag ttggagccac gaaggtgtta tttgatgaaa atgaaatggt cccacttcac
   178261 aatggcagac tgaactgtcc gtgcccgagg atcgctgcga ccttctttat ttcttttcac
   178321 gcgctcgaat tgagagacga tttggcagtg gaaaatcgga ttgcgctgct cagtgagaag
   178381 agaggctgta ataagagatc gattggtcag cgattgactg acgagggagc gaacgaacaa
   178441 taaataaatt gactggacag acactttttc gggagtatgt ggtcacgtga ttatgcactt
   178501 acctcgttcg gtcggccgtc gggcgcaaat taacaatccg tccttcctac ttactatatg
   178561 attagtattt cactgaaata ggcaacagtc gccaccgcct cgttcttcca acctacgttt
   178621 acgtctttcc atcctgacta tatcggacaa gaaccataag attgtcactg acctattcaa
   178681 tcatataacc agaatgcctg tccccgctca actgcgcaca atagctccag agaaaatcaa
   178741 ggcagccgtc tctcctagcg cgatctcagc gtttacacag acacgtcatc gtccgggggc
   178801 tggctctgct aataataaac ttcaagccac aacaaggcct tctacaagag cttctgctcg
   178861 cattgaagat gtctcttcct atgttgttgc tttgcttcaa ggcaaaggta gactttcttg
   178921 acccatttta ctcactttat atcgctaagc cacgctgttc aggtcatgga gttgaaattg
   178981 gtatagctgc aataagttta ttgaccggtc aggtgagctg tgcaggtatt ttgtgataca
   179041 agtctaatac cagtaaaaca gactgtcatc actcaagtga gatgttccgc tactgcaatc
   179101 ttcatatgag tttgcgaact tgattgctga ctgaattgat aggttgctga caatgccagt
   179161 cagtctacca ctatggaagg tctgaaataa taccatgccg tagctgatct tttcaggctt
   179221 tgaaaaaact gtacagcagc tttattccca tccacctaac acaatcattg ttccagatac
   179281 catgttaaag agtggagctg cggaagccag ttacggtgac cagagggata tcaacgtaaa
   179341 ggagcacctc atgagtaggc tagaagacga atatgagatt gaatgtattg gtgtggaccg
   179401 cagtcactgg aatcgagaaa ctggtatgtc actgtaatgt cgttcttttc accagaggct
   179461 ggtcctcctt cttatccaca tttttcaggc cgtgattttg tcgaggactt ggcagttgat
   179521 gacgagctca aagcatctat ccttatggct attgaaaaca agtgatgtat caaaaggcac
   179581 tcatgctcgc tgaagactga tgacccaata gattctatgc cctatgtgct ctttctggat
   179641 tgttcagata tttacaggta tggaggaaca ttgaatttcc ggagcgcagt ctgaggatga
   179701 aatatgtggt ctctgaaggt acggtgctat cttctgctca caacaaggcg acttcttgtg
   179761 ctcatcatgt ttaccacaat gctatgtagg gacgatgttc attgatattg aaactgccaa
   179821 aaatctggag ctcgtgcgca ataatctcac aaataaggcc acccatacgt tgtactgtga
   179881 gtaaaagttt acgtctatgg gtatccagtc caagattaat gtactctgac gttaccggta
   179941 gctgttttga accattgtca tactcctatg ggtatgcgac ttcttaggac atgcatactc
   180001 caaccaagca atggtacagt tgtgatgttt cactaaaatc ttccgctcat gtctagcatc
   180061 tgaaagttct tagtgatata gaaggaagac ttgatgctgt tcagggtgtg tgggccagca
   180121 actgtgtcag aaatatgcaa tatgctaatg agcaacagaa cttgtgacag cgcaagagaa
   180181 gctcacagtt ttgaggtcaa agttgtctgt tatgtctaag gtgtgtacta gcatacaatg
   180241 gtcatcatca tacctcatta tttgcgagct gatgaattga ttagatggat ttggagtcca
   180301 ttgttgctca ggcaagtcga tgggcttggt gtttaatatc acttggcttt catggttaat
   180361 ctgagtgtta gatttcacat caaaatctgt cacaaacaga tgtggctatg actgatcgca
   180421 ggatatctct gctgctcaac cttgtggact acttacagag cgtcaaatca atcaatgctg
   180481 agcttgcagg aggacactgt aaattgcttg gcatgattgc tagggtatgt gacaattatc
   180541 tattgccttg ggttaaacta agaagtcttt attctttgat aagcgccttt ccgataaaca
   180601 acttggcaag ttatccagca ttatcaacag tgagtgaaat aagacatctc tgcctgcaat
   180661 acttagagtg aatcagactg tctttccaga gattcgacaa cgttgaggaa aaatggaaaa
   180721 caccaaaatg ccagaatcgc tcggttgttt gctgtgaaag caggttttgc acctctgctg
   180781 gatgttgcta gacagaccta ccaggagaat cttcaggata tctatgactg taagtctaaa
   180841 acaaacaagc ccatacatac atggtacctc tctcacccct ctatatagtg gaattagaag
   180901 tcaatggtga gtgtcgtgac tgttacgacc actaaaatag tcataaagga aaatatggct
   180961 tgagctgcca agttgagagt gtgggaggta catttcaatt tagcataccg tcaggacagc
   181021 ctgaaaactt gctaccatct gaatttattg gtactgaaaa ggctaagcac aagtgcatca
   181081 ctagtaggaa tggatacaca tgagttgtaa ctgatttgat cttgccagaa ttcggttcac
   181141 aagtcaagag cttgtatggt tacattcatg gatggaccca tttttgacca tgcgcctgta
   181201 gctcaaacgg tgtgcgaaac tgtcccaatc tcatcaagag gttctgttga tcagtggaca
   181261 aaccatcaat gatcttatcg cgcaagtgaa gggaaacttg ggtgggtgct gtgttgcatc
   181321 aacctgctgc tgacaaacat ataaggtgga ctatatcatt gtgctgaagc tgtatattgc
   181381 tgcctataac atctcaggtc tcaaatgttt tttttatcta atataataca tagattgcaa
   181441 gtcttgacat gatcgcaagc tttgccttta gtgccttcag taagctgaca tgttgacaat
   181501 gagtatgatg ctgatcctct ctctagacag caactacagt gagtgactag tgattgtaaa
   181561 tcatctacta gatgaatgac gagctaagtg gcatcagttc gtccagattt caaggatact
   181621 ctagcggtat ataagactct gtatcatccc tgaccaaaac tgatcagaag gacatttgta
   181681 gattcatggt ggccgccatc caattttgga caatttactt ggtgctggtg attgtatacc
   181741 aaacaacgtg tgagtattta agcagttggt ttcttttttt tactgatctc acataacaac
   181801 ttagttatgc tgcaagaggt tctgccactt ttcaaatcat tcaaggtcct aagtttgtca
   181861 ctttcttttt ttcttaatca ttactttctg atggtgcttt agtatgtcgg gcaaaagcac
   181921 ttatctaaag caggtagggc ttttgactgt acaggctatg attgggtgct tgtgagttgg
   181981 agacactaaa accatatcaa gcagttgaga tgactagtcc tctcttctct cagtgtacct
   182041 gcggaatatg catgctttac aattcatgat gctcttttga gtcgtttatc aaatgatggt
   182101 aaggaacagg cgaatgtaca cgatgacttc atcagctcaa agttgtagat tcaatggaga
   182161 aatgtctatc aacctttgcc tcggaaatgg ctgcatcagc catgatactg ggtgggtcac
   182221 agttcattaa cagactgctc atagttagga ctcgcaagtc ctaggtcact tgttctcata
   182281 gatgaagtga gtggtgtact ggccatggac tatgtcattg acaacattcc caagttgggg
   182341 aggggcactt caagtctgga aggcatggga ttatcctatg ccatagctga atcgctcatt
   182401 aggaggcaag taagtcagtc tatttgacag actttttcgc ttgttgaaaa tgcagcagtc
   182461 tttcgtcttt ttcgcaactc atttccaaga ccttgcagta attcttggga atctgtctgg
   182521 agttgtaaag tcagtcaaga ctgaaatatt catcttttag atactgatga acatgtcaca
   182581 agactacacc taaaggtcca ggtaacaagc agtattcatt ctacatgggg tccacaatta
   182641 cttatctgag ctagcattgc aatacagaaa ccctttcacc aacagaattt ggcagtactt
   182701 ttgcctacaa agttgctgag ggtgcagctc caatggtgca ctatggttgg tgctttgttt
   182761 ggaacatata gggaattttg tcatctagct aataaactgc aggcctcgag atagctaaac
   182821 tagccgccct tccttcaacg gttttgcaaa gagcatcaga gattgcaact caactgagtg
   182881 aattggaaga acagggtaag aatgtgatct ttatatgaat ttgataccaa tctgcatata
   182941 taggtaggcg gtccaactta gccaacacta gcatgcgacg ccgaaagata ctgtgggagg
   183001 taaggtgtaa acaattcttc catgggcagg atcgctcaac gatatctagt tgagggccaa
   183061 actgaagcag gtgcaaagta attcaaggct tgataatgag acattgggag aatttcttct
   183121 gaatcttcaa gctcaatgtt atctgactct tcgtcaatcc ctagagatgg ttcaaacaac
   183181 aaccagtggt agtgaaacag ggcattaaca atcagctcat caaaatctag taatctgatc
   183241 cgaattgatt ccgacatttt tttatgtgct gcataggaaa cagataaatg taattatttc
   183301 tcaagttgtt cagatatgtg tgtccagtca attctttttc ctggccatcc ttctccgcca
   183361 tcctgaatta gtgctctttc ctgcaccact cttaactctc gtaatctcat ccttcgggcc
   183421 tttctcttag ggtctttagg attcaaaggt ttgagagcat caagctctgt atcggaaggt
   183481 atgactgaat cagcaggtag aggatcagag ggatggtgca gtggacgcgg tgttgcagtc
   183541 ccaaaaactt ctgcttgagc gagtgaatgg acgtgagttt gtagaaggat ctgttgcaca
   183601 gtcaacaacg ctcttgaaac agcccaggga agaggaggaa ggttggggtt ggctttagga
   183661 tccttgaaat gagccaaaac catggctgag aaaaggtctc cgactcctga gaaataacct
   183721 ctgatggtgg gaagagcaaa agcgtatgtt tccatttgac catcaaacca gctgctggca
   183781 aagcaaacta ggacctcgtc atcaggggca cctgtcccaa cagcatcata ccatggtgga
   183841 agaggttggg gaagcaaacg agtgtatgag ggaggtggag ctggcaagga aagtgactcg
   183901 acaagagaga tgggaagggg aatggacgaa aaagcaatat gggggagctg attgacagtg
   183961 tgtagctttt caagggcatt ttgtaatgtt tctagagaag tgatcgcgat ccctgataga
   184021 agcctggtca tgcaagtcag actgattgcc gtcactctga atccgtatca cttactccac
   184081 ttcgaactgg tttggtgtta tgattgtagc caaattcaac atttccttgt atatagggac
   184141 tacatccctg gatacataca gacccgttcc aatgtctccc atgacggctt tgaccgacgt
   184201 caatcttttt ttttccccct gtctatacta acatcagata aagaactcac gatcaagaag
   184261 atatataagg gaagggttgt ctgccttcat tctccttatt ctatcggtga cgacgctcag
   184321 tgcctcagca cttggtatat aacctgtaag tattctaggg tgggtgagta gtccattgac
   184381 tgccatgcca ttgaatatgg cagccaactc gtcaggcgag gtcttatgtc cgtccgtgaa
   184441 accgtaacct aagacataac gttagccatc tatttaaacc tttataggaa aatctgacct
   184501 gtatgattgg agaactggac agtgttgatc acatccacat cataacctag agtctgtagt
   184561 ggaaacgtgg cagccctgtt gccttatcat tctccgttag cactgatcaa gagagaaggt
   184621 gatcgtactc accgacgtag cctgaaacta catgtgattg gatagaaagt atcctctctc
   184681 catcttgata cgttcctttc tgtccaacag tcgacattat gtagcggaag tagggaaatg
   184741 aaaaatatcc gattgaataa gaaaaagacg ctgcgggtaa tcgataagaa aacagccgag
   184801 acgactcgcg gagagagcct gggacaagtc cgccagctaa taactcttct tgcaactttt
   184861 gcaatttatt tataactact acgagcacta cttgttgttg cagactcgca ataatattgt
   184921 gacgtctcct tacaaacaat ttgctcgttg tagtactttc tgtcaactgg aatttattgt
   184981 gacactgcaa atgagaagtg atgcgaattc atcgtgatac aaattatgtt aattgatcca
   185041 ctactcccgc ctcgtgctct aaacctaatc tgatgtctgc gcccatacag taccgtctaa
   185101 caactcgacg cgcacgattt ttggaaataa ggaaggggaa acacgaaaat gatcatgtct
   185161 cgaagtgatt ggcggggtaa aaggtgtcaa aaggtatatg tatatgcaag aaaagggata
   185221 attgaaagcg tatcccttat tgcttctttt cgccctcggt agactcggaa gattcggtgt
   185281 tgttgtcatg agattcagcg tttcgctttt cgtacaccta tcacgagttc gttaactgta
   185341 tgttcccatt ttgttagtga tcaaacaact caccttttgg aaaagaccga gagaagcctg
   185401 ctgagcagcg tcaagggcct gtcggatgtc ttcggccttg acactggcgt caccagcggc
   185461 gcccttagcg gcgatctccc taagctcgcc caaaagcttc ttgaccttct cccgctcagt
   185521 ggcgtcaagt tgagcctcaa actcggtcat ggacttctca gtgtcgacga cgaagctctc
   185581 gcccttgttg gcctcctcaa tgacaagtcg gcgggccttg tccgcctcgg cgtacttctc
   185641 agagtcggca accatttgtt caatctcgtt gtcggagaga ccggaagaag aagcaatagt
   185701 catagactgc tcacggttgg ttgccttgtc aatggcagaa acgttaacga taccgtcggc
   185761 gtcgatgtcg aaggtgatct ggatctgagg aacacccttg ggtgcaggag gaaggccagt
   185821 gagctggaag tcaccgagaa gcttgttgtc tcgaaccaac tctcgctcac cctggtaaac
   185881 cttaacctgg atggcggtct gaccgtcggc ggctgtggag aaagtctggg acttcttggt
   185941 agggatagtg gtgtttcggt tgatgagacg agtgaagaca ccaccaagag tctcgatacc
   186001 gagggaaagg ggggtaacat caagaaggag aatgtcggta acattaccgg caagaacacc
   186061 tgcctggata gaggcgccga tggcgacggc ctcatcaggg ttgacaccct tgctaggttc
   186121 cctaccgaaa gtagatttga cagtctcaac gaccttgggc attcgactca taccaccaac
   186181 gagaatgacg tcgttgatct cagaagcctt gataccagcg tcgctaagag ccttcttaca
   186241 gggctcaata gtccggtcaa caagaggctt gacaatggat tcgaaacgag cacgggtaag
   186301 gttaaggttg atgtgctgag gaccctccgc ggtagcagta atgtaaggaa gagagacgtc
   186361 ggtggcgccg gcagaagaca actcgcactt ggccttctcg gcagcttccc taattcgctg
   186421 aatagccatt cggtcgccag aaacgtcaat accagtctcc ttcttgaact cagccaagat
   186481 gtggttgaca agagcaatgt cgaagtcttc accaccaaga tgggtgtcac cgttggtgga
   186541 cttgacctcg aaaacaccct tctgcatctc aaggatggag atatcgaaag taccaccacc
   186601 caagtcgtag acagcaatca ccgcggaatc gttcttgtcg aggccatagg caagagcagc
   186661 ggcagtaggc tcgttgatga cacgaagaac ctcaagacct gcgatggaac cagcatcctt
   186721 ggtagcctga cgctgagagt cgttgaagta agcagggaca gtgatgactg gagcgagggt
   186781 cagctactga tgctgcagaa ccaattgtat acttaccggc gtgcttaacg ggcttgccga
   186841 ggtaagcaga agcagtgtcc ttcatcttgt tgacaacgaa agcaccaatt tgagagggag
   186901 agtacttctc accacgagcc tcaacccagg catcaccgtt ggtgtgagcg acgatcttgt
   186961 aggggacgtt ggtgatgtcc ttttggacct cggcgtcctt gaactttcgt ccgattaatc
   187021 tggtgaacca acatcaacga cctgtccatt ttcgagtcaa gccaatttca cttaccgctt
   187081 agtagcaaaa atggtgttct ccccgttaac aaccgcctgt cgcctagcag gctggccgac
   187141 aagacgctcg ccgtctacgc agaattcgga agtcagtaca ttacgctttc acaatcggct
   187201 acaccatggc ccgccactct ttttatatcc ttcgtctctc tgaaaactca cccttggtga
   187261 aagcaacgac ggaaggagtt gttcgagcac cctcagcatt ttcaagcacc ttgggagcgc
   187321 caccctcgta gatactagat accagattag taaacaaata ctctgttttc gaaataccag
   187381 agcatccgtc actcacgaaa cacaagagtt ggtggtacca agatcgatac tgatttagcc
   187441 cgttagcatt aaatcacgct ataatcatat cctatggttg ctcacccaat tacaggacca
   187501 gaaaccttgc cactgttgaa tcgcttggaa gcgaggaggg gggaagtcgt cctctgcggc
   187561 aaatatcagc ggagactcga gtccaatgaa ggggtgaacc tacagcgacg cttcggaggg
   187621 ggttgatggc ctgagtggat cggagtgttc gagagaggga gagcatggtg ttgtgttttt
   187681 cggtggagag aaaaagcaaa gaagaggaag acacgcgata tatatggacg gaagaaaaaa
   187741 aaggggaaaa gtctggcgta ttctatgaca agctggaaaa tgcccaccaa gggcgacctc
   187801 caccgcggaa cctttcggcg atactcgctt atagtggcga gtcaaccatc aactatcgcc
   187861 gattcctgtg gcactgcaaa atgcaatttt gttccatgca ctttttccag cagcaggcat
   187921 aattatctgt cgaacaacta tgcatttcac aaggcacgca tgggaatacc atctactgta
   187981 tacatgccat caaattacaa gactccaaac tctagattga atgcgtttcg atcccgatca
   188041 ccttgacccc tttctttcgc ggcacaccat cagataattc attgcaacct gacttgttca
   188101 tcagatactg taacccgtaa aaaaaaaaaa ggaaagtaga ccacgtaccc catactctaa
   188161 cttgttcgat agcatgacat ccgtccaaca catctttgac ccaaaaatta ttaaccgccc
   188221 gacaccatcc aacatccagg tatttgaggt tcttgcatct gaccaacgca ttcagggcct
   188281 cgagtgccac ctccttccaa ccgaggaggc tcagccactc tatcgtctcg cccgaatgag
   188341 cgatcagagc tcccaaagca gagtctctaa gctcatgacc cttttccata tcaatacagc
   188401 gcaggccctg gtgacctttg gcttggagcg atccgaaaaa cgccgtaacg ccctcgtcag
   188461 taagttctgt gaggttgcgg aggcataatg actggagtcg agggcaatat ttgacaatag
   188521 ctgggagaat ggcgtcggtc aaatcaaagt tgtcggccag attaaggtct tctatggaat
   188581 cgcctacggc ttcaagcagg tcaacgatgg catcatccgt taaggaatca gcaggggaag
   188641 aaatatcaag aagcctgagc ttcttgaggg gcttgagttc cttaagcatc tcactgtcaa
   188701 gtctgccaat ctctgcaagt cttagttctg tcaggttcgg gcaattcttg accaactggt
   188761 gtactgtctc cctgtcaatc cttggggact gagtcactag gaagccctcc aatcgttccc
   188821 cagctgcttg gaagagctca atccaggctt ccttcctcac aagaaaggga gcatgaagtt
   188881 ctatccgttt cagctgtttc agactcttgg cccagtgact aactacttct gtagacattt
   188941 gcccgacaag gtcaagacgc aatgtttgca gatttgggca aagatttgcc agtgtgaaga
   189001 aagcttctgg agtaagacct attacaaagg tgttagatgc tgatcaaata ggtttgatac
   189061 acatacgagt acaatcatac atgtccaacg aatcgcgttc gacggaataa aacaagggtg
   189121 cggtctcagg cgtcctttat ccgacatcag ctacatccga cgtagattca cccaattcgt
   189181 acttacaatc ggcggccctt gcatataatt ctacagactt tatccatgtt gatactgcca
   189241 atgtcgccta gttgctcaac attctcaatg tatttgccta caagctggtc ttagagttag
   189301 atatataggt ttacataaag tggtaaaaca attacctgaa tgcaaatgtc tcctaaagaa
   189361 tttactcctc gtctttgttc gtaatggaca atcttggccc tattctgttt tttaactgct
   189421 ttctttggag cggccttttt gggcttagca aaggggtcaa tccctaacgc atagcagcac
   189481 tggacacata gatatgtttg ggaattggta ggatgttcct tggtgtatgc cgtctgcatc
   189541 atcatgtcag attttgcaaa atctgaccca gaatgggaac gcaccactgt aaaccgtttg
   189601 gtacactctc cacagaccat aaactccccg ataggtctca tggggccggc gggcacattt
   189661 gttgaagatt gaggggctga ttttggcgtt cgagcgctgt gacctaccac aggggtatca
   189721 tctgcatcga gatcatctga atcgatagat gcggctcgaa cacgtttggc cttgtaatct
   189781 tcatcaccct aagagatggt cagtatataa ctgtattacg cagagaaaat ttatgctctc
   189841 acatttgttc ccctctctct tttgaacccg acaggcaagt caccctcttc gtcaagtgac
   189901 ggtgtgccca gtccaactct gctaggaccc gcctccacat tctcatctga gactacattt
   189961 gccgggtcag ggtgttgatt ggacccatta gaagtaggag tttcaacggc ggaacgatct
   190021 ccccaagcat ttatacgatg cgacggttca acgccgaggc cctgcgttgt cggcgtgagc
   190081 ggcgccagaa acctttaaga tataaagaac gtactgccaa gaaggaagta agggcagaag
   190141 atgggccacg gactgcccca cctgctctgc tacgtctaga catgggaggc ccgataagtt
   190201 ttaggtgagt ggcaaaatag gctctatatc aggtcgattc taatctttgt tcgctgccct
   190261 ctgtctggtg gaggcacaaa gtggaggcaa ggtaccacca gtacagtcaa ccgccacccc
   190321 ttacagactt cctcggcgtt atcccacttc gcgcctatct caatcaggca cgccatgcca
   190381 catggcttcg tcgctgctca atatcaacca ccaaccacca tctctcaatt ccatatcaac
   190441 cgtacgaccc ttctacagca ccaaccatgg ccacacaccg ctccgccgtc ctcaacgaca
   190501 agccgtactc tgaccccaac cctttgccct ccaatgtccc ccatgtcgat gagctcggcg
   190561 tcacctccgc ccccttgaaa agcgcttcct tcttcattgg tcaacattgc aaggaggtga
   190621 acggtaggtt acgcatatgg cagattttgt gcgtgtatct gatttaaaca gaggacttta
   190681 tgctgtgtaa gcaggagaac agggatccgg cccactgttt ggcggaaggc agaaaggtga
   190741 cacggtgcgc gcaggagctg taagtctaaa ttgcggcata cgagcgcatg taggtggagg
   190801 ctgacaaggg tgatctttta tattttagga ttaacaaatt gagggagacg tgtctgactg
   190861 agtttgatgc ccactggcaa tgcttggaaa agaacaacca ggtgagggaa aatgtaacca
   190921 tgcgattgta gcagatctaa tttcaaggat agtacttcca agcatgccga aaaccggaaa
   190981 aggcactcaa ccaatgtgtc tttacaaagc ttgtcagtat tttcgacgca tgtgatccga
   191041 gcctatagta gggtgcttat cgtttattct tgtagggcct cactaaaaac attcccggat
   191101 caccagaagg acgaccgcaa atccacgaaa aggagtcgcc aatctactcg cgggtacaga
   191161 aatagatgga ctttggtcat gcagcatata actggataca tgctttacta tatgggtgtt
   191221 gtgcggttta ttcgtcgtct cgttcgcctc gtaaacgctt ctcatcttca cgcctttcaa
   191281 tctcctcttc gtcttcactt ctaccacgct tttgtcggtc gccaaagaag tcttcacctc
   191341 gaggaacgtc ggcgcccgca agacccaggc caccaacagc agcgtaggtg tcgaactgca
   191401 tttgagaacg caatctgtct tgttcctgcc tccttctctc ttcctccaaa cgttgatggc
   191461 cccagccgcc tgtgattgta cattagttcc ccctttaaag tatttagaac agcaataagc
   191521 ttacctcgtc cactgtcgta ctcttgtcta aactcgtctc gaacttgtcc accacttcgc
   191581 cctcgaccga actgccttcc ctccttgtat cctggatcca aatcacatct aatgactcgc
   191641 tcatcgagct tggtgccaga gatgtatcgc atgcagtcga ctgcttcttc atgaagaaag
   191701 tactcgacga aagcgaaacc gcacggtgtc ttggtattcc gatcgagacc catgataatt
   191761 ctaaagcaag acatgagctt gctgcgacgc aatttgaaag ggaaatccca ccttttgata
   191821 cctccgccga tttcaggttt ggcacaggtg gagaaaactg gtcaatacca tttagcaacg
   191881 aacaaatcga aagagccttg gaaacccacg ttgatacatc tgtgtctctg tggtgtagaa
   191941 actgaggtta ccaatataga gtgtgctcga tagggccaaa agtcggcgct cagtctctcg
   192001 atcaatctgg gtgtgaaatt agcgcatgtt ccctgggtat gaagagggaa gcgggtacct
   192061 ctgacctgct atcgcggtag gaagatgggt ggtcgaggca gggtacgact tgtgccatgg
   192121 cgtgcggacg ggtgatctgt cagtgtatct ggtattgttg ttgtgaagag tgatggatcg
   192181 tgggagggga taactttggt ggattgtgcg agcgtgggaa agcgaggatg tcgcgttgtt
   192241 gccgccgcgc aagtcaatac gaagcgtcac ccataaagtg cttgaactgc ttacttatta
   192301 ctctctcccc tgtcttcctc cccaccatgg ctgacaactc aaacctttca gacgctgaca
   192361 aggtgagcac actcagatca ggacaccctc ttacccccca cagatccgtc tcaagcgtct
   192421 cgcccgcctc ggcacctcca cccccatccc ctcgcagacc cagccacagc aacagccctc
   192481 gtccagcagt actcccgagc ctcatcaccc accctccgcc tcctcaagac ttcttgcaaa
   192541 ccttcctccc gctgctagtc ccacatcctc ctcccccgct attgtgtccc caaaaccctc
   192601 tgcttctacc aaacctgacc ctcaagccgt ccaacccaag ctttccgtca cccccagtct
   192661 ttctctcaag agaccatcat ctgctagtac ccccagagat gaaccggtgg gtccgagaat
   192721 tgtgcatacc aagccaatcc agccacttgt caagacggaa tacaaggcat gggagaccga
   192781 gaaggttggg caagtattcg ctgttacact aagtgttagt ccatttgcag actgtgttag
   192841 ccaacgacta actatttaca tagaagcaga aggctcagga aaccgattgg tccctttgtt
   192901 ggctcaaaga tctagaacag gagctcaatg aagaaagtaa gttgtgcctg tcttgatcaa
   192961 atactaatgt aatagactat ccttctccgc tcaggaccga tatagagcta gctgatagac
   193021 ttctcattgc ccgtctctcc atggacccca cgcttatggc tcagtccgat gatcccgatg
   193081 cccttacgat tcttgcagga ctacctcaga atgagactgt ctttgaatac cttgctgggt
   193141 gttggaagag gttgtaccaa gccagtaggg acgccaaccg gtatgccttc tccgaagacg
   193201 aaaagagtca atggggcaaa tcaatggata agatcaaggg gctggttgtc tcatattgtg
   193261 gtatgacgat cgaggaccct accatgttcc ctcaaccagc agagtgagtt gcttggatca
   193321 ctcgagacgc taaaagtaac gttggattct taggaaaccg cttgggccgg ccgaatttct
   193381 cccgcttctc ctttcagttc atcaaccgtc atccggtgat cttctcatgt ctaccccttc
   193441 cgtcccgacg ccgctatctg gtccccttca gcccaacgac ttgttacctt tcctccagga
   193501 cctcgctgcc ggttttgacg atgatacttt aaaagatgtc atcagcccga cactgagtct
   193561 attcttccaa gagtggttca agatcactcc taccccggat atcatgggtg cggagtggag
   193621 gagatacctc ggtgctatga acttgttggt acaagtcaaa catatagccg cgtttgtaag
   193681 ttgtacttct atgacctaat cattaaggct aaccatgagc agctgcccac tttacctatt
   193741 tgggtggcgc caaatgtgac agctccaaaa ctcgaatggc aatcgctttt aggtcccctt
   193801 acacgtctga gtgttttccc tagagaattc gtgagtcatt agcgtcaatt ttgaatcgtg
   193861 aaactctcta aaacaaccat gtgcatagcc tgaaatttgg aagacttact tttctaaccc
   193921 taccgaaagg aagaaggaag acattgacgc gaacaaaagc aaccttcgat ttaccctcgg
   193981 aagcctacat gtacgtaaca aagtcgctaa tttttgctga cttgatgaca gtcatccctg
   194041 tttaacgtct acaatgccat cgtccgtgca tcaccagatg ccagagaggg tattcttgac
   194101 tttttcacac ttgctttgcg tctcaacgag aagcgtgcgg gaatgcgagt tgaccctcga
   194161 accgtctcct cagacggcta catgacgaat cttcaggtcg tgctgctgaa actgtttgag
   194221 ccggtaatgg acgccagatt ctccaaaatt gacaaagttg atccagcata ttataaatcc
   194281 tcgaaaagga tcgatatctc agaagagaca aagattaagg gcgccaagga agaggcggat
   194341 gaatattttg gaagctccat ggatggtatg ttgtcacgcc tttcaatata aatgcataga
   194401 ctcaattcct ttttagtgga cacgaaacca aacttcatct ccgacttgtt tttccttctc
   194461 aatagctatc tccatcttgg tgtagtcaag actatctcaa ctaggattcg agctgaaaaa
   194521 aatctgagtg aaatagaaaa ggaactgaag agagttgagg catccacagg cgattgggca
   194581 aatgtaagga catgattctt acccggtttt atttttggtt aacatctttg cagaatgcga
   194641 cattacaagc acagggcgaa gcaacaatta aaaagttgaa gagcgacatg tctgttcttc
   194701 atgcttctat tcacgcctac gacacgcagc ttttggatcg agatatgatt agaatggttg
   194761 tctccttcct cagctttgtt atgacatggc tcatccgcct tgtcgaccca aaccaccagt
   194821 acccagcgtc gcctcttaat ttaccgttac caaaagaagc tccaatggct tttaggatgt
   194881 tgccagaatt tttcatcgaa aacatcgcag agtactttga gttcctcgcc aagtgagtga
   194941 catttaacaa gctcgggaat aaactgacgc ataccccaga tatgatcccg atgcgcttga
   195001 tgatgtagat aaggacatct ttattacctt tgccatcact tttctttctc ccaactacgt
   195061 taataaccct ttcctcaaag ctaaacttgt cacggtgtgt tacctcttat tgtctcgtgt
   195121 gaaacttgac taacagcacc ctagattatc tcatatggcc tgtatcccat gggctactgg
   195181 cgccatggtc ctctctttga cagacttagt atactcagcg tggccacaga ccacttgatg
   195241 ccaactttga tccgtttctt catcgatgtg gagatcactg gaggtcatac gcaattctgg
   195301 ggtgagtgaa tatgtctcta gtctaatgtc ttgactgact ggtgatgcag acaagttcaa
   195361 ctttaggtta gcaacgtctt aatttcaaga tgaatggatt ttgactgact gtgcacaggc
   195421 gcgacattgg ccacatcttc aaagccatgt ggacaaaccc tctccaccgg gaagcatttg
   195481 tcaagtctag acagtacgtc ccaggtatcg ctgtattcat ggtgttgggt gtctaacttt
   195541 tttgcgtttc ccccccctcc agtgatgact ttgatcagtt tattcgcttt gtcaacatgc
   195601 tcatgagcga tactacattc cacctcgaag agtccttgac cggtttggcc aagattggac
   195661 aaatagagtc tcaaaaagcc aacactgctt cgtgggaagc attgccccag tcagagcggg
   195721 aggatctcga tggtcagttg aggcagacgg agggtagtgt cccatggcac acgcagatgg
   195781 gcttatcaaa tgtcaaattg attcgagact ttacggcaac cacacgagag ccatttgttg
   195841 ctcccgagat tgttgaccgt ttggcagcag taagttggtt tactgatgtg ggcgtggatg
   195901 atggctaaca ttcattattt agtccttgga tgagaacctt acagctctcg ttggcccaaa
   195961 gatgtcggat cttaaagtat ccaaccccga caaatactac ttcaagccta aggacctttt
   196021 agcagctatt gctcaaatct acctcaatct ttccgtcgaa tctgaattca tccgtgctgt
   196081 cgccaatgat ggtagaagtt attcaaagga tctgtttatg aagttcgcta ggactttgaa
   196141 gaacagagcc atcatgactg aaggagaggt agccgaggtt atcagcttta cgcaaaaaat
   196201 agaagacatg aaagcgacaa tatcaatgga ggacgagagg gagattccgg acgagttttt
   196261 ggatccattg ttgtcgactt gtaagtcaaa tctcgcttgg ccatatccca tgcctttgct
   196321 gacgctcgcc ctccgtagta atgaaagatc ctgtcatctt accagtatct cgagtgacca
   196381 ttgatagagg caccattcga actgtcttgc tttcaaagga agtcgaccct ttcaacaacg
   196441 tgccgtaagt gatcatgtac ctccttaatt gcgtatagac ttggaagcta atatcttgca
   196501 tctaggctga agtacgagga ttgcattccc gacacagagc taaaggccaa gatcgatgcg
   196561 tggctggcgg agagcaacgc aaaacaagcg gactcggtga tggatgttga tcagctgtag
   196621 gagaatgtcg ttgtagcaag tatacgatag tactacattg taagatactt agaatttgca
   196681 tgggaacaga agaagcaagc agtgtagtac aatagtgaac agtggccgtc aatcatctgt
   196741 gcgatggtgc cagttattgc aaatgcttgc actgtgctat gtgctaagta tctggtcaca
   196801 tgtatcgtga atgagtatat gtactctatc agctaccatc gattcgctgc tgggatcggc
   196861 gggcagcgat agtgcatcgg cgcatcgtca tgatcattga gaaggatttt gtcggacttc
   196921 gaccgacgat tttcttccca acttttggca tcatcgtcat acaatcaccc acacacaata
   196981 attatgcact ggttcctgta catgtacagg gacagcaccc acccaactta gaccagtttg
   197041 tgacctatgc taacacacag agtcactcaa cagactctgg ttggataaca tgagagctga
   197101 gtcttggtaa cagtcaatca ttcaacaagg agtaaggcca tgtgtcacgt cagtcagcct
   197161 agttgcccgg cgcttaactc gaatgatgta caatctcgac aaggaaaagg taaagagtat
   197221 ccagacttgc agaatggaac ggaggagtta ccaggctgac gggacaggag ctggacgact
   197281 tggagagagg aaaggaatag ccaaggccgc ctgaaggcag gagctggact aagggctggc
   197341 tgaaatgact ttaaaaggaa ggaattctcg aaggcaaaga gagtgataaa gagcaacagt
   197401 attgattttc tgacgactac ggaactacga aaaaatactt ccttatatac catttaaacc
   197461 gtcgaccagt ttcgaaaagc gaacgtttac ggttccatcg gaagatctca gagtggaggc
   197521 aggctgaggt attagagtca aggagccgtt attgatttgt tcgttagttc ttctatatat
   197581 cccccctcca ggtggtccaa caacaaggag cagaacatcg agtcctcttc cgtccacgaa
   197641 cccagcacct aattacctag acacctagac atagccaccc cttttccgct cttccccacc
   197701 ccccacccct tcctcctcct ctcctctctc gctctctccc acgactacct gacctgcgct
   197761 acacaacata agattgggtc gtgacagcga acgccgcggc cacggattga ctcgtacata
   197821 agatcgtgac accataccga aaggcgcttt cttaggaacg cagacgagga ttagcatgga
   197881 gttggcgaag gcaagggcgc ggtcgctggt ggtctaaagg ggcgggagaa gaagtaggga
   197941 ggttgcttga ttgataggcg ggaggtttga gcgagtgagc gagaagagtg gaggcaaaaa
   198001 gcggaagcat ttagaatgtt aacgtacatc aaactaataa tgtaaacacg agccatacgt
   198061 atgtatcctc tatgactaaa cacgctcctt tcagattctt ctgattcctt attctgagct
   198121 acaaataata ataccaacat aaaacaattt gagcatctct gagatcaagc gttctctatc
   198181 cactcctgct gaatatcctt gtcgccgacc tttccagcaa tggcagaacc ggataatggt
   198241 ccagcaatag aaatgcccaa gatggccgcc tgaatatccg atttagctag gttgtcttca
   198301 tgagcagtgt tggagtggaa gatttgatcc atctgctcga gcgttttacc cctgtccaga
   198361 gtcgtcagca ttcaatttcg agacacggat ttcggacact cgaatcttac atgggctcag
   198421 ggcagaagaa ccagacatag agaccagaaa ggaagcaaaa ggtggcgaag aaaatgaaag
   198481 tgccgtactt aatgttttca agcataggtg gtgtgatgag accaatgata aagttaccca
   198541 accagttgaa gacggttgta atggcgacac ccttggctcg gcgactcgac gtgtgaacct
   198601 cggcagctac gatgctgtta ttagcgctgg ccttccatgt tgcttgagct caaaaggaac
   198661 ttacgcatgg cccaaggtac cggagaccaa cccacaccat aagagaagat gtagatgaag
   198721 atgaaggcca cagccaccca tgcctccttg ttgtaccgga cccaatcgtg actgaattta
   198781 gccataatga ccgccacaat tacatggcaa atagtggtgg ccacagatcc gaaaaggaga
   198841 ggaggttttc gtcctactcg gtcaagaatg aaaaaggcaa gccccgtggc gacaaactga
   198901 ataatgttaa ggacaccgct catgtcaagc tgcattgtat agtcgaggcc gagctgctca
   198961 aagagagtag gggagtagta gacgagctga tggattgttg aatcaatatt caacgttcaa
   199021 gcatgatctg aggaaaactt acagcactga taccagaaaa ctgctggaac atcatcaagg
   199081 tgggaccgat gatagttcgc ctgataagct tcggtttgaa catgtcgatc caagaagcaa
   199141 tctcgagttt gaattcggac ataaagtcct cgccttgaag agaaggatgg ctcttgacaa
   199201 taacctctcg gttctggatg gcctccgccc tgatgctgat ccactcggcc tgaagtcgag
   199261 ggtcggtggc aggatatcct cgaagacgta cgagagcgtg gagggcatct tcgtcgcgac
   199321 ctgcctgagc aagccatcgc ggtgaatatg ggagtttcca gagaccgaat atcaagagga
   199381 tacagggggc aatctgaacg aggaaaggaa gtcggaaact ccagtcaccg gggatgtgtc
   199441 gagagccata agtctataca aaagtaagta aaaggtttgg gtagctagta gagataacac
   199501 tcacaatgta gaacatgatg acgataccac cgttaatggt agtagcctcc atggcaagca
   199561 atgcgccccg gatgtttggt ggtgcaatct cactaatata cattggggcc acagcagaga
   199621 gaagaccgac accaagaccg cctactaatc ggccgacaac cagttgagca taagagaagg
   199681 atgaggtctg cagaatagct ccaatgacga accacacaga accgagacct tttttttcca
   199741 gcttcagtca gctaatggcg cttgtctgca acgtggtttt gattactaac cgatagccga
   199801 tttacgagaa tacttgtctg caacgaaacc cgcttgaagg gctccgatca aagcgccaag
   199861 ttccaaaagg gcagtcatga gtctgggaag cgtgacagtc agtacaggtc tttgtaccct
   199921 tataaatttc aaaagcgaca tctacccttt gtggaaggcc gcggaagagc tgacgtcggg
   199981 atcgatatct gggaattgcc caaggaattg tttcatggta aggacgatgg taagaatacc
   200041 ctggtcgaaa ccaaagagca ggccacccat acaagtggca aaggaggcaa tcaaaacaag
   200101 tccactgctg aatacatctt tgaggcctgc agacgtgtga gtacaaggca ggtaggtaat
   200161 gtaggggaaa aacattactg accgttgccg ccaattgcat gggccaatgc ctcactgtct
   200221 gccacataac gagcagtatc gggatggagc tgaacaccta ggtcctctag gcttgggata
   200281 gtatccctat ctggagcatg ctttggcggc tttggtgtgt cagtagaatt tcttttgaaa
   200341 aacatcttgt gcagatattg tgaaagtaag tagttattaa gtagatgggg ttaggaaagc
   200401 tcattagaca tggcgcttat ttataaaaga aacctgtctt tcgttaaacc cgatggtttc
   200461 atttagtgtt gaaggaacct gccgaataat aacgatttgt acagtccctt gacgttcatc
   200521 aaatagtttt gcgtaagaat tgagagaact ctagaggcat gatgctatgt gcccagggac
   200581 tcctggcgtc ccggggcggg agaaggagga gttgcacggc tattgttgaa aagaaggacg
   200641 gcagttgcaa gttgattcgc ggtatgaggc ggaagtgggc ggttgaaaag tgcatctgtt
   200701 tgcttgtttt ataaggctga tcgtgcgtag cttgaaaacg agtgacgcat gtcagagact
   200761 gcgaaagggc acccgaatgc cgaacaatct gtgtccccgc tgatcaaaaa gctggtgggt
   200821 tacactagtg gcttgccgat ctgagagcgg tgcctggttg ttgtttacgt ccgctgactt
   200881 gttggaggtt ttgggtgccg ctgaccagag ctgcaactcg gagaccgggc cgtattgtgg
   200941 ggagctgggt tggggctgtg ggctgtggag agggtgatga ttagatatgg tcggtcatag
   201001 aatagcttgt ttgcattatt aaggacttgg atttatgctt cttttttctc tctttcaccc
   201061 agtctgtacg caggtgctta cacatcaatt tggatgatag attgcatcca tcgattctga
   201121 ccccctagat tatcaacccg ttgactctgg aaagtggaaa gcggctacta gaacaccctt
   201181 cgatccgatt gttcaaatca tcaaccagtg cggccataaa ttgtcctggg tgccaaacaa
   201241 ggttttcatg gcgtgagcag ggctgcgaag tcgcgataaa ctccacaatt gacaggctta
   201301 atcaacagct tggattttag aggtaggaaa aggatatacc taattccctt ttgccgctca
   201361 atgtcccaca acaaactgtc gattacaaat tgacaaagag gttattggag taggacgcct
   201421 cgctcgtcgg atcatggaca tgtataatag gtttaattgc caatttgctc gagttcattg
   201481 tgagatactg aacctaatca ccattggcgg atcagcactc ggattactca cgagtacatg
   201541 tgctgtggaa ggttggaatg acttaggatg atgtattaga tagaggatgg aatgaaaagt
   201601 ctggggacaa gaggtgtggt atttataatg ttgccaagat acgagacaca gtgaagagag
   201661 cctgtttcat gcttgaggtg tattgcatca gcgtctctag gtgccaaggc ggagggtaga
   201721 gggtatcctt gctctcctcc caccaaaaaa aataccggcc acccatcact ccgcacttca
   201781 ttttattcag gccaaggcat attcttttac cccatgcccg cgtagtctca aaatgttaat
   201841 aaagtcacca tactcccgct ctgcagctca caaccccatt tcccagacta attgttcctc
   201901 aaccccaccg ccatgcataa acccacgcca atacattttc agcacgaggc ttcacgacta
   201961 tgtaaattta ggcaaccaga gggccgacaa agcttttaaa gaggataaat aaaggtcttc
   202021 cacctgtgag cactactcct caggctaacc tccaggtaag gtaggacgag tgactttcta
   202081 ttttgaccgc ttggttaacg cgtccattga acagacaagc gtcccatcaa gctctagctt
   202141 gggctttgct accattgcgc aattcaacac aaacttctat tgccatccca catatcttcc
   202201 aggttgaacg gattcgatgt cgacaaagtt tcgacttcgc caaagccgtt ctcccacaga
   202261 actgctcaac aacttgcctc acttctcctc cgacaatcca gtcctcagca gccaaccgta
   202321 gcgctcgcgc gatgcttggc aggcattcca ttcaagagct caaccttttt cgccagcgat
   202381 tctcccaccg gccatgggcg atactggcgg caggtggggc aaaggaggag ggacattttt
   202441 cggggctgat aaacatatca tgaggccggg tttagctttg ggaaggacag atagcgggga
   202501 aagtaggcag ctccatgcac gaaagcagtc atcgttgcca gtcaagcgag actctgggat
   202561 ggaggaatgg ctctccgctc ctagaccaat gacgatttgt tgcaaaacac gttctgccca
   202621 gaacttccga gcagagcttc cttgctcacc gtcagcagca tcttcataca agagttctgt
   202681 ttcgtcccga aacaacttcc ataaagcgat tcaaacccct accttctacg acatggacga
   202741 agaagagctt ctgccacctc tgttgccagc ttttggaaca cgcaagatcc ctttcaactc
   202801 cataggggat tctgcgccta ttccttgggg tagagcttca cccgtgccat ttcccaaatc
   202861 cccagggaca tccccgggga cagccacaag aagagtgcac ggttgcctgc tgactgccga
   202921 cggtggcaca ctgaaagctt ggactcaatt ctagtccgtt ttctccgttg atatccaagt
   202981 cactagtgtc cagaccatcg caagattctg agcctccatc gacatcaaca agacgcagac
   203041 taccacaccc gccttgcatc attgttgaga atgacgggaa aggaccagca ttggaagtag
   203101 tagggaagag tcctggatca aatcagacga ggaaaacttc agtcgaatga gggacagaga
   203161 ctcgaagcgg aatggcgaaa agacttctcc aatacgtggc gtattgcttg atcacgggcg
   203221 tcgatgaggg atgtaaatgt ataatcgatc ttgtagctat aaatgcgata ttttgtgcag
   203281 gtcctagagt caaccttgag tcttcgttaa aagcagtaga gagattgcgt agtaatgggc
   203341 aggatatgag tggacttggg atttttcggc ccaaacgctt ggtgatagcg gacggtcacg
   203401 tgacttgttc cgagatttcc aacggctgat tgggatccga cccgtgttgc accatgattt
   203461 ccaagtttcg ccccgcttat ctattgcttt ctcatcttta ctctccattc tcaaacccaa
   203521 cccttttccc tgccatggta aagctcccct cagcatcccg catccgttct ctcgccaccg
   203581 tgccctccac ggccaccagg gctttcgcta ccgtcaatcc cacccctcct gccgcccagc
   203641 ccacaaaatc caaacctcgt ttcgaaaagc tcgacgatgg attgactttt gacgactttt
   203701 tatcaggcga tgttcccccc gagaacgaac gtgtggttct gggtaacacg aaacagtatg
   203761 ttttttcttc ccctgcttct catccccccc gcgcctgccc accttttact caattgctac
   203821 attttagacc tcgtttgcca tcttttctca agcacccgat ccccactggc gcttcctaca
   203881 gcggtataaa aaaggaactc cgtggattag gactacacac tgtctgtgaa gaagccaagt
   203941 gtcccaacat tggcgaatgc tggggcggcg gtaaaggaaa tgcgacggcg acgatcatgg
   204001 tgagtcccaa ttagcgcgcg cgctttttcc cctctctcat cattcaatca ttgaccgcaa
   204061 ggctgatgat ctcttggacc agttgatggg cgatcaatgt acgagaggat gtcgattctg
   204121 ctctgtaaag acctccaggg cacctcctcc actggacgtc cacgagccgg agaacactgc
   204181 ggaagcaatc agccgatggg gtttgggtta cattgtactg acaagtgtcg atcgagatgg
   204241 tgcgtcgtac aactttttac tcggtaggtg gggggatgta tatagctgac ttttttttcc
   204301 aatcgcggat tttagacctg gtggacggtg gtgcggccca tatcgcctct acgatttcca
   204361 aaatcaagca aaaggcaccc aatatcctcg tcgaagcgct tactcccgac ttcgccacaa
   204421 agggcgtcaa cgttatccac accgttgctt cctctggcct tgatgtcttt gcgcataacg
   204481 tggagactgt tgaaaggtgt acgccgtttg tacgagatag gcgggcgggg ttcagccaga
   204541 gtttaaaagt gttggaagag gccaagaagg gagccaaggc cgcgggcagg gagattttga
   204601 caaagagcag tatcatgctg ggtgtcgggg agatggaaga ggagatccac gaaacactga
   204661 gacgtcagtc ccccccccgt ctcgtttccc atttcccaac tgctaacggg tagaaaaatt
   204721 agggttacgc gcgtcggacg ttgacgttgt cacttttggt caatacatgc gaccgacaaa
   204781 acgacacatg aaggtggacc ggtatgtcga acctgaagag tttgcgaaat ggaaaaacgt
   204841 tgccgagggg atggggttct tgtatgtggc cagcggacct cttgtcaggt caagttacaa
   204901 ggtgcgttcg ttttaagaag aaacagttgg tcacaatgac agaactgacg ttttggtcag
   204961 gctggtgaat tctttattga aaatgtactc aagaagcgac gtgcagctgc tgccgagcac
   205021 gctgcttccc aattatctac acagccgcca gagatcgctg ccaaggtgta attgtgttac
   205081 ttttttttta cttatgcata tatacatgat aaactatcta tagataatca atttttagtt
   205141 tttcacccag atcgtccccc accgggactg tttcccgata cccagcttgt tgctcttgac
   205201 accagcgtcg ccgagggatc attcccgaaa taccccgatt ggtcctgctt gatagccgga
   205261 gacggtgtat ggaacgaaga cgggatatac tctttctcgc ccatgacagc ttttgaaacg
   205321 tgtttctgtg ctcggttaaa cacccggagc gcaaacgcgg ccaccgtcca tactccgcct
   205381 atccaaacaa aacccgggtc agccgcaaac caaaaaacca aaaaactaaa agtgtttttt
   205441 ttgtggactg accgactaca ccggctagcc tgatgaggaa ctggtacaac gacgtcgttc
   205501 gttcgcggat gatgaccgac atgggctcga ggtcatactt gaagaacaag ccgggtacgc
   205561 ctttgccatg ctcaaacgat cgagaatagt ccgtgacggc gtattgagag gtgatcagtt
   205621 tccggcggct ggcgtcgatg taggtggtgg gcacgacgcg gagaaagtat tggaaaatgg
   205681 tgaacgctaa agtggtgtta gatgtttact ctggcacgag ggaaaagacg acttgcgctg
   205741 ttctgttatt tcgtagcttt gatcaagagg ttgggcgatg gcggggaaga agggaccgaa
   205801 tgaaaactcg tgcacgacgt gtgaaaggtt catcacttgt aaacattttc tttgtcagca
   205861 gcccgcgtat actccaaaag agcaacaaga ctcagactca cgatgatgat cggtatgctg
   205921 aaagctcata tacccatgac cgagcgttgt gatgtgcaag tttgcagtca cctttttcac
   205981 ctctacactc ccgtaaatcc tacatgcggg cccatcttga accttgtcgt acgttggtcg
   206041 gtaggcagtg tgtccctggg acgtgcggcg gttggacgag gcggaagagt caaggccgaa
   206101 gagacgcttg atacccgaga atgaggattg ttggttgggt gtccggcggc gagaggagga
   206161 gatgatttca gaggcagagg gcgtcgttga agaagggttg tttctggttc ttgtcagcgc
   206221 atgtcaaaag gtgtggaaaa ggtgtggaaa aagatgattg agatttactt tataaaagtg
   206281 gctgttccga cgttaaagtg ggtctaacaa gaccgtcagc ttttgggttc gttatttcga
   206341 gtcttgcttg cagggagaga tacaactcac cccatctttt gcgaaagagt tgctcaagtg
   206401 taatcgatct ccaacagcat cacgcagatc gatcgtaagg tctgttttcc cagtgtcaat
   206461 atgtatatat atcagagacg agttttgggg cacaagggta cgaagactca cagcgacatg
   206521 gcatggccac agtcagatcc acattcagct gaaggtcttt ttgtacctcc gaatccactt
   206581 ggaaagcgta atccggggcg ccgtacagat actcgcccaa atcgttctcg ggaggatttc
   206641 agcaaaatga tcgatgtcga tggcgaacaa ggggacgcaa cttacaagaa caagcaggaa
   206701 tatgatcagt ccaaccagtg ctgtgaggac accgcctctt ctagatttta tcgtatacgt
   206761 agactcgacc tatgaattgt cttataacgt ttaccgggct gggactagaa agagaagacg
   206821 cacctttgga aaggcatcaa agcgctttat aggcgcaatc ttgtcgagtt cttcgaggag
   206881 ggacatgccc tcgttatcat ggctgtgctg gtttgcaaag tctacgaggt gtggctcgta
   206941 catggcgtag gttggggggg gggagtgaag gggagattgg cggtgagacg atgggtttcg
   207001 gtaatcgtgt gcgtgctcgc gacgcggttg ctgcggcggc cgaaaaccac gtgcagagtg
   207061 acaagacgct ggcataatac gtagcatagt tatataaaat gtgcatattc actggctcaa
   207121 ctccccggac gttacttgca tatcgatcgt caccaaattc aaattgtcta gccgttatga
   207181 gctaccatcg ccagacgctg tggcgtactc acagccaaca tagtcgtgta gccattcctc
   207241 ttggggattg ttgtgaccga cgtagcggct gcgttttaca agtataaacc tgtatgcctt
   207301 tacttacaac atgactgatg ggttatcagc cagatacact tacaacatga ctgatggtta
   207361 tcagccggat agtgttgggc agtactgatc ggcacttacg attttccatg atcttgccgt
   207421 tgggctagag ggatgagcgg tggacatggt tgtggtggac atacgaggtg caggttgtag
   207481 tactgccaat tgagcgtttg tttattggcc aagtggctta cctttaggtt gctatactct
   207541 acgtcaatgc atcttctaat ccatagcaca aaacacgtac tctagcggtg cccatcttgc
   207601 agctacaaac atgtgcagag tcttttcgtt gcgtctgttc tcagggaacc accattctac
   207661 ctggtggtca gcgcagagtc gactggatct acacgtacgg ccgttgtagt aatagcagtc
   207721 ggaatgtttc gtctcgtgca gtaaaaaggc gtggaaatag acgtcccacc gctcgtccca
   207781 cctgcgtttg tcagacatgt ccagtgtgta gagtatgaaa ggtacacttt gggcgtgaag
   207841 tcaccgggcg gagggatcgt ctgtcctgcg ggaagggccc tgcttgatct ctttgaggcg
   207901 gagggcatac gaggcttgtt gtccgtgcgg accgaggtcg ctggtttctg cgttgcggtg
   207961 ctgtgcatgg tgttagtgtg cagatggtgc agatggccat gtttattgtg tggacgggat
   208021 acatgggcac ggacgtgcga gagatgtgca tcgacggcgc tgtggggatg tgtggcgccg
   208081 gacatccccg tggcgaccgc ctataccctg cgccactcga cgagctggat ggcgtcgccg
   208141 ctgcgtgggc ggtgtctgtg cgctctgata tacgccctgt gtgcgttgcg ctgtagcacg
   208201 tgggcacctt gtacgagcgt ggatgagaga gagggacgag cggcgcagat gtcatggggc
   208261 ggccatgtcc ggggcggtgt tgtctatcac caggatgcca gtgtgtcccg agtcaccgcc
   208321 ggacatgcgg atgctcaccc tccccctcct cctcgccctt cgymtccgaa agacgactcg
   208381 ctgttgtcga ccctacccga ctttagagtg tttgggcggc tctttgacat tatgtttttg
   208441 ctcgctgcag ctacgaccgc actttaccga tacatcgttt tgatagccag cgcagatgat
   208501 attggtgatg tttatacata gacacattag atatatatat atctccatgc tatacgctat
   208561 gcattatgct cttgctaatc ctacatgttc tccttgtaca ccccgctttt ctcgcacagg
   208621 ctgctgctct gtctccccca actgatcttg ttctttccta tccgtttctg aatctttctt
   208681 atccctcact tgatcttcaa cttttgacac ttctgcttct gcctctgcct ctgtatcgaa
   208741 atcatccgcc tctgtatcga aatcatccgt cccccactct ccttgactat tatcttccgc
   208801 tcccaccacc ctctccgcct cttcaccacc gccgccaccg ccgccgccac cagcatccgc
   208861 ctttccagat ccgagcccag aaacagtggt ctgctgttca ttgtcatcgt tcaccaatga
   208921 cgacctcatc cgtcgacgcc tcatacttgc tgtgatgcca cgctccgtat cctcccgcgc
   208981 cgccgccgcc gccgccgttg tatgcaagtg gtgcaaatgg gcactctgtg cgagtttacg
   209041 ggacgagacg gatggtggtg gtggtgtttg cctcggaggc gggaaagata ctctcacgtt
   209101 tcttgggttt gggtttgggt ttgggatatt ggccggggag ggggaggacg tcgggggaag
   209161 gtgtgagagt ggggaaaacg tgaattcgga agaagagacg gagcggtaag agggagggac
   209221 ctggggaaag atnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
   209281 nnnnnnccct cccccctccc ccgccccccg cccagcagcc gtccgccacc ccgcacgccc
   209341 accacagcaa gtacaactat gcctcccccg actgctccgc ccgcatccac tcgtcctccc
   209401 cgcagacaca gcacgccgcg tccctgctcc acaagtcccg cgacaggtac atgctcaccc
   209461 cctgcagagc cgacgagcac tgggtcgtcg tcgagctctg tgacgagatc cgcatagagg
   209521 cggtcgagat tgccgtctgg gagtttttca gtggcgtcgt ccgggaagtg cgggtgagcg
   209581 tcggcggcga ggacgaggag gacgatgcgg aagagcccgg ccaggatgat gtcgctggta
   209641 gagggcacag atggaaacag gtcggatcgt ttattggcaa gaacgtcaga gggtcccagg
   209701 tgagctcctg ttgacttttg caaccccgct gaacgcttcg atcagacgtt tagcctctca
   209761 caaccgacct cgttccaccg attcatccgc ctcgactttc cctcgtactt tggctcggaa
   209821 tactattgcc ccgtatcgtc cctcaaggta tacggcatga accagatgga agcgttcaaa
   209881 tgggaacaga aacagttgag cgccgtggcc aaggacaggg acaggactgg gaatagagaa
   209941 cacgaagaag aagagcgccg tgcaaaggaa aggcgggaaa gggaaaagaa ggagagggat
   210001 gagagggata agcaagagca gagggagcgc gagctcgatg aactggaaaa gcttttgcat
   210061 gagcaagcgg gaagacttgt acccgaactc ttgactgaat ccggcttgtt ttccagtatc
   210121 gacgagactg cgcctaccaa cgtacccact gtcgtctcca agcgtgatgg ggattccgat
   210181 tcgccaccga ccaacgagtc catggctaca tccttgatcg aatccacctc gatcgaatcc
   210241 acctcgatcg aatcgcccac ctcgatcgaa tcgccctcca catcatacac ccgtgccgta
   210301 ccgcctcgct ccgactcctc tgaatccatc tacgcattca tcatccgccg actcaacgct
   210361 ttggaaggca actcttcctt ggtagcacgt tatatcgagg aacaagccaa agtcatgcga
   210421 tccatgctga aacaggtaca agttgggtgg gacgaatgga agggtgagtg ggaagacgaa
   210481 gatcgtggga ggtggcagca agaggtgcgt cctgctagcc tacttatgtg aagtcatttt
   210541 gctcaactct tgacttttga ttagcggatg aggcaagaag accggctggg acgggtactc
   210601 tcccaactgg aacagcagcg catcgctttc gacgctgaac gaaaagccat cgagacgcag
   210661 ctccgtgtcc tcgccgacca gctcggctac gaacgccgcc gcgggatcgc ccagctcatc
   210721 atcatggtcg tcatcatcct cctcggcgcc gccagccgca gcagcaccat ggacgccatc
   210781 cttaccccgc tcttgaagga agcacgccgg cgccgaagcg attattatca tcggaaaagt
   210841 ctatcgggcc cccttgccgg tttacatatc gacatgggcg cggggagacc cccggccatc
   210901 atcggccaag cgcgtccgac atccaccaca cccagcgccc atccccatcg ccattcctcg
   210961 tcgacaccca ccccgcgctt gaaaacatcc ctatcccgag ctggatcagg ccaccggtcc
   211021 aatacttcac tcaaacgacg tggtatcgta ccccaggtcc ctccctctta ccgctccgtc
   211081 tcttcttccg aattcacgtt ttccccactc tcacaccttc ccccgacgtc ctccccctcc
   211141 ccggccaata tcccaaaccc aaacccaaac ccaagaaacg tgagagtatc tttcccgcct
   211201 ccgaggcaaa caccaccacc accatccgtc tcgtcccgta aactcgcaca gagtgcccat
   211261 ttgcaccact tgcatacaac ggcggcggcg gcggcggcgc gggaggatac ggagcgtggc
   211321 atcacagcaa gtatgaggcg tcgacggatg aggtcgtcat tggtgaacga tgacaatgaa
   211381 cagcagacca ctgtttctgg gctcggatct ggaaaggcgg atgctggtgg cggcggcggt
   211441 ggcggcggtg gtgaagaggc ggagagggtg gtgggagcgg aagataatag tcaaggagag
   211501 tgggggacgg atgatttcga tacagaggcg gatgatttcg atacagaggc agaggcagaa
   211561 gcagaagtgt caaaagttga agatcaagtg agggataaga aagattcaga aacggatagg
   211621 aaagaacaag atcagttggg ggagacagag cagcagcctg tgcgagaaaa gcggggtgta
   211681 caaggagaac atgtaggatt agcaagagca taatgcatag cgtatagcat ggagatatat
   211741 atatatctaa tgtgtctatg tataaacatc accaatatca tctgcgctgg ctatcaaaac
   211801 gatgtatcgg taaagtgcgg tcgtagctgc agcgagcaaa aacataatgt caaagagccg
   211861 cccaaacact ctaaagtcgg gtagggtcga caacagcgag tcgtctttcg gagacgaatc
   211921 agtaaactgg tcgtcatggt cgatacctgt gtaattgcca tgattgccaa acgggccgga
   211981 ctcgggcaag gtaggcggga gtgacgttcg caattggatg agtagagaaa tcacataggt
   212041 cgtcttttta aatatatata tcgtcagttc cgacattttc taattgctaa tcggcacaac
   212101 gtacaaaaag ctgtcccagg ctgagcagta agaaacccgc gccaacagtc ttgcttgtca
   212161 acctcaaaat cttgctcaag ctccgcataa cctgtgtcag actcgacaag atcaacacac
   212221 ccgtcaagat tagcgaaatc cctcgactcc atgtcggcac atcaatatcc gcaaagtctc
   212281 tgggcaactt gctgatagca agcgccagga agaatgagat ccagtcaccg ttggtgttac
   212341 ccctgccttc taccggaatc tctcccgatt cttgttcagc tgtgcgcggc gcgaaaaaga
   212401 gtgatgggag acactgatgc ggggcaacgg ttagggaact gagttactct ctcaatcgtg
   212461 caatgtcctt ggtaaaatca ttcaactcac cataaggaga cgcgcagcac agtaaatggc
   212521 aaagacgtag cctaaaacgt tatatatctg tccacggaac gtgtgcccga aatcctgccg
   212581 tctctacgtt ttgtcaaatg agcatgattt tttcttcttt gtagaaaagt cctgatctta
   212641 cctttcgagc cttcatagct ctgagcgatc ttgatacttg catctccatc gtttccaggc
   212701 ctttcaattc ggcctcaaga gaggcagctg agtttttaac ggtttcagtt tcacatccct
   212761 ttttttttca aaatcacttg caaaaaactc ctcctacttt ggttattttc acccctaaat
   212821 atcctcccca tccagccgct cgatccttct ccattcggaa cagcgtaccg gttaatctca
   212881 tccctcttgg aaatcagatc ctgccggacc ctatagagtg atcgctcggc ctggagaagg
   212941 tcgttatccg tgagcgtgcg acttccagct cgtcggtgct cgaaaaaatt ccaagctgag
   213001 cgaacagcac caaagccgga caaacttccc aaaatgacta cgccgagaac gacgactcgt
   213061 cccaaactag gggctaacca acctccttgc tcccatccct caggtccaga tgtcgaccac
   213121 tgtacgatag cctcgtcaat tgaagaagcg gtagatgatg ggtcatcaat atccattgat
   213181 ggtgttgaaa cgacctggac gttcataggc accgcggtta tgtaaggcgg gatacgggta
   213241 aacaaaaaca tgtaaagggt gaatgggatg agcgatatga gcaagcgtga ggtgaaggag
   213301 agtgatgatg attgagaagg ggtggttgaa gtagatgacg aatctgttcg aatgtcagaa
   213361 gttgcggggg tgggacatgt acactcagtt gcctacctct agatcgatag gtgaacaaga
   213421 gacattggac cagcgggaca acaacaagga ttaatgcgag gataaagtgg agagagaccg
   213481 aaaagttgac ctggcgagat ctaaaagtgg gattagcatg ggtcgagagc acacattgta
   213541 ctcacctagc attgagcacg cctatcgcat ggaataccac caagctgagc aagttgcaac
   213601 cctctgcgaa acacactgag aataagatcc ttgaaactcg atgtaaccct cgcgtcgcct
   213661 tcttcacccg cttggtccct gctccagatc ttttgccatg actcaattga agtaccttcc
   213721 tactcactcc agagcttgca tccttgagct tttgtccgat tgcttgtagc tcaatggtat
   213781 tctcgccttg agagggatac gaagggagat ttgaagatga ataacttggg ttatcgtccc
   213841 gtctaaagcc gttgtttgac gatgcaaggg tcacgcttat aggcgctgga gagcctgggt
   213901 atgaagatac aggcgtaaag ctagtgtcgt ctgtctcatc gttatactca gtctcaagtc
   213961 ccaacgcgtt cccgccgcgc cgcgaactgt ccgcagtcgg taataatacg gtgggtggga
   214021 ggattgtatc cggctgtgag atgtcccgga gagtaggatt gatcgtagag tgtaaaaact
   214081 tgcgggatat gaagaagtat acgagtctga gaaggaggag caggaaagtg tcgaaaagga
   214141 ttggggaaga ggtggcagag gagctaataa caggggcgcg tacaggctgg ggatctgagg
   214201 attccatgtt ggatgcggtg gtagttatgt ggacatgatt gaatgtgggt aagagtatca
   214261 aaggatatga tgtggatgtg aattcaaaaa agtagaaatg ccatcggaaa cgaagcgaat
   214321 aagaggacaa ttctctaata acatcttccg aacaacctca aaccttatct cccattgcgc
   214381 agattaacaa cacatcctgc aggcgatcta taggacatgc attcgtatga agtcatacac
   214441 tcgtctacga ctctaccgac tctacaaaaa catatacaga tgcatggctg atttgcacat
   214501 gccttcctgt ctaaggctcc ccaagaccct tccactccaa cacttccagc cattccgcga
   214561 catcccccaa tctgctcgtt aagctcttgc ctctatcctc caatgtctcg gcacttggag
   214621 tgtaattacg aggatttata agagccatca tttcttctcg agaggatgtt ggaggaggcg
   214681 taagtccaga agatgcgctc gatgcgtcgt catctttttc atggcgaaca tgcttttgcg
   214741 aacgcacatg gctagcaagc tgacttatgg attgagttaa cgtatcgtcg ggcgacgcgt
   214801 cttcatgggt cgccgttgca gtaccattgg gcttagcaga ctcaacggcc ttcttatacc
   214861 tccattccaa ccatttaata agaggcttaa cgtctttgga cttgccaaag tgactccacc
   214921 tctctattga gtgaggcaag ttgtcgtctt cggttacctt gcccgcaacc gcaggtcccc
   214981 aaatcagtat gccagtgccc catccaatag gagctttgct atcgttgtca accggacggt
   215041 gactcaaagc atagtatatg cgaccatcaa gatccgtgcc caaaggttcg aaccgcagag
   215101 acgtttggtt gatcccagcg cgcatatttg tattgtactg cgctacccgt aaattgtgtt
   215161 cgtgagactc tttcgtagtc tacaagtcgt caacacacat caaagtgcca ccaagtatag
   215221 acccacctga gaaacattgg ctttggtctc cgccgctgtc ttacacaaga gccgttcttc
   215281 ttgcagtctc tgtttccgtt tctcccatgc cgtctgctcc ttcttcaaca gattcgcatg
   215341 ctctttcctc acctgcgtct ccaaggcaaa tgtctccata ctgtttttga tttttggcgt
   215401 ggtaagggtt cgttccacca atgctagcag cattctaacg acttcagatg gctgaggcat
   215461 ccgggaagca cctcggcgag aagggacaga aagctcggtt gcccatgcag gcgcaggttg
   215521 atcatccccc agatcaaaga gagaccgcaa agcagcctcg ttagcctcag ctctgcgatc
   215581 aaatggcgcc ggcgggagct caagaccgag gggttcaatc aagctttgga atatggatgc
   215641 gaatcggggg acatcggcgt aataccgcag ctcttcgcgg aaattgaata atgtctcctt
   215701 caactgcgct gatatcagcc acgagacccc aagtaatctg cacatgcact cacatcctca
   215761 ttgtcctcat ccttcgacgc ctctaattca tccttgatga catccagcag agctcccgat
   215821 attaacctga cattcgactc ggtaataggg cgatcaaagt cgtcaagagc cggtaatgaa
   215881 cgttcaggaa ttgataaaat ctgtctaaac cgccaaagga attcgcgcag ctgggaacga
   215941 ctcagcttcg tcatgtacaa aagataaggt atacccaccg ccatacgttg ttcagcctct
   216001 tcatgtccta atcgtgtgac cactttctca aaaataggag gttctgggat gacttcgggt
   216061 ttcttcactc tagatttggg cttagcatcc ctgggttcgg cttctttggt cttcttttgc
   216121 gttttttctt tacccctttg cgcgttcttc gaagcacctt tgggagcctt ttctttcatc
   216181 tttccggcag tcttcgtctg ttttttggtc tctccatttg cctttttttc tttcttctcc
   216241 tttggctctt tcgctacctt ggtcgctttt ttcttcagcg cgactttcga gctagcttgc
   216301 tttttcgtac gttcagtgtc ggattcaata tcggagagat ctgaatcttc gtgcagaatt
   216361 gctgaggccc ctaaagccgt agcaaccaca aagtctttct ttgcttgaat agctcccttc
   216421 tccttcttga cgatctcctt tgttggcttc ttggagttac ttcctgattt tgatgtacca
   216481 gttttcgaaa catagaaaga tcagaatcgt gataacgagg catagttttc gagatcacgc
   216541 gcgactcacc ttttggattc ttcgtttccc ctgcggattt gccgcttgcc ttgacttttt
   216601 tcgcctttgg cttggttggg ccagccgttt tatcctctgc tgatcttgcg cgcttcttgc
   216661 cgacggtctt tggagtctta gatgctttgt tctcctcgga tgacagttcg ctcagctcag
   216721 agctactggc tcgtgatcta tcaacggcat tttgagggat ggccatgcta ggaatgtaat
   216781 gatatggact gaaaagagag gaaataggat gattgaaaat gtgaggggca tcattggggc
   216841 tttgacgcgt ttgctttatg acattttgtg tacgcgccaa agatcaggac accccaagcc
   216901 aaaccatcca ccttcgcgtt tattatcaaa ttatcaaatg ggcctacagt tgccacagtt
   216961 gttggtcttc acctcattca agccttcgtt tgcaaaacca ttttgacgaa ttcgcagcta
   217021 atgcaacgca gcagcacgcc tattaacatc gtacaaatac caaatccctt cactagtgac
   217081 tagttcatga tggacggaca aggcaaacga catgggcata ataaggtgtt tttccttgct
   217141 tgtgatagct gcagacaacc caccatccac cacgcgacgg agtgatttga catacatgac
   217201 aagtgaggac gttctgtaac caacttagcc aggctcgaaa tacaatttga aaagcaataa
   217261 tctcaggcag atacgataaa acctaacggc ttattgataa tgacatggca aacaaaaaat
   217321 tattgttgta tgtaaaattt gaaaggatca ccacagactg ccaccatctc gcctttcaat
   217381 cttaaatcaa aaactctgct tggcatcgat tccatatgtg agctcttatg atgttctatc
   217441 tgccgtcgct tattttccca gaaatgtgga ctgcccaacc ttccagcaga ctcaaataaa
   217501 ggattcaata atacctttgg gacaccgagc aagaacgaac agtatccctg aaacgtcggc
   217561 agcatcaaag gaaggatatg aaaagtatat cgaatttaca acgagtggat ggtataaatg
   217621 atattgacca aagggcttca ctcctgagtt gcgaaaagtg ccggcctcca tgatccctcc
   217681 cagtatcaaa ttcagtcgac ctctaaccac agttaacgcc gtaacgctcg tggcgttagc
   217741 ttctttcttc ttctcagttc tctactacgc cctatcacct tccccccttc tgcctttcga
   217801 cacccttagc tcttataatg ctgaatcaaa taaacccaat gacgcacctc gcgaagcgta
   217861 tgtgactttt ctgtccaacg aagacccata ttactttcaa tctgcccgac ttcttgtgta
   217921 cgctctccag cacgatcctc tgacagccga cccatcacga cctgtcattg tcttaaccac
   217981 acctggtgta ccagcctcat actctcgaaa acttgaagcg gaaggggcca ttgtgattga
   218041 gaaacctttc ataacgtctc tgcctatggt gcagacgaac ccccgctgga aagacgttta
   218101 cacaaaacta tggatcttca acatgacttc ctacgataga ttggtctatt atgacgcaga
   218161 tcacctcgtc cttcgtccag tcgactctat ctgggaagct gaaaacagct ggcctgagag
   218221 cggtctggct gctctaggaa gcggtgatgg aggctatgtc gaggactcgg attacttttt
   218281 agcaggattc ttcctcgcca ttcccaaaga ggagattatg gagggactgt tagctgaaag
   218341 aggctatgat ccagtctttc ctgagcaaaa cctcatgaac aagtacttca gcagggatgg
   218401 acttaggcca tgggctcctt tgaatcctat gtgagtttgg cccaccatca ccacgcaccc
   218461 cacggccaaa tttgggacgt agtataatat ttgctaataa taaggtagtc atgaacgcat
   218521 ctcgccaaag tatgaacatg tcgagcaagg tgctcacacg taggttacat cccacttatg
   218581 gaatgttcat atgctgactt ggctggaaag aattcatgaa aaatgctggc aaggatgggt
   218641 cgaaaggagg ctcgcagaac tcttctatga acgcctcggt cgcatggaag gatactggct
   218701 agccaaagaa tccagtggga caattccgac tcctgatcct cgtggctgat tatcctccgt
   218761 tcatacgctg gcattaaact tcataataat gcatgaagta cggtgatagt atgttacaga
   218821 acgtggttcg cgtacacagt attgttactt gtaaatataa aattgtccta tggtattagt
   218881 cgtaatcaaa ctctttggtg acgcttgtct agccaatcca aaatttggca atcgcgccag
   218941 ccaaatcttt cggacccttg cccttctttt tctctttccc attcttcgct ccattcttta
   219001 cctcatctac agcttggatt gaacccgtac tgtatcttac tcgatgcccc ataccttgaa
   219061 cttccccgct tgagcccgga ctgggtttgg tattgccagt gctacctgtt ccagacgagt
   219121 aggcaccctc attcgtatcc ctctgtaagc tggtactcga aagtccagac ggtttcatgc
   219181 cggtatgtgg taggttgatg ttcgacaagg atcccgacgg tttgtcaatt ggtgaattgg
   219241 cggcactaga tgtaccactc attccaccgg cagagcctgc aacatcatat gaaatactcc
   219301 tcccttgact acccagccat gtgcttttac ctgcactcct tgataatggc ggtccctctc
   219361 gcgctctaga tcgttgttct tgcacatacg atgtcgactc cccggtcaac ccgttaggca
   219421 acggagtctt gagctccgcg cctcgaacag aatttgagtc tgcgtaggct gcatcgtccc
   219481 agaagacagt ctgagatcgc acgactgaca ttcgcttccc tcgttgcgag ccaatacctg
   219541 aattgccgtc ttgcgctaac ccgttaggcg ttctcagatc gctagaagta cggttagaag
   219601 aatccgtgta tatattgaga ggatcaccaa tggaaatagg gcgtcgtcgg gtcgaagttt
   219661 cactagcata tcggcctcct tgggtgcgat cggacgagga tggaggtaaa gagggttgta
   219721 caaatcctga tcctgggcgg tttgatgaag tcgaacttcg acgagaatca cctgcagcag
   219781 cgggcatgac aggaacaggc agagccacag caggatactg gggaaagggt aaggcaaccg
   219841 agctgcgggg agacagtggg aattgcatcg acgcataggg acctggctgg ctgaagagga
   219901 tgtctggaag acgtgtttca cccatcacaa gcttttgaaa cgcgagaaga gtgtagtacg
   219961 cgtcattgcc agcgttgccg ataggcgcaa aaggttggac aggaatttga agggtttgta
   220021 aaagagaggc gagggatgtg agaggttgtt gtctatctgg agtgccaggt attccttgag
   220081 cctgtgctcg ccgcaaaaaa ttgtattcga gagcaaggac atcaaattgc aaaacgttgt
   220141 tgggtaaggt cgaagagctg ggcaacggaa gaggaaccgg ttcaccgact gtcaacaaga
   220201 taagggcatt ggcgtggccg tcattctcct gcgaagcaag agcgttgaga gtcgcactga
   220261 aggacgtcag caatcgtcct gcagcaggag taatatggta tgagtttact ctaagatagt
   220321 ctctaccctt ttctcggcca caaactcgct ctgaccgaag gcataagccc ttggaaacgt
   220381 tggtgggttg tgattcgcac gctagggatg acaagtcagc cgtttgacgg gatgatgatt
   220441 agcttgtgag acccaccttg tcgacccatt cttcgacgac ataatgcgat ttgcggtaat
   220501 tatcagctgg gaccggcggc cagacgccct gagaggtcct ttagctccat gatcctttgt
   220561 ttaggttacg ggcacgagag tactcaccag cgcccgaaga tttgcgcatc tcaacactgc
   220621 aagcccaatc tccaatacga gccccttgtt acttccctgt cctgtgcttc cagagtgtgt
   220681 acggccttgc ccaggtatca atccatatgg cggaccccct ttctcccacc aatttgtctt
   220741 gacacatgca aatgtatacc ctacaccatt gtcgcggacg cccacacctc ctgtttctct
   220801 ttctccactg gacccgcctg cgtagaagag ttgttctatg actgtagctt cgccggagcg
   220861 tacccgtgaa cgaagatagg acagctcagc cgccggaagt gaagctgcaa gtttgcggta
   220921 gccgctgaga tctcgaacgg tgacgagacg gcgaagggct aggttgcgag tcggaacggg
   220981 gttgagaggc aaggttgtcg gtgggtcttt ggagagtgac tcgccaaagc tgcagggaca
   221041 ttagcttgag aaaccaagat attggactat gtaggtgggc gcaccgagtc cgaatcatcc
   221101 tggcgaacag tgcaatctgc tccctcctca cagccacatg aggcttaccc gtttcactat
   221161 ctacgacaac tgatccctga agtcattata atgtccacag cagtgttatg gcaagcactc
   221221 acccatcact tcccagccaa atcccaggaa ttcgttaaaa gacacaaagt accctcccca
   221281 tgacttctcc caccaatcag tatttgtcga ttcgaaaaga cctctgaaac caaagttagc
   221341 cacaacttga tccaattcag tattgcatag acccacatat atgcagcata gatagagtgc
   221401 aggtcgacat caaattcgac cgcgttacca tattttgttg tgtcagccat ggcagcagtc
   221461 gatgttcact gtaaatgtga tcaaatgagc gtgggaaaag gcggcgtcaa gatcgtcgca
   221521 gagcttgctg cacttgtcgc ttggcagcct cgatgggtat tatcttctat ggattggaag
   221581 gccttttaca catgaagatt atcggatggg tggaagagac acgggttgaa agttgaccga
   221641 tgtatacaga agtgacttat gaacggtgca ctgtccgcgt gagggtaagg gtgattggac
   221701 cggcgaccga aaagcgggtt cggggacggg tgacgggcgg cggggggatt tgagattgaa
   221761 gtataaggaa ggtggcggct gtatagatgt ggcatgtata acgttagctg tggctgtcta
   221821 aatagctcag gacggggagg gcgaaagggc ttacctaccg gtgagaacgt cgcgttgttt
   221881 cgctgagaaa ggacaacgct aataaagaaa ggcacatttc acgccacctc ttcccagatt
   221941 cggcccctcc acaaccactt ccttcccaga ttcgactctc cattcatcac cactccatga
   222001 atgtcacact acgtcgcgac gataatttta ctaaacaaat tatagcagat ataagttaac
   222061 gatcttacca gcagcactgc aaattgatct tttctattcg cctcattcat cctggccctc
   222121 gcttacatcg cctcttccag ggaaatgcag taacccccgg cctccaccat ccaggagtcc
   222181 ttacttacat gctattaatg tatactcctg gcgtcttctt ttattcgggc tgcatatggt
   222241 acacatagac aatcacatga actgtacgac catgtaatgt atcttatctc accggggcaa
   222301 ttacttgaaa ttattcgaac taaataaaca caacacaaag aagggtacaa acacaataat
   222361 ctctcctata atacagtttc gatatatctt gattactctt gtttcaaacg agcctctaac
   222421 tctttgactc gatcctgcaa tgctttgttc ttactctcca agtctttgac tctattacgc
   222481 aagccttgct tgagcttttc tgacccttgc aaaagacggt ccatgcgata cagttcgtcg
   222541 ttgagttgct ccatagtaga tatgctggga agaagcttag gatgaggggg tagtgtgccg
   222601 gcgggggacg agacaaaagg attagactat aaatgagttg attgtcagcc ggtgtctgtc
   222661 gagttaacgt gaatacttgt cgcacgtcta tgttcgcctt ctttggcgtc ctaagatcct
   222721 catcctcctc ttctctatct cttttcatac ccgtcatgac gctgctcaat ctctcgttga
   222781 atcctagagt gggagtagag ctaatcgaat ctcgggtccc atgcttcttc accgagtttt
   222841 ggctgcccgc aatagcttcc ctctcgagac catcgacatc tacagcaccc caatcaatat
   222901 catcttccac aggaacaagg tcatcctcgt tgtccgacag aacgctggca gcttgtttcc
   222961 ccttgctcaa agaatgtgga gtatgaaggc cgaccgaaga cgagctgtgt cccaccggag
   223021 tttggcctag ggcttgaccg gtagagccgc cgaatcggga tcgaccaacg catggtgttt
   223081 ccggagcctg atcggatttg gcgtttttat gaatctcatc ttcccacacg aaaaatttgc
   223141 accttttagg atcttcccgc ggaagagggc agacgtagaa ggctctgtgc ataaccgtgt
   223201 caattgccat tattcaacat agccaaactt tccgcctacc tgttgggatt tttggtactt
   223261 gagctcacaa atcgtttaca tctcctgtta tggccctgat tgaggtcgtg ttaggaaaca
   223321 aagggaagaa gaaagtaaag gaacgcacgg tacaaaccac gtttccatct tcatcctgcg
   223381 agggtgtcgc agcagttatc tggatcctgc gtggggtgga cactcgagta ttcctcgcag
   223441 tatacgctgg catttgcagc tgtatatttc taagaggtag atgagagaat cttgaaggag
   223501 atggatgaat agtaggaatg gagaggcgga aatgagatat gggtgatgtg cgacgttctt
   223561 gtctttcagg caccgcccaa gaagtaaaac ctgaaacaat catattccca gtaatgtctg
   223621 gaaatatacc tgcaaaatga attttgggat agtctttaca gccaaatatt tgggccaaaa
   223681 ttcaactcgg gccgtcaaac tgcatctgac gcgtcagcat tcccactgct accccaacaa
   223741 acaacaacag caataaaaac aacgaaccca gaagaaagaa ccctcatgtc ttacttgttg
   223801 ctcgcgtctc agcttgaaat attgtactat acattaactt tgcctatcaa gaagtattac
   223861 cattctacat ataataaatg gcaaaatcta ctacatatag gtaagtgaag tagaattcca
   223921 agcctcaggc ccacggccca tcgccaacca atagccttcc attcgcccaa gcttttgtcg
   223981 ccatacttct ttgacttccc tgtcaatatg gggtaaccac atcttgtcat ggaggctatt
   224041 ccaaattagc ttgggatgaa tggattttgc aatctgggct tacacatgga taccagcttc
   224101 gaggtcgact ttccttggga aggttgtgac aaacctaaag cccttgtaag tgatacgtag
   224161 acaaattgaa acatgtcaag gtacaaccca catatgattc agaggcctcc acggtctggg
   224221 cccatccctc cggaagtaat gattcaacaa gttctacgat aacgctgtca gcagttgatc
   224281 tggcagctcg gatattatga taaaaccctg accaatctca cctgttcagg aaaccatggg
   224341 tcgaaatcct tctcctgtag caactcgttg aaagtctttt catccggcct agccaacatg
   224401 aaaccactat tgaaataatt ttgatcctcg atcggcgtcg gatggtccca ggcactctta
   224461 ctctctccac acgcagccat cccgctctcc ggccaggcat tcggatcatc ccaaatccca
   224521 gtcaacggct tcaccatcaa ctggtcagca tcaacaaaga gaacgcgctc atagtctgta
   224581 aggttgaaaa tgaacaactt ggtgtacact tcagcgtagc gcgagattcc cttttccgga
   224641 agagggaggt ggtcgatcaa aggacgggag gcaatgatag ctccctcttc acgaagctgc
   224701 tcgagctgcc attctgggac acctggtgtg gtgattacca caaaatctct ggggtgtggg
   224761 tcgagtgtaa gggggtcata tttgagctga aacatgagcc tgcgcacggc gttgaaatac
   224821 catggtctgg gatcatcgga atgcgcgagg aaggtcacgt aggcttctgc cgctggtggc
   224881 ggagttggcg gggccggctc taccgcctcc attggagata gctggatgtg gaggatatgg
   224941 atcagtagta tggcgatgat gccgctggca atcaggcgca accatgtgtt cgctattcgg
   225001 taggacaccg tcgcagggta ggagataggg gcaggaagga tggatgaaga ggtagacggg
   225061 atgtttgtct cttcacgatc taggatattt tcctcggtga gcttttcagg agacatcgcg
   225121 gtggaaatta agaggactat gcaggagatg gagagttgta cttttattga ggatatgaac
   225181 gacgctgcgt cttcttcaag agtcgttcgc ggttctctgc tcctcttgcg agctatttta
   225241 aatagtagct gtgtctgata aagctgtagg caaagggtaa cggataaaca attgcgaaac
   225301 gatcttgtgt gaaagaattg tttccatgta tagacatggg caaatggaag ttaaacgcta
   225361 ctttgtttga caacctttct ccttgccaag atgacgagct ataatgatgg ccggtctcct
   225421 tgttgtacgg ctttaggtac agatcttcgc tcggcatctc atgactactt ttagactgca
   225481 tagttcatcc ctttgtgctg tttgggaacg ggggacagtg aaaggacggt acgtcggggt
   225541 acacactctc gtttcatgat gcgagagatc gaaaagaaca atgaacgcat aggcatccgg
   225601 cgtttgtttt tgtcattgag tgatacttgg ccatcggctg agagaggatg catggccaaa
   225661 atctgacagt catatcccat ataaacacaa caacaaaaga taccatctgt gtcttgattc
   225721 aaatgaattt tgccgaacca aaacccgaaa cctcaagatc caaaaacatg tccaacgttt
   225781 tgctgataag tctcaaagct atctatatcc tttctgccgc aacagcaagt caccaaaccc
   225841 gcgcccatca cttttgcgtc agtttctttg cttcttcttg ccatctatca atctcctttc
   225901 ggatggcatc tgtcctttgc tcgactgaag gatgtgtcgc cttggtccaa agtttgaacg
   225961 cagcacccgt gagggtgttg ttatcggcct tgtcatcagg ttggatctcg tgtaagctcg
   226021 cgacagaact ttggaaatga ccgattgttg ctcgtgggtc ataacctgct ctcgcgagta
   226081 tcctggaaaa aagcatgtca gtccataaaa agcaaaacat tttgaaaaca aatttataac
   226141 aagataactc accgtaaacc ggcaagatcc gcttcatact cgtgcttcca ctggaaccca
   226201 atctctccat acttgtccgc caactcttct gagctagttc ttcccatatt ggccaaagca
   226261 tcgttgactg tcggtccaag gaaaacactg tggtaaccac actttagccc tgttacattc
   226321 acgatagatc tccacttacg tcaaaggcca gataaaggct cggataagat ccatactaaa
   226381 tcctaataca ctaggccaga ggacttgttg ctgagaaagt gtttcaaggt gatggctcag
   226441 taataaatgg cccatttcgt gcgccaagat acaagcaaga tggagatttt gctcttctgt
   226501 gggctggatg tgatgttgct gattctgatt ggaagtgcga gaggtcgaga ataagccaga
   226561 aaggaaacct gattgaggcg tttctatttg gggtgcagat tggggtgttg gtgaagaatg
   226621 acgaaggatc tcgtctaata atcccgtgta gatgacgata ccgccagcct ttttaccgcc
   226681 aaatccatat gaaaacgcat tttgctcatc tttttgcagc aacatgatgt tatacggtgg
   226741 ccctacttca aggtgctcac ggccagtatt gggctcaccg ccaggaagaa cagaatgaag
   226801 gagagaggaa actcgagggc gaggcttgaa tgggtgatag ataggtggcg gtaagggaag
   226861 agctgagaca tattcgttat gaggtctttg ctctggaggg atcaactggc attcggtaag
   226921 agcggcagtt tctagccggt tgaggacgct ttgaacccag gcccaccgcc agtcatcggt
   226981 ggatactata ggtggagctg ggcgttcggg agtagtgaga aggttgatga cacttcggta
   227041 ccaatttcca ccggcgagac ttgtcgaaat ggcatcctct tcttctggtg tgagcaagat
   227101 taatctccat ctgccagtaa gaggtactct ttccagaccg gcaatgtatg cgccacagat
   227161 taagaggaat ggcaggaaaa aaacggtagc gacaaaccaa cggccccatt ggaagcaatc
   227221 tttgaaagtt tttaaaccaa gccaatatcg cctgagggaa tcaacttctg cctgctgctt
   227281 tgattcaagt ctgttgtagt agttttcagc agaagatgga agagggggaa taatataata
   227341 tctccggcgg attacaaaag ctacctttcg tcgattgccg tggaaatgtt ccataagcat
   227401 ttttggagtg acgtcaaact ggatgtctgg gtcctgggat ggacgtcgaa attttcgggg
   227461 aggaagaggc attgagtagg caacgcgtcc atctggcaga gtcaagccac caagtttgtc
   227521 tggttgggaa tcaatcaacg catttgcctc ttcaggtttt agcttaatgc tcttttcccc
   227581 ttcacaccac attttgaaaa attcttctgc ctttgggctc actgttggac attccacgcc
   227641 ggactctatc catctaccta gacgaatcat cttaaaggct gcgatcgtac ctatggggag
   227701 gaaggagatg ataatgcgag agaatgcagt ggcagcggtc aagatggaag ctccctaata
   227761 tgtatatgtt agcgacgtgg caaaaagctt ggaaggtggc gacatgcctt tacgacagat
   227821 attccaaccg gtattagagg tatagcttcg cgtctggcag aagtgtggaa tgatggagga
   227881 tgaccgagac gctcggtgat gcgataccga gcatgtccga gatgttgaaa agttgccaaa
   227941 gtttttggtg aagaaagcaa aggggaggaa gcatcgtaga ccttgttctt tccctttccg
   228001 tgtgatgtgc taaatgtgaa gcgaggagaa tagagtgatt ggaaggggcg ggagtggtga
   228061 gagaaggata aagttgggat gcgagatggg gtaatggttg gcgttgctgt gagtgatgac
   228121 tttatgagtg gtgtaggcag gcgtttagtc cttgaaagag agatcatggc tgtgttatgg
   228181 ggagtgggca gtggattgag cggccctctg tagaacgagt agaacaacga agggcgataa
   228241 ctgaatacct cgctgcgaac gttctcggca tcacttctgc tcatcggcca tgtcgagtca
   228301 cgtgacgacg cacaacaaca acaaatccgt caatttacaa ctccatacag tataccacag
   228361 catccatatg aagccccatc ccctgcacac cacaaatcac ctcagagacc ttactcccca
   228421 agaagcacag cagctcaccg cttttatcga caaaagaaag tggtttgagc acagactaga
   228481 cgtgagttcg tactatttcc tccataacgc ttacacttcg ttgtctagtc cctcgagcac
   228541 atccctcctg tctatccctt tattcaccca gtgctggaac aaataccgga aaatgccaac
   228601 caatgtgact tgcaatttat gcgtagcggc gaagcagatt ctcaatggca gctgcccgat
   228661 caagaccaag tgaaggcttg gaaacgcgaa agagacgaga ttgaggaaca agtgctagag
   228721 tttgacggtg gagatctgaa gagaatgaag aagatgactc gaggtgagct atataaaggt
   228781 gttgatatgc cttcttcagc tgacaagagt gccagcggct acattacttc ccctgacacc
   228841 gccatcgaca cacctcgtgt ccatcactct agaccttatc gtcttgatag accgtatctt
   228901 atctttatta cggcggcgcg gccagatcct cgatttggtg atgcttcgac ttcaatggga
   228961 tcaggttcgg tggcaggtga tgagtgaatc aaaagggcta ctaaatgaag tggactctgt
   229021 ggtccgagac aaggctagat ggtctcctgc agaagtcgac gtgacgtctc gtggctcgcc
   229081 acggtatttt ccacgatcac caagctgtcg tggaagcgtc acacctgtga cgcccaaatc
   229141 tagtacgcca cgtaccgaca cacttgcatc cgaccttgca tctgcccatc tcgggagttc
   229201 tccccaacac aaacaagcat ccgaaagcgc cgtacaaaca gcatcccctg ccaggcatct
   229261 cagtacaccc gataggtctc tgcatatccc cctccttcat tcacaacttg tcaacttgcg
   229321 gatacgtcac aagaatatta cctctaccca tctggctcgt agcggagcga tccttgatcg
   229381 catgatagac gtcgcatcgc acctacaaaa tttaggtgat gtgaatggcc cttgcacaaa
   229441 aaatgagtct ctggagggag gtgctgtgcc ctatcagctt ttggatctgc aggatgaact
   229501 tgatgcttcg gtagaagagt taggcagaag ggtggcgtgg tgtggagagc ttgaagaaca
   229561 ttggaaattg tacgtcatcg gcttgcatgt tctggtgaat cgactgatgt gtgctttatt
   229621 aggtccgaag cccattactc ttcctctttt caagctcatc aactcggctt ggaactgctt
   229681 gacaacttgc accaggccct atcgaaacca gccaccagca aacgacacca acaactctcc
   229741 gaattacttg gaaaagctca atcatgtctc ccaaccccaa tcacagactc attttctcga
   229801 ccattttacc ctgcttaccc cgaaaacgat gaatataacc aacacgccaa gggcgctttg
   229861 atcaaagctc atacgaatgc ttctgatatt atcaaaaagg ggaaagaagg ggtggactgg
   229921 tattcgcgtc tattgagcgc ccgagaaaaa gtccttggca aacactcgga gattaaggaa
   229981 cttgaagaaa atatacggca gctgctagag tttcttgaaa ggggcgaaaa tagaattgaa
   230041 cggcctgata tgtccagccg acactgtctg gatggcaact ttgagcactg gatcaacact
   230101 gtaccttcaa aatcagccat gacgctccag tacgtcgagc aatcagaatc ggtctgcaat
   230161 cgctccaccc ttttggcatt acaataccga aacctgctta aaacgcctcc tcgatttatc
   230221 cgagaacaag catggtggca aacggatttg atcaactacg atctggcaga tcaggtggat
   230281 acagacttga accgactgct tgagttgagg cagcagacgt tggcggccgt gcaagctgca
   230341 aaagaggata tcgagattct tgaaaaggca caacaagctt tcataggtgc atcacttgtt
   230401 cgcaatgaag gtttgttcat ccaaaggcag ttggaaacgc tcatccaaaa aattgcctat
   230461 ccgtcttctc aatgcgttga aagaaatcac ggggagctga accgcaccat aactcaactt
   230521 gctcgccgta tcgagcagca agtcacgact ccgttttcct ctttcaaagg tttaatcaag
   230581 tgttaccaac gtcatttacc aaccctttgt caattccttt tgtccgctat atcagacgtg
   230641 acaaatctgc cttcccagct gtctagatcc atggacctcc tggaacgagt acagaaccaa
   230701 accaccatcg ttgaaagtgt ggaagcagaa gcacagaaga tgatcgtgaa cgttattgtc
   230761 atccgggaag aagccgagca aatgactgga cgcgaagatg tcattgatgt tttggacagt
   230821 ctgttagcaa aggtcgaaga actggacgaa gaggcgagat cgtgggaatc caagttatca
   230881 caacgcattc ccttccttgc atctgaaacc aacggactcc cgtcatcaaa cgacttgtac
   230941 accgtaccta ccgcacccat gatgtcttct ctgtcccgct ccaaagctcc tcagcaaaca
   231001 tccaccgtcg gattggccat cgatgatacc aactcggctg ctcttgactt ggcgtcagtc
   231061 gaccagtctg tcaggggagc ggttaatgat caagtcttgg ctgtggggtc tcacatcgca
   231121 cattgcaagt ccgtctgtcg gtcagctatg cttgatgtat gggagaaccg atgtcaggga
   231181 agggttacag ctttagaaaa gggtatatcc tcatggctag atctttgtga aaagacaagg
   231241 aacatcctcg acgatatggc cggtcgagtt aatgtccaga ctccctccta tgggcttgcc
   231301 caggtcgcag tacaagaagt agaagacact ctggcatcat tgaagaaata catcaccgag
   231361 cacgagagga ttttacaagc acatctggcg ggggtggagg atatattcaa cgctttgccg
   231421 agatggtgcg gggaggagga ggaagagagc cagggtagat gtcagaggtg ggaaatatca
   231481 aaaaggatat ccaaagatgt cgtagaagat gcgttgggaa aggctgggga tatcgtagcg
   231541 gcaggagagg ctcttttggc caagatcaaa tgccaaacag aggatataca taatcaacag
   231601 caagcacttc ctgacactcc tacacctctg acaaatactc ccgacgtcct tgggccttct
   231661 gtgattgctg atgacacatc gtcaagcccc tttgaaactc taaaagatga tcttgatctt
   231721 ttggagcagc tgcgcaagca attggacgat ttgaaggtcg aagaactggt gaacccgatc
   231781 acatcgaaat cgtcatggac ttccacatcc cgacagcttc ctgcccaagc gatggcggaa
   231841 cgtatagcta aagttctggg tgatatatcc gagagcgtac gattgctttc caatccgtct
   231901 tcacatgtta ctctaacaga agccgaaagc ctcaaacaat ccttgacatc acagaaagct
   231961 ttgatgcctc ggcttgaaca actggctcaa atcgatggtg ctgttaaagc ttgtgatgat
   232021 gcgcatagcc agttgcttga cataatcgac aactacgcgg agcaaaaagg accgctacag
   232081 gacgctgcac gagacgccca acaagctctt gactatgttt tggagtgctc catgccggtg
   232141 aatgacgaca gcagagtgtg cagagaagtt aagcgtctga gagacacaat gaaagaccta
   232201 gagatgttgg tggaagaatg tctagatcct gaaaagttaa aagaggagga tgttcaggat
   232261 gctatatcag atatttcaag atcagaaagt gcactgtcct tcgcctcgac agttcagcct
   232321 tttaacccga acgcatcagt ctcaaaactt ccccgactct ccagctcctt gttcaaaccc
   232381 tcacctcgct caacgtccaa tccgcaacgt acgcctctcc gctcatcttc tggcatactc
   232441 gcacatcagg ggaagaatgg atatcgcgta gtatcagata cgcctaccta cgtgctagca
   232501 aacaagtcac agagtattgt agatctccat ccacccctct ctttggccgg tcctaccgcc
   232561 acaccgtgtg ccacccctac gctgccaggt tccgaccctc gcgctcgcaa gtcatcgata
   232621 cctcgacgat caagaatatc aaatgcgtca tctatagcct cctcatcggc agctacaccg
   232681 caatttgcta aggctatacc aaaattgaga aggaccagtc atctagtacc ttccatccaa
   232741 tcgaaagtga agaaggagta tgttcccaat cccaaaagca agctcgatgt agctatagga
   232801 aaagtcatca ataagcttga tgtgagtggc gtctttcata atgaggacga cagctgaaca
   232861 acaatcatca tctctagatc gatgtcccag tacggccggt gaaccaggac atcataggaa
   232921 gcattgccga atggcaagat ttatcaggac agtattggat tgggtccgaa gggaaggcaa
   232981 agttatgctt ttgtagaatt ctgaggtcga ggaccgtaat ggtccgagtc ggagggggtt
   233041 gggttgaatt atcaaagtaa gcgtatgcat tagcgccttt gacggcacgc tcactttttg
   233101 ttactaggta cttgctggac catttcaccg aaatgatggg tagtttccct cggcaaacaa
   233161 ctgctgtgcc aagtctgcgt cgctcctact catcaaccat ttcccttttc aatatgaatt
   233221 cgccagtccc aataacctca gcttcactca tatcccgctc tgccctgtcg tcgcttccta
   233281 tggatgaatc gatggatcca aaatcggcga tgcacatctc caaaaataat caaatgactc
   233341 ccttgcgtcg agctgttccc cttgcacaga cgccagaaca atttctgtcc ccacaaaaag
   233401 ctcaaggtag tttagaacct gttccctcta ctcctcggac tcccaactcc acagggcgaa
   233461 atgcgagctt ctcaagcaca tcaccccact caccctctgt gactctcccg tcaggtgttg
   233521 gaagcccatt tctggccttc caattcatgc gtaaagcagc cgatagcccc aatgcgcgag
   233581 agaaagaaaa agaaatgttt ggcgcgaagc gatcaagccc tattaaggaa aaatccaaaa
   233641 gaaacctaat ggtgtaatgg tcggacaact caagcaacaa ttttaggaga gaaaaaagat
   233701 cttcatagag cattttttcg tattcttgtc acgtcaatct gtctcattat gaacataagg
   233761 atcttgatac accttacaaa gtaaggccaa aaacaagtat tgtatactac attacattca
   233821 tgcttgcctg cttaggcatt gaactatgca aagctaaaaa cttgcgacga ttctgtacaa
   233881 caaacaaact gaagacaata cagcaaatca cgcaagtagc agtaggcttg cctctcatgc
   233941 acatatcaaa atccaatacc cccaatttgc gagcttaagc tcgtatcaat gatttctgat
   234001 tggttttcgg gactctcatc cacaatgttg tactttcttt tcttcgcttt cccagccttc
   234061 ttctctttga gagccgcaat gctatctctc aacctcctat ttgtcatctt catctgatga
   234121 agctcatact gccacgaaga gtctctccca gtctccagct cttcaaaaat attgtcgttg
   234181 ggtagatgga cgagggggcg ggcttgagtg agtgaagcga ttgagggggg ctggacggag
   234241 cgttgatgcg aaggggagga tgacagcaat ttgacctgga cgaaaatatc ggtaatcttg
   234301 accgggtagg tcgaagctcc gtttggtgtg ccaataaaat tgactgaagc cgattcgtca
   234361 ttatttgagt aagaaatggg cgattgcttg tctttagctt gccctggagc gtaaaagacc
   234421 agaatcacgt cgacaggctg gccagaacga tgtaccatct tttgccgaat agacaacgcg
   234481 ccccggtggg tactgtcatg tatggtttga tagattgcct tggcaacagg agcgatatcg
   234541 ggagctgaag catagttatt aatgagatgt tcgccagacg gaggggtatt ttggccacca
   234601 ggcaaaagag aaaataagtt tctacccaga atctcttcag cttggtagcc caagaccttg
   234661 tcaacgccaa aagtgagatt taggagtaaa ccttggaatg aaatcttggc ccagaactcc
   234721 gttttggcga gcccaccgtg ctctgctacc ttgccccagc tcaaagtggg catgttcctc
   234781 actctcccag aaaggatgac agccttccga cctttgccag cttccacgac aagccgtccc
   234841 atactttcca cccacacgta cccaaagttc ttcgtgcgga tgcgaaaggt gaaatgaaca
   234901 ggttttggtt gctgctcctc cccaatcgtt tgtgtggaat cttttagggc acggatgacg
   234961 ggcacgatat cagacggatg tgcgaattcg gagatgtttt tgttcaacag atcttcaggc
   235021 tcatacccta aagaacgtcg aatggaagat gaagcgtact gaaagaaacc cttgagtgat
   235081 aaggcatgta tgaagtctaa attgtgttag ccttgtacat tgacggcaac atgtgacaca
   235141 atacttacca tccgtattat ccagaatcat cttaaaccac tccattcgtg ccccctcttc
   235201 cgtacccgcc gcgagtgcct tcgtcctact gcccataatg tccagcacgg ctgtactcag
   235261 gcctgctatg gcagcacctt ttccatcaag ctgtagaggt ttttcaggtg ggatggaata
   235321 tgtgtagtcc actgaatagt tcccatcttg catattacgg aggattttgt ttggctgttc
   235381 aaccaagtca atttggaagc ccacatggta gacgatgtca ggaccgtccc acggtatagg
   235441 cacaacagtg acaaggttga tgaaaggttc gccattccgt cgataattga taagagaggt
   235501 ttgacattcc tttccagcct cgagagatcg tttgaggaga tagacagcct cattatccgt
   235561 atattcacgt ttggagcctt tggtcacttc tccatcggga ctttggagga atcggcagtt
   235621 acggccgaga agttggggaa gctcgtaacc agtcaacctg gtgaaattcg gactagcgta
   235681 gacaatggga gagtcatatc tccttatatc ctggagacta catcagcgtc aagtaattat
   235741 caaatgacgc aaatatctca ccaccactac gaaactacaa ctcaggtcga caggtccaat
   235801 caccatgctg ggattctttc tggctgctac tcttcccaat ataccaagca tatcaaagcc
   235861 ggtagtggaa tacaaacctg ggccatcttg taaagcttgt tgggcgggag atagtagtgg
   235921 gtgctgtaga agggctcggc catcggctga atgtacatac gaagtcgtag atgacaatgt
   235981 aaagttcatc tcacgacggt gtgggtttgg attagataca gaggcggcac tggagaagtc
   236041 aatttgatgg ggaagtcgat gatccgagat attttgatca taggaagggc gctgaggaag
   236101 gatagccgag gtggacatca tgttaggggc gtgcgtttga tcgtgagacg gacgggggga
   236161 tggcgcccga tgtgatgaag gcgatgtatg tggctgtaga tgagggttac caggcgagct
   236221 aaagtgatta ctggaaggtg ggccgggacc ataaatcggc cctgaaatgg ccgcatattg
   236281 gtgggggctg ttcatcgcaa tatctctgct tcccacctcc ccaccacctg actcgttttc
   236341 ctgct