GenomeNet

Database: RefSeq
Entry: NC_006681
LinkDB: NC_006681
Original site: NC_006681 
LOCUS       NC_006681             906719 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 12
            sequence.
ACCESSION   NC_006681
VERSION     NC_006681.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 906719)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 906719)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 906719)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 906719)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017352.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..906719
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="12"
                     /note="MAT-alpha"
     gene            complement(298..2931)
                     /locus_tag="CNL03660"
                     /db_xref="GeneID:3254804"
     mRNA            complement(join(298..848,910..985,1038..1108,1163..1679,
                     1731..2224,2289..2484,2531..2931))
                     /locus_tag="CNL03660"
                     /product="alpha-amylase AmyA, putative"
                     /transcript_id="XM_567929.2"
                     /db_xref="GeneID:3254804"
     CDS             complement(join(477..848,910..985,1038..1108,1163..1679,
                     1731..2224,2289..2484,2531..2625))
                     /locus_tag="CNL03660"
                     /codon_start=1
                     /product="alpha-amylase AmyA, putative"
                     /protein_id="XP_567929.1"
                     /db_xref="GeneID:3254804"
                     /translation="MPVLSKLISLLPLLAIAQGATSDEWRSRSIYQLITDRFAPPSDD
                     TTCPLGATNYCGGTWQTIISKLDYIQNMGFDAIWISPTALNIEGNTKYGEAYHGYWTA
                     DPTKLNPHFGQASDLKALSVAVHDRGMYLMVDIAINALAATSYSLDASALASDADGTL
                     LFKDPSDFHTRCDISWGNHTSEQVCWLVTGDDNGDVALLDLKTESDSVASVLKDWVGG
                     YVTEYGIDGFRIDASKHMSKEFQHDFCEAAGTFCMGEVAGDNTEYAGEYQSAGGIDSV
                     CGFGLMYGFVNVFTGGDKMSTLEYYINLAASSYPDPTVIGTFLDNQDLPRFNSLTSDA
                     SLVYNAIVGMFMYGGMPIVYYGLEQDISDGPTDPQNREALWNYNNYATDGVTFGRITN
                     LNNIRNRLGGVGELYNAVATVLAIQDQDIALQREEALIVLTNRGQSGTGTWAIKNTQF
                     GGSVSVIDLLSCSTSTTDSDGSLTVTWTSGQPFVFVASDVADKAGLCGSLSNSTNATT
                     VSSSSSASTSIDTATSSASISGNLAVITDGSSSPSFSATSSALSSSISWYTPTSAASS
                     VSSSELVVVVAAVSTASTAVTSSGSICRRSKKRAMSKRQL"
     gene            3128..6034
                     /locus_tag="CNL03670"
                     /db_xref="GeneID:3254792"
     mRNA            join(3128..3281,3340..3641,3710..3781,3852..4940,
                     5003..5083,5152..5162,5220..5291,5355..5489,5549..6034)
                     /locus_tag="CNL03670"
                     /product="expressed protein"
                     /transcript_id="XM_024658121.1"
                     /db_xref="GeneID:3254792"
     CDS             join(3254..3281,3340..3641,3710..3781,3852..4940,
                     5003..5083,5152..5162,5220..5291,5355..5385)
                     /locus_tag="CNL03670"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513803.1"
                     /db_xref="GeneID:3254792"
                     /translation="MTSTFRQPSLFDHFHRIPNPYAQKGLEYVTPGKELRKLKRKEQK
                     ERRIEQRRAHLKKRSQLLAERATIVAKRPVWHDIPDWGDRTDCPLFKLPPEILDLCFG
                     TELDNDLSLREYIALAAVSRYFRQQFTSEVFLAIFLHVTGDCRESLDKHAEHIFSTHV
                     EDWREEKPLPKISESIYIASMPHDQWTRAEYEYHTALQKFYRSRYMVMYLRGEIHRCP
                     SGGTNKWIGNVSYTHSNTMGDKSIYYSSTVPGLKDGETYDPKDPTCLHADVLDKSIYP
                     CCSDWSMDTEIDEDEPELNKWKTIVENYHVTYESDFWNRKAEEILRRRRRKRYRRKQS
                     SRPGEPAKRVDTKLDLSSSDDSGYDTDDLQKLVNDDELGNETEDGLDGYDGDNEDTAE
                     GKNDEINSEVPENQEKLELMMLRTLAIKARDSREAYEKRKEGEETKDEPESDDGWVVP
                     LPGDPEREALALKFLEYVLEPEPHDHWPSHVRRTIARNINSHAVAEDDAIEVYGVTKE
                     ELYGLKHYHGALWEKTDLVLYPRMAVEALTLRSHGGPLGHYRFIIDRHARKLR"
     gene            complement(5647..8486)
                     /locus_tag="CNL03680"
                     /db_xref="GeneID:3254973"
     mRNA            complement(join(5647..6006,6060..7582,7629..7940,
                     8000..8486))
                     /locus_tag="CNL03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_567931.2"
                     /db_xref="GeneID:3254973"
     CDS             complement(join(5889..6006,6060..7582,7629..7940,
                     8000..8371))
                     /locus_tag="CNL03680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567931.1"
                     /db_xref="GeneID:3254973"
                     /translation="MQASTPSPTTIQTPTLSFPDTPQMDETPKTAVLRTPRATFDGGE
                     VRIEGSVSGSERGSIDMGTANGERKDKGKERAVESAEDKDEEETGFDMEQLTRLQSRV
                     NELEANGKTGDEWVQRDELLGMVKTLLPLTLNHLPFLQERLAAQKSTIATMQQQAKIS
                     EQLMATERERHAVERDSWHKEMRAVMVSKEEEKVSNKRKVLDLDVGYHKELEAANKRL
                     EMDNRLMAPRLVDTQRQIDRLVNELRLLRPHVILNTSALTSKPTELTPATSAPPVFLP
                     QYMPQLENSKGIHRSSRATMGDARTEHLLLAAKAIRSMRKTNDRLGRLTMGELKKAGV
                     VGPEGGMGYKEGYGEQPMSDVEEDASEEEPLIDQRASGSVTKGKSKSQATPLLSRTKR
                     STKKNVQNASISTIPQTPSKSRTTGQSSLPQTTPGGSNFNDLLRAAEMATRPNSPVHG
                     EPILSTLSATRSTTRPRPDSSDIERGSPKRRRGDVWEGGGSHKAHQHSASAGSASALD
                     LLAQASQLDVASSTAPSSVVQSSPAVPLTSSTPQFGGLLEKDSSPRSHGSSLGAPIDL
                     TPRNRTMANVRLKAHPASDDFVVDPSLQTPTHRIRGSSTTSESLTPARGYASSQIYPT
                     PGGELDERLPPAGASSSAINPTSTPGVISEGGGGPGAGNGNFASPSGKVVPGLGKYWH
                     YTSEMPIKRVRSPYLKWTVEEDELLARAVAIHGEKWDLVSKGVPTRSYHQVRQRWLRK
                     TGAFDKKNQAAKAEREAKTESANEAKSSSTEREV"
     gene            complement(8648..11349)
                     /locus_tag="CNL03690"
                     /db_xref="GeneID:3254833"
     mRNA            complement(join(8648..9150,9206..9277,9328..9362,
                     9412..9474,9527..10459,10513..10584,10654..11349))
                     /locus_tag="CNL03690"
                     /product="expressed protein"
                     /transcript_id="XM_567932.2"
                     /db_xref="GeneID:3254833"
     CDS             complement(join(8748..9150,9206..9277,9328..9362,
                     9412..9474,9527..10459,10513..10584,10654..11010))
                     /locus_tag="CNL03690"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567932.1"
                     /db_xref="GeneID:3254833"
                     /translation="MQPKRTAETRNSTTKRARTVQSGKDETADPPVAVAEDIRSIDSR
                     LKGRAKGRKGKNKAEGTSDSPPPGPKKRVRKPFAAKEATWRDIPDWGDRTDVPLFRLP
                     AEVLDLCFGTKLNLGLQLRDYVALAGVSRYFRFHFTDDVFREIYLKSHPNYMKLRPCA
                     RRSPIKHSQLIFTRAVKDWRQDPPLKRFDHLEIHMRSIPPREEWTQKDYEFVIRADKI
                     IAQARQIWADARAERANIKKEKMKKRRVLRKVIVDGISRTVLATVPGLKHGETQGPKN
                     ELGVPIMTDENGKEIGLGASHAEEGNDGHDDDDDEESDDELNFYSTLQEWEWEESVHN
                     KDGELWQKIYKLEDKMRLLRRTYDNYDKGEDFSDLSSEDEADEGKEGDRSTRKKGKKK
                     QTKKFVRDPNWVLPPEEKPKRPHATLVEYDPLTGERLPHDAYPSPWRARAVEAANKKF
                     INRADAIRVFKVGEAELLCLKHYLVPNPLNPKTPSSIYSLAAIQALALRSHGGPIGHH
                     YHVESANERALKSLATRQANAAKRKADPTYVEKEPKSRQYPQTTVDPDDIGAKYGVDK
                     DCGIWHYQGTFIDFVADWREHRAAKAARKAQRVANGEGSETSDEDGSSQDELLPVPNV
                     PWNDVNEYMYSFTDEEDDLW"
     gene            complement(11591..14321)
                     /locus_tag="CNL03700"
                     /db_xref="GeneID:3254998"
     mRNA            complement(join(11591..11764,11829..11943,12005..12112,
                     12166..12529,12578..12644,12697..12814,12863..12916,
                     12968..13099,13152..13219,13283..13537,13588..13705,
                     13771..13798,13848..13978,14030..14122,14185..14321))
                     /locus_tag="CNL03700"
                     /product="glutamate decarboxylase, putative"
                     /transcript_id="XM_567933.1"
                     /db_xref="GeneID:3254998"
     CDS             complement(join(11732..11764,11829..11943,12005..12112,
                     12166..12529,12578..12644,12697..12814,12863..12916,
                     12968..13099,13152..13219,13283..13537,13588..13705,
                     13771..13798,13848..13978,14030..14112))
                     /locus_tag="CNL03700"
                     /codon_start=1
                     /product="glutamate decarboxylase, putative"
                     /protein_id="XP_567933.1"
                     /db_xref="GeneID:3254998"
                     /translation="MALSQHVDADKLIEECKDHPIKRHLSHKAALYDIPYTSRYEVED
                     EVPRYRLPSKGVNGRATYQLLHDELMLDGNPNMNLASFVHTWVPDECNRLVQENINKN
                     LVDQDEYPAAQQIHERCISMLSHLWHAPKEATAMGTATTGSSEAIMLGGLALKRRWQE
                     KMKAAGKDIHNPGPNIVMGAEAQVALEKFARYFEVEARLVPIKPESSYVMDPKDVLKY
                     VDENTIGVFVILGSTYTGAFESVKDVAQELDKYEAETGISVPIHVDAASGGFVAPFAY
                     PHYQWDFQIPRVHSINASGHKYGMSTVGVGWIIWRSMEYLPKELIFELHYLGATDYSF
                     NLNFSRPAHPILAQMFTFLNLGFEGYKRIMDKNLTVARLISRALEHSGYFICLSKIHH
                     PKALTESSSSAEQSNILPAVADAANTVLHGKKTTVDDAEYYCEGLPVVSFMFTDEIKK
                     KYPGVKQAWIQMQLRSIGWIVPNYPLAPDCEKTEILRVVVRESLSGDLARKLIHDILQ
                     VTEDLLNDAGPSYSMSTATRRHENLDHGKLDNIDAVHIKQHTSTYSKPC"
     gene            15266..16360
                     /locus_tag="CNL03710"
                     /db_xref="GeneID:3254827"
     mRNA            join(15266..15690,15743..15789,15842..16121,16176..16360)
                     /locus_tag="CNL03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_568202.2"
                     /db_xref="GeneID:3254827"
     CDS             join(15293..15690,15743..15789,15842..16121,16176..16287)
                     /locus_tag="CNL03710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568202.1"
                     /db_xref="GeneID:3254827"
                     /translation="MVVVFYNAPIDHAHSTLEGKVGLRMWFLTVNETSSSFPTWTIGT
                     KRYYDAGEGEVPGRGIGLAAPARNKERAADTGSGGDGGLHAYGFGIWGWCEWTNSRWT
                     GDAVCTRKTGYKLPDDSDSSWDSIYELELPYAVTHVLSGAAIPILITPFVVLSYFIIL
                     CLAILFPGPYPPWPVPSKYPAEVKHYRTRCAWLLRDWRFNLYYFLAMLVLGLSMIVTV
                     LVGRGKVNTEGGGLKARPGTGFGVFFAAWACWICSQMLCMWKTGIIMRREGKERTKYS
                     KG"
     gene            18802..24104
                     /locus_tag="CNL03740"
                     /db_xref="GeneID:3254847"
     mRNA            join(18802..19367,19438..20620,20683..22169,22219..22583,
                     22641..22733,22783..22790,22840..22963,23014..23301,
                     23363..23447,23497..23916,23970..24104)
                     /locus_tag="CNL03740"
                     /product="glucose-methanol-choline (GMC) oxidoreductase,
                     putative"
                     /transcript_id="XM_024658122.1"
                     /db_xref="GeneID:3254847"
     gene            complement(18819..20843)
                     /locus_tag="CNL03730"
                     /db_xref="GeneID:3254851"
     mRNA            complement(join(18819..19483,19546..20611,20663..20843))
                     /locus_tag="CNL03730"
                     /product="glucose-methanol-choline (GMC) oxidoreductase,
                     putative"
                     /transcript_id="XM_567934.1"
                     /db_xref="GeneID:3254851"
     CDS             complement(join(18929..19483,19546..20611,20663..20808))
                     /locus_tag="CNL03730"
                     /codon_start=1
                     /product="glucose-methanol-choline (GMC) oxidoreductase,
                     putative"
                     /protein_id="XP_567934.1"
                     /db_xref="GeneID:3254851"
                     /translation="MVHAATHPKDAPKNFDFIVLGGGAGGCTVAGRLAENPNVSVLLV
                     EAGVNNPSEITDITTPAKAMGLRNSQYDWKYKTTMIDRPDYTRIEKPNTRGKVLGGST
                     ALNYYTWVRGSAATFNDWEEFGGSTWNWENTKEYFNKSTTYHDDLGLFPDDIKSIGNK
                     GGPVDISHSDLVPELKPWRDALERAWVSKGHELTVDVYNGVQKGLFKCVNSIYKGVRS
                     TAAAFLEGKPNITLASSTISKKIIFEGKTAVGVTVIGPDDREYDFYANREVIVAQGVY
                     ESAKILMLSGIGIKSDLEALSIQCVVDSKHVGQNLQDHPILSHVFKIKDGFGLDNHLL
                     RAGAEHDGAISSYRKNHNGPLSSGLLELVAFPRIDNRLENHKQYRDYKAQNGGKDPFG
                     PDGQPHFEIDFVPMFADAFQWHFPTPPTGDYMTVIVDLMRPISQNGVVKLTSTDPFEQ
                     PYINLNFFSHDLDLIALREGVRFVDDILINGEGMKDIVEGDYPWPMPRNSDEGMIRQI
                     LERSQTGFHPCGTARISKDIDHGVVSPELSVHGVKNLRVADASVFPLIPDCRIQNVVY
                     MVGEKAADFIKAAHPDLYKEAK"
     CDS             join(22133..22169,22219..22583,22641..22733,22783..22790,
                     22840..22963,23014..23301,23363..23447,23497..23916,
                     23970..24046)
                     /locus_tag="CNL03740"
                     /codon_start=1
                     /product="glucose-methanol-choline (GMC) oxidoreductase,
                     putative"
                     /protein_id="XP_024513804.1"
                     /db_xref="GeneID:3254847"
                     /translation="MTEKTPTYTLSEGCPIADATTAQRLGSCPVKGLMLMQDTQLIET
                     LAHFSRERIPERTVHASAVGAWGEFEVTHDNSDITSAAFLNGIGKKSKVLMRISTVGP
                     EAGTAETVRDVRGWSMKIFTEEGNQDFVFNSIPVFFIRDPIKFPSVNRSHKRHPAKHT
                     ADSSMFWDFHNNNPEGTHAIMMYFSNRGLPYSLRQINSYSGHTYKLTKSDGSFVYVKL
                     HFKSNQGVKGMTQAEGVRTAGEAPDFHTTDMWDAIERGDYPTWTLYAQVMKPEEAENY
                     RWNIFDMTKVWPHKDFPLRPLGKLTLNRNPENYFSDIEQAAFSPSTMVPGVAPSGDPM
                     LQARMFAYPDAARYRLGVNYQQLPCNRPVSEVYAPYQRDGAMRYMTNYGGDPNYVRSS
                     LKEVNFKGQLGAKGHSTGGNEKHNEWVGRVAAYTSEVTDEDYVQARMFWEVLGKAGDQ
                     EDLITNVSCHLSKAIPSVQKGAVEIFAKVNVDLAKSIEDRLAELNKGK"
     gene            complement(24231..27156)
                     /locus_tag="CNL03750"
                     /db_xref="GeneID:3254846"
     mRNA            complement(join(24231..24525,24583..24744,24792..25313,
                     25367..26607,26664..26918,26979..27156))
                     /locus_tag="CNL03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658123.1"
                     /db_xref="GeneID:3254846"
     CDS             complement(join(24369..24525,24583..24744,24792..25313,
                     25367..26607,26664..26918,26979..27074))
                     /locus_tag="CNL03750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513805.1"
                     /db_xref="GeneID:3254846"
                     /translation="MSVPTQRFSDIRRSRPSYSCQVCRDRRVRCDQARPKCGNCVRNQ
                     AQCVYQSNLSQKRKDPITDDSANKMPRRNKSSGSERSPSPLETGKLKPGYLVLNSGGR
                     SRYTESTFWACVDAEGLELDRILRNLPLFPRTGGPDDLVTPPAFSSSPGAATSVPNPS
                     TGTSPDRISWGPVRLAKLLQPLPPKLVCDRLFRAFMDCIHPLIPLMHIPSFESAYDEF
                     WSWRLTRPAQNISLSILHRNPSFLPLLISVLSAGSITIHEPWSDRVGQKLRGLMPEAL
                     RVIGFPYYPSVYSLMAYILANSTLIREEDAFSSCSFVAVALRVAQSMGFHRDGTEFEL
                     DPISTEERRRVWWHLMHLDTMTSIAQGLPGIMSSSRCTTQVISEMKDELIGKIKSTDS
                     LDRELWVEPKYVLAAGRYEASTQLRTILERLQEAPNITLSDIAPLEMQIEDLRRRQSR
                     RLESVNLHAHSASLQEILDQLSVRVGGDDFTDHRPPPPTTASKAIQQWNQALLHLTTV
                     KAYCILYQPFMSDKVIWANLRSRALPHFQYFLALFLEMTTNPSYRPFHWLYPGSYQPL
                     QPCAVLLSDLSAHPHSSDKMLSMQLIDRVFSLLGPAGRLVSPGSYQSLPSLTGAKQVW
                     TVLEKLRAKVWHDLGYDHTLFWAEDEKGDDGLAHRGSMDFWLTGNLAGHSADRSDTAT
                     SSYPPPMPQNGEAIADSTTHPTSYAESGATSTSSIPLPVAALNEQDWQNDMDALSWIP
                     WGTSNDPPFQSIQNSLTTSNYMPESTDSGEAEIAPGQMIVPPGNETDLFGLYPPTESQ
                     LSSTRYQGQNFF"
     gene            complement(27566..29217)
                     /locus_tag="CNL03760"
                     /db_xref="GeneID:3255035"
     mRNA            complement(join(27566..28144,28194..28381,28430..28869,
                     28922..28986,29045..29217))
                     /locus_tag="CNL03760"
                     /product="UDP-galactose transporter, putative"
                     /transcript_id="XM_567937.2"
                     /db_xref="GeneID:3255035"
     CDS             complement(join(27613..28144,28194..28381,28430..28869,
                     28922..28986,29045..29058))
                     /locus_tag="CNL03760"
                     /codon_start=1
                     /product="UDP-galactose transporter, putative"
                     /protein_id="XP_567937.1"
                     /db_xref="GeneID:3255035"
                     /translation="MGVLRLAVCISGVYAAFLLWAIAQERLSKPFPSVHPHPHQQPHS
                     PSDPPPGDKFPSPLFLNFAQALASSLSALCYLSFKAWRDGWKGRGLGQLLGLKEVFGK
                     SQTALNGDAKANKKESELNEKTKEVVEKAPKPPKKSLLALLVQVSVFQTIASPIGFLA
                     LRHISYPTMVLGKSCKLIPVLLLNVLLYRRKFSPHKYIVVALVTVGISMFMLFAETSK
                     KKKGGSDSMWGLVLLLVNLLIDGLTNSTQDQIFSSYPSYTGQQMMFTMALTTQIILLP
                     LLVLPLPTNPISLLAHLPPPFGSSVPTSTLSFSPPAALESISFLLSHPSALAPLFAYA
                     LLGGLGQLFIFETIQHFGSLTLVMVTVTRKLFTMLLSVVVFEHRLTKGQWLGVGVVFA
                     GIGVEAGMKRKDVMKKAKKD"
     gene            complement(30381..33048)
                     /locus_tag="CNL03770"
                     /db_xref="GeneID:3254788"
     mRNA            complement(join(30381..31983,32041..32254,32327..32737,
                     32792..33048))
                     /locus_tag="CNL03770"
                     /product="expressed protein"
                     /transcript_id="XM_024658124.1"
                     /db_xref="GeneID:3254788"
     CDS             complement(join(30497..31983,32041..32254,32327..32737,
                     32792..32995))
                     /locus_tag="CNL03770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513806.1"
                     /db_xref="GeneID:3254788"
                     /translation="MADKEELQERTKVARQEYREYLPLAQQLQGDLRDDAEQLRVQEG
                     WDEDTWNGVEEWVDDVGSIWRALRRNRYDQNKTHSFLLSVLSTRLSLSLHGPIPSILP
                     YSDSPLFHILPLPSHTDKLNRPIVVLTAREIVRDEQGMLDDVKEWIWWALEMCRRTSK
                     DWWSKGMWDGSGVDGYGRGKGKARGEGGEGIVLLVDAAGAGYRNLEVDLLPTLLSVGH
                     NSFPGLLEAVYVINVGWTGRSMWAVVKHLLPKSALERVAFLDTKESLAEVFELDKIPQ
                     AYGGDSPYTFSPSNNPIYAYYSRHSSHSFIASISRSTSCTSIADVYYTARNTPFPSRR
                     TSPLISRQNSASSGMMKAMFRAGYGNDLRMTKSRDERSRKVEGDDDGDEEDEMTRVIS
                     ASDVAAVGPMTGLITQSLTEPEDPQPILSRASSTLTSRSKPPTRAPSSAAVSRIKSLS
                     DFHLYLSPSRLARIDLLSDSSDSEDEPPPPPSIPSLPRRKVLRPALLEKSLAGTPDER
                     EKRTNRPALRLMGLPGHLADDDPVRSYSGRLQMHHAKWLEGWKGTPEELGLEDNHKLG
                     GVKHEEEENAPIPRTISVSPPIDRPPSPSGTLEPSPSPSPIHSPAMTPQPHDIQPYST
                     SNPFFGYPVVQFGSSIRPRYPRNRKRDLVKTLLFLFMLKLQSWRDSVERALGLNRLRI
                     PSLSQPYCSSSLYTPGPNRRNPAEGLVRSAATPGTYSKQVAKYRRWDKDWWWMIIGML
                     LLRGTWGRIVLAPLEALGLGLSEWKAIWGAV"
     gene            33242..35175
                     /locus_tag="CNL03780"
                     /db_xref="GeneID:3254992"
     mRNA            join(33242..33364,33481..33524,33599..33674,33733..33861,
                     33991..34076,34134..34288,34348..34627,34686..34796,
                     34849..34939,34990..35175)
                     /locus_tag="CNL03780"
                     /product="chaperone regulator, putative"
                     /transcript_id="XM_567939.2"
                     /db_xref="GeneID:3254992"
     CDS             join(33280..33364,33481..33524,33599..33674,33733..33861,
                     33991..34076,34134..34288,34348..34627,34686..34796,
                     34849..34939,34990..35042)
                     /locus_tag="CNL03780"
                     /codon_start=1
                     /product="chaperone regulator, putative"
                     /protein_id="XP_567939.1"
                     /db_xref="GeneID:3254992"
                     /translation="MLPTTLFFLLTLALLGGCLAESLYNVLGVRKDASDADIKKAYRK
                     LSKKYHPDINPDEAAHEKFIQVSKAYEVLSNSETRTIYDRHGEQGLKQHEAQKSGGSQ
                     DPFARFFGGGAAQEQKGPGLITNVEVSLADLYTGRTLEFQIPRRVICPHCHGSGAESE
                     KDIHSCNKCGGQGVVVQRHQVFPGMFTNVQMTCPHCNGKGKQITRSCHVCHSEKTVQT
                     QHTLALHIPAGAPEGFEEVFHGEADEQIDMEAGDVVVRVRSKLNEGEGAWRRKENGIL
                     GRVTLSVAEALLGFERRLTHLDGRTITLSRTGTTQPGEVEVIEGEGMPSYMDIPPGDM
                     FIEYSVVFPTAVSSETRQKLSDILKYAPPVHHDEL"
     gene            35366..36740
                     /locus_tag="CNL03790"
                     /db_xref="GeneID:3254840"
     mRNA            join(35366..35449,35869..36328,36385..36497,36546..36740)
                     /locus_tag="CNL03790"
                     /product="expressed protein"
                     /transcript_id="XM_024658125.1"
                     /db_xref="GeneID:3254840"
     CDS             join(35435..35449,35869..36328,36385..36497,36546..36554)
                     /locus_tag="CNL03790"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513901.1"
                     /db_xref="GeneID:3254840"
                     /translation="MTRTERNQYPAAVLKDRHSRTGLDKTQWNHKNGDGAHNWGSTAR
                     KGDDEASGRLDGEAEAEAALDELPSSDVFDLDEEINDPVGAMPVTDSGNDFKPMDLGK
                     RGSIQGQSNIATSPTDSMSSLDSGDRPGMGRRMSAVSDEEREKMRLYREGVLHKKQGV
                     DLAHIARSSHGIAMSPPTNSYLGPVSPSNTRYGFNFNK"
     gene            38503..42135
                     /locus_tag="CNL03800"
                     /db_xref="GeneID:3254845"
     mRNA            join(38503..38604,38782..38923,38982..39105,39168..39253,
                     39303..39456,39502..40376,40429..40499,40555..40650,
                     40699..42135)
                     /locus_tag="CNL03800"
                     /product="telomere maintenance protein, putative"
                     /transcript_id="XM_567940.2"
                     /db_xref="GeneID:3254845"
     mRNA            join(38503..38604,38782..38923,38982..39003,39064..39105,
                     39168..39253,39303..39456,39502..40376,40429..40499,
                     40555..40650,40699..42135)
                     /locus_tag="CNL03800"
                     /product="telomere maintenance protein, putative"
                     /transcript_id="XM_567941.2"
                     /db_xref="GeneID:3254845"
     CDS             join(38822..38923,38982..39105,39168..39253,39303..39456,
                     39502..40376,40429..40499,40555..40650,40699..41827)
                     /locus_tag="CNL03800"
                     /codon_start=1
                     /product="telomere maintenance protein, putative"
                     /protein_id="XP_567940.2"
                     /db_xref="GeneID:3254845"
                     /translation="MSSLFEAAAAFEEAAAHGANPVILERSGKGHSPVVTMTDMSGAS
                     SRAPTSAEIDAVIAAAIANAPPPPPSDFNSDINRSVTPLMTNLLPSAVGSDGRVNLFV
                     GNLPYRVRWQDLKDLFRKAGTVLRADVSLGPDNRSRGYGTVLMGSREDAARAIDRYNG
                     YTWQTRTLEVRPDRLPPEYEPQSHPIHHNANPRSAMYSFHNFPGPSHTPFSIPGHITP
                     QSGQGWLPGQIPSSRPFSAAGGLIPGGMGVPSSSSAVGLTSSTPIPGAQSPPSVFGAQ
                     PLPLSVQNTGLNAFHSLGQSPLAGSLTSGTGAAMPAGVSAVRRDSLTPFGASLTTFDS
                     AAAPLSSTSPNMAVSRPTSSSGSVKPPSPGGSRAPPPGTLGPLPPSLFAGIKPAPAVD
                     AIAPTIAGDVPAQSPNGGAGRLAAAPIPQLEGLANQGMGLGPPSTLHDRVIFVSNLPL
                     SMQWQDLKDMLRPAGTIIRADVATDAHGKPRGFGTALFATEADATRAVLLFNDREIGG
                     FRIRAHLERDIHPEVSQRSARNSVSGEATSLGIQDHLTGVPEGVKDMLQSNGITPIDT
                     SVPSTKPSSTSPIAKLPWSLNTSLQTHTAPGHGQPPHGEPSPTSHTPVFRHPHHPGPI
                     SMPPFHMEHGNPISPLHTRGLPPMTPSMPGFVFNYPETPPLHGHASHFMSPAAGPFSP
                     GIPVTSPGAFQYNPFLNPAPGAPVNRFPSTPGNHPQAGSAALGTPTTQAFPNGPIGYG
                     QYAGPPGGALQGKSENSPQARQGQDYFANAIPPQHATSTAGNRTLGVGALGGKDKLRS
                     SPLSGGDGQNDSDEETRAPSAVGDELAKMAEELTVDDENEDGEPGRQSSSGLSLSGLG
                     SSAAVSPRGGRASMDDGKLGRH"
     CDS             join(38822..38923,38982..39003,39064..39105,39168..39253,
                     39303..39456,39502..40376,40429..40499,40555..40650,
                     40699..41827)
                     /locus_tag="CNL03800"
                     /codon_start=1
                     /product="telomere maintenance protein, putative"
                     /protein_id="XP_567941.2"
                     /db_xref="GeneID:3254845"
                     /translation="MSSLFEAAAAFEEAAAHGANPVILERSGKGHSPVVTMTDMSANA
                     PPPPPSDFNSDINRSVTPLMTNLLPSAVGSDGRVNLFVGNLPYRVRWQDLKDLFRKAG
                     TVLRADVSLGPDNRSRGYGTVLMGSREDAARAIDRYNGYTWQTRTLEVRPDRLPPEYE
                     PQSHPIHHNANPRSAMYSFHNFPGPSHTPFSIPGHITPQSGQGWLPGQIPSSRPFSAA
                     GGLIPGGMGVPSSSSAVGLTSSTPIPGAQSPPSVFGAQPLPLSVQNTGLNAFHSLGQS
                     PLAGSLTSGTGAAMPAGVSAVRRDSLTPFGASLTTFDSAAAPLSSTSPNMAVSRPTSS
                     SGSVKPPSPGGSRAPPPGTLGPLPPSLFAGIKPAPAVDAIAPTIAGDVPAQSPNGGAG
                     RLAAAPIPQLEGLANQGMGLGPPSTLHDRVIFVSNLPLSMQWQDLKDMLRPAGTIIRA
                     DVATDAHGKPRGFGTALFATEADATRAVLLFNDREIGGFRIRAHLERDIHPEVSQRSA
                     RNSVSGEATSLGIQDHLTGVPEGVKDMLQSNGITPIDTSVPSTKPSSTSPIAKLPWSL
                     NTSLQTHTAPGHGQPPHGEPSPTSHTPVFRHPHHPGPISMPPFHMEHGNPISPLHTRG
                     LPPMTPSMPGFVFNYPETPPLHGHASHFMSPAAGPFSPGIPVTSPGAFQYNPFLNPAP
                     GAPVNRFPSTPGNHPQAGSAALGTPTTQAFPNGPIGYGQYAGPPGGALQGKSENSPQA
                     RQGQDYFANAIPPQHATSTAGNRTLGVGALGGKDKLRSSPLSGGDGQNDSDEETRAPS
                     AVGDELAKMAEELTVDDENEDGEPGRQSSSGLSLSGLGSSAAVSPRGGRASMDDGKLG
                     RH"
     gene            complement(42118..43550)
                     /locus_tag="CNL03810"
                     /db_xref="GeneID:3254798"
     mRNA            complement(join(42118..42369,42421..42651,42705..43184,
                     43253..43293,43348..43550))
                     /locus_tag="CNL03810"
                     /product="FMN adenylyltransferase, putative"
                     /transcript_id="XM_024658126.1"
                     /db_xref="GeneID:3254798"
     CDS             complement(join(42332..42369,42421..42651,42705..43184,
                     43253..43293,43348..43466))
                     /locus_tag="CNL03810"
                     /codon_start=1
                     /product="FMN adenylyltransferase, putative"
                     /protein_id="XP_024513903.1"
                     /db_xref="GeneID:3254798"
                     /translation="MANISQSLHALLERAQKQDSLGKLIIEALVLIESVIDILGEETV
                     AISFNGGKDCTVLLHLYAAVLYARHTPSLPPHLFPKPSPKITIPPLPSRTPQEPLSPQ
                     PVLPPSLPACTPPSITPPASNPSPPFSHPRSTHHHPPTDLPYPPIRSIYITAPNPFAE
                     LDEFVLSSTKLYGLDLYRFGGGMKAALEEWLGCGGGRGVKGVLVGTRQGDPNDAVDII
                     APTDPSWPQFIRVHPILHWTYSDVWDFLLELQVPYCILYDQGYTSLGSTTNTLPNPLL
                     KSESVEGGWEPAHRLKDASQERAGRH"
     gene            complement(43907..45632)
                     /locus_tag="CNL03820"
                     /db_xref="GeneID:3255032"
     mRNA            complement(join(43907..44271,44346..44465,44519..44550,
                     44609..44639,44704..44817,44875..44899,44952..45015,
                     45069..45080,45146..45189,45242..45279,45351..45632))
                     /locus_tag="CNL03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658127.1"
                     /db_xref="GeneID:3255032"
     CDS             complement(join(43988..44271,44346..44465,44519..44550,
                     44609..44639,44704..44817,44875..44899,44952..45015,
                     45069..45080,45146..45189,45242..45279,45351..45603))
                     /locus_tag="CNL03820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513920.1"
                     /db_xref="GeneID:3255032"
                     /translation="MRNKEILTSNSLVVTYVDNATAFKDGLAFWTSDGIPGIQVDHWS
                     DTAVGANRNSVRITTKSLFEGGLFIIDLALMPWGCGVWPAFWTLGYEGTWPETGEIDI
                     IEGIQSNTNNQMTIHTMPGCSINYSTSNLYSGTLTNQDCDSSTGGSGCSIISASNSSY
                     GMPFNSAGGGVFAMKWDTDGIRMWNWNRAQIPSDITAETPDPDAWDLPTAIWDASICD
                     LESFFKAQVLVLNINLCGDWINSVWDQYPYCPGTCPEYVSNPLNLNNTVMLINYIKVY
                     QQSDAEVTTQQAETNSNLTGAGGPVGVINGATIRRPWWRTAREKMLGMVSVVPVGLLF
                     AGWI"
     gene            complement(46632..49705)
                     /locus_tag="CNL03830"
                     /db_xref="GeneID:3254741"
     mRNA            complement(join(46632..47225,47281..47459,47514..47690,
                     47743..47934,47984..48363,48431..48761,48879..49124,
                     49178..49282,49357..49493,49549..49705))
                     /locus_tag="CNL03830"
                     /product="clathrin binding protein, putative"
                     /transcript_id="XM_567943.2"
                     /db_xref="GeneID:3254741"
     mRNA            complement(join(46764..47225,47281..47459,47514..47690,
                     47743..47934,47984..48363,48431..48830,48879..49124,
                     49178..49282,49357..49493,49549..49705))
                     /locus_tag="CNL03830"
                     /product="clathrin binding protein, putative"
                     /transcript_id="XM_567942.1"
                     /db_xref="GeneID:3254741"
     CDS             complement(join(46799..47225,47281..47459,47514..47690,
                     47743..47934,47984..48363,48431..48761,48879..49124,
                     49178..49282,49357..49493,49549..49573))
                     /locus_tag="CNL03830"
                     /codon_start=1
                     /product="clathrin binding protein, putative"
                     /protein_id="XP_567943.1"
                     /db_xref="GeneID:3254741"
                     /translation="MAMAPPRKGENWELRQQLNSEYRDKRADAIKRVIANHTIGKDCS
                     GLFPDVVKNMQTDDLEQKKLVYLYLMNYAKTQPELVILAVNTFVKDTADPNPLVRALA
                     IRTMSILRAEKILDYLASPLSRCLKDENPYVRKTAALCVAKVFDLKPELAIEYGFIET
                     LRDLIGDGNPMPGSPNDDESPSSVRPNQSLFIIDPATLTKLLVALNECSEWGRIAILT
                     TLARYRTNDEKESEHICERVMPQFQHVNAAVVLGAVKVIMIHMKNVTKEDLLKSLTRK
                     MAPPLVTLISSPPEVQWVALRNINLLLQKRPDILASEMRVFFCKYNDPSYVKVEKLEI
                     MVRLANEKNVDTLLGELKEYASEVDVDFVRKAVRAVGQVAIKIDEAAGRCVEVLMELI
                     ETRVSYVVQEAVIVVKDIFRKYPHSYEGIIPALCANLEELDEPEAKASLIWLIGEYAE
                     KIENADELLGAFLETFSEESYPVQLQTLTAIVKLFLKKPDESQAIVQKVLQAATKDCD
                     SPDVRDRAYIYWRLLSSDPAAAKSVVLSVRPPISLPQTTVAPAILEELIGEISTLASV
                     YHKPAATFIGKGRLGADEMHKKSLDAEDDVSREKALQAVVAGNQAENLLDFDDEPTPT
                     NGESSIPAPGAGLGISSQAIASAAKSTNPLDELMDLFSTASMTTPVVQPGQPAAQAQT
                     SAQSSGGLGGLNGLAGLSSPPQSVSPQPGAPQSQKQQQQAAAQDDLLGLF"
     CDS             complement(join(46799..47225,47281..47459,47514..47690,
                     47743..47934,47984..48363,48431..48830,48879..49124,
                     49178..49282,49357..49493,49549..49573))
                     /locus_tag="CNL03830"
                     /codon_start=1
                     /product="clathrin binding protein, putative"
                     /protein_id="XP_567942.1"
                     /db_xref="GeneID:3254741"
                     /translation="MAMAPPRKGENWELRQQLNSEYRDKRADAIKRVIANHTIGKDCS
                     GLFPDVVKNMQTDDLEQKKLVYLYLMNYAKTQPELVILAVNTFVKDTADPNPLVRALA
                     IRTMSILRAEKILDYLASPLSRCLKDENPYVRKTAALCVAKVFDLKPELAIEYGFIET
                     LRDLIGDGNPMVVANAVAALGDIHEASLNLPSSQPGSPNDDESPSSVRPNQSLFIIDP
                     ATLTKLLVALNECSEWGRIAILTTLARYRTNDEKESEHICERVMPQFQHVNAAVVLGA
                     VKVIMIHMKNVTKEDLLKSLTRKMAPPLVTLISSPPEVQWVALRNINLLLQKRPDILA
                     SEMRVFFCKYNDPSYVKVEKLEIMVRLANEKNVDTLLGELKEYASEVDVDFVRKAVRA
                     VGQVAIKIDEAAGRCVEVLMELIETRVSYVVQEAVIVVKDIFRKYPHSYEGIIPALCA
                     NLEELDEPEAKASLIWLIGEYAEKIENADELLGAFLETFSEESYPVQLQTLTAIVKLF
                     LKKPDESQAIVQKVLQAATKDCDSPDVRDRAYIYWRLLSSDPAAAKSVVLSVRPPISL
                     PQTTVAPAILEELIGEISTLASVYHKPAATFIGKGRLGADEMHKKSLDAEDDVSREKA
                     LQAVVAGNQAENLLDFDDEPTPTNGESSIPAPGAGLGISSQAIASAAKSTNPLDELMD
                     LFSTASMTTPVVQPGQPAAQAQTSAQSSGGLGGLNGLAGLSSPPQSVSPQPGAPQSQK
                     QQQQAAAQDDLLGLF"
     gene            complement(49891..51502)
                     /locus_tag="CNL03840"
                     /db_xref="GeneID:3254910"
     mRNA            complement(join(49891..50369,50422..50611,50666..50760,
                     50811..50908,50960..51120,51200..51502))
                     /locus_tag="CNL03840"
                     /product="1-acylglycerol-3-phosphate O-acyltransferase,
                     putative"
                     /transcript_id="XM_567944.1"
                     /db_xref="GeneID:3254910"
     CDS             complement(join(49993..50369,50422..50611,50666..50760,
                     50811..50908,50960..51120,51200..51388))
                     /locus_tag="CNL03840"
                     /codon_start=1
                     /product="1-acylglycerol-3-phosphate O-acyltransferase,
                     putative"
                     /protein_id="XP_567944.1"
                     /db_xref="GeneID:3254910"
                     /translation="MGISWLLKPVALVSTVALSTLGVLSRRYQRARFYFNLTIYVSTL
                     GLMSVWGVVVSILATAAGQRLNINYYVARSLYGLSGPLLGIKFEVEGEEHLEGLMTAR
                     DGQHQGAVLLSNHQSFLDILYIGRIFPKQAAIMAKKELKWTPLLGQFMSLSGAVFVNR
                     KNRHDAVKALAIAGEDMKKKGVSLWIFPEGTRSSSPEPTLLPFKKGAFHLAVQAQIPI
                     VPIVCENYHRLFDGRTRFESGVLKIRVLPPIPTTGLTVDDVTSLAESTRESMLHALRE
                     ISEPGPSSSTPIPTSAEVPLAPPISRNTTQPPAGDSIQLDISESGALRQRGVHSSGVS
                     SEWSEGKFEAQSEETTEDEMDEDVVLLKKPKENVA"
     gene            51644..52491
                     /locus_tag="CNL03850"
                     /db_xref="GeneID:3254775"
     mRNA            join(51644..51706,51755..51842,51904..51981,52032..52078,
                     52134..52180,52233..52317,52369..52491)
                     /locus_tag="CNL03850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568204.1"
                     /db_xref="GeneID:3254775"
     CDS             join(51704..51706,51755..51842,51904..51981,52032..52078,
                     52134..52180,52233..52317,52369..52440)
                     /locus_tag="CNL03850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568204.1"
                     /db_xref="GeneID:3254775"
                     /translation="MSRTVDIPQDVLDALKQFRFKNSKGTTAISVKIIKNSLTMAVDE
                     EFEGQSIEEIAEELPENAPRYVLLSHELKHKDGRISYPLLLINWAPTTSPIELMTLHA
                     SSLSYFQQVSETAKVLEARDGAEGLTTEAVDEKLLSH"
     gene            54649..57012
                     /locus_tag="CNL03860"
                     /db_xref="GeneID:3254849"
     mRNA            join(54649..55062,55107..55964,56020..57012)
                     /locus_tag="CNL03860"
                     /product="expressed protein"
                     /transcript_id="XM_024658128.1"
                     /db_xref="GeneID:3254849"
     CDS             join(54753..55062,55107..55964,56020..56924)
                     /locus_tag="CNL03860"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513807.1"
                     /db_xref="GeneID:3254849"
                     /translation="MPTRLSQRSALAPTRILEPKRHSSDQSFGGIKLQIRQRVPQLSI
                     SKDKFRNESLRTKTLDQQEKEDGEFYYQQEDAGMPSEAYVCEKNIAKKPSRPFVSKGS
                     HQLKVIASLPSISTSPSAFSFPEQPLRESISKSIDLWFDDFKTDSFISTSTIDNPPPT
                     PPPKITIESDEQPTPKATQVAFNIATAVREAPSINSFTANGSFLGLPEEADMLYRSNI
                     VWGDLDHSEDQQTSHKKLAAAQHLSPASAGSQKHIKAADLRFEDAESEASRARNEGSC
                     DLNDNTEKSEPLDKPLPHLPDDSGPSEYSMTTYSQSSAIISKTAESPEVLHSLNSQPL
                     PQWKSSTPRRLRHHTVSTKSYEHCDEPEQGEEEQGAAVRNQTRHSSSGWEPPRQDAQV
                     KPESTRARHGKAGSVSSTATAKTIGQSHYPAGSTLTRNHIRAVAPQETSRLVIDHSIA
                     PAKPIMDTVTNRINSAKGSKSTRGSFELNDHAVVRASTAENQTIHSLVEDDDVEIIGD
                     FTFASSRRPSVSSSVKTMGTVSFASATAARAPRISLRSPHDRNTSSQDSPAQHPVRAR
                     SQSEDPVPRCIFGISAIFSQSKPGPNRKGHRSILDPFSSFDPHVPIVPCKTVPNDNWI
                     LITNTAEDDILRPGWKDVEMRWVEGESFGGWMMRRIRGECWNTVVAREKRADEQLRMM
                     ELRDGKGG"
     gene            complement(57528..60292)
                     /locus_tag="CNL03870"
                     /db_xref="GeneID:3254824"
     mRNA            complement(join(57528..58314,58374..58522,58575..58766,
                     58815..59421,59475..60009,60058..60292))
                     /locus_tag="CNL03870"
                     /product="xylulokinase, putative"
                     /transcript_id="XM_024658129.1"
                     /db_xref="GeneID:3254824"
     CDS             complement(join(57658..58314,58374..58522,58575..58766,
                     58815..59421,59475..59750))
                     /locus_tag="CNL03870"
                     /codon_start=1
                     /product="xylulokinase, putative"
                     /protein_id="XP_024513808.1"
                     /db_xref="GeneID:3254824"
                     /translation="MTSPLFLGLDASTQSLKASLLSVNLDVVAECAIHFDSDLPQFGT
                     KGGVHFGSDGQVHSPVMMLVGAMDLLFDKIKIAGWKVDDIRGVAAAGQQHASVYWSKT
                     SPKILASLNSSLPLSSQLVEAFSRPIIPNWQDSSTTAECQALDAAVGGPAALAQLTGS
                     RAYERFTGAQIMRFKRVDPVAYDQTDRIGLVSNSVTTLLCLDGEVKGIDESDACGMNL
                     WTMNRKQRGWNQELLKAIAGDDGAAELSRKLGTVETDGGRVVGRIGKWFVDRYGFSSE
                     CCVFPGTGDNPATFLSLTLRESEGLVSLGTSDVVLISTSAYHPDPDYHAFFHPAQIAP
                     PSEQDDQNRQGAEPLRYFNMIVYKNGSLTRQHVRDLYFDGSWDKFNAAIEELRPKSVI
                     DLPSRTAFWWLLPDIVPHGAHGIYKYITEPTAGTLFEVPAAKKVDQFPDIRQEALALL
                     ESQLFNYRSRASVILDDSSTPYDPSSPNVDAFLPRLTKVYATGGASANRTILSLMADV
                     LSTKVCKNVEYLDGKWKDADWNACSVGVAYKARWGWERVIAADGDERKWVGFDTVIRE
                     CREARKKIRGDEGRGLELEEEGIRIVASPGPGSRAYERRIEWWRELERKALAEQRAEK
                     TA"
     gene            60577..64944
                     /locus_tag="CNL03880"
                     /db_xref="GeneID:3254894"
     mRNA            join(60577..60918,60972..61918,61967..62099,62152..62455,
                     62503..62874,62932..63010,63066..63309,63360..63407,
                     63456..63943,63998..64409,64462..64944)
                     /locus_tag="CNL03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658130.1"
                     /db_xref="GeneID:3254894"
     CDS             join(60698..60918,60972..61918,61967..62099,62152..62455,
                     62503..62874,62932..63010,63066..63309,63360..63407,
                     63456..63943,63998..64409,64462..64813)
                     /locus_tag="CNL03880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513809.1"
                     /db_xref="GeneID:3254894"
                     /translation="MASAPIASASEQPLTSTNPQLGPEPYFTYPTPTPDQLEEELPPY
                     FENENVSLGLVLDRFARKGNHDLRVLLGEVLPQLSIRERPKPIIEYAKTTRQALLKYL
                     AVLRWKTSVDIASTSTGSSVANTAGPASFPTPHSNNDPNDNSPDAFAGKGKSKTQADE
                     SVIKGKVTDAKRIAHFMEHQNQQHEVAIEHVKHVTKVVEGLRERNPDLLTALSLLATG
                     TYNRLPASLVDPYLPKPVLTNSAILKVLRRLNRQIRYRLRCLDYLPPELIVEDIKDGR
                     MYARGDGWRAELTVVGFEDTSRWWLTGVEWGWKAKEKGVDDPGGRVTKKFTGEERQGI
                     LDIANGEVLPPRELPENEMEVDTVITEDPQVKKSEVVEVVKKTVDAPLVRVYNLLQHL
                     SLSYRLEVLFTQAIALSQGKWRGQLIPEMDREDKTLRLKYWLRERPMQVQRQDSTSIK
                     RPQAPATLPASRQTMVGGIIHITLAEKTTPRSELDNLLSDIACGGLVPSERVLRLELN
                     VKWVVDEAGVGGGLKSGDVMDNSMLHLDPDALSVEDLLHVCTRTHASHLTRSHGTSLL
                     TSPRFLNASSVQPSLQESTDPSARPLTLRVPLPSRYAVSHLLIGVSSFSGLLEVEDEG
                     AKGNDARAERAAMSMKSVNEGKTKLVDDITRLTTAIVVENIEAQMRQLGWKPTRQIAL
                     RLKDLIKADLHPVTTVFVPLASSPNHYFVTKAVQNGIVFELLKVAKVPNENGLGMKYM
                     VGDRTMMDLGKLKARRKSGDDKLQRSAFEVQNKDLKDLFILSNALVAQTIVEQQLKDR
                     SIPYIQQFPPTAGPASPKSTSPLAGMVPTICVDVRDLLRAGRGGGSAAMEVAMPKVWL
                     QIEGWWEGGKCEVVTIVVLRHQPSTVAPGTVSQEGEDEKDRGESAKAEGISFDPKSSI
                     VRFRAKDISRCVPAFLEQWERLSKVIVVAGEVSRLNKTESFKDVKILSFDLRTATLQY
                     APGHNASITYSPTDDSYRITFFLSSPSSDTDRNPHELVAPLLSARLNELTSTGIAGEN
                     KPKGQVGREFMGLLKNTLPVLKIGKILETKMGWGVVVLGVAKYRLIKDHNGKRFSVDV
                     TLLPDLEHYLIQDGATPRGPDHVVDVYTGPLTSLEMDKVVHAVFDAEKSVSLAETGDE
                     KGQGKKRHVPPVMKLDQGKSLVCEVARFERVLRKVMEEASKVMGLGNNMEMDS"
     gene            complement(64928..65713)
                     /locus_tag="CNL03890"
                     /db_xref="GeneID:3254791"
     mRNA            complement(join(64928..65036,65104..65187,65243..65314,
                     65431..65557,65662..65713))
                     /locus_tag="CNL03890"
                     /product="U6 snRNA binding protein, putative"
                     /transcript_id="XM_024658131.1"
                     /db_xref="GeneID:3254791"
     CDS             complement(join(65011..65036,65104..65187,65243..65314,
                     65431..65557,65662..65673))
                     /locus_tag="CNL03890"
                     /codon_start=1
                     /product="U6 snRNA binding protein, putative"
                     /protein_id="XP_024513902.1"
                     /db_xref="GeneID:3254791"
                     /translation="MSSRGGRGGARGGGNQGGERKKRESILNLAQFVDKSIRVKFMGG
                     REATGILKGYDQLMNLVMDDVVEEYEDGRPTRSLGLVVLRGPNIVLVSPTDGSSEIEN
                     PFQQ"
     gene            65834..67935
                     /locus_tag="CNL03900"
                     /db_xref="GeneID:3255039"
     mRNA            join(65834..65927,65972..66038,66086..66199,66248..67351,
                     67400..67935)
                     /locus_tag="CNL03900"
                     /product="expressed protein"
                     /transcript_id="XM_567948.2"
                     /db_xref="GeneID:3255039"
     CDS             join(65894..65927,65972..66038,66086..66199,66248..67351,
                     67400..67883)
                     /locus_tag="CNL03900"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567948.1"
                     /db_xref="GeneID:3255039"
                     /translation="MSTDQVDVSFKVLSLLSKERAVYGLRNGDHERYRRHCSNKVHRL
                     RQVTGTTCGKKTYKAPSKIEVESVKDVRQLQLLLFLAERALAHSHELKKNKNHSKKDQ
                     LSWLRQAFKVSTQLYFLVQSLSASSSDLPGRVDAKTLGEITIYHLTIRSELSFEKSNW
                     IESLTDLACRRKLLTTLGEGAKDSYDEALANEFIDSHDPLIRYCAYKLGRAESHDIEG
                     VMADIEPEVLEEALPGMSQLLESLRTETGVEEMEEGRRKLEDVEFAGEKVELRNAEIV
                     GVMVRVQDALSKLGDGKSKGARGMKRWDRVLSVLGEAEGVARKLLEDNEANGASSSLR
                     STRTAQSLALAHQYIIYLLLTHRIRRDLALVETLSSSPVPKDPTQFKVQGGKAKLEEA
                     VKTLGAVVKLYGTMLQSLKQAAELSVVQEKEGVRSGVEGLEAYFHAIRCYNLARLHCI
                     HPDPSYSSAVQLLSNASLSLRQAQDFLASPVDEPIVSVPAEDLSSLSKNISALEKASK
                     RGLFGRSVEKPVFFDMAFNYIDLPIDELQRLAGNGEKVQVATVKTQEKEVEIKPVENM
                     KKSRDSRETTPAVDSQEEKQEGKKGWLGGWFGRK"
     gene            complement(67899..68751)
                     /locus_tag="CNL03910"
                     /db_xref="GeneID:3254740"
     mRNA            complement(join(67899..68008,68063..68127,68209..68287,
                     68341..68378,68430..68477,68528..68751))
                     /locus_tag="CNL03910"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024658132.1"
                     /db_xref="GeneID:3254740"
     CDS             complement(join(67994..68008,68063..68127,68209..68287,
                     68341..68378,68430..68477,68528..68717))
                     /locus_tag="CNL03910"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513810.1"
                     /db_xref="GeneID:3254740"
                     /translation="MSAPASYLEHHEPLATELHPISDATLTVRVIKSFEFRTQKSVVL
                     KNLDLRTLTVEALMNLVREEVKKGAGFKPYRNLVLDTMKLYTVAHGHKTQNLIINLDH
                     DEWILDPSKTLEEVGAQNETELSFFNREAYEKFKLDPEVKWD"
     gene            complement(73648..75493)
                     /locus_tag="CNL03915"
                     /db_xref="GeneID:36393115"
     mRNA            complement(join(73648..74032,74109..74223,74288..74556,
                     74623..74905,74991..75493))
                     /locus_tag="CNL03915"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658820.1"
                     /db_xref="GeneID:36393115"
     CDS             complement(join(73752..74032,74109..74223,74288..74556,
                     74623..74905,74991..75020))
                     /locus_tag="CNL03915"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514653.1"
                     /db_xref="GeneID:36393115"
                     /translation="MICLIQSVMLKYYVPPLIFSHNNLRLINEKMVCIDGKQRCTSIV
                     RFMDGEIPFISPGTKEKLWFKDGPGKRKLLPMPLRRHFEQVNLPAVTYKELGDEQQRD
                     IFQRVQLGVALSSAEKLQAVSSPWAQWCSKLEKKYITAPNTLGDLLSWDIKRAKSFQN
                     VVGFVYLAKCKKEGRESSSTGWMSLKGLLEANIPPDPRLMDEVDMAMSIWLVIAQRYY
                     AAAFDTISRRVAPVESWFIPFLIFVHMHQLSYSQLAQSIGDLRQELHDVFVGNVFANT
                     KVSRWLLDWINRVENVKKRGVETAEEQWKREKAAQSQTEGEGRKRRKRD"
     gene            complement(75614..77709)
                     /locus_tag="CNL03920"
                     /db_xref="GeneID:3255006"
     mRNA            complement(join(75614..76126,76194..76283,76339..76426,
                     76480..76522,76573..76944,77010..77175,77235..77513,
                     77567..77629,77670..77709))
                     /locus_tag="CNL03920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658133.1"
                     /db_xref="GeneID:3255006"
     CDS             complement(join(75869..76126,76194..76283,76339..76426,
                     76480..76522,76573..76944,77010..77175,77235..77513,
                     77567..77629,77670..77699))
                     /locus_tag="CNL03920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513811.1"
                     /db_xref="GeneID:3255006"
                     /translation="MSTTMVPVPQEELPVLEALINIRNRLTALKKDTTKFIRAPDVMP
                     IYNSVVKQITRLNAIRDEQQQSHSALNPAPGSSTKPPPPPEANRVDQLLADVFGLLSL
                     FFLTVGKSRETPAIYCQIASMRQILSHMDESGAYTEQFLIPFRERLDQLRSVIKQDSL
                     EGKHPEPIVRLMIRKLEGVERQLDELFQSLTVLSVELVPIHQRLVQLRKELAALAAEP
                     KPNKAEYKAILEELRKTDSKRVDGKFLGPGGSSVPEGQALLSGLLETCFEITQDIKAR
                     EAEEEVGPSLKPIYDRLSQMKNQLDQMTLTHRWTLRETDLYNYAMALREIDAMRVDGK
                     FVDADGNKAEGQYALMFLLRRCYGLIYRLMSESEPISEELLPIANKLSTIKKCLNEVL
                     KYGGPYTARDLYPYHLALHQIDSLRKDGKFYADDGSIPEGQAILVAQLSEAHELLEML
                     KESMSDGESDDE"
     gene            77996..80107
                     /locus_tag="CNL03930"
                     /db_xref="GeneID:3254994"
     mRNA            join(77996..78037,78344..78367,78829..78892,78945..79251,
                     79303..79473,79526..79627,79678..79748,79807..80107)
                     /locus_tag="CNL03930"
                     /product="14-3-3 protein, putative"
                     /transcript_id="XM_567951.1"
                     /db_xref="GeneID:3254994"
     CDS             join(78829..78892,78945..79251,79303..79473,79526..79627,
                     79678..79748,79807..79862)
                     /locus_tag="CNL03930"
                     /codon_start=1
                     /product="14-3-3 protein, putative"
                     /protein_id="XP_567951.1"
                     /db_xref="GeneID:3254994"
                     /translation="MSNREDSVYLAKLAEQAERYEEMVENMKSVASSDQELTVEERNL
                     LSVAYKNVIGARRASWRIVSSIEQKEESKGNEAQVAMIKAYREKIEAELAKICEDILE
                     VLDKHLIPSAASGESKVFYHKMMGDYHRYLAEFATGDKRKDSADKSLEAYKAASDVAV
                     TELPPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELDTLSEESYKDST
                     LIMQLLRDNLTLWTSDMNEPEKEEKPEETKQEEVAPAA"
     gene            complement(79948..81665)
                     /locus_tag="CNL03940"
                     /db_xref="GeneID:3254900"
     mRNA            complement(join(79948..81185,81249..81665))
                     /locus_tag="CNL03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_567952.2"
                     /db_xref="GeneID:3254900"
     CDS             complement(join(80169..81185,81249..81608))
                     /locus_tag="CNL03940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567952.1"
                     /db_xref="GeneID:3254900"
                     /translation="MADLTPGARKPAPAELTGFRSALAHTGIPHGVLLWKPRLPSRNW
                     LVFWSVSLSLSYAYYYDRAECKRIKQEVVERVEKYGREPMPGGSLGEPRRVVVWAGRW
                     GGDDDADRAGRYFRKYVKPYLVAAGIDYTLPSVPLHGSITRQLHAAILLQRRQALGLA
                     PTATPLSLPGVLDPAEAKRREVESGVVVVGRASLKEYLEGLRRGWECGVDEWAWETEV
                     EKTLAGDGVFESVESPVEPAVETAETVVEPTADAVPKSNFGFLARPAPVTPGAPAIPA
                     HLHTPPSPLPPTPPLLLLPFTNHLGFLQLPYMILDFFNERAKVRQGAQSALALIEGPT
                     RDMHREDAEHWEEKSESWYNKTARQLPERLQKSRTEYYEAIKSRIDLARAYENGDREM
                     TEEEKKANKVERIQDIQAERLKKELRWKGSEEGWEIVKPETPATWRDRWEGWLKVYQV
                     PEDAQKGL"
     gene            complement(81795..85763)
                     /locus_tag="CNL03950"
                     /db_xref="GeneID:3254758"
     mRNA            complement(join(81795..84350,84400..84667,84720..85339,
                     85396..85482,85544..85763))
                     /locus_tag="CNL03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_568210.2"
                     /db_xref="GeneID:3254758"
     CDS             complement(join(82145..84350,84400..84667,84720..85339,
                     85396..85482,85544..85590))
                     /locus_tag="CNL03950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568210.1"
                     /db_xref="GeneID:3254758"
                     /translation="MQSPNTAKRAAAALDSEAKSESDRLRNVLGSQPPWSKEVELHRQ
                     QCRNAHLTLLFSHPFSPYSQSLDSLWLHTTYVLIQAYRDLISRLERFPPAASNSNGGS
                     KGRRGGGGGGNSELKKALTRFRQVLASEETFYRSLAARLVRFYNLGEISGVDETLKAV
                     KLPTEYMPTNDSGEDESSSYAARFASLQEKKDKIPLLYKGLICLGDLERYKKQYKQPV
                     NNNRHAQERERQADKFEVAEKYYLAAWRLMPDDGAAWNQLAVISTYVHNDYSTTYYYY
                     RALAVKNAFQGADGILQRFFGRIFDKWRAKRKDGDGEEGGEVGDGVEKWKEEMVVLMA
                     ILYLKAGFTYIPTILPPLLTSLKDFLSERRLPTESIVQLTSILLGSHFRARSTSGLEQ
                     DPNLLKRSFEAEGKTLEVALGVWKIYLEIAREEIDEARASLRRGLEDSALLDDEDEEE
                     LETDEMPQLISAVLRRILPSLRIISKWLKLNTTYLSGLASPSSNDQVSSPELRAAISS
                     FWNTYNAFFQSSSRLFILERLPSITRPLEEDIDMRGFAPLQKGKTADMDSFAAGATSA
                     TDSADAEGDVDGGQEGREVHPNEEHLMRLGDIQVDGLLIGQSLGFTDPLHTFTTGTFA
                     IPEATELPNVPRVEEHEREHDLQSISTNTEDDPVNLAMRASLGVESVGEEDEDDEEVI
                     VWSRGRENAVDTSVYQQVQTIPAQLPAPMVPPPKHRLQHQQSQTAMDLLQDLLQSTPP
                     LAHSSGNNSPALVASSPYAHQSPSYTQTGFPGMNRNMSGPSAGIPSPHNTQMPPGLPI
                     LGPAPVPQSVRPVQHSGQAKNPGQVPSLFMGPQGNSIWTMTREESQQGRARRAGSGAG
                     TGPGMGWVGGDEGQQGSVASQGPPPPPGFGIPQAPQIAQPLATQMHQPQPQAPVPIQH
                     MGLSTASATLQAQATFPRSSPGAVAPPNLTHRPPSIPKLHHESPARQTPVQVQHPTRQ
                     PRGPSANPSGTWGGLSNMNMGGTGMGMGMSNVPLPVPKSEGEAAVPYYMRPGVFGGGA
                     ATPAGAGGISGVGGVVPASGRDGAGQGIWDGTRGFGQGQGWVSGS"
     gene            complement(85905..87112)
                     /locus_tag="CNL03960"
                     /db_xref="GeneID:3254806"
     mRNA            complement(join(85905..86044,86098..86184,86237..86723,
                     86891..87050,87098..87112))
                     /locus_tag="CNL03960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568209.1"
                     /db_xref="GeneID:3254806"
     CDS             complement(join(86009..86044,86098..86184,86237..86723,
                     86891..87048))
                     /locus_tag="CNL03960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568209.1"
                     /db_xref="GeneID:3254806"
                     /translation="MGRVIRAQRKSGGIFKSHTHHNKNPARLRNLDFAEKNGYIRGVV
                     KDIIHDAGRGAPLATVVFRDPYRYKLRKETFLAAEGLSTGSFVYCGKKATLNVGNVLP
                     IGQCPEGTIVCNVEEKIGDRGALARTSGNYATIIGHSESGVTRIRLPSGSKKTVSSRC
                     RATVGIIAGGGRIDKPFLKAGRKYHAMRAKRNSWPRTRGVAMNPVDHPHGGGNHQHIG
                     HASTMARDAPAGQKAGLIAARRTGLLRGTQGKNVDNA"
     gene            complement(87442..91196)
                     /locus_tag="CNL03970"
                     /db_xref="GeneID:3254818"
     mRNA            complement(join(87442..88349,88401..88570,88631..88795,
                     88846..88972,89030..89721,89759..89836,89883..89979,
                     90029..90107,90159..90285,90351..90476,90526..90733,
                     90826..91196))
                     /locus_tag="CNL03970"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_024658134.1"
                     /db_xref="GeneID:3254818"
     CDS             complement(join(87480..88349,88401..88570,88631..88795,
                     88846..88972,89030..89721,89759..89836,89883..89979,
                     90029..90107,90159..90285,90351..90476,90526..90733,
                     90826..91161))
                     /locus_tag="CNL03970"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_024513812.1"
                     /db_xref="GeneID:3254818"
                     /translation="MAMTALHPTVSSSDIHLDSPHSYTHSGSTLLPDPSASPSPSTSH
                     APLPGASAGDMQAEAPELVEEVPEGESEGMGDQIILDSQPEVDVEDLTGEMEYENLRY
                     RTERERKRVKVYELRDESWFDRGTGICRGMINADGHAVILVEAESPQVQENEDEPGGF
                     LTKDILLNSNVERDDIYGKQQDTLIVWTDPESKLDIALSFQDADGCEDTWQFICEVQK
                     HLISVEDETQVPSSSSPIGGSPMMVANAHMVNAEHKLPWQPPTLANIREQEFCIRAQA
                     KSAMGRERAMEHILNEDYIKQLINVLEQAEDLESLDDLHALCSLMQTILLFNDNGIFE
                     YILQDDVFLGVIGMLEYDPEFPELKATYRQYFQENARFREVVPIPDPIICNKVHQTYR
                     LLFLKDVVLARVLDDSAFNILNGFIFFNQVDIINYIQQSDGFLTQLFEAFRDPLPPPP
                     PKDTPPEPLDDKKRDTVMFLHQLVMMGKSIQLPPRLQLYRTLVDRGLLRVIEWSFRRP
                     EAKILHAGAEMLTLVVEHDASSVRSYVFKEQEQKERTLVKEIIELLHKTTNAGLMGQM
                     ADTLKTMLEVPPDNESFMAKKEGPLAEQFMTHFYETWATYLFKPLLDIPDYKTEQPTT
                     KLTREYTSLLQNLVELLSYCLLNHPHKGSYFILSNPISKKVVALLYIRDKPLRHAALR
                     FLKACLRTPNHFIHRHFVKNDLLGPLLMLLEEESLRDNMMSSACMEVVEQIRKDNLKT
                     VINYLFENYTPRLEALSRRPLMRGIMMGIRSRWEMNNEPTPSMPLVAATSATSIGGED
                     GWVNEEKKEDDYFNGSDDETDRTVVDDTENVIGEEEGEEGAVPAKRKRLQSGGGPKKR
                     AQRTGSALGLDYDDNSDPESPVSTPQHTEHSSSSTPVLTTTTSLLERTVSRAQAVAEK
                     EKNTSELEEDLGDVQAKMREKRRREEEEEEEGGFAGLLVGAKPQPVATVAASAASGGG
                     AIGAGKGEEGKDDERDTAMQSEVSTTGEGKKGLKDMGKKIRLNFGLGKKFSK"
     gene            91327..93342
                     /locus_tag="CNL03980"
                     /db_xref="GeneID:3254739"
     mRNA            join(91327..91521,91568..91906,91960..92116,92167..92536,
                     92597..92833,92912..93342)
                     /locus_tag="CNL03980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658135.1"
                     /db_xref="GeneID:3254739"
     CDS             join(91359..91521,91568..91906,91960..92116,92167..92536,
                     92597..92833,92912..93112)
                     /locus_tag="CNL03980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513813.1"
                     /db_xref="GeneID:3254739"
                     /translation="MSSQPPKRPRSSDVQLPSPKRSRIVPYTRPKQSTNQGFLSRTFG
                     VMSNLLGWGTPREQESNSSDDGQSSSHSRASSPDPLDSIPRGSSHDPPSPPPPAETRR
                     PPIRPNRDAYSSQASPFTWSATIDGQRRPLWVDRDTDTEDRASQRVISMFSGNVGALN
                     RRRTLRKVDDRLAGIRTVLRNDQATKSFDEVVQSKPQQEVYKPKQKREIGVKAQEQAS
                     KSSSFEFVSILKNLKALQLAKEKALKPSVPSKLSPQQESKVDAHLRNPKFKVTLNVSE
                     VEAGSLRRLKPSTWLDDEVMNAYCDLMCSRFKDGKAGRKVHSLNSFFYGKLVDQGYAA
                     GRLKRWTKKIDIFSLDVLIFPINQGNMHWTACAINFAKKRIEYYDSMGDYGNARKQVF
                     RKVRGYVEAEHKEKKGRAMDWEGWHDYFNKNTPQQNNGSDCGVFSCQTLEMITRGRDI
                     VTQGFEFTAKDMPFMRRMMIYEIGEGKLEKRTWGSPAL"
     gene            95203..97094
                     /locus_tag="CNL03990"
                     /db_xref="GeneID:3254782"
     mRNA            join(95203..95443,95507..95578,95630..95776,95825..95882,
                     95946..96038,96105..96170,96219..96250,96314..96370,
                     96421..96606,96655..96742,96799..97094)
                     /locus_tag="CNL03990"
                     /product="stomatin-like protein, putative"
                     /transcript_id="XM_567955.1"
                     /db_xref="GeneID:3254782"
     CDS             join(95249..95443,95507..95578,95630..95776,95825..95882,
                     95946..96038,96105..96170,96219..96250,96314..96370,
                     96421..96606,96655..96742,96799..96944)
                     /locus_tag="CNL03990"
                     /codon_start=1
                     /product="stomatin-like protein, putative"
                     /protein_id="XP_567955.1"
                     /db_xref="GeneID:3254782"
                     /translation="MSAPAPDHNKPSMDGTTINFNNSAKGHNEPLPVAEENNELDRYV
                     TDDLPRQPRMAAKPQIPDAIMAVQPLRKNEMQPSYAQDLGTGTIDHGCYGSMMNVLGE
                     CIGALGMIPCCPCPNPFNNISQGAVGLVSRFGQFYKSVDPGLVKVNVCTEDVRVVDVK
                     IQLTSVPRQTVQTKDNVSVEVDSVICWHVISPYRAAFGINDVRSALVERAQTTLRQVV
                     GGRVLQSVISDREGLAHEVAEIIEATAEKWGVAIESILLKDINFSVELQQSLSSAATQ
                     KRIGESKVIAARAEVDAAKLMRQAADILASPAAMQIRQLEALQNMARSSGSKVVFVPM
                     NLGTMGAAGMNDVAHQIAASGHDEHADHGPSTATNAGIISSMANV"
     gene            97210..97297
                     /locus_tag="CNL04000"
                     /db_xref="GeneID:3254926"
     tRNA            97210..97297
                     /locus_tag="CNL04000"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:3254926"
     gene            complement(97572..99238)
                     /locus_tag="CNL04010"
                     /db_xref="GeneID:3254887"
     mRNA            complement(join(97572..98282,98349..98725,98782..98894,
                     99131..99238))
                     /locus_tag="CNL04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658136.1"
                     /db_xref="GeneID:3254887"
     CDS             complement(join(97624..98282,98349..98725,98782..98894))
                     /locus_tag="CNL04010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513814.1"
                     /db_xref="GeneID:3254887"
                     /translation="MDSDAEVILSTDEVLKLFGTIQTAVDATTSSSVPLLNKVQNKEE
                     DLDFANGLSLLNLRPHLLLSSLHQLVILLALRLTSSTEAAPDPSTSTALSIPFPNPRS
                     RPELTDDNVLNEIAGELVMNQEVMDKVRGLENKLEYQIKKLIGLAEAEDKRGKDVVED
                     VEEDPLSFRPNPSAITSRTSPKAARGGSPTGSDDEKSGVYRPPRVAAVPYSEAAPQGR
                     ERERRAPALLSEFAATMDSAPLLESTSGLSVRPVTSAAAKYSNSVSAKRAAELKRIDE
                     FEEENMTRLVTSKREAKRRRDDEAALAMGFGVGPSRGRRGRNGLEAELEGVLGDRGDK
                     GVWDGVSGKFGQRGDALERGKKRVSGTGSTSGKAKKARFEKELARKRK"
     gene            complement(99289..102683)
                     /locus_tag="CNL04030"
                     /db_xref="GeneID:3254831"
     mRNA            complement(join(99289..99616,99680..101419,101466..101679,
                     101739..102009,102062..102070,102123..102368,
                     102427..102683))
                     /locus_tag="CNL04030"
                     /product="expressed protein"
                     /transcript_id="XM_024658137.1"
                     /db_xref="GeneID:3254831"
     gene            99329..101103
                     /locus_tag="CNL04020"
                     /db_xref="GeneID:3254735"
     mRNA            join(99329..99561,99612..99656,99711..100104,
                     100153..100353,100407..101103)
                     /locus_tag="CNL04020"
                     /product="expressed protein"
                     /transcript_id="XM_567957.2"
                     /db_xref="GeneID:3254735"
     CDS             join(99369..99561,99612..99656,99711..100104,
                     100153..100353,100407..101046)
                     /locus_tag="CNL04020"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567957.1"
                     /db_xref="GeneID:3254735"
                     /translation="MSVAHIADSKGVQGPAKWSAVKNAVQFSAAAKDKNRRNQTDTLP
                     VSTTSTSVSAAFARSLVLFTGFLFKRPSKLFRPNRVDTWLGLRQLALSTEQTISPAFI
                     RSLLRQKAGIIAVTLTILPPMLVNATLGFLLFTSHSLFTLGLSRLSFFQRKIEMEDGT
                     EVDEEEDINLETLIRGPSIIPNHPTILSAIAGAGAGLVQGAAFTPVENVVRFLHQSAT
                     SWATLLARLVHLPVPEVPNAFEGKQPATPMQAIKNLFASETWRKNRNWWTGWRWVVAR
                     DALSYSCFFAAFDVTRRVALRVKALFGGNIEHGWENIFIIEFPDDHPQSASPSISNSP
                     AKYRPDSDQPQAPTIARVAQATTIVTGGIIASYLAQMAGRPLRTCQRIMMLDERERMR
                     AEKAQGRAQAGGAGSVSSSNSSNTLRRGKPHPILEVLRTKGIRPFIHSEGLLQSAPMK
                     EAFQQEGRLVRTMKSVGWKMAAMGPWGFGFLVWAWVGGEV"
     CDS             complement(join(101149..101419,101466..101679,
                     101739..102009,102062..102070,102123..102368,
                     102427..102648))
                     /locus_tag="CNL04030"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513815.1"
                     /db_xref="GeneID:3254831"
                     /translation="MNTTRSFFITAPRTTKRLVTQQLRRQHAMAYPINHSNPTDLLSK
                     LPEKFDEARSSGQLFYFPSEAKDVISQGRRFNVRLCPALQDKAKAKADALAAIRAEKD
                     GSPDKKRPRVTNEDDKVELVNKQNELEPFKPPYVPELFVGSLEGFEGEEGMSILLNKY
                     SLLPGHILLCPFTYQPQDLPPTPPQLALAYNILLAASRHPIRPSKLLAFYNGGEGAGA
                     SQKWRHLQFVEAPGGRAPVEEWVQEVQFDRLDKPVILPNLPYLHIVHPLPPSAQMPVP
                     PTSESTEQLIDFLAPALMRLLDMAFDAARRGGGDKDGGWNILMTLEHLHLIPRTLPSY
                     PLPSPHPPLELNSLGYAGMMLVRSPEQEAALMQATESQGGLMGVLAKCGVPREFGEQV
                     LEAEAAFHGQIEQEMLSG"
     gene            complement(103399..104092)
                     /locus_tag="CNL04040"
                     /db_xref="GeneID:3254870"
     mRNA            complement(join(103399..103464,103518..103792,
                     103843..103926,103982..104092))
                     /locus_tag="CNL04040"
                     /product="bud site selection-related protein, putative"
                     /transcript_id="XM_567959.2"
                     /db_xref="GeneID:3254870"
     CDS             complement(join(103436..103464,103518..103792,
                     103843..103926,103982..104040))
                     /locus_tag="CNL04040"
                     /codon_start=1
                     /product="bud site selection-related protein, putative"
                     /protein_id="XP_567959.1"
                     /db_xref="GeneID:3254870"
                     /translation="MPKIRTQRTKPPPEGFEDIQDVLEDYEKKMRDAESESHEGKRKV
                     EAVWPIMRLSHARSRYIYDLYYKRELISRELYDWLLKQGYADANLIAKWKKNGYEKLC
                     CVRCIQTRDMNFQGSTCICRVPKAQLKKGTVVECPHCGCRGCASSD"
     gene            104157..105940
                     /locus_tag="CNL04050"
                     /db_xref="GeneID:3254969"
     mRNA            join(104157..104322,104374..105167,105222..105940)
                     /locus_tag="CNL04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658138.1"
                     /db_xref="GeneID:3254969"
     CDS             join(104261..104322,104374..105167,105222..105673)
                     /locus_tag="CNL04050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513816.1"
                     /db_xref="GeneID:3254969"
                     /translation="MGKWQQSKYDTELVSKILRLFEASETSQHSSTAQRNQSREPLSD
                     KKFLSFIKNLNPDSALVQQCFSQLLRAVHSEVKGMRPSGSVSPHSNPFAVPSIGQQLF
                     SVQPQPFALELTDIEVPSASRFPSPERRHRMAVNLPPPVFDSSRPWQFQSFSSQSRPE
                     YSRNHSGVSDSAALAAQPQPTSPQQESVAPPALRQSPLSSASRSWLSQYTHSAPASEP
                     RPVRPLPLRSIGSRRPLSFSRSTRDILNNAPPSTSPLVPLGDRSSSLYPRAQSLVDGP
                     RSTLTPSSSTLRRRRMRDELGNDSTEERSANRQRRFDPSSEIQRVWQEENNPWNEADP
                     SGRDTRRDGIVFDADVYLTQGADFLESSPEGAFGARDDDDWVTVVPSVTVPDEIPGDD
                     AWFLPPAGLSTNGVPEVQERNRDSQETTSVLYPSSHLPLNENE"
     gene            106134..108239
                     /locus_tag="CNL04060"
                     /db_xref="GeneID:3254800"
     mRNA            join(106134..106281,106360..106402,106469..106553,
                     106613..106740,106795..106895,106949..108239)
                     /locus_tag="CNL04060"
                     /product="expressed protein"
                     /transcript_id="XM_568207.2"
                     /db_xref="GeneID:3254800"
     CDS             join(106234..106281,106360..106402,106469..106553,
                     106613..106740,106795..106895,106949..107701)
                     /locus_tag="CNL04060"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568207.1"
                     /db_xref="GeneID:3254800"
                     /translation="MAVQVDIPKSEASRAEGNTAFKKGKWVEAIGHYTNAVIYNPEDP
                     VAYCNRAQAFLKLEKYHDAERDCTSALALPKGKSNIKALYRRGLARKGLEKIEEALSD
                     MEEVLRLDKSNTAVKPELEELQEMKTKMDQEKKKPSRRPLTPPILPKPLPKKSSNPPK
                     SEDVSDLTNLTQDLGLKSTSSRSPEEKKESSFAAIRKSRDGKKMSFVGESTSQLSKQP
                     QDKEAATDAALSAIFPPSKPRVTSTSGSKKPAASTINVNSTPSTSALPPLPTSLDTTS
                     TSPGAGLSLLRYFTSSPTYNFSLLSLYPAENIPIILGTLLEPDTLGFLLLALDEGASK
                     GTETDKENVKKILEGLRQTKRWKMNIGMLSTDEKKAGENAWKSCGGIGSWI"
     gene            complement(108723..111624)
                     /locus_tag="CNL04070"
                     /db_xref="GeneID:3254957"
     mRNA            complement(join(108723..109754,109825..110264,
                     110354..110465,111276..111624))
                     /locus_tag="CNL04070"
                     /product="transcriptional regulator nrg2, putative"
                     /transcript_id="XM_567961.2"
                     /db_xref="GeneID:3254957"
     CDS             complement(join(109103..109754,109825..110252))
                     /locus_tag="CNL04070"
                     /codon_start=1
                     /product="transcriptional regulator nrg2, putative"
                     /protein_id="XP_567961.1"
                     /db_xref="GeneID:3254957"
                     /translation="MSTEASPHQSQHLPSSYPHHPASLPPNEPPRMPNPAPSLPDAAN
                     GSHPFTGDLSINSIKTEDSMSDHSAVAGQPSQSSKGKNGATGPAEGKAKPHVCPICQR
                     GFTTGGHLQRHHRIHTGVKAFKCPFPGCETRTSRQDNLQQHYRTHLSPTLRRGSGSAA
                     RAAVNAAMEAAGLKSSSSRQPRKSKSATGTPTSATASHFPSPYATNPGPNPYAAYMYD
                     QQHGYPPPYPLPPGVAMTQPQSATSSRVPSPVNGHSAAGSLPPAHQQSFFSQPYTPTY
                     ASYPSVHQQPPYRYPTGGMPYPSGPYSHHSLYSPSIAPEHSQHMYSPMQSSFAAHSRE
                     GSYGLSASAYGGRSPTSGAYGHARR"
     gene            112229..113179
                     /locus_tag="CNL04080"
                     /db_xref="GeneID:3254928"
     mRNA            join(112229..112467,112534..112556,112647..112753,
                     112804..112940,112993..113179)
                     /locus_tag="CNL04080"
                     /product="histone h2a variant, putative"
                     /transcript_id="XM_567962.2"
                     /db_xref="GeneID:3254928"
     CDS             join(112372..112467,112534..112556,112647..112753,
                     112804..112940,112993..113046)
                     /locus_tag="CNL04080"
                     /codon_start=1
                     /product="histone h2a variant, putative"
                     /protein_id="XP_567962.1"
                     /db_xref="GeneID:3254928"
                     /translation="MSSKVGGGKGGKSKTSSEAKVLTTRSSKAGLQFPVGRIHRFLRN
                     KNANNVRIGAKAAVYVASIMEYLTAEVLELAGNAAKDLRVKRITPRHLQLAIRGDEEL
                     DLLIRATIAGGGVLPHIHKSLVAKNAPLKKPKALDA"
     gene            complement(113190..119528)
                     /locus_tag="CNL04090"
                     /db_xref="GeneID:3254962"
     mRNA            complement(join(113190..113514,113578..113608,
                     113671..113862,113913..113959,114009..114054,
                     114121..114270,114324..114407,114462..114559,
                     114623..114715,114765..114894,114940..115021,
                     115076..115247,115296..115439,115504..115621,
                     115682..115819,115870..115972,116033..116035,
                     116049..116466,116523..116540,116593..116687,
                     116736..116794,116857..117106,117162..117196,
                     117260..117742,117793..117911,117965..118155,
                     118233..118510,118557..118640,118694..118927,
                     118991..119528))
                     /locus_tag="CNL04090"
                     /product="phosphatidylinositol 3-kinase, putative"
                     /transcript_id="XM_024658139.1"
                     /db_xref="GeneID:3254962"
     CDS             complement(join(113387..113514,113578..113608,
                     113671..113862,113913..113959,114009..114054,
                     114121..114270,114324..114407,114462..114559,
                     114623..114715,114765..114894,114940..115021,
                     115076..115247,115296..115439,115504..115621,
                     115682..115819,115870..115972,116033..116035,
                     116049..116466,116523..116540,116593..116687,
                     116736..116794,116857..117106,117162..117196,
                     117260..117742,117793..117911,117965..118155,
                     118233..118510,118557..118640,118694..118927,
                     118991..119401))
                     /locus_tag="CNL04090"
                     /codon_start=1
                     /product="phosphatidylinositol 3-kinase, putative"
                     /protein_id="XP_024513817.1"
                     /db_xref="GeneID:3254962"
                     /translation="MSGNIQHRILHRTVPLICQALITSPDDETVWLEGLRLLSSAKLR
                     HALPHTSSIWLPLLLKGLEVTRSEGIILESLRLLIEAADTLEPMKSCLIKPLRSLAKV
                     ANLAGTEELILVVNCLGIKVWDSKNNAIGSDAPNQRDNRTELARDLSTQEPPQHPLLS
                     EILAHNLPPKPRSVQHTWTNTLLSSPNDSPSLWLHNLYQATLEASNIPEMTVTSRLGP
                     LINAELFQTAFAKCYLQLEDDAAFKAVVDEAIVSLLSDKTVNKEILIMFLDLLAFCTK
                     DTTPYFSPKVFEAAKMCALQCFHGGLNQTLPGVILWYIEQQAEALPTPESISNLVEAN
                     IRVGTGGYDAAWSTLLWLENDWNIEPQPMWITSLSHWQQALSAQDKIDKNQQATMYSS
                     FNLRMICYHALGNYQKGYDLAQNFFEGLDDNERRNTAHWATAAAWHMGDFDTMADHLA
                     FHPRGTSKSLYKAIIDVHNEQYASAFHHINKAQSLSYDELQMQLGAGLQVALKSLAKT
                     EFLVELQEAIQYKSQPELRPTILATWKTRFKRSHADANSWLKRLEIWTLACSPKTFEL
                     QDCFLKTAKLCESAGMHEAARSIIKRITPEVTLPGCKVEYTKLRFQWKDVFQRHDQNG
                     MEDALERLYIHTRRYLEYINVNKHELEASALGLQPLSKTENLSTLERKVIARRYYRLG
                     EWTSVLQGSEWLQDRESTVLMYTSLAAKLDVSWHEAAFSLAERSVTLFESNGFSRYDG
                     VAVGSYIVPALRGLFQAARTKESPEFIIKALLRLVTLWFRFGESQAVLVEVENQLNIT
                     DVEPWLSAIPQLIARLGTPQKDLQCTLIKLLRTISSHYPHAVIWPLLTATQTRKVEHQ
                     EAARVIMDYICTMADGTRLVDQAELVGRELIRTSISKWRGIIDGFLPRQDLMEIKWQD
                     IPEIWEEDLRMLTNPETPDEHQFVLQYGEQLHLVDKTLIRYNSSRQLNLVNNAYSTLY
                     RLYGEIEAQLNQWRLPGMKLHLASTAPRLLSLRDCILTVPGLYDPHIKLDDQAFIDGF
                     QPVVHILSSKQLPRKLLIQSYLSDHTFLLKGNEDLRGDERIMQLFNLINTLLNHRSDA
                     FSRNLHLLPYEVVPLSPSAGLVSWVSNTQQLQSMIQANRDKHKRNALTNRELGSLLGY
                     DPDVFNPNNPKLDATAEMGKYDKLPLLIKVQRLKAALSHSNQSDIKDVLWQRSPSADI
                     WIKRRTNFARTVGVASFVGYIIGLGDRHGSNILVDQLTWGALHIDFGDLFNVAQERSF
                     LPEKVPFRLTRMMTNAFELASQGDLETPGSAGTFKQASFITMDVLRGSRSTLLAMLEA
                     FLYDPLLSWTSSQNNPSGTTRLEEAVLREAPKVGASLEGLKSKAGQKDSSQGTQSQQG
                     ETKDLSIQEDSLPYEQLDNSLTSTCLRTDSYMARVSSTEMTNSKALQVLTQIERKLVG
                     LHNTNSEQPFSVSKQVQELIKEATNLQNLSQGYVLGWIPHW"
     gene            119645..121138
                     /locus_tag="CNL04100"
                     /db_xref="GeneID:3254756"
     mRNA            join(119645..119741,119804..119837,119892..120170,
                     120229..120416,120472..120612,120675..120844,
                     120907..121138)
                     /locus_tag="CNL04100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658140.1"
                     /db_xref="GeneID:3254756"
     CDS             join(119739..119741,119804..119837,119892..120170,
                     120229..120416,120472..120612,120675..120844,
                     120907..121099)
                     /locus_tag="CNL04100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513818.1"
                     /db_xref="GeneID:3254756"
                     /translation="MSLAYLEQDTTQALADSIWNVSWNTANQLVTASADGHIRVWDVE
                     ELRQPVHDIDSHPLAITSLSVADKKALASSLDGTIVLVDTVNGEQLGKVNSGRVKVSA
                     EGPEIPAFACSLHPQSACWAWSGRSSKVVIRTMVSDDADPTTQGPLGGESSIMDGGKG
                     KFGMDLQFSPDGRSLALATDQGQVVVFDTETRATIATYTSHNKAVRTIGWSPDSQWLY
                     SGSDDHLIVLYDARAGSQSGAGGKGEGAVAMMQGHQSWVLSVAPSPDGRLLGSGGADH
                     LIKLWDIGQRTCVSTSSSNADVWGFAWQPEGAGTLPPGKQFAVAGDDKVVTLYRAAGA
                     V"
     gene            complement(121117..123091)
                     /locus_tag="CNL04110"
                     /db_xref="GeneID:3254737"
     mRNA            complement(join(121117..121499,121554..121677,
                     121733..122065,122105..122210,122263..122312,
                     122386..122622,122661..122911,122965..122978,
                     123025..123091))
                     /locus_tag="CNL04110"
                     /product="adenylate cyclase binding protein, putative"
                     /transcript_id="XM_567966.2"
                     /db_xref="GeneID:3254737"
     mRNA            complement(join(121117..121499,121554..121677,
                     121733..122065,122105..122210,122263..122348,
                     122386..122622,122661..122911,122965..122978,
                     123025..123091))
                     /locus_tag="CNL04110"
                     /product="adenylate cyclase binding protein, putative"
                     /transcript_id="XM_567965.2"
                     /db_xref="GeneID:3254737"
     CDS             complement(join(121183..121499,121554..121677,
                     121733..122065,122105..122210,122263..122312,
                     122386..122622,122661..122911,122965..122978,
                     123025..123065))
                     /locus_tag="CNL04110"
                     /codon_start=1
                     /product="adenylate cyclase binding protein, putative"
                     /protein_id="XP_567966.1"
                     /db_xref="GeneID:3254737"
                     /translation="MATSQGIHSISTILKRLEAVTSRLEDIAVTQTSHGSSVKSPAPT
                     PDTPTGVAPPAPETPKSAEMTQPTLSPASKVYQDEIVNGALNDFLSKSKEVGGLVAEH
                     SALIGLLCEAQLSFLQFASNHAKPSAPNALAPLLEPQGKAIEAVMETKDKLSRSKEGR
                     EWGVCFNVLGEGVPAWGWVQMNAAQFWSDRVIKQYKETNTSVVAWAKSFIALIAALES
                     YVKEWHVTGVVWNPKGSPAPSSIPKTSTSAPPPPPPPPSSSAQAASTPAASGAAALLA
                     DLNRGGAATSGLRKVDSSQMTHKNPSLRSASIVPDNGKKGPPLKPKPGAKPAKKPAKV
                     ELEDGNKWIIENQEDNRSIKIDNTELHHTVHIFGCVNSVVQISGKINAVTMAGCKKTS
                     VVLDSAVSSFSITSSPSFEVQIIGSIPTIQVDTTDSGQVYLSKDCMEVIEIITSKSSS
                     INISVPTGEDGDFVERPVPEQMKSRVVDGKLVTEIVEHSG"
     CDS             complement(join(121183..121499,121554..121677,
                     121733..122065,122105..122210,122263..122348,
                     122386..122622,122661..122911,122965..122978,
                     123025..123065))
                     /locus_tag="CNL04110"
                     /codon_start=1
                     /product="adenylate cyclase binding protein, putative"
                     /protein_id="XP_567965.1"
                     /db_xref="GeneID:3254737"
                     /translation="MATSQGIHSISTILKRLEAVTSRLEDIAVTQTSHGSSVKSPAPT
                     PDTPTGVAPPAPETPKSAEMTQPTLSPASKVYQDEIVNGALNDFLSKSKEVGGLVAEH
                     SALIGLLCEAQLSFLQFASNHAKPSAPNALAPLLEPQGKAIEAVMETKDKLSRSKEGR
                     EWGVCFNVLGEGVPAWGWVQMEPTPAPYIHEMKNAAQFWSDRVIKQYKETNTSVVAWA
                     KSFIALIAALESYVKEWHVTGVVWNPKGSPAPSSIPKTSTSAPPPPPPPPSSSAQAAS
                     TPAASGAAALLADLNRGGAATSGLRKVDSSQMTHKNPSLRSASIVPDNGKKGPPLKPK
                     PGAKPAKKPAKVELEDGNKWIIENQEDNRSIKIDNTELHHTVHIFGCVNSVVQISGKI
                     NAVTMAGCKKTSVVLDSAVSSFSITSSPSFEVQIIGSIPTIQVDTTDSGQVYLSKDCM
                     EVIEIITSKSSSINISVPTGEDGDFVERPVPEQMKSRVVDGKLVTEIVEHSG"
     gene            123251..124555
                     /locus_tag="CNL04120"
                     /db_xref="GeneID:3254987"
     mRNA            join(123251..123394,123448..123532,123609..123667,
                     123728..123795,123845..123957,124000..124096,
                     124152..124253,124315..124555)
                     /locus_tag="CNL04120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658141.1"
                     /db_xref="GeneID:3254987"
     CDS             join(123325..123394,123448..123532,123609..123667,
                     123728..123795,123845..123957,124000..124096,
                     124152..124253,124315..124380)
                     /locus_tag="CNL04120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513819.1"
                     /db_xref="GeneID:3254987"
                     /translation="MSIPTPNIAHFTESDYEHIYEPAEDSFILLDALELDAEDLLRMN
                     PSVCVEIGAGSGVVSAFMSNLLGHENSFVISTDINPHACQATIRTGTANNTILDPIRC
                     NLVDPLLPRLSEKVDVLLFNPPYVPTDNQELQMTQESRDIGGAWAGGADGMAITNILL
                     QQLPSLLSRGGRLYLVAIHQNNTKDINARMLSLGLQSQEIIKRRAGRELLSVLRISKP
                     I"
     gene            complement(124519..127418)
                     /locus_tag="CNL04130"
                     /db_xref="GeneID:3254751"
     mRNA            complement(join(124519..125291,125341..125413,
                     125472..125523,125583..125718,125768..125840,
                     125900..125938,125996..126051,126113..126239,
                     126292..126378,126433..126505,126566..126774,
                     126825..127096,127164..127418))
                     /locus_tag="CNL04130"
                     /product="protein threonine/tyrosine kinase, putative"
                     /transcript_id="XM_567968.2"
                     /db_xref="GeneID:3254751"
     CDS             complement(join(124603..125291,125341..125413,
                     125472..125523,125583..125718,125768..125840,
                     125900..125938,125996..126051,126113..126239,
                     126292..126378,126433..126505,126566..126774,
                     126825..127096,127164..127302))
                     /locus_tag="CNL04130"
                     /codon_start=1
                     /product="protein threonine/tyrosine kinase, putative"
                     /protein_id="XP_567968.1"
                     /db_xref="GeneID:3254751"
                     /translation="MSQTPSQQPPHSDDVFEPTQLSQPAYSQTQNTQAFISSQVEPRR
                     KYWAIFISTHSDRGILKVPWSKPYIQLGRGPYTLGNDVILPEKRVSNTHCRFTLGMQN
                     AKNLEPSNDTARAWKEGEGEPEVWVEDLKSSNGTFVNGARINTRRLLRHGDEISLGHA
                     GTLDYHDVRYIYRSVGGKRLKNGQASSNSGDLEPVGQVYEKYQLLDRLGKGTFAEVHK
                     AVDVETGNMRAIKQIVKHRFAGNDKTLQLFHREINITRSLEHENICRLIDWYEDPQHI
                     CLVLEYVDGGDLLDYIMDWPEEQGGLPEQHAAELTVQICRAMAYTHSKGITHRDLKPE
                     NILLTKEHEGARIVKIADFGLAKMIHTNTMLVSMVGTPQYLAPEIVMQTEQQPGYENV
                     VDSWSVGIIVYSMMTKALPFDEDSKLPVEQRIRARFTQPPDVSLLEQRNVSQQAIDFI
                     LRLLDKDPAKRMTMAQALDHEWLSEPSSQPIESQRMGLGGDSMWSIQSFDSLQPDFNY
                     GPGSANWQRPATVSSTRLKSGFEGSDDFSQPMTKLHLNTPEICNIPSKKASIKQTSAA
                     IGINTPVSLVSPCVAGNPVNAVSPSAPTSTSPTSLSKQQKRKLEDEKRANSIDSEGEG
                     SESIDRTNNAPVNENIDASVMMDSAVDSVKEDGKDDIVLARRPRKSMRLQ"
     gene            127562..129600
                     /locus_tag="CNL04140"
                     /db_xref="GeneID:3254787"
     mRNA            join(127562..127858,127914..128814,128891..128989,
                     129047..129600)
                     /locus_tag="CNL04140"
                     /product="expressed protein"
                     /transcript_id="XM_567969.2"
                     /db_xref="GeneID:3254787"
     CDS             join(127586..127858,127914..128814,128891..128989,
                     129047..129330)
                     /locus_tag="CNL04140"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567969.1"
                     /db_xref="GeneID:3254787"
                     /translation="MSDNQHLQGQSSVPETPANTSEVDTSGAPAAASSVGPASSEGTD
                     QQDPVVSTSSSKVQDILQQSINRDNFQEEVGQVMGTINSWWGGVKKQSVSTLATLKAD
                     IDKTVTQAQADFEYLKAAKIEVVRKDATSEPTRVSAKEDQDISADTLKEEPISVQNDQ
                     DKGKGKETAQSSATNQTSPPAFFTKLASSTSQLQQSLLSAVQFTLDATTANSALSNPN
                     AFRQQLVDNLRLASARENLQLSVKQAEKLAEEYLRKGDQWVKGAEKWMEEAVKVVPPE
                     GEETHVVNIGWDGGDWYSFSTSDNTPLHISTIDNGAPGPSAAGTQVKVLASSRKDALL
                     KRLREDKQLLLVDPEGEGETEKRKAEFRDWVKTQWEAQKTNGRLEDEGLVGHIRMELV
                     PEYLTDEQFWQRYLFHKHMIEEEEQKRKLLLQTSQQDQSDDFNWDDEPEETTPLGDGQ
                     ASHGVVTPKVSPVGKLPSSVFSHSKAKLATLDSTSPHDSEESYDLVSDQGGKTARAAP
                     PVGDDDSDWE"
     gene            <137655..>141899
                     /locus_tag="CNL04160"
                     /db_xref="GeneID:3254809"
     mRNA            <137655..>141899
                     /locus_tag="CNL04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_567971.1"
                     /db_xref="GeneID:3254809"
     CDS             137655..141899
                     /locus_tag="CNL04160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567971.1"
                     /db_xref="GeneID:3254809"
                     /translation="MMDVIDDAMLEARFLQVPTRPRHPPTVANVIAPVPAPPLIAKLA
                     PAPSTTTKGHTTQQLDWLDPAKRLPLGDAGRSARAYLQSINACFSCCVVGHHRLICPT
                     RPPSTPPNASASVPVANLVSLADDDESDHHGVFAVDPVTDTLVQDASSALAGSVPLIM
                     VNCRFKADGDTVPALVDCGAGINVIDRAYAEQQGWQGRPIIPVGTKMADNRAGPVVDQ
                     EYVVDVIIGDTTYNATPFYAMALGPRYRLILGLQFCRQHRLFDGAERLNHLLNAGGSS
                     YTSLVQLQLNSITPVESPTVSTERHSHSDAILREFADILPANISDVSHYPPICSSTSQ
                     VRHRINILPDAMPVARAGFRVPLAWRDTLRQEIEKHCTAGRLRPSSSPWAAPAFLIKK
                     ENGKFRFLCDFRGLNSVTVKDRTPVPNIDDILQRAARGKVFAKLDLTDAFFQTLMHEP
                     DIEKTAISTPWGLYEWVVMPQGACNWPATQQRRLNEALRNLISVCCEAYVDDIIIWGA
                     TDSDLAKNIRAVLTALRNSGFVCSPSKSKFFVDSVSFLGHVISPNHIGPDPKKVEALR
                     AWPSPGCVKDLRSFLGLLQYLRKFIPHIATKTSVLTALLPPNKTAEKAYESRKRQLAK
                     GLPAERLESLSWVWKWTTSAQDAFEALKEMVARITGLSPLSHEAILAGQTNLYLFTDA
                     SNTGLGAWLGTGLSPDNAQPIAYDSRSLTAAERNYPVHEKELCAIIHALKEWRPLLLG
                     VPVHVMTDHATLKWFFQQPNLSERQKRWLLVLADYDLQISHIPGATNVIADAFSWLRN
                     SDAHVNALTMMVLSPNTAFLDAVAEGYGQDPVMSIWREVDRCHPGVRTAEVNGARGVR
                     TVLTYEDRLCIPDVLTLREQCLQECHDAMGHFGVEKTLELLRCKYFWDGMASDVKDFV
                     STCPACQTSKATTTKPPGLLHSLPVPPAKFSDIGIDFVGPLPQSHSFDYLIVITDRLT
                     GWVALIPTVMTLTSSAFAQLYYDHWVSKYGVPQSIVSDRDKLFTAASWRRLNSLLGTK
                     LKMSTAYHPQTDGISERSNKTVIQILRTWTDDQGRNWAANLQRVAFAMNNTIRRSTHH
                     TPAELVFGKRLSLTPPLLPSTSATDQSLAQPTASEWDLAAQRMALEEGIARDELLLAK
                     HRQSVQANKHRRPDPVYRPGDKVYLNTAEFRHEYKTATNRSAKFMPRWEGPFTILKAF
                     PEQSLYELDVPVTSTQSTPRRHVSRLKPYRESEQYHQHAVPRLLDHPAVSSPRILQIL
                     EDRTLTPKGNHPKVYCKRLASDPVTHGHHFPQLLISSHVSICFRFFLQVARVKLHPRS
                     LSQVTCFIFPLFLRAASQFTPAPFLQVARVKLHPHSPSQVTCIILLPLFLFLLSLPFL
                     VLSPSFLSDFSCHKPRCLPGFGRDWFRERRQSAWKG"
     gene            complement(150339..157502)
                     /locus_tag="CNL04180"
                     /pseudo
                     /db_xref="GeneID:3254729"
     gene            158122..159695
                     /locus_tag="CNL04190"
                     /db_xref="GeneID:3254917"
     mRNA            join(158122..158602,158673..159196,159255..159695)
                     /locus_tag="CNL04190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567972.2"
                     /db_xref="GeneID:3254917"
     CDS             join(158182..158602,158673..159196,159255..159647)
                     /locus_tag="CNL04190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567972.1"
                     /db_xref="GeneID:3254917"
                     /translation="MPRRSAKYKATARARELYRMATILNHKQLKASLSIPYHALRTSR
                     YLNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLRVNHTEFRKLLCLIKDHPVFVSH
                     GPRKQANPLLQLTVALYRLGHCGCAASTFEIGEQFGVSEGTSAIWTTRVIKAILSLER
                     NNVYWPDENERKAIDRHFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVDFFSYKGRY
                     GFNILGICDHLKRIRYFQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVH
                     SEMISQGEYLLADSAFPAGDWCVPLFKRRRGQNDLDRPEAKFNKKCSSARVKIEHAYG
                     ILKNRWQSLRSLRVKIRNVRDEGVATCWIRACVVLHNLLIDTGDWYNRLDGDADEPDD
                     YIDIERMQERMERVLERHREEEEDEARDARDASNLTRKRVMERMQEIERRDLL"
     gene            complement(159330..161103)
                     /locus_tag="CNL04200"
                     /db_xref="GeneID:3254732"
     mRNA            complement(join(159330..160411,160472..160565,
                     160620..160938,161001..161103))
                     /locus_tag="CNL04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658142.1"
                     /db_xref="GeneID:3254732"
     CDS             complement(join(159696..160411,160472..160565,
                     160620..160910))
                     /locus_tag="CNL04200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513820.1"
                     /db_xref="GeneID:3254732"
                     /translation="MPPKRQNENENQASEATQKKQRNSNKQWATDTNSDGVSAEEHVA
                     VWLSTIPENGRLPNFHNWKTGHEKKDFWSRKCLQYLTDNGCDSRRQFQSVALKINQIV
                     ESFTKASQIGTGTGAGAMEIDDESLLAQRKKVCPFYEILLPVLGDRASVTAHHASSTL
                     HASLNRPDRDLAALDGLIERQRGEMAADDSEDELSGEDGGLFGDGAGEASETESEADA
                     PIIAAIRRESRSSSQPARSSSVLGSVSTPIRAQTQSQRASIRSSKAKAVSADDKMDEL
                     VMRQEGNDDRRHQELLAVQERKISVQEKHHADMMNIAQENVTIARENAATEKMKMLAE
                     SWNRKMEMLMRSGKSWEEAKVMVGPEPGAPSL"
     gene            <163732..>167381
                     /locus_tag="CNL04210"
                     /db_xref="GeneID:3254941"
     mRNA            join(<163732..164167,164227..164687,164715..165035,
                     165387..165763,165821..166134,166188..166438,
                     166503..166852,166979..>167381)
                     /locus_tag="CNL04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_567974.1"
                     /db_xref="GeneID:3254941"
     CDS             join(163732..164167,164227..164687,164715..165035,
                     165387..165763,165821..166134,166188..166438,
                     166503..166852,166979..167381)
                     /locus_tag="CNL04210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567974.1"
                     /db_xref="GeneID:3254941"
                     /translation="MRTLQQAQEGDASNNSVMPGEAEGTNGGAQGDGDAEMSEVSLRP
                     THTDISTPQSSIFVDHSPASVSNPAFQTFINNSLSRVQCQISVSDNEDDSAAPSVSGE
                     HGTESEEELRDAQSHLDVGGRREDMESWDEQAVAREKREAGPRLYAMSEEDIDKIGLY
                     SWKVDHNISRAAYNSLPDHANNIPFISLKEAQSLIDNYSDTLCDYYDMCKHSCLCFAG
                     PYAKDQKCSKCGADRFDRNGKPFQRFLYIKIIPRLQKMYNHPSTKERLMYRDKSTREY
                     DNSNIQDIFDGSMYRILLEKEIEYFADDRDIALSFSSDGFCPFDNGSGTCWPLVLFNL
                     NLPPEERVHTREILSVGLIPGPKKPEDFDSFIYPLVEELLQLTVGVHTWDADLGSFFT
                     LRAHLLYVSGDTPANILKLQVNLFSGAVKDLADEDFVLTTRQWAAVGEATAAAGATIP
                     SSFAARPPDFVKNRQACTADTWSFWLQYIAPVLLDGLLESRFYKHFMRFLSLFRECLA
                     YEMPRERLAGLKTDWIKWGVDFYRLYHENKPSHLHVCSAQVHSVFHFGLIIEMMGPIW
                     VSWQFAMECYCGDLGRNLRNMRHPYASMSQRILAKSHLQHIANKYDLHWGGRGRVSDD
                     EAPKRYETVLPSYAHYALSSPTNDAQGVIRHNLMNKLINTMTTQHDIPPTVELRALVS
                     KGKLRVWNRVRVLNGGDSIRVSRMDTAEEDRRCASFVSYMVSIDWNRRHPTRHVEFED
                     HLCYGELLNLITIDLPHHPKSSDTPPVTLAFAHIKPAVSHKHRIGNHEWSYYKEYQAE
                     EMVDLASVNELVGRVKSISKPGTTYIIDRGTPYSRVSLVFHHLPSSSSSSSSSSSSSS
                     SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPLSLIFLPT
                     DLLSCSYPPSLPCYYLLYLCHGHSLLSPLFRFTSVLSRLFYIFSSFIVLSSSLFFV"
     gene            complement(176065..178418)
                     /locus_tag="CNL04230"
                     /db_xref="GeneID:3254731"
     mRNA            complement(join(176065..176529,176595..176790,
                     176843..177102,177165..177497,177556..177617,
                     177672..177752,177803..177983,178044..178186,
                     178256..178418))
                     /locus_tag="CNL04230"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_024658821.1"
                     /db_xref="GeneID:3254731"
     mRNA            complement(join(176065..176529,176595..176790,
                     176843..177102,177165..177497,177556..177617,
                     177672..177752,177803..177983,178044..178418))
                     /locus_tag="CNL04230"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_567975.2"
                     /db_xref="GeneID:3254731"
     CDS             complement(join(176311..176529,176595..176790,
                     176843..177102,177165..177497,177556..177617,
                     177672..177752,177803..177983,178044..178199))
                     /locus_tag="CNL04230"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_567975.1"
                     /db_xref="GeneID:3254731"
                     /translation="MTSQALIQAEAFESQKFLTWFKESGGWYNEELVDIVSVPGMGYG
                     AVAVKDIEEGTPLFHVPDDLILSAYTSDLKDHLDASEWDQLNKGWAQLILVMMWETIK
                     GSKSRWAGYLANMPVLFETPMFWTERQREQLSGTDIADRIGREDAEAEYTSVLAPFIK
                     AHPDLFPVDSPHITMDAFHIQGSRILSRSFTVPLHRFGRSHSQSRSDGNSEKESDDED
                     EEEMVVMIPFADMLNAAWGKDNAHLYVDEDTIEGFDEGVVMKSTQLVKQSEQIYNTYD
                     SPPNSELLRKYGHVDVLPLPSDMLDLLNETELGSWPYGNPGDEVLLQGDLIVGCVTTK
                     LGGAHMKATLQDRIDWWLEEGQEDIFPLNFSHDIDDGLISFIRLLLHDSDWDRAHKKG
                     RMPRAIIDETVADVLHEIINQRLAQYKQNIEHDLKVVRSSYHGADDKPVTSLGRNESA
                     AVVRLGEKRILYLARRKIAQATAGQKSSQKRKNNSTLMGKGKRIH"
     CDS             complement(join(176311..176529,176595..176790,
                     176843..177102,177165..177497,177556..177617,
                     177672..177752,177803..177983,178044..178079))
                     /locus_tag="CNL04230"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_024514654.1"
                     /db_xref="GeneID:3254731"
                     /translation="MGYGAVAVKDIEEGTPLFHVPDDLILSAYTSDLKDHLDASEWDQ
                     LNKGWAQLILVMMWETIKGSKSRWAGYLANMPVLFETPMFWTERQREQLSGTDIADRI
                     GREDAEAEYTSVLAPFIKAHPDLFPVDSPHITMDAFHIQGSRILSRSFTVPLHRFGRS
                     HSQSRSDGNSEKESDDEDEEEMVVMIPFADMLNAAWGKDNAHLYVDEDTIEGFDEGVV
                     MKSTQLVKQSEQIYNTYDSPPNSELLRKYGHVDVLPLPSDMLDLLNETELGSWPYGNP
                     GDEVLLQGDLIVGCVTTKLGGAHMKATLQDRIDWWLEEGQEDIFPLNFSHDIDDGLIS
                     FIRLLLHDSDWDRAHKKGRMPRAIIDETVADVLHEIINQRLAQYKQNIEHDLKVVRSS
                     YHGADDKPVTSLGRNESAAVVRLGEKRILYLARRKIAQATAGQKSSQKRKNNSTLMGK
                     GKRIH"
     gene            178595..183294
                     /locus_tag="CNL04240"
                     /db_xref="GeneID:3254837"
     mRNA            join(178595..178907,178963..179012,179062..179076,
                     179143..179158,179217..179423,179489..179561,
                     179612..179718,179790..179876,179942..180013,
                     180067..180105,180159..180220,180285..180311,
                     180372..180524,180584..180629,180677..180829,
                     180889..180906,180949..181072,181129..181153,
                     181202..181301,181346..181371,181434..181479,
                     181527..181538,181598..181626,181682..181749,
                     181805..181852,181903..181971,182034..182098,
                     182149..182211,182249..182286,182335..182409,
                     182459..182529,182583..182601,182655..182745,
                     182803..182895,182944..182999,183050..183294)
                     /locus_tag="CNL04240"
                     /product="mismatch repair-related protein, putative"
                     /transcript_id="XM_024658143.1"
                     /db_xref="GeneID:3254837"
     CDS             join(178694..178907,178963..179012,179062..179076,
                     179143..179158,179217..179423,179489..179561,
                     179612..179718,179790..179876,179942..180013,
                     180067..180105,180159..180220,180285..180311,
                     180372..180524,180584..180629,180677..180829,
                     180889..180906,180949..181072,181129..181153,
                     181202..181301,181346..181371,181434..181479,
                     181527..181538,181598..181626,181682..181749,
                     181805..181852,181903..181971,182034..182098,
                     182149..182211,182249..182286,182335..182409,
                     182459..182529,182583..182601,182655..182745,
                     182803..182895,182944..182999,183050..183208)
                     /locus_tag="CNL04240"
                     /codon_start=1
                     /product="mismatch repair-related protein, putative"
                     /protein_id="XP_024513821.1"
                     /db_xref="GeneID:3254837"
                     /translation="MPVPAQLRTIAPEKIKAAVSPSAISAFTQTRHRPGAGSANNKLQ
                     ATTRPSTRASARIEDVSSYVVALLQGKGHGVEIGIAAISLLTGQTVITQVADNASFEK
                     TVQQLYSHPPNTIIVPDTMLKSGAAEASYGDQRDINVKEHLMSRLEDEYEIECIGVDR
                     SHWNRETGRDFVEDLAVDDELKASILMAIENKFYALCALSGLFRYLQVWRNIEFPERS
                     LRMKYVVSEGTMFIDIETAKNLELVRNNLTNKATHTLYSVLNHCHTPMGMRLLRTCIL
                     QPSNVLSDIEGRLDAVQELVTAQEKLTVLRSKLSVMSKMDLESIVAQISHQNLSQTDV
                     AMTDRRISLLLNLVDYLQSVKSINAELAGGHCKLLGMIARRLSDKQLGKLSSIINNCL
                     SRDSTTLRKNGKHQNARIARLFAVKAGFAPLLDVARQTYQENLQDIYDLELEVNGKYG
                     LSCQVESVGGTFQFSIPSGQPENLLPSEFIGTEKAKHKIRFTSQELLKRCAKLSQSHQ
                     EVLLISGQTINDLIAQVKGNLGGLYHCAEAIASLDMIASFAFSAFNSNYIRPDFKDTL
                     AIHGGRHPILDNLLGAGDCIPNNVYAARGSATFQIIQGPNMSGKSTYLKQVGLLTVQA
                     MIGCFVPAEYACFTIHDALLSRLSNDDSMEKCLSTFASEMAASAMILGLASPRSLVLI
                     DELGRGTSSLEGMGLSYAIAESLIRRQSFVFFATHFQDLAVILGNLSGVVKLHLKVQH
                     CNTETLSPTEFGSTFAYKVAEGAAPMVHYGLEIAKLAALPSTVLQRASEIATQLSELE
                     EQGRRSNLANTSMRRRKILWELRAKLKQVQSNSRLDNETLGEFLLNLQAQCYLTLRQS
                     LEMVQTTTSGSETGH"
     gene            complement(183251..184740)
                     /locus_tag="CNL04250"
                     /db_xref="GeneID:3254815"
     mRNA            complement(join(183251..184023,184076..184187,
                     184251..184448,184499..184582,184633..184740))
                     /locus_tag="CNL04250"
                     /product="bud site selection-related protein, putative"
                     /transcript_id="XM_567977.2"
                     /db_xref="GeneID:3254815"
     CDS             complement(join(183294..184023,184076..184187,
                     184251..184448,184499..184582,184633..184717))
                     /locus_tag="CNL04250"
                     /codon_start=1
                     /product="bud site selection-related protein, putative"
                     /protein_id="XP_567977.1"
                     /db_xref="GeneID:3254815"
                     /translation="MSTVGQKGTYQDGERILSIQSHVVSGYVGNRAATFPLQTLGYDV
                     DVINTVQFSNHTGYGFTDGHKTSPDELAAIFNGMAVNGLLTHPRILTGYIPSAEALSV
                     VTDRIRRMKADNPSLIYLLDPVMGDIGTGLYVSRDVVPIYKEMLNLATIITPNQFEVE
                     LLSGIAITSLETLQNALEKLHTVNQLPHIAFSSIPLPISLVESLSLPAPPPSYTRLLP
                     QPLPPWYDAVGTGAPDDEVLVCFASSWFDGQMETYAFALPTIRGYFSGVGDLFSAMVL
                     AHFKDPKANPNLPPLPWAVSRALLTVQQILLQTHVHSLAQAEVFGTATPRPLHHPSDP
                     LPADSVIPSDTELDALKPLNPKDPKRKARRMRLRELRVVQERALIQDGGEGWPGKRID
                     WTHISEQLEK"
     gene            complement(184993..187734)
                     /locus_tag="CNL04260"
                     /db_xref="GeneID:3254889"
     mRNA            complement(join(184993..185317,185374..186767,
                     186817..187019,187076..187154,187252..187334,
                     187397..187429,187486..187553,187604..187734))
                     /locus_tag="CNL04260"
                     /product="heat shock protein, putative"
                     /transcript_id="XM_567978.1"
                     /db_xref="GeneID:3254889"
     CDS             complement(join(185237..185317,185374..186767,
                     186817..187019,187076..187154,187252..187334,
                     187397..187429,187486..187553,187604..187666))
                     /locus_tag="CNL04260"
                     /codon_start=1
                     /product="heat shock protein, putative"
                     /protein_id="XP_567978.1"
                     /db_xref="GeneID:3254889"
                     /translation="MLSLSRTLRSTQAINPLRSVARTTSPLLASKRFNSGKVSGPVIG
                     IDLGTTNSCVSIYEGGAPKVLENAEGARTTPSVVAFTKDGERLVGQPARRQAVVNGEN
                     TIFATKRLIGRKFKDAEVQKDITNVPYKIVAHTNGDAWVEARGEKYSPSQIGAFVVNK
                     MKDTASAYLGKPVKHAVITVPAYFNDSQRQATKDAGSIAGLEVLRVINEPTAAALAYG
                     LDKNDSAVIAVYDLGGGTFDISILEMQKGVFEVKSTNGDTHLGGEDFDIALVNHILAE
                     FKKETGIDVSGDRMAIQRIREAAEKAKCELSSAGATDVSLPYITATAEGPQHINLNLT
                     RARFESIVKPLVDRTIEPCKKALSDAGIKASEINDVILVGGMSRMPKVVETVKSTFGR
                     EPSKGVNPDEAVAIGASIQAGVLAGNVTDILLLDVTPLSLGIETLGGVFTRLINRNTT
                     IPTKKSQTFSTAADGQTAIQVKVYQGERELVRDNKLLGDFQLTGLPPAPKGVPQIQIT
                     FDIDADGIVNVSAIDKATNREQSMTIASSSGLSDNEIEQMVADSEKYAEADKARRLVI
                     EEANKGESFVVDTEKSMTEFEAQLDATEREKVKKLLGELREIAAKGAAGDASVKAEDI
                     RQALDAAQQASLGLFQKVYEKRNAESHDNNTESSESTEGEKKQ"
     gene            complement(187971..190202)
                     /locus_tag="CNL04270"
                     /db_xref="GeneID:3254899"
     mRNA            complement(join(187971..188088,188149..189018,
                     189067..189134,189187..189284,189336..189533,
                     189585..189788,189843..190061,190115..190202))
                     /locus_tag="CNL04270"
                     /product="DNA dependent ATPase, putative"
                     /transcript_id="XM_567979.1"
                     /db_xref="GeneID:3254899"
     CDS             complement(join(188012..188088,188149..189018,
                     189067..189134,189187..189284,189336..189533,
                     189585..189788,189843..190061,190115..190183))
                     /locus_tag="CNL04270"
                     /codon_start=1
                     /product="DNA dependent ATPase, putative"
                     /protein_id="XP_567979.1"
                     /db_xref="GeneID:3254899"
                     /translation="MSRRSRAGGAVRGPSSALTSFLAGLGVEPSHRINAWGDRSAVET
                     PTSNGSNQHPDPANVVSDENVEAGPSRVGLGTPSLDEEGDLPVGFKRERGTNGDEDYK
                     AKRVRAASIDSDDLDADDTPVVGHSARTPKSAPQSSTNVPAGPMRPIGEFMVCGECTK
                     RFTVTAYTKEHPTNSQTYLCVQCCYALGIDPFAKPKKAAPKKAVKKQNRAKIVHYEQR
                     RGVNSLGDICIQLVGKYIENVEQLGDIGSINMDKVCRIICKGRRLTPETAPLFYSVER
                     DSLDMYDCTRLTPEAFFTLANLCPNLQTLRLDLVGQMSTEVVSHWAKSLKQLKRIELH
                     APFLVRKEAWIELFQAAGERLEGFLVTQSPRIDRETVHQLVKNCPNLTELRLAEIGRL
                     DSEMLKELKPLKKLRLLDISSPADSLTDDAIVDLLEAVGDSIEDLNLADNFDLTDAIL
                     PAIVKYCPRLQSLCLRNLTELTDEGVTAFFGSLQAKGHQGLRCIDMEKGHELRDSALG
                     ALIAHSGETIEWLSLLGWKEVALEALNALVRCKNLKYLDVGWCRAVNNFWVKDVLDGC
                     HAIEQVRVWGCNELSDGVPRKKGVKVIGIETHSI"
     gene            190442..191223
                     /locus_tag="CNL04280"
                     /db_xref="GeneID:3254754"
     mRNA            join(190442..190623,190672..190759,190829..190901,
                     190953..191012,191076..191223)
                     /locus_tag="CNL04280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568211.2"
                     /db_xref="GeneID:3254754"
     CDS             join(190467..190623,190672..190759,190829..190901,
                     190953..191012,191076..191165)
                     /locus_tag="CNL04280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568211.1"
                     /db_xref="GeneID:3254754"
                     /translation="MATHRSAVLNDKPYSDPNPLPSNVPHVDELGVTSAPLKSASFFI
                     GQHCKEVNEDFMLCKQENRDPAHCLAEGRKVTRCAQELINKLRETCLTEFDAHWQCLE
                     KNNQYFQACRKPEKALNQCVFTKLGLTKNIPGSPEGRPQIHEKESPIYSRVQK"
     gene            complement(191192..192174)
                     /locus_tag="CNL04290"
                     /db_xref="GeneID:3255026"
     mRNA            complement(join(191192..191469,191525..191760,
                     191812..191857,191910..192006,192059..192174))
                     /locus_tag="CNL04290"
                     /product="20 kda nuclear cap binding protein (ncbp),
                     putative"
                     /transcript_id="XM_024658144.1"
                     /db_xref="GeneID:3255026"
     CDS             complement(join(191228..191469,191525..191760,
                     191812..191857,191910..192006,192059..192118))
                     /locus_tag="CNL04290"
                     /codon_start=1
                     /product="20 kda nuclear cap binding protein (ncbp),
                     putative"
                     /protein_id="XP_024513822.1"
                     /db_xref="GeneID:3255026"
                     /translation="MAQVVPCLDHPSSYRDSRSEIDRETERRLLALSSTLYIGNLSFY
                     TTETQMYQLFSTCAKPEIGGGIKRIIMGLDRNTKTPCGFAFVEYFLHEEAVDCMRYIS
                     GTKLDERVIRCDLDPGYKEGRQFGRGRSGGQVRDEFRQEYDSGRGGWGHQRLEEERRR
                     QEQDRLRSQMQFDTYAAVGGLGLAGADVPRGEDFFGDRQKRGRSEDEEEIERREDEKR
                     LRGERDDE"
     gene            192305..196821
                     /locus_tag="CNL04300"
                     /db_xref="GeneID:3254790"
     mRNA            join(192305..192362,192404..192814,192864..192936,
                     192976..193303,193354..193675,193723..193830,
                     193889..193990,194032..194365,194417..194583,
                     194634..194932,194980..195094,195145..195301,
                     195351..195366,195419..195493,195563..195869,
                     195923..196280,196339..196444,196506..196821)
                     /locus_tag="CNL04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_567981.2"
                     /db_xref="GeneID:3254790"
     CDS             join(192327..192362,192404..192814,192864..192936,
                     192976..193303,193354..193675,193723..193830,
                     193889..193990,194032..194365,194417..194583,
                     194634..194932,194980..195094,195145..195301,
                     195351..195366,195419..195493,195563..195869,
                     195923..196280,196339..196444,196506..196620)
                     /locus_tag="CNL04300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567981.2"
                     /db_xref="GeneID:3254790"
                     /translation="MADNSNLSDADKIRLKRLARLGTSTPIPSQTQPQQQPSSSSTPE
                     PHHPPSASSRLLANLPPAASPTSSSPAIVSPKPSASTKPDPQAVQPKLSVTPSLSLKR
                     PSSASTPRDEPVGPRIVHTKPIQPLVKTEYKAWETEKVGQVFAVTLSKQKAQETDWSL
                     CWLKDLEQELNEENYPSPLRTDIELADRLLIARLSMDPTLMAQSDDPDALTILAGLPQ
                     NETVFEYLAGCWKRLYQASRDANRYAFSEDEKSQWGKSMDKIKGLVVSYCGMTIEDPT
                     MFPQPAEKPLGPAEFLPLLLSVHQPSSGDLLMSTPSVPTPLSGPLQPNDLLPFLQDLA
                     AGFDDDTLKDVISPTLSLFFQEWFKITPTPDIMGAEWRRYLGAMNLLVQVKHIAAFLP
                     TLPIWVAPNVTAPKLEWQSLLGPLTRLSVFPREFPEIWKTYFSNPTERKKEDIDANKS
                     NLRFTLGSLHSSLFNVYNAIVRASPDAREGILDFFTLALRLNEKRAGMRVDPRTVSSD
                     GYMTNLQVVLLKLFEPVMDARFSKIDKVDPAYYKSSKRIDISEETKIKGAKEEADEYF
                     GSSMDVDTKPNFISDLFFLLNSYLHLGVVKTISTRIRAEKNLSEIEKELKRVEASTGD
                     WANNATLQAQGEATIKKLKSDMSVLHASIHAYDTQLLDRDMIRMVVSFLSFVMTWLIR
                     LVDPNHQYPASPLNLPLPKEAPMAFRMLPEFFIENIAEYFEFLAKYDPDALDDVDKDI
                     FITFAITFLSPNYVNNPFLKAKLVTIISYGLYPMGYWRHGPLFDRLSILSVATDHLMP
                     TLIRFFIDVEITGGHTQFWDKFNFRRDIGHIFKAMWTNPLHREAFVKSRHDDFDQFIR
                     FVNMLMSDTTFHLEESLTGLAKIGQIESQKANTASWEALPQSEREDLDGQLRQTEGSV
                     PWHTQMGLSNVKLIRDFTATTREPFVAPEIVDRLAASLDENLTALVGPKMSDLKVSNP
                     DKYYFKPKDLLAAIAQIYLNLSVESEFIRAVANDGRSYSKDLFMKFARTLKNRAIMTE
                     GEVAEVISFTQKIEDMKATISMEDEREIPDEFLDPLLSTLMKDPVILPVSRVTIDRGT
                     IRTVLLSKEVDPFNNVPLKYEDCIPDTELKAKIDAWLAESNAKQADSVMDVDQL"
     gene            complement(198033..200425)
                     /locus_tag="CNL04310"
                     /db_xref="GeneID:3254789"
     mRNA            complement(join(198033..198351,198411..198606,
                     198665..198986,199043..199453,199505..199728,
                     199791..199882,199946..200126,200183..200425))
                     /locus_tag="CNL04310"
                     /product="monosaccharide transporter, putative"
                     /transcript_id="XM_567982.2"
                     /db_xref="GeneID:3254789"
     CDS             complement(join(198165..198351,198411..198606,
                     198665..198986,199043..199453,199505..199728,
                     199791..199882,199946..200126,200183..200345))
                     /locus_tag="CNL04310"
                     /codon_start=1
                     /product="monosaccharide transporter, putative"
                     /protein_id="XP_567982.1"
                     /db_xref="GeneID:3254789"
                     /translation="MFFKRNSTDTPKPPKHAPDRDTIPSLEDLGVQLHPDTARYVADS
                     EALAHAIGGNGLKDVFSSGLVLIASFATCMGGLLFGFDQGILTIVLTMKQFLGQFPDI
                     DPDVSSSAAFHKGLMTALLELGALIGALQAGFVADKYSRKSAIGLGSVWFVIGAILQT
                     SSFSYAQLVVGRLVGGLGVGLLSAVAPMYISEIAPPNIRGALLAMEATTINGGIVIMF
                     YITYGSRHIPGDWSFRLPFLVQIAPCILLIFGLWKLPYSPRWLAQAGRDEDALHALVR
                     LRGYPATDPRLQAEWISIRAEAIQNREVIVKSHPSLQGEDFMSEFKLEIASWIDMFKP
                     KLIRRTIIGPTLMMFQQFSGISALVYYSPTLFEQLGLDYTMQLDMSGVLNIIQFVATG
                     LAFFILDRVGRKPPLLFGSVATTICHVIVAVIMAKFSHDWVRYNKEAWVAVAFIFIYI
                     FSYGVGWSPVPWAMPAEVHTSSRRAKGVAITTVFNWLGNFIIGLITPPMLENIKYGTF
                     IFFATFCFLSGLYVWFFCPEPMGKTLEQMDQIFHSNTAHEDNLAKSDIQAAILGISIA
                     GPLSGSAIAGKVGDKDIQQEWIENA"
     gene            203483..205108
                     /locus_tag="CNL04340"
                     /db_xref="GeneID:3255003"
     mRNA            join(203483..203755,203828..203999,204083..204239,
                     204316..204663,204723..204901,204961..205108)
                     /locus_tag="CNL04340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567985.2"
                     /db_xref="GeneID:3255003"
     CDS             join(203535..203755,203828..203999,204083..204239,
                     204316..204663,204723..204901,204961..205071)
                     /locus_tag="CNL04340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567985.1"
                     /db_xref="GeneID:3255003"
                     /translation="MVKLPSASRIRSLATVPSTATRAFATVNPTPPAAQPTKSKPRFE
                     KLDDGLTFDDFLSGDVPPENERVVLGNTKQPRLPSFLKHPIPTGASYSGIKKELRGLG
                     LHTVCEEAKCPNIGECWGGGKGNATATIMLMGDQCTRGCRFCSVKTSRAPPPLDVHEP
                     ENTAEAISRWGLGYIVLTSVDRDDLVDGGAAHIASTISKIKQKAPNILVEALTPDFAT
                     KGVNVIHTVASSGLDVFAHNVETVERCTPFVRDRRAGFSQSLKVLEEAKKGAKAAGRE
                     ILTKSSIMLGVGEMEEEIHETLRRLRASDVDVVTFGQYMRPTKRHMKVDRYVEPEEFA
                     KWKNVAEGMGFLYVASGPLVRSSYKAGEFFIENVLKKRRAAAAEHAASQLSTQPPEIA
                     AKV"
     gene            complement(205081..206965)
                     /locus_tag="CNL04350"
                     /db_xref="GeneID:3254771"
     mRNA            complement(join(205081..205378,205453..205686,
                     205737..205835,205902..206203,206269..206303,
                     206371..206441,206512..206626,206686..206769,
                     206824..206965))
                     /locus_tag="CNL04350"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_567986.1"
                     /db_xref="GeneID:3254771"
     CDS             complement(join(205143..205378,205453..205686,
                     205737..205835,205902..206203,206269..206303,
                     206371..206441,206512..206626,206686..206769,
                     206824..206943))
                     /locus_tag="CNL04350"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_567986.1"
                     /db_xref="GeneID:3254771"
                     /translation="MYEPHLVDFANQHSHDNEGMSLLEELDKIAPIKRFDAFPKVEST
                     YTIKSRRGGVLTALVGLIIFLLVLNDLGEYLYGAPDYAFQVDSEVQKDLQLNVDLTVA
                     MPCRYLTIDLRDAVGDRLHLSNSFAKDGTHFNVGTATFIKNNPSSTTPSASEIISSSR
                     RRTPNQQSSFSGIKRLFGLDSSASSNRRTSQGHTAYRPTYDKVQDGPACRIYGSVEVK
                     KVTANLHITTLGHGYMSFQHTDHHLMNLSHVVHEFSFGPFFPAIAQPLDQSYEITEQP
                     FTIFQYFLRVVPTTYIDASRRKLITSQYAVTDYSRSFEHGKGVPGLFFKYDLEPMSVI
                     IRERTTSLYQFLIRLAGVVGGVWTVAAFALRVFNRAQKHVSKAVMGEKEYIPSSFHTP
                     SPAIKQDQSGYFGNDPSATLVSRATSWVSGNSPGGGRSG"
     gene            complement(207092..208248)
                     /locus_tag="CNL04355"
                     /db_xref="GeneID:36393116"
     mRNA            complement(join(207092..207281,207330..207350,
                     207400..207482,207522..207531,207581..207656,
                     207699..207781,207826..208248))
                     /locus_tag="CNL04355"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658822.1"
                     /db_xref="GeneID:36393116"
     CDS             complement(join(207209..207281,207330..207350,
                     207400..207482,207522..207531,207581..207656,
                     207699..207781,207826..208085))
                     /locus_tag="CNL04355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514655.1"
                     /db_xref="GeneID:36393116"
                     /translation="MSGATHPHSAVDAHLSHVRAHVSRPHNKHGHLHHLHTNTMHSTA
                     TQKPATSVRTDNKPRMPSASKRSSRALPAGQTIPPPGDFTPKVWDERWDVYFHAFLLH
                     ETKHSDCYYYNGQWWFPENRRNEKTLHMFVAARWAPLDNLKYYNLHLVCPPQPCPPLI
                     PLAQRQDHGKSHVVSVSGCKTQPLRRSQQSPRGMATRLCWL"
     gene            209306..211759
                     /locus_tag="CNL04360"
                     /db_xref="GeneID:3254862"
     mRNA            join(209306..209699,209746..210504,210565..211759)
                     /locus_tag="CNL04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_567987.2"
                     /db_xref="GeneID:3254862"
     CDS             join(209451..209699,209746..210504,210565..211713)
                     /locus_tag="CNL04360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567987.1"
                     /db_xref="GeneID:3254862"
                     /translation="MLTPCRADEHWVVVELCDEIRIEAVEIAVWEFFSGVVREVRVSV
                     GGEDEEDDAEEPGQDDVAGRGHRWKQVGSFIGKNVRGSQTFSLSQPTSFHRFIRLDFP
                     SYFGSEYYCPVSSLKVYGMNQMEAFKWEQKQLSAVAKDRDRTGNREHEEEERRAKERR
                     EREKKERDERDKQEQRERELDELEKLLHEQAGRLVPELLTESGLFSSIDETAPTNVPT
                     VVSKRDGDSDSPPTNESMATSLIESTSIESTSIESPTSIESPSTSYTRAVPPRSDSSE
                     SIYAFIIRRLNALEGNSSLVARYIEEQAKVMRSMLKQVQVGWDEWKGEWEDEDRGRWQ
                     QERMRQEDRLGRVLSQLEQQRIAFDAERKAIETQLRVLADQLGYERRRGIAQLIIMVV
                     IILLGAASRSSTMDAILTPLLKEARRRRSDYYHRKSLSGPLAGLHIDMGAGRPPAIIG
                     QARPTSTTPSAHPHRHSSSTPTPRLKTSLSRAGSGHRSNTSLKRRGIVPQVPPSYRSV
                     SSSEFTFSPLSHLPPTSSPSPANIPNPNPNPRNVRVSFPPPRQTPPPPSVSSRKLAQS
                     AHLHHLHTTAAAAAAREDTERGITASMRRRRMRSSLVNDDNEQQTTVSGLGSGKADAG
                     GGGGGGGGEEAERVVGAEDNSQGEWGTDDFDTEADDFDTEAEAEAEVSKVEDQVRDKK
                     DSETDRKEQDQLGETEQQPVREKRGVQGEHVGLARA"
     gene            complement(211719..214299)
                     /locus_tag="CNL04370"
                     /db_xref="GeneID:3254991"
     mRNA            complement(join(211719..212043,212105..212413,
                     212491..212583,212642..212727,212798..213343,
                     213397..213500,213546..214299))
                     /locus_tag="CNL04370"
                     /product="expressed protein"
                     /transcript_id="XM_567988.2"
                     /db_xref="GeneID:3254991"
     CDS             complement(join(211756..212043,212105..212413,
                     212491..212583,212642..212727,212798..213343,
                     213397..213500,213546..214207))
                     /locus_tag="CNL04370"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567988.1"
                     /db_xref="GeneID:3254991"
                     /translation="MESSDPQPVRAPVISSSATSSPILFDTFLLLLLRLVYFFISRKF
                     LHSTINPTLRDISQPDTILPPTVLLPTADSSRRGGNALGLETEYNDETDDTSFTPVSS
                     YPGSPAPISVTLASSNNGFRRDDNPSYSSSNLPSYPSQGENTIELQAIGQKLKDASSG
                     VSRKVLQLSHGKRSGAGTKRVKKATRGLHRVSRILFSVCFAEGCNLLSLVVFHAIGVL
                     NARSRQVNFSVSLHFILALILVVVPLVQCLLFTYRSRDSSSTSTTPSQSSSLSFTSRL
                     LISLIPFTLYMFLFTRIPPYITAVPMNVQVVSTPSMDIDDPSSTASSIDEAIVQWSTS
                     GPEGWEQGGWLAPSLGRVVVLGVVILGSLSGFGAVRSAWNFFEHRRAGSRTLTDNDLL
                     QAERSLYRVRQDLISKRDEINRYAVPNGEGSSGWMGRIFRGENNQTASLEAELKGLET
                     MEMQVSRSLRAMKARKRRQDFGHTFRGQIYNVLGYVFAIYCAARLLMCLPSLFFAPRT
                     AEQESGEIPVEGRGNTNGDWISFFLALAISKLPRDFADIDVPTWSRGISLILTGVLIL
                     SSLTQVMRSLSKILRLTSKTVGAGFLLLSLGQLFTTYVISLLIQLRTSLPPTLPESGP
                     FGNHGNYTGIDHDDQFTDSSPKDDSLLSTLPDFRVFGRLFDIMFLLAAATTALYRYIV
                     LIASADDIGDVYT"
     gene            complement(214400..216789)
                     /locus_tag="CNL04380"
                     /db_xref="GeneID:3254836"
     mRNA            complement(join(214400..215179,215227..215703,
                     215754..215930,215979..216463,216550..216789))
                     /locus_tag="CNL04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_567989.2"
                     /db_xref="GeneID:3254836"
     CDS             complement(join(214511..215179,215227..215703,
                     215754..215930,215979..216463,216550..216766))
                     /locus_tag="CNL04380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567989.1"
                     /db_xref="GeneID:3254836"
                     /translation="MAIPQNAVDRSRASSSELSELSSEENKASKTPKTVGKKRARSAE
                     DKTAGPTKPKAKKVKASGKSAGETKNPKGSNSKKPTKEIVKKEKGAIQAKKDFVVATA
                     LGASAILHEDSDLSDIESDTERTKKQASSKVALKKKATKVAKEPKEKKEKKANGETKK
                     QTKTAGKMKEKAPKGASKNAQRGKEKTQKKTKEAEPRDAKPKSRVKKPEVIPEPPIFE
                     KVVTRLGHEEAEQRMALREFLWRFRQILSIPERSLPALDDFDRPITESNVRLISGALL
                     DVIKDELEASKDEDNEDLKETLFNFREELRYYADVPRFASIFQSLIEPLGLELPPAPF
                     DRRAEANEAALRSLFDLGDDQPAPAWATELSVPSRRGASRMPQPSEVVRMLLALVERT
                     LTTPKIKNSMETFALETQVRKEHANLLKKEQTAWEKRKQRLQEERLLCKTAAETKANV
                     SQTTKESHEHNLRVAQYNTNMRAGINQTSLRFEPLGTDLDGRIYYALSHRPVDNDSKA
                     PIGWGTGILIWGPAVAGKVTEDDNLPHSIERWSHFGKSKDVKPLIKWLEWRYKKAVES
                     AKPNGTATATHEDASPDDTLTQSISQLASHVRSQKHVRHEKDDDASSASSGLTPPPTS
                     SREEMMALINPRNYTPSAETLEDRGKSLTSRLGDVAEWLEVLEWKGLGEP"
     gene            217352..218868
                     /locus_tag="CNL04390"
                     /db_xref="GeneID:3254970"
     mRNA            join(217352..217417,217462..218430,218509..218559,
                     218611..218868)
                     /locus_tag="CNL04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658145.1"
                     /db_xref="GeneID:3254970"
     CDS             join(217670..218430,218509..218559,218611..218749)
                     /locus_tag="CNL04390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513823.1"
                     /db_xref="GeneID:3254970"
                     /translation="MIPPSIKFSRPLTTVNAVTLVALASFFFSVLYYALSPSPLLPFD
                     TLSSYNAESNKPNDAPREAYVTFLSNEDPYYFQSARLLVYALQHDPLTADPSRPVIVL
                     TTPGVPASYSRKLEAEGAIVIEKPFITSLPMVQTNPRWKDVYTKLWIFNMTSYDRLVY
                     YDADHLVLRPVDSIWEAENSWPESGLAALGSGDGGYVEDSDYFLAGFFLAIPKEEIME
                     GLLAERGYDPVFPEQNLMNKYFSRDGLRPWAPLNPIHERISPKYEHVEQGAHTIHEKC
                     WQGWVERRLAELFYERLGRMEGYWLAKESSGTIPTPDPRG"
     gene            complement(218777..222036)
                     /locus_tag="CNL04400"
                     /db_xref="GeneID:3254902"
     mRNA            complement(join(218777..220256,220310..220401,
                     220457..220528,220588..221029,221085..221169,
                     221223..221323,221377..221778,221855..222036))
                     /locus_tag="CNL04400"
                     /product="expressed protein"
                     /transcript_id="XM_024658823.1"
                     /db_xref="GeneID:3254902"
     CDS             complement(join(218909..220256,220310..220401,
                     220457..220528,220588..221029,221085..221169,
                     221223..221323,221377..221450))
                     /locus_tag="CNL04400"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514656.1"
                     /db_xref="GeneID:3254902"
                     /translation="MADTTKYGNAVEFDVDLHSIYAAYIGLFESTNTDWWEKSWGGYF
                     VSFNEFLGFGWEVMVVVDSETGKPHVAVRREQIALFARMIRTRFGESLSKDPPTTLPL
                     NPVPTRNLALRRLVTVRDLSGYRKLAASLPAAELSYLRSRVRSGEATVIEQLFYAGGS
                     SGERETGGVGVRDNGVGYTFACVKTNWWEKGGPPYGLIPGQGRTHSGSTGQGSNKGLV
                     LEIGLAVLRCANLRALGVWPPVPADNYRKSHYVVEEWVDKRANHNPPTFPRAYAFGQS
                     EFVAEKRVETILDATLNALASQENDGHANALILLTVGEPVPLPLPSSSTLPNNVLQFD
                     VLALEYNFLRRAQAQGIPGTPDRQQPLTSLASLLQTLQIPVQPFAPIGNAGNDAYYTL
                     LAFQKLVMGETRLPDILFSQPGPYASMQFPLSPRSSVALPFPQYPAVALPVPVMPAAA
                     GDSRRSSTSSNRPGSGFVQPSLPPSSSDRTQGGRYASETSTRRRPISIGDPLNIYTDS
                     SNRTSSDLRTPNGLAQDGNSGIGSQRGKRMSVVRSQTVFWDDAAYADSNSVRGAELKT
                     PLPNGLTGESTSYVQEQRSRAREGPPLSRSAGKSTWLGSQGRSISYDVAGSAGGMSGT
                     SSAANSPIDKPSGSLSNINLPHTGMKPSGLSSTSLQRDTNEGAYSSGTGSTGNTKPSP
                     GSSGEVQGMGHRVRYSTGSIQAVDEVKNGAKNGKEKKKGKGPKDLAGAIAKFWIG"
     gene            complement(222229..223625)
                     /locus_tag="CNL04410"
                     /db_xref="GeneID:3254733"
     mRNA            complement(join(222229..222626,222686..223184,
                     223240..223295,223349..223625))
                     /locus_tag="CNL04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658146.1"
                     /db_xref="GeneID:3254733"
     CDS             complement(join(222393..222626,222686..223184,
                     223240..223295,223349..223603))
                     /locus_tag="CNL04410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513905.1"
                     /db_xref="GeneID:3254733"
                     /translation="MIVSGFTSWAVPERQERRTSPISHFRLSIPTIHPSPSRFSHLPL
                     RNIQLQMPAYTARNTRVSTPRRIQITAATPSQDEDGNVVCTGHNRRCKRFVSSSTKNP
                     NRAFYVCPLPREDPKRCKFFVWEDEIHKNAKSDQAPETPCVGRSRFGGSTGQALGQTP
                     VGHSSSSVGLHTPHSLSKGKQAASVLSDNEDDLVPVEDDIDWGAVDVDGLEREAIAGS
                     QNSVKKHGTRDSISSTPTLGFNERLSSVMTGMKRDREEEDEDLRTPKKANIDSNPFVS
                     SPAGTLPPHPKLLPSISTMEQLNDELYRMDRLLQGSEKLKQGLRNRVKDLESKNKALQ
                     DRVKELEARLKQE"
     gene            complement(223859..225454)
                     /locus_tag="CNL04420"
                     /db_xref="GeneID:3254885"
     mRNA            complement(join(223859..224035,224084..224134,
                     224192..224253,224322..225454))
                     /locus_tag="CNL04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658147.1"
                     /db_xref="GeneID:3254885"
     CDS             complement(join(223891..224035,224084..224134,
                     224192..224253,224322..225116))
                     /locus_tag="CNL04420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513824.1"
                     /db_xref="GeneID:3254885"
                     /translation="MSPEKLTEENILDREETNIPSTSSSILPAPISYPATVSYRIANT
                     WLRLIASGIIAILLIHILHIQLSPMEAVEPAPPTPPPAAEAYVTFLAHSDDPRPWYFN
                     AVRRLMFQLKYDPLTLDPHPRDFVVITTPGVPEWQLEQLREEGAIIASRPLIDHLPLP
                     EKGISRYAEVYTKLFIFNLTDYERVLFVDADQLMVKPLTGIWDDPNAWPESGMAACGE
                     SKSAWDHPTPIEDQNYFNSGFMLARPDEKTFNELLQEKDFDPWFPEQNLLNHYFRRDG
                     PRPWRPLNHMFVTTFPRKVDLEAGIHVLHDKMWLPHIDREVKEVWRQKLGRMEGYWLA
                     MGRGPEAWNSTSLTYM"
     gene            complement(225640..228223)
                     /locus_tag="CNL04430"
                     /db_xref="GeneID:3254882"
     mRNA            complement(join(225640..226082,226153..226287,
                     226340..227754,227808..228223))
                     /locus_tag="CNL04430"
                     /product="expressed protein"
                     /transcript_id="XM_024658148.1"
                     /db_xref="GeneID:3254882"
     CDS             complement(join(225848..226082,226153..226287,
                     226340..227754,227808..228167))
                     /locus_tag="CNL04430"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513825.1"
                     /db_xref="GeneID:3254882"
                     /translation="MISLSRTKRLPTPLIKSSLTATPTITPSRIPTLSFSHHSRPFQS
                     LYSPRFTFSTSHGKGKNKVYDASSPLLSSPKTLATFQHLGHARYRITERLGHPPSFHT
                     SARREAIPLIPVGISVVKGASILTAATAFSRIIISFLPIGTIAAFKMIRLGRWIESGV
                     ECPTVSPKAEEFFKMWCEGEKSIKLKPEEANALIDSQPDKLGGLTLPDGRVAYSMPLP
                     PRKFRRPSQDPDIQFDVTPKMLMEHFHGNRRKVAFVIRRRYYIIPPLPSSAENYYNRL
                     ESKQQAEVDSLRRYWLGLKTFKDCFQWGRWFVATVFFLPFLLICGAYIAGLERVPLTG
                     RWRLILLTPEEEDAISTSLAGGNWYRSVINLLTTPERPAPPIVSTDDWRWAWVQSVLN
                     RLETAALTECQLIPPEQRPHNEYVSALPLPPPIYHPFKPRPRVSSLLHSVLPGGEPNT
                     GREHLEVGPPYNIMLLQKDEQNAFSYGFGGKKAGGIVIYTGLLDEILRHSSPTPQSAP
                     QIETPQSGFLSGLFSTSRTSNQNQQHHIQPTEEQNLHLACILAHEMGHLLLSHHLETL
                     SQQQVLWPSVLGFSMDLIRAFIWPLTVFLGPTVNDALANMGRTSSEELADKYGEIGFQ
                     WKHEYEADLAGLRILARAGYDPRATIGHFQSSVASLHEIQPDDKADNNTLTGAAFKLW
                     TKATHPSVEQRTDAIRKEIDRWQEEAKKLTQK"
     gene            228358..234349
                     /locus_tag="CNL04440"
                     /db_xref="GeneID:3254781"
     mRNA            join(228358..228481,228529..228763,228816..229569,
                     229623..232821,232878..233056,233108..234349)
                     /locus_tag="CNL04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658149.1"
                     /db_xref="GeneID:3254781"
     CDS             join(228368..228481,228529..228763,228816..229569,
                     229623..232821,232878..233056,233108..233657)
                     /locus_tag="CNL04440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513826.1"
                     /db_xref="GeneID:3254781"
                     /translation="MKPHPLHTTNHLRDLTPQEAQQLTAFIDKRKWFEHRLDSLEHIP
                     PVYPFIHPVLEQIPENANQCDLQFMRSGEADSQWQLPDQDQVKAWKRERDEIEEQVLE
                     FDGGDLKRMKKMTRAATLLPLTPPSTHLVSITLDLIVLIDRILSLLRRRGQILDLVML
                     RLQWDQVRWQVMSESKGLLNEVDSVVRDKARWSPAEVDVTSRGSPRYFPRSPSCRGSV
                     TPVTPKSSTPRTDTLASDLASAHLGSSPQHKQASESAVQTASPARHLSTPDRSLHIPL
                     LHSQLVNLRIRHKNITSTHLARSGAILDRMIDVASHLQNLGDVNGPCTKNESLEGGAV
                     PYQLLDLQDELDASVEELGRRVAWCGELEEHWKLSEAHYSSSFQAHQLGLELLDNLHQ
                     ALSKPATSKRHQQLSELLGKAQSCLPTPITDSFSRPFYPAYPENDEYNQHAKGALIKA
                     HTNASDIIKKGKEGVDWYSRLLSAREKVLGKHSEIKELEENIRQLLEFLERGENRIER
                     PDMSSRHCLDGNFEHWINTVPSKSAMTLQYVEQSESVCNRSTLLALQYRNLLKTPPRF
                     IREQAWWQTDLINYDLADQVDTDLNRLLELRQQTLAAVQAAKEDIEILEKAQQAFIGA
                     SLVRNEGLFIQRQLETLIQKIAYPSSQCVERNHGELNRTITQLARRIEQQVTTPFSSF
                     KGLIKCYQRHLPTLCQFLLSAISDVTNLPSQLSRSMDLLERVQNQTTIVESVEAEAQK
                     MIVNVIVIREEAEQMTGREDVIDVLDSLLAKVEELDEEARSWESKLSQRIPFLASETN
                     GLPSSNDLYTVPTAPMMSSLSRSKAPQQTSTVGLAIDDTNSAALDLASVDQSVRGAVN
                     DQVLAVGSHIAHCKSVCRSAMLDVWENRCQGRVTALEKGISSWLDLCEKTRNILDDMA
                     GRVNVQTPSYGLAQVAVQEVEDTLASLKKYITEHERILQAHLAGVEDIFNALPRWCGE
                     EEEESQGRCQRWEISKRISKDVVEDALGKAGDIVAAGEALLAKIKCQTEDIHNQQQAL
                     PDTPTPLTNTPDVLGPSVIADDTSSSPFETLKDDLDLLEQLRKQLDDLKVEELVNPIT
                     SKSSWTSTSRQLPAQAMAERIAKVLGDISESVRLLSNPSSHVTLTEAESLKQSLTSQK
                     ALMPRLEQLAQIDGAVKACDDAHSQLLDIIDNYAEQKGPLQDAARDAQQALDYVLECS
                     MPVNDDSRVCREVKRLRDTMKDLEMLVEECLDPEKLKEEDVQDAISDISRSESALSFA
                     STVQPFNPNASVSKLPRLSSSLFKPSPRSTSNPQRTPLRSSSGILAHQGKNGYRVVSD
                     TPTYVLANKSQSIVDLHPPLSLAGPTATPCATPTLPGSDPRARKSSIPRRSRISNASS
                     IASSSAATPQFAKAIPKLRRTSHLVPSIQSKVKKEYVPNPKSKLDVAIGKVINKLDID
                     VPVRPVNQDIIGSIAEWQDLSGQYWIGSEGKAKLCFCRILRSRTVMVRVGGGWVELSK
                     YLLDHFTEMMGSFPRQTTAVPSLRRSYSSTISLFNMNSPVPITSASLISRSALSSLPM
                     DESMDPKSAMHISKNNQMTPLRRAVPLAQTPEQFLSPQKAQGSLEPVPSTPRTPNSTG
                     RNASFSSTSPHSPSVTLPSGVGSPFLAFQFMRKAADSPNAREKEKEMFGAKRSSPIKE
                     KSKRNLMV"
     gene            complement(233763..237760)
                     /locus_tag="CNL04450"
                     /db_xref="GeneID:3254727"
     mRNA            complement(join(233763..235096,235149..235710,
                     235762..237375,237438..237760))
                     /locus_tag="CNL04450"
                     /product="White collar 1 protein (WC1), putative"
                     /transcript_id="XM_024658150.1"
                     /db_xref="GeneID:3254727"
     CDS             complement(join(233946..235096,235149..235710,
                     235762..237375,237438..237536))
                     /locus_tag="CNL04450"
                     /codon_start=1
                     /product="White collar 1 protein (WC1), putative"
                     /protein_id="XP_024513827.1"
                     /db_xref="GeneID:3254727"
                     /translation="MSTNLTSPQSHNTLPPGDQFNRPELRPTNSVVSSTQSPLDWSSF
                     MNFQTPPGVQGNSLGPHRSLSSLENGQPGRVSGHSMATPSVEPSSCPGDQYQSFAQGI
                     ALSQASSSAINFQAPQPRIVRPSQFSTSQQYAIDSSPRQSQAYTSPNFQFHPYASQQY
                     SHHPSPQISSPHTPADQLFKGKSPASSSSHSHSNLTPGSSVQPSHPEPLRRTSGDMRP
                     SDDGDSGLSLDLSKFPRDVRFQVPSFPTNRAPGAPPAGSQAWTEYSNTSVQSSDASQT
                     APGGLFARAACVGGPAWTMAPDQGRPFGSNENAGWNRWDQAQMKQNGLSMGVGVGMAM
                     AQMGTVYVNPNLNPAVYGQGIQSFPSNGYYGGQYNLQQGQHMQQENESGGGEVGSRDI
                     AMNSPHQYAAISGPIYGPGPPSSNHFSSPGNPHLQPHTSPSSHRAPSPRPSHDQTHAP
                     NMMSTSAILPQRPSYDQNISDHRLPHQIDFSSAASVSNPNPHRREMNFTLSSTTSYVH
                     SADGRALLQHPLLSPAQQALQDGPGLYSTTGFDMLGILGRVAARKNPSMVIGPVDLSC
                     SFVVVDIRRYDSPIVYASPNFTRLTGYELPQLLGRNCRFLQSPDGEVTKGSKREYTDN
                     EAVYLLKRSLEAGKECQTSLINYRRNGEPFINLVTVVPIPWDGPDIVYHVGFQIDLVE
                     QPNKILRNMQDGNYSVDYTYSIPPEKPLQLDGKGAAIAGLSTAVLDIMGSRTKALAAG
                     TEEGARMEWFKMILDNTDDFIHALSLKGFFQYASSSIRRSLGYEPEDLLNKNISEFAH
                     PSDIVPVIRALKDSTQTIGEEQQPKPVHFTFRIRTKNFGYVWVESMGRLVVEAGKGRK
                     AVILSGRVRNMPTLSWGKVAEHGGLAKTEFWAKISFQGLLLNLTFGVDKVLGYQAEEI
                     LGRNLFSLLPGGQNTPPSGEHLINNYASAPDIAPVAKAIYQTIHDSTHRGALSIRQKM
                     VHRSGQPVDVILVFYAPGQAKDKQSPISYSNNDESASVNFIGTPNGASTYPVKITDIF
                     VQVKLLSSSPSHQRSVQPPSIASLTQARPLVHLPNDNIFEELETGRDSSWQYELHQMK
                     MTNRRLRDSIAALKEKKAGKAKKRKYNIVDESPENQSEIIDTSLSSQIGGIGF"
     gene            complement(238949..242121)
                     /locus_tag="CNL04460"
                     /db_xref="GeneID:3255005"
     mRNA            complement(join(238949..239420,239483..239536,
                     239590..241447,241506..241702,241896..242121))
                     /locus_tag="CNL04460"
                     /product="expressed protein"
                     /transcript_id="XM_567996.1"
                     /db_xref="GeneID:3255005"
     CDS             complement(join(239137..239420,239483..239536,
                     239590..241447,241506..241702,241896..241944))
                     /locus_tag="CNL04460"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567996.1"
                     /db_xref="GeneID:3255005"
                     /translation="MPPIVSTDRWQQKLLGDWFVRLSPVDSSPDILVKDFSVTRLAAS
                     DDIPRKDGKAVNKPVGLVLGGVILGRKSSQVKERIGSGGIASPILSRSHAHITISPSG
                     HVYITDLRSLHGTSIVSAKEPSSSVVLKPFSPVQLCEQDTIVLGKKVNASNKSYAPVK
                     FAVSFRYPELGQGSLDGEREYLGELSQEDVASKFLSTSKKFLAVKAIKSTDTWKKEMA
                     TSPDYSISPGASISGKSYREPNKYGIPEWMRYSSEEPELENIPMIAVGDEDDGIISVS
                     SKSRVSQIRSDVLISDHQSVLSLSSDEDEWPRGSSNEVANGDRNEEADDNSFTDYDDL
                     GSPEVFGVHEADHSEAAKDMHAENYDWGNHALQSQDDQSEHDCWSPSYQSSPVAWHFS
                     PDLSDYDNEADEQQKSSDVAPFSTSAHDEAGALEDNNIGEANYNGEKVNNVSDETLPQ
                     EPPIRQTQADKLDSLDEEEQRESFYRAIAASFAEADAQGDAPQFDSEPLQLSYDNVIR
                     LGPTNSSCQQPPASEFSVYGSEQGLFRNEKAASAKKRAELPYSYESEDEDEDDDEDDS
                     NYDDDAASGEDDMIIVYSSEEEEDDLDDRSIGDEAVDASPTPFSPRPKKNSDCFIREK
                     RPRQEVVPNKYLGDKFLTGKITMDVETTAAQEVITSSSSSEADSRDLPSSEGKKLDLH
                     RDIEEEVAVFLEQSQQMLAAHAAVMNELSRQETTEACGLQPTSSPSSSSSSEGLVTPV
                     IGRKRSLPLEFNEHEEPTIVEETSAVHLGPIEASNPTGPPAKRRNVASTVGLVVLGAA
                     LGSIGTIAGLMQLAE"
     gene            242942..244659
                     /locus_tag="CNL04470"
                     /db_xref="GeneID:3254959"
     mRNA            join(242942..243205,243253..243374,243424..244294,
                     244346..244416,244467..244659)
                     /locus_tag="CNL04470"
                     /product="ubiquinol-cytochrome C reductase complex core
                     protein 2 precursor, putative"
                     /transcript_id="XM_567997.2"
                     /db_xref="GeneID:3254959"
     CDS             join(242984..243205,243253..243374,243424..244294,
                     244346..244416,244467..244485)
                     /locus_tag="CNL04470"
                     /codon_start=1
                     /product="ubiquinol-cytochrome C reductase complex core
                     protein 2 precursor, putative"
                     /protein_id="XP_567997.2"
                     /db_xref="GeneID:3254959"
                     /translation="MYSLNRLPRSSAFKNSANLLRRNASTTSAGGVNVVGFENKGPAA
                     TSSLTVAIKAGSRYETTPGVAHVLKSFAYKATASASALRTAREAELYGGVLSAALTRE
                     HLLLSAEFLRGDEEHFLNVLASVLSSSQFYQHELNELVIPVVEAETISAQATPSAIAL
                     DLAHSLAFRRGLGNSLYANKNYPVSIDDVKTFGEAAFAKSNIAVIGTGISTEVLAKSV
                     GNAFGTGTSSSSKLSTPKAAYYGGETRVPLDIHAPATAAPTMVIAFGTSAPPSADLKV
                     LKHLLGGETSVKWTPGASPLAQAADKIPGASAKAFLLPYSDASLFGVVLSAPTSAETK
                     ALAQEVASIVKGAGEFKEEEVKRAVAKATFEDAASTETLSGFVAAAGPAALIGSVPEA
                     QSFSGVSASSISKAAGELLKGKPTVVSIGNISVLPYGDELGL"
     gene            complement(244529..245849)
                     /locus_tag="CNL04480"
                     /db_xref="GeneID:3254761"
     mRNA            complement(join(244529..244629,244686..245481,
                     245535..245623,245706..245849))
                     /locus_tag="CNL04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658151.1"
                     /db_xref="GeneID:3254761"
     CDS             complement(join(244587..244629,244686..245481,
                     245535..245623,245706..245755))
                     /locus_tag="CNL04480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513904.1"
                     /db_xref="GeneID:3254761"
                     /translation="MQTKLPPLLQATSGALGSAVGNCIVFPLDVATTRMQHASKKPKA
                     MRLSLILTLHRLLSRRHAMTRIYSGLKADTLSTLLSSFIYFYTYTALQKGLHQYRLKQ
                     AIYQAAPSPAGVGGLSSKASDTASTERTPLEELIIGVLAGVTSKGITLPISTVSVRQQ
                     VSESGEDEKRSALQTLLAINKEDGIRGLFSGFGPTIPLTLLPSLTLYIHSFLLRILVP
                     ERHRAHPPGVVTFFLGALSNALATIPLYPLILVKVLYQSGKEKENDKENQEESMFSTI
                     RKFIRKEGIEGLYVGLEGQLVKGFVSQGVMMLVKQRVEERTIRFYRARS"
     gene            246046..249130
                     /locus_tag="CNL04490"
                     /db_xref="GeneID:3255016"
     mRNA            join(246046..246276,246330..246350,246408..246439,
                     246498..246505,246554..246620,246678..246737,
                     246788..246853,246910..246993,247043..247119,
                     247168..247278,247327..247456,247512..247661,
                     247711..247784,247839..247916,247969..248092,
                     248156..248171,248235..248401,248456..249130)
                     /locus_tag="CNL04490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658152.1"
                     /db_xref="GeneID:3255016"
     CDS             join(246141..246276,246330..246350,246408..246439,
                     246498..246505,246554..246620,246678..246737,
                     246788..246853,246910..246993,247043..247119,
                     247168..247278,247327..247456,247512..247661,
                     247711..247784,247839..247916,247969..248092,
                     248156..248171,248235..248401,248456..248953)
                     /locus_tag="CNL04490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513828.1"
                     /db_xref="GeneID:3255016"
                     /translation="MACPPPSGKGKDTVKTEMSSEERAAADAKQRSFERSLAGPSVGK
                     AGITRDQTEINRIIAEASKGSKFYNNQVRKDQELTEKIAWYRNKRDELMRMAPRDQLE
                     DEADRILMEVEATRDLSQTIIHVDMDAFYASVEVQRDPSLKGKAFGVGKGVLCTASYE
                     ARKFGVRSAMAGFIAKKLCPHIILTDLHFDLYTKASKAVKEVLVQYDENLMMASLDEG
                     YLNITPYMSTHNMTASEVVTEIRAQVEEKTSLTISAGIAANRMLAKICSDKNKPNGHF
                     ELAFDRATIVRFMRDLPVRNIPGFGRVTERCLEGLGIQTCGDIYEKRVDLLLMDHWFG
                     FRGLCRAYLGIADNTVAPGRREERRSVGVERTFRDKTDDEDIMATLIDIVEELGKDLD
                     RLQYAGKTVTVKYKLHTYENKTRAKSIPKYISSATDILPIAQELLKKELPLRIRLLGV
                     RLSTLKDLTIPDKGIKGFFKAAEDKAKTGSPITGHTLETLEHIPEMMRLEADNAQGDS
                     FGAGEASGSEGIGADDFKILPATTKKRKSPSPTRDAPSPTAGPICPICGQALDAGTSN
                     QQLNDHVDWCLNKDAIKEASRVSPVAKKKAKIGRTSERTSSNVTGPSKKDGSKGEKGT
                     ISSWLKKG"
     gene            complement(249088..251458)
                     /locus_tag="CNL04500"
                     /db_xref="GeneID:3254753"
     mRNA            complement(join(249088..250524,250578..251458))
                     /locus_tag="CNL04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_567999.2"
                     /db_xref="GeneID:3254753"
     CDS             complement(join(249349..250524,250578..251405))
                     /locus_tag="CNL04500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567999.2"
                     /db_xref="GeneID:3254753"
                     /translation="MSVCGNSPTPPPPPPPNAIHMHPPQVTPSAASHTSHPTHHTPDA
                     RAQQYSIRRAYSTPSIAFPLPHQAPPSSALTHASYTSNMSENITRYTPGGTPQSSASR
                     PGNGNSKFPPSFDSPTPHGARYNSAVRMDGIEGAEMLESGDLAGIQPPATFPLPEYPA
                     SFMRAEPVPTEETEELQRFLPNDGSVRKYRYGGASCNPWDYMLGDVPDADYDHPLSSR
                     PARYGPDAKHGCKVRRRFTKRELEALEVLWSIAKSPSKYERQRLGAWLGVKTKHITVW
                     FQNRRQEEKRYSRDGHHDAPPPSRSNRGTFDPVTGKWRPVPASCISGLQPPPDDKIAV
                     VRAISLGDVTRDMWLNKYPSSSGRGMTASARVSPTPMSLAATSRGRTIKNAHTTPLLP
                     RNQSRSLDQVLQARESSFGTGAQKRYRRGSGEFVIKGEGQDRIKEILSLMPSDPPSMG
                     LAESDVEESDEDDGGIDEDVEKRKRAKQAKASSTLAGLGRATPYDVLASSSRAKLLAK
                     PISEHSSRNPVLSQLNPNLSHFAPPSNLRKHTLESVATNQPTKRHRSRVTGHPNPNFH
                     AGSRTKDFNRSVSTSALPRSSRVAEGQGSSSSSYLPSQLKTPNLGYTRSHSVSSSSSR
                     VITPEDVKDKREGPQMRGQARGQEKDQEVIGAAEMLLQLFGGS"
     gene            complement(251497..254245)
                     /locus_tag="CNL04510"
                     /db_xref="GeneID:3254801"
     mRNA            complement(join(251497..251772,251852..251972,
                     252046..252060,252110..252377,252424..252432,
                     252498..252509,252560..252595,252645..252699,
                     252740..253025,253074..253156,253203..253412,
                     253463..253506,253556..253716,253780..253806,
                     253862..254245))
                     /locus_tag="CNL04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658153.1"
                     /db_xref="GeneID:3254801"
     CDS             complement(join(251627..251772,251852..251972,
                     252046..252060,252110..252377,252424..252432,
                     252498..252509,252560..252595,252645..252699,
                     252740..253025,253074..253156,253203..253412,
                     253463..253506,253556..253716,253780..253806,
                     253862..254185))
                     /locus_tag="CNL04510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513829.1"
                     /db_xref="GeneID:3254801"
                     /translation="MNRPILTLARRIPSRSRPFSSTFHRLNIPSWPNPPVPQSPVGPS
                     GNLSSSPQQSEQYRYHGKQEKTFWTEWLSSPSFQAALTTIVGLGIVFGGGMAYLEWYK
                     AHVLHRIMRAFEPGYDPALELSKLNGPNASHVKRREQPLIDGIVRGEEKGGYYLVIGP
                     KGTGKGTMILDAMRKINADGVSFCEAHPDLEVFRLRFGKALDFDYYEDWQGSLFSRAD
                     PRNGGPALDIERALNKLEKVALRYALKNGRPLVMVFNNIHLFPNTPEGHGILHQLQQR
                     AEAWAEGGILTMVFSSDDYWCLDVMKKNASRMRILSVYDLSAAESLRALRHLRRQELA
                     NQSARSLVSGDLELENDSVLRRVYELVGGRTSYLARVARADDMLGAEEAQAMIEDEKQ
                     WLLSKIGLIPEHDDDVMDEQKWASCSWLILRHLANAAEPLPPYPSIFPPIPLESPDDA
                     HLEKEDDHKRSSSAVNVTPPREISSADIHLPKVTYEEARRIMTRADFLEALDHYHIVS
                     IDIHHNVRPDSTLLLRAAQQVVAEEGFDDALDQTRDRVDQIEGLHRQNELTVKEPFRV
                     TFDKRDGKPVWEVVGLGESFVPEEKEEEERLV"
     gene            254384..260858
                     /locus_tag="CNL04520"
                     /db_xref="GeneID:3254841"
     mRNA            join(254384..255014,255065..255204,255253..255392,
                     255454..255522,255571..255810,255864..255962,
                     256017..256096,256157..256210,256273..256356,
                     256403..256499,256548..256676,256726..257055,
                     257112..260063,260115..260421,260478..260858)
                     /locus_tag="CNL04520"
                     /product="centromeric protein e (cenp-e protein),
                     putative"
                     /transcript_id="XM_568001.2"
                     /db_xref="GeneID:3254841"
     CDS             join(254470..255014,255065..255204,255253..255392,
                     255454..255522,255571..255810,255864..255962,
                     256017..256096,256157..256210,256273..256356,
                     256403..256499,256548..256676,256726..257055,
                     257112..260063,260115..260421,260478..260617)
                     /locus_tag="CNL04520"
                     /codon_start=1
                     /product="centromeric protein e (cenp-e protein),
                     putative"
                     /protein_id="XP_568001.1"
                     /db_xref="GeneID:3254841"
                     /translation="MSLSPNKSTLSRQPSSPSLAVGLPPALPESNIMAPSTTSPSKLP
                     KSRIHRGDVESTESSDAEEDVRNHTKTPKRKVINTEPVSMSSSNKAKKRETLAERLAA
                     AAVGNIKVKVKSSSSVNDGLKASNSASTLTTASASTSAMVQTPPAQARTSMMIPSTMP
                     AQRTSRPSSGSNSSDKVVVCVRIKPTQSSFSSMAYEITSTSLTLSDNHPKVKQRGGKA
                     GREDTYTYTFDKLLEYPSKTPELYVDKVAPLIDKAMNGFNSTVFAYGQTGSGKSFTMT
                     GIPTELGIIPCAVDGVFDAITEEPDRAFLLRVSYIEIYNETLRDLLNFKKGPLRDDEK
                     PSIHTSKGKVYVEPLVEEIVSTPEDVMELLEKGNAQRRIGATDWNERSSRSHCVFTIV
                     IESRPRDGDGDEDIRLSRLNLIDLAGSEKAVSDSERRGEGKHINQSLLALREVINKLT
                     EKTKASHIPYRNSKLTHLLENALGGDSNICVICTLSAEEEHCGETLETLKFAGRCSQV
                     KTNAKKNILPASERALIRAKDQEIEELRARLTGLTNSRPSKMEPDTDQVTDLAESVAA
                     MEARKAKLTAQLAKLNSEILTSELPRHSSTIMGVPMSPPKPKRRRISDFSAIMSTGSD
                     RIGLGMGTPKKVDRRAVSGLTRVQEEEDAPGIMGRLSAIGDNGVPNFDHDIALATLRK
                     SLRQKEEELSLANRNLASALSRASQLSERDERIAALSSELSTTLKSLSALQATLRTTE
                     TDLRDRNSQLETTRADLVATIEDKATKIDELEEKVLELRKSREELAIEDEGRLQEVQK
                     QLDMAVKDKQEIEQRVKLLEDEAAARKKAEEGEKDARREVESIKSQLEVLQKEHASIY
                     SSAQNASTRFAEYETSISTLTAQINDLLSAKLSRETALEELRNEHAETKKQRDRAAED
                     LENFQKEAMANETKVLGELREEIGNLRRLREDEKAVWDRSKAEMEASIETLKQGEAKS
                     KARLVEALKTLEDAAQANRSLEKKLSYEAEGRRTAQEERDQAFEKLKEAAGVANAQLE
                     HEITTRHELETQLAFLKEQLDSQRAAVEALTRNLDTERQSAKELARQLDITQKEMETQ
                     ESRIEKAVDERKDVERRLSEMESALEAGEKEWRVRIEDEAHKRREAEEKLNELEKLRE
                     VGTSAETELQMKLDVEAKAREELEQRLKGVEKRHTSFKALENDLRKQLEAQVTSRENV
                     ESKLQEITLFWESENAQLRQQLQSAVSRRQEVEEDLTALQHQHDTITTSEAGLRKILE
                     VESTARRVAEKKIIQLGRQREASSSEAASLQKKLGDEQMAREELERRLQDTEGRLQSE
                     MEELRVKDEAEFKNKQEAERKFTELIEKQCISETANQDMQKRVEAEIVAQQIANDNVS
                     ALKEKLEAASSTEQRLHQRLSEESVSQAQLREQLEVAALTEQRLRQLLEAESASRQAA
                     EKELSEVFASSKTDSEKQKDLGAELAEHRTANQKLTSLEAAHTELQAQFKAHKTASEA
                     AQKDAKAEYSKEVNTLRKELLVLRESLSTAKAEASDAKTEADAHREKVTKLAKDVVEL
                     EARHKENKTLSSSTSVSARLRTLSTPGPWVNSGEMGDASIKGMKARELKGTTAGFGAG
                     ERESSMARLHVGHKDEIERLEKVVEVQKGIIDEQRMKIERWSKEMEKQREIVRLLTND
                     TTSTSLSPSSPLPPNRFRGKSHSISHSPTESPATATPAKGFPSTFTARNLALPTTPTP
                     LPMHSSQFSNASVRKGRRVTIEHDIDLLIESNKVNRAKAIFETPDKGSKQGPASPTRE
                     PLRVNQATWSIPRQRRP"
     gene            261111..262786
                     /locus_tag="CNL04530"
                     /db_xref="GeneID:3255007"
     mRNA            join(261111..261720,261775..262474,262535..262786)
                     /locus_tag="CNL04530"
                     /product="DNA-3-methyladenine glycosidase, putative"
                     /transcript_id="XM_568002.2"
                     /db_xref="GeneID:3255007"
     CDS             join(261141..261720,261775..262474,262535..262640)
                     /locus_tag="CNL04530"
                     /codon_start=1
                     /product="DNA-3-methyladenine glycosidase, putative"
                     /protein_id="XP_568002.1"
                     /db_xref="GeneID:3255007"
                     /translation="MPSTRSETAKSDPALGIPSVTRAARTNTTSTATSKRAKPDSGAL
                     SLSAGKGHLKPSKKKQKVEPSIMDIQPPSTAVDLPTVPQPTLLPPTLNFNLPSAISHL
                     SALDPRFSLFFEHLPCRPFVNLEAIDPFRTLVTSIIGQQVSWMAARAINTRFRALFGF
                     THEKEGFPSPQMVLMQDVTSLKGVGLSGRKAEYVLSLADHFASGQLSTQLLQSGTDEE
                     ISKALIAVRGIGQWTVDMFMIFSLRRPDILAVGDLGVQKGLLKWALAAHGALEKKSSG
                     TNTPKKTKGKANKGEKKEVKEEVDDKGEGELDTNIKGSTPVKHVTSSAFPPTPLTPND
                     TSENPLPKMGALHTPAAPSGASVAQGPRTPSTPSAMPRETVEVPPKTLPGPTPEVMLT
                     APLEHPDWDPHRAVPLLEGLSVDILKSRLNGKKVKGGAYLTPKEMEALTEGWRPYRSL
                     AVFYMWPVAGE"
     gene            complement(262677..267630)
                     /locus_tag="CNL04540"
                     /db_xref="GeneID:3254871"
     mRNA            complement(join(262677..263642,263692..263753,
                     263807..263934,263986..264107,264158..264286,
                     264337..264428,264479..265113,265161..265569,
                     265622..265751,265799..265817,265868..265963,
                     266016..266320,266372..266475,266525..266609,
                     266662..266739,266784..267109,267156..267198,
                     267247..267375,267432..267512,267560..267630))
                     /locus_tag="CNL04540"
                     /product="microfilament motor, putative"
                     /transcript_id="XM_568003.2"
                     /db_xref="GeneID:3254871"
     CDS             complement(join(262794..263642,263692..263753,
                     263807..263934,263986..264107,264158..264286,
                     264337..264428,264479..265113,265161..265569,
                     265622..265751,265799..265817,265868..265963,
                     266016..266320,266372..266475,266525..266609,
                     266662..266739,266784..267109,267156..267198,
                     267247..267375,267432..267512,267560..267562))
                     /locus_tag="CNL04540"
                     /codon_start=1
                     /product="microfilament motor, putative"
                     /protein_id="XP_568003.1"
                     /db_xref="GeneID:3254871"
                     /translation="MAPSKKAGKKGAVGGFLSGASKPQKVQKADWSEGFTKKKAAGVP
                     DMTLLSTITNEAINDNLKVRFQNQEIYTYIAHVLISVNPFRDLGIYTNDVLNSYRGKN
                     RLEMSPHVFAIAESAYYRMTTEKENQCVIISGESGAGKTEAAKRIMQYIAAVSGGAEG
                     GGIEGIKEMVLATNPLLESFGCAKTLRNDNSSRHGKYLEIMFNGMGQPVGAQITNYLL
                     EKNRVVGQIDDERDFHIFYQFTKGASAKMKEAFGLQGPEAYAYISRSGCLDVKSINDV
                     SDFQETLRAMQVIGLTSDEQDSIFRILATILWLGNIDFVEGDDGNAAISDSGVADFAA
                     YLLEVDSAQLQKVLLMRIMETQRGGRRGSVYEVPQNVAQASSGRDALAKALYNNLFEW
                     IVSRVNISMKPQTPSQYVIGVLDIYGFEIFQDNSFEQLSINYVNEKLQQIFIELTLKA
                     EQEEYVREQIKWTPIKFFDNSVVCSLIEDRRPAGIFATLNDATATAHADPSAADNSFI
                     QRSSMLASNPNFEARGNKFLIKHYAGDVLYTVAGMTDKNKDTLIKDILDLIEGSKDPF
                     LHTLFPDKVDHTSKKRPPTAGDKIKLSANLLVENLMNCQPHYIRTIKPNQHRSPTEYD
                     DKAILHQIKYLGLQENIRVRRAGFAYRAEFSKMIQRFYLLSPATSYAGDYIWTGDDRS
                     GCERILTDAKIKKEEWQMGVTKAFIKNPETLFYLEGERDRYWHTMASRIQRAWRAYVR
                     RKHEAATKIQRFWRNQREALVYERKRDYGHQVLAGKKERRRFSLLGMRKFMGDYLDIA
                     GGSAQGEMLRNAATISPAEQVHFSSRAELLVSKLGRSSKLSPRFLIITDKAVYFVVSQ
                     ARDGRVSTSLERKIPLVTIKAISMTNLRDDFVALNVNACEEGDPIFTCVFKTEMITVI
                     LTLTGGNMSVNIGPTIDYAKKKDKRAVIKTQKNEAVRGDATYKSHTIQVGSGEPPNSL
                     SNPMPPRKPKVKKAAKTASSSRPVNSGRPAAVALPGATKPAAPPALSSMPSHTPVVTK
                     PTAIPTAAIGAARAPPSIPGRAAAPPPPPPPPPPAGPPKEFYKALYNFTGQEGEMNLV
                     KGEEVEVKEKDDNGWWMVVKNGQEGWAPSNYLKKVEQAPPPPPPPPPPSRPVAARPPA
                     ASSAPTAPAVTNGSAVPSWKAKNAASATPSADSTPPTSRPASSASKVPPAIKAKPSIP
                     AKPAIPAKPQVGAKPAPAIGGKPPVPTAPKVQPKAASKLGQVAQPAKAPGQLDLAAAF
                     AKRAARAQQEED"
     gene            267778..269170
                     /locus_tag="CNL04550"
                     /db_xref="GeneID:3254820"
     mRNA            join(267778..267855,267904..267978,268036..268226,
                     268301..268462,268516..268809,268857..269170)
                     /locus_tag="CNL04550"
                     /product="ccr4-not transcription complex, subunit 7,
                     putative"
                     /transcript_id="XM_568004.2"
                     /db_xref="GeneID:3254820"
     CDS             join(267787..267855,267904..267978,268036..268226,
                     268301..268462,268516..268809,268857..268944)
                     /locus_tag="CNL04550"
                     /codon_start=1
                     /product="ccr4-not transcription complex, subunit 7,
                     putative"
                     /protein_id="XP_568004.2"
                     /db_xref="GeneID:3254820"
                     /translation="MSSTLLTMPQQEQLPSKDYGIREIWADNLESEFAALRQAVERYP
                     YISMDTEFPGIVARPIGNFKTGSDYHFQTMRCNVDMLKIIQLGITLCDENGDSPEVST
                     WQFNFAFSLGEDMFAPDSIDLLKSSGIDFKRNEEEGIDVEYFGELLITSGLVLFDNIK
                     WVSFHSGYDFGYLLKILTCEPLPADETDFFRLLFIWFPCIYDIKHIVRSIKTLRGGLQ
                     EIAESLGVKRIGPQHQAGSDSLLTAAVFFRIQTIYFDGHLNDDYYKNYLYGFSSGRLG
                     KASPAAAGENLVDKPY"
     gene            complement(269107..272958)
                     /locus_tag="CNL04560"
                     /db_xref="GeneID:3254853"
     mRNA            complement(join(269107..269269,269336..269889,
                     269948..270036,270090..270204,270264..270401,
                     270455..270796,270853..271079,271132..271712,
                     271763..271874,271924..271976,272028..272183,
                     272584..272958))
                     /locus_tag="CNL04560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658154.1"
                     /db_xref="GeneID:3254853"
     CDS             complement(join(269199..269269,269336..269889,
                     269948..270036,270090..270204,270264..270401,
                     270455..270796,270853..271079,271132..271712,
                     271763..271874,271924..271976,272028..272183,
                     272584..272587))
                     /locus_tag="CNL04560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513907.1"
                     /db_xref="GeneID:3254853"
                     /translation="MAQVSEEHNPHKSHPLAVIPQRASKRKRQSKSEDEPVSEGSRTK
                     ETSVASEKKGPPLRRGDACLRCRAKKLKCSAEKPSCDQCSKRNDNCVYDTARPATRVQ
                     KLEAKLAQMEDQETRPSIEQQRPSSSSFESSISHGLLTPYGNSIGQDDGLIFFSERGF
                     GDFNNAMVPSPNPQALYGQQNIGGSQDVPFMASSSPAFVSSKPSIDIPNSLPIFNEWS
                     WPPSGLGLNLWNNQVEGSSSLGEPRFAQAPFTVIGMSQDVSNTWSPTQETKPLPAFDE
                     TTIPTSSSGHHVLDHSATGRGMDDLNAFLAPSDLNTKNPGPIDGDRHSGKPFIQSEQP
                     TSSLQGLEGLSYPSRVLQMGGGPTQQRPWRLREDDVSASAREYLLDLFFSPEPPRYQF
                     GSEAFTEAQFRAKLTLQPSLQPHPSLLFSMYTLAASTSYIPAIRSLADELSEIAMKRI
                     EEAIRNKDRLIDAINACKIMSKWFYAKGKAFEAYQYSAKAVSLCLACELHRIPSSVFQ
                     PYQSKSPPSEGGILSAPKDQWELCERIHAFWGVWGNEKGQEICTSWTGLLKDELIITP
                     LPRPPEHLFNGAMHGIEDITLRDLYDLPHRTNPPCFEPLYALLLASVHLFTRANNLTS
                     NPPESNPSYRSLSLASSVSVRQRFPRACEEIALACTYLEETVSQNWPLEDGPEGQAGK
                     GWFIEDVPVMFLLLKCSKIRLLFPPQDPGNQNEFISLVMESGDLVMKWINRTDFGNVA
                     GSAPSARKDNKDSYRNKNGLSGPYRFVQWRFVAERMKECAALLRESGRLLEAQTCSEK
                     AEAIREGVEKLPNSF"
     gene            complement(274006..276859)
                     /locus_tag="CNL04570"
                     /db_xref="GeneID:3254780"
     mRNA            complement(join(274006..274301,274365..274488,
                     274549..274807,274860..275110,275161..275275,
                     275327..275403,275450..275520,275577..275686,
                     275750..275775,275815..275839,275893..276158,
                     276217..276253,276306..276324,276382..276391,
                     276460..276491,276553..276574,276674..276859))
                     /locus_tag="CNL04570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568220.2"
                     /db_xref="GeneID:3254780"
     CDS             complement(join(274261..274301,274365..274488,
                     274549..274807,274860..275110,275161..275275,
                     275327..275403,275450..275520,275577..275686,
                     275750..275775,275815..275839,275893..276158,
                     276217..276253,276306..276324,276382..276391,
                     276460..276491,276553..276574,276674..276733))
                     /locus_tag="CNL04570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568220.1"
                     /db_xref="GeneID:3254780"
                     /translation="MSQQKQVDGKQVAEHNSREKGVWIVVHGNVYDVSDFLDEHPGGA
                     DIILKYAGKDATEEYDPIHPPDAIKENLDPSKHLGPLIPSTLPVEKPAPAPAPPPTSV
                     PVGQATNGTSVTEEFVKPSLAEILSLHDFEAVARRTMSKRGWNYYSSGADDEVTMREN
                     HNAYHRVWFRPRILRNVGTVDYSTEILGFKTSMPVYITATALGKLGHPEGEICLTKAA
                     GEHNIIQMIPTLASCGFDEMVDAAIPGQVQFLQLYVNADRERTKKIIRHAAERGIKAL
                     FITVDAPQLGRREKDMRTKFEGTASAQQTKGGDKYQRDQGAARAISSFIDPSLNWSDL
                     KELVDAARGLKVILKGVQCWEDAVMAAEAGVDGVVLSNHGGRQLDFAPSPLALLPSVV
                     QHLTAHGFMNNPLRPRFEIFVDGGVRRATDVLKAVALGATAVGIGRPMIYAMSTYGKD
                     GVSHALQILKDEFEMNMRLLGAPTMADVVPSMVDTSGLFGPQGSVTMYEENYERMLPV
                     GVKAKL"
     gene            complement(278228..278931)
                     /locus_tag="CNL04580"
                     /db_xref="GeneID:3254785"
     mRNA            complement(join(278228..278456,278531..278604,
                     278677..278931))
                     /locus_tag="CNL04580"
                     /product="expressed protein"
                     /transcript_id="XM_568219.2"
                     /db_xref="GeneID:3254785"
     CDS             complement(join(278373..278456,278531..278604,
                     278677..278824))
                     /locus_tag="CNL04580"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568219.2"
                     /db_xref="GeneID:3254785"
                     /translation="MKRLHFLNSQTKKTVQAYNMSGTQSPSSNKPDPMLPKDVSQMTQ
                     ADQRPAASGNKPGAAPGEKSEGGVSGSAFKSAQQSADSLSGEGGKSRKEVETGPGPT"
     gene            complement(279755..286075)
                     /locus_tag="CNL04590"
                     /db_xref="GeneID:3254878"
     mRNA            complement(join(279755..281838,281891..282402,
                     282454..284081,284141..285379,285434..285469,
                     285519..286075))
                     /locus_tag="CNL04590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658155.1"
                     /db_xref="GeneID:3254878"
     CDS             complement(join(279878..281838,281891..282402,
                     282454..284081,284141..285379,285434..285469,
                     285519..285905))
                     /locus_tag="CNL04590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513830.1"
                     /db_xref="GeneID:3254878"
                     /translation="MSNESSQLAASSRLPTTTNQVKTVITDTPFVSTALEERRSRSLR
                     ARPSLSSPSMGIPSTTHPNGHATQSKGMEAISQGLRQEAVIVRREKRITEKERELKEV
                     VESHDGLIREKFHLERFVTLLEGWNPEQAKLDNSPVFLQWKDSKHNLLNLLPDEPAIS
                     ASSQAGPSRPRSSLPSRTTRRKAHEQSELLAHVVAPVAKPPAFAPSTKGKERVGDELH
                     AKTKGKGKGLAEQSLIPSPAEGALHTKGGKRKVGDVTTDMLPPPVPDKRSRGSRRATM
                     GAPLPQIDQNEEVGLDSQATHGGKAKRRGRISLPDLPTSKKLRTAKRASAVSSESASP
                     VVEAPTLERLASPSPLSTPVPLPTFAHLPFPPAPHRIRKRIVGPRTIRYTDPSQRPPA
                     PKYGGDITPIIESYVNINDTGPPPEMKTLEARAKKEGYLLARVMYLKSHGRLQRLVDE
                     EDGSNLFSTTTTSNSHAKIIRIPPRKTDYHDTLIAHMVQVRNAMLNVAKSKPVTCKKV
                     ARMVQAYWENIEGKEERERLAEEKERRRMGKEIIKSLRKRWALAVKVVRAKILEAQKQ
                     EQDRLGKEHLQNILQRSTGLLEAQIQGSNDSGEEEGEDSTSDNTDDSEGDDETNTLLP
                     LTSISPEPVIGDDEEDVDVHDDDDEQQGEEDTSHKEDESDASDTESDENSMSEHNQDL
                     RFLISDDVLNEDPMSTGRFAEEDRGSSDTEQLTDNKNDGEEPKETAVQAAFDGSDDVN
                     RLEEPHNPVSSTANIGNFALLESSSAEVSDASCPATMPILVRQSPKTCSQPRTRKVKL
                     STLSLSSDPDPDINDPEFKARLEDSNQDDQDEELDLEMEEADSAGRESGEGNRDSEDE
                     GLLADADLPIEVLLRRYGYPVPEGEGAVNGEPEQSESKGREQAAPTSTVSETLPSTKL
                     SLAQPANQTDQSLTDTALPEPRVPEQLIISGKRQRRKKEIWTPDDSEPQHLVGKKRIK
                     KVEIVEKVEADVHQNGDGLVIVEEETMGDEDNDDSKVGQEEEDGHEYDSEEEYDEDED
                     EEEEGAKEDNVDWDDRQDKEGDIGPRVRQPFLLRGTLRPYQQAGLEWLASLWSNNMNG
                     ILADEMGLGKTIQTIALLGHLACDKGVWGQHLIIVPTSVILNWEMEFKKFLPGMKVLT
                     YYGNQKERKEKRVGWHTENTWQVCITSYQIVLADQHIFRRKNWCYMILDEAHNIKNFR
                     SQRWQTLLGFKAQRRLLLTGTPLQNNLMELWSLLYFLMPGGIGADATAVVGFANHKEF
                     MEWFSNPMDKAIETGDAMDEETLETVAKLHTLLRPFILRRLKSEVETQLPGKFEHVVY
                     CRLSKRQRFLYDEFMSRASTHEALTTGGYLGVMNTLMQLRKVCNHPDLFEMRPVKTSF
                     AMDNVARDFEPSDILIRKRLLAEEDERRIDALAIGFGVAHNEAMSGWVARARQTYDAS
                     DKLPYAASPLRRGKLSAPPPKDTRSVELWLKYRVWAEEEFSKRRWESIRATNRQRCGI
                     SPIYGSTFLSLLGNLPNFLLPQDVQSRREETFADFTPPAAKFITSLPERAKSLEDVID
                     RFAVIPPNAVARNLATYALPGLEPISHPALTDPAFDTLHRSSVKLQIAFPDASLLQYD
                     CGKLQKLFEMLRDLKSEGHRVLIFTQMTRVLDILEMFLSHNGHRYLRLDGSTKIEDRQ
                     VLTERFNSDSRIFVFIASSRSGGVGINLTGADTVFFYDSDWNPSMDRQCMDRAHRIGQ
                     TREVHIYRFVSSHTVEENMLRKAEQKRLLDKMVIQEGGFNNDWWGRVGWKDMFGDVPG
                     ITDVSGVVEKSGEGIIDIQVEGTPVAEDVEVTRPRAGEERELARALAEVEDEEDAQAA
                     RMAQGEGELDLQEFEEGPKAVAKRVRVFEPENSGTPVTTEAGETGDVVEEYDDEPGSV
                     EEYMLKWVEEDWDYFSPYRA"
     gene            286237..287651
                     /locus_tag="CNL04600"
                     /db_xref="GeneID:3254722"
     mRNA            join(286237..286501,286555..286607,286661..287120,
                     287168..287261,287326..287651)
                     /locus_tag="CNL04600"
                     /product="expressed protein"
                     /transcript_id="XM_568214.2"
                     /db_xref="GeneID:3254722"
     CDS             join(286316..286501,286555..286607,286661..287120,
                     287168..287261,287326..287471)
                     /locus_tag="CNL04600"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568214.1"
                     /db_xref="GeneID:3254722"
                     /translation="MAQPEDLISTPTPTTRKAAEAAASNQHALVNLIRLVKSLEIKLA
                     ESEEDEYLNIYIIRKDWETVLYARVLLDTLKQGNEQTSSTTSTLSGLEKSLNHIQSAY
                     HSRLASPLPTSRLNPALIALPRSPSSTIPYDSRIPSPPLTTTTQFPIPSNQTASKNVR
                     RRRAQLEDYLAKRSREDTFGEGTGLLTIKPIHDSEDASSKPSEARDELLGDAIPGSAL
                     GAVQVHEELSGQLADMSQRLKLNAIHFSNSLENEKHLIQNSQDVLEKNLSATKTSKKH
                     LSTVSKKGRSTTYLTLGIILLVMIVFIWTYLLIRFT"
     gene            287706..289167
                     /locus_tag="CNL04610"
                     /db_xref="GeneID:3254724"
     mRNA            join(287706..287890,287945..287994,288044..288060,
                     288129..288403,288456..288661,288717..288766,
                     288813..289167)
                     /locus_tag="CNL04610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568215.2"
                     /db_xref="GeneID:3254724"
     CDS             join(287840..287890,287945..287994,288044..288060,
                     288129..288403,288456..288661,288717..288766,
                     288813..289078)
                     /locus_tag="CNL04610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568215.1"
                     /db_xref="GeneID:3254724"
                     /translation="MQNKPEQDRNQEATVYLGNLDERCTDALIWELMLQAGPVSNVFL
                     PKDRISQAHQGFGFCEFMSEADAEYAVKIMNQIKLYGKPIRVNKASYDKKQVDVGANL
                     FVGNLDPNVDEQTLYDTFSTFGTLAEQPKIARDPTTGLSKGHAFIAYNDFEAADLAIE
                     NMNGQFFGGKQITAQYAFKKDGKGERHGSQAERLLAAQAKKRQLLPATGGPALPYQGQ
                     YANALVVNSVPAAPSGMPTYPPPPPPGMPVYQAPAPDAGYAGYPGAPAGYAPPPPAGF
                     PVAQYQMPVAAPGQAPPAPPPIRMGFQG"
     gene            complement(289119..292357)
                     /locus_tag="CNL04620"
                     /db_xref="GeneID:3255010"
     mRNA            complement(join(289119..291810,291859..292357))
                     /locus_tag="CNL04620"
                     /product="exoribonuclease II, putative"
                     /transcript_id="XM_568006.2"
                     /db_xref="GeneID:3255010"
     CDS             complement(join(289185..291810,291859..292232))
                     /locus_tag="CNL04620"
                     /codon_start=1
                     /product="exoribonuclease II, putative"
                     /protein_id="XP_568006.1"
                     /db_xref="GeneID:3255010"
                     /translation="MALLPARSAISSSFARRAFASTSRSCDARRTRVGSSTKQPQLKA
                     REILDTLAADATLLSTSRAPTSLKSEKPARVKFEVAEGQSNDRRAYFVNDVDAEVGLD
                     WGSIEGDGSSAGLEIGRVVECRRSGQVSLGLILASILIGERPRFLLLRSSGEIWPVSA
                     HDVQFIMPISLMPPSLTEACWSPELLQAWAQSESSSGLASETTSTTPEMMEARRKVAL
                     MLRRVQRETERMCGKLRGGTFDKGLIGGAEGVWEKWASENDSERTTITAVEAAEYILN
                     PSSGTESQSPPIQIKPNTLPAYAAHVLLMGRPDMFVSDEGDMWATGTFIVRSKAERQR
                     IERVQRWVEAHKSNGDDAEPLRSFVDRAKAVIALSEKIYTETEGDPLKPYTNGLPSWS
                     STDLDMIYTLFGAVAETRSTQTSPFLSLAIAIARLITPDPEEVVDRGTITILLQKMGM
                     ILPWDSLETSRVAESNMKALAKASTSGDIKGEGEFLQGNELDHLRIDYSDQKVYVIDD
                     ATASELDDGIALERILNSEDVWVHVHVADPTRYIPPAHPLAKRASVMGSSLYLPEGNS
                     PLFPSDVIMRELSLGASVQRDEGRQGVITFSARVGKDGEVHDTKVNLGWIKKPRVVTY
                     SSVDRALGLTPVKSYRPFGGPQSFDEPVKSEVISSDIEDLQKLYELAKNIRAKRYATA
                     GFDWTWPSSSVRILNQQAPPNPDVFALPNIPSCPQLFSGSLSVDYCVSSSPATLTSAT
                     MVAEFMILAGRLAASFCSERNIPMIYRGSTAPKPVATNSTLDQWLSLRIPGMGIIDPY
                     VMAEPGWYRSSAFVSLKPSAHWIMGFDAPGGGYVRATSPLRRFDDMLVHWQIKAALAK
                     DRGETGKLAKSLKKEEIVTLAQRSDEGSKRAKRAGVNAELFWKTQVINKHFQSPNGWP
                     VPGRSVKEEEGLVDVRGEMIARIAGVSESSVFGEWTTVAVESLGIHVAKMEHPAGKFW
                     KMGEEVRVRLKRSEGWPNPRITLTLAE"
     gene            292485..293248
                     /locus_tag="CNL04630"
                     /db_xref="GeneID:3254743"
     mRNA            join(292485..292646,292700..292747,292800..292840,
                     292906..293248)
                     /locus_tag="CNL04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658156.1"
                     /db_xref="GeneID:3254743"
     CDS             join(292555..292646,292700..292747,292800..292840,
                     292906..292940)
                     /locus_tag="CNL04630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513831.1"
                     /db_xref="GeneID:3254743"
                     /translation="MSFFHVVFVAFVIAAIGAAGWFVTPKGKNQTLLRTSLLLTLTCC
                     YLMWAITYLCQLHPLITPRRSDLRMEY"
     gene            complement(292939..294512)
                     /locus_tag="CNL04640"
                     /db_xref="GeneID:3254763"
     mRNA            complement(join(292939..293289,293337..293795,
                     293843..293908,293963..294512))
                     /locus_tag="CNL04640"
                     /product="expressed protein"
                     /transcript_id="XM_568218.2"
                     /db_xref="GeneID:3254763"
     CDS             complement(join(293099..293289,293337..293795,
                     293843..293908,293963..294443))
                     /locus_tag="CNL04640"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568218.1"
                     /db_xref="GeneID:3254763"
                     /translation="MRVVSLSRMLPFSPTLPELHHTEDQQDVLLEWKKASLPRFIILI
                     TKCLIPPLLVFALILTLISLLLPTVKHHETTFFSIQPIGHARKVTAGSLPVNSTSSSL
                     SPLRASAVAAIRDIKQELEETSPGNDIVNATKTIVQSGNVRLEEWLGINGPSIFVGAL
                     RICSRMKANESIMCTSSGEAAYHAAFLPLSLGKALIVLPPSPFSPILLLLSGILTLIS
                     VLIFIVGLISWHLPRLALLRQKSHLEAVPHRPDYPRDIDSVRPLVHEDGADDKGKSVA
                     SFKWGNGPHPAFFCTVLSALGVAGGAMMELRDVSKAREQWDDIQAWEVGLEFRLGTLT
                     YLLPLLPICLFLVLVIGSLPWAWSVAQSKHYMNFGSVRNMSPVSTKPDSLQNAQTPQA
                     SSFTGN"
     gene            complement(294720..295943)
                     /locus_tag="CNL04643"
                     /db_xref="GeneID:36393117"
     mRNA            complement(join(294720..295169,295247..295413,
                     295544..295943))
                     /locus_tag="CNL04643"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658824.1"
                     /db_xref="GeneID:36393117"
     CDS             complement(join(295047..295169,295247..295413,
                     295544..295697))
                     /locus_tag="CNL04643"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514657.1"
                     /db_xref="GeneID:36393117"
                     /translation="MTSLTRLLTLTFWLVLLGLDIIRATDADTCMSACTDWAVVMLYC
                     RWEYADRFTTNQDDYIYNNQFVACLCQGQTASTAALGNSTISASASTCSTCATTPSLI
                     VQNINDFLDICTVQAQNGTASGALTYRPQVYNTNTTDPQPAEYYS"
     gene            complement(296355..297118)
                     /locus_tag="CNL04645"
                     /db_xref="GeneID:36393118"
     mRNA            complement(join(296355..296641,296711..296874,
                     296924..297118))
                     /locus_tag="CNL04645"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658825.1"
                     /db_xref="GeneID:36393118"
     CDS             complement(join(296519..296641,296711..296874,
                     296924..297080))
                     /locus_tag="CNL04645"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514658.1"
                     /db_xref="GeneID:36393118"
                     /translation="MLRSLICFVPFLIAIFLTLAVSLADASQEQCVMACTNWSRVIEH
                     CRWEYINRFKHNQHNYNYNNKFVGCLCRGETAAGSIGNNTISASVGVCLNCHTTPGLV
                     KRDLRDLLQLCTVQAQNGTAADALHYRPQGYHTNITEPQPYEYQY"
     gene            complement(297417..298374)
                     /locus_tag="CNL04647"
                     /db_xref="GeneID:36393119"
     mRNA            complement(join(297417..297811,297877..298037,
                     298113..298374))
                     /locus_tag="CNL04647"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658826.1"
                     /db_xref="GeneID:36393119"
     CDS             complement(join(297605..297811,297877..298037,
                     298113..298266))
                     /locus_tag="CNL04647"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514659.1"
                     /db_xref="GeneID:36393119"
                     /translation="MFRAATGIFLIGAFFFFFSGVIATDEDKQCLSACSDWSVVLGYC
                     RGQYKETTVQQFNLTYMNDFIGCLCEGQTYAGTLGNETITGSAGICESCQTTPALIQE
                     NLQDFLRLCSIQSANGTSFNATIFRPQGYETAEDTSKDAVVGKGVQTLAKATLLCWMG
                     TLLMAFFFGVTAL"
     gene            complement(298761..301648)
                     /locus_tag="CNL04650"
                     /db_xref="GeneID:3254919"
     mRNA            complement(join(298761..298914,298971..300527,
                     300575..300884,300935..301410,301461..301648))
                     /locus_tag="CNL04650"
                     /product="expressed protein"
                     /transcript_id="XM_568008.2"
                     /db_xref="GeneID:3254919"
     CDS             complement(join(298885..298914,298971..300527,
                     300575..300884,300935..301410,301461..301631))
                     /locus_tag="CNL04650"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568008.1"
                     /db_xref="GeneID:3254919"
                     /translation="MLSFCFLSSPKLPSMLFHSDKRPRSALTAIFTESGHADILLGIF
                     NNLAIQHIPALLRVNKYVNSVFTSSSQLQLRYRKSYHSVSPHTQSSAPSRLTNSAEEL
                     GLLIEQEKRLSNLCPSEIRCLHFPNAEIAQVQLNHILVTERINREIVFPNAPDSNYLW
                     DGWSVWRIRNAYEFDGESRGGKKAQGVWKWKMNFGAPIDSATMCVEDNVVAVAYAVNH
                     PPCDEISYNSTLKVAHRIYFYSLIPPVGTPQQSDGIFQPPIPHPEAKLPYVEVLVPAK
                     HHMHHIELQLGPGGKVGLLLVSADTTRQNFVGLWDWKAGVSIGKLSPTPDVPVCEDFR
                     FLGPFILSSVMRDLVKKPEDELMVLHNRELDSCASGGRPSCLSASTPQRPKPASVYDD
                     IDYDSEEDTFQGVSEAVPPPLETVYSIDTHAPLPTERGTRPFKRSYITHFGPGSEIDE
                     AYTWDWDEIPFCMPLASLQLPTLNTTPLGVYETPLDSIMDSLHVDTDFHPVRLAFDSF
                     SVDPALLQGERLGVIPFTLSGDTSDGLGAPNVVRCKGIIDITTLLGKTIEAMQWHMAK
                     TKGIDIKLLALGAKLNKKTWRDQLIEAFELFLRSGQDDGWETEEDEPSRYKSKKSRSK
                     RISKRATIISPKQTKSTYKWENPHVVPWKSWDSGVSIRFNHRNIVTAWGTRAVMVEPV
                     PDAKPLVRKKDGQLMRQYWMTLRDYSRHTFHDHPGRPRQVLGGLQHPYLSLDKASLST
                     ASSSTSPSPPESGAKREKPRVIKCPLVNPVPVAQMDNNLIEHSTSEIQDKRLWTKRIF
                     YDELLQSKLMYKEVRAKILLDQKRPYRSSAFDGKMVVIGVESGAHIFTF"
     gene            301791..303429
                     /locus_tag="CNL04660"
                     /db_xref="GeneID:3254918"
     mRNA            join(301791..301971,302027..303429)
                     /locus_tag="CNL04660"
                     /product="expressed protein"
                     /transcript_id="XM_568009.2"
                     /db_xref="GeneID:3254918"
     CDS             join(301849..301971,302027..303409)
                     /locus_tag="CNL04660"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568009.1"
                     /db_xref="GeneID:3254918"
                     /translation="MTAALPVDIWSHILSYCIEVPPTPGAHVPQPTLVNALRVSSTLF
                     LAAAPHLYSQATVSDPGSFLLGLDRPTSVFPSSFITSQQMDYEYLKWGHKKIPLLRHL
                     QKVTFFRPFISGYDSVVSPESTGSEATFASLGYANQMLSHLLFTETTHVSPKFETLSI
                     LDPPELPVYPQTVPPFAQFIQLFIRYFQPRSVCVQNADILIPSQKVKLQDLYLPENVI
                     IHADLDWKLTVIWGTTNRICFFKSKIAEEGNLDLGALTIADPTEGNGQAMEAAVDIRS
                     DDDGGWEDIDGISGASSGLTSQRAQNTPSNTALHNQSNELYLGAFDPEDLEDDYYDEY
                     DWDDELDADDDFGGIYDDGVGLPSRMSDFDGDDEVAAVLPGGFSEEEVISTLADCLSR
                     SFKHCRINNRKGGGKSIQRTIFEFYGLEQFLSVDTLVYRNPDIYGQDTEDQILQKAMD
                     RIREMVQQHVEQMLAGVGQLPVIKFLRANEASDCEGCGRKMAECRINKPED"
     gene            304245..305785
                     /locus_tag="CNL04670"
                     /db_xref="GeneID:3254748"
     mRNA            join(304245..304456,304510..304596,304654..304743,
                     304803..305110,305173..305232,305285..305785)
                     /locus_tag="CNL04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_568010.2"
                     /db_xref="GeneID:3254748"
     CDS             join(304412..304456,304510..304596,304654..304743,
                     304803..305110,305173..305232,305285..305630)
                     /locus_tag="CNL04670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568010.1"
                     /db_xref="GeneID:3254748"
                     /translation="MRVTTLVSAASLLAVATATPLVVRQNATAPQCAEDCFADVDTIE
                     SICSSGDVACYCTDPMIVGYLRSCLSSSCSTENVNNAIYYGEEVCAANGADVSMRDDG
                     SSTTGSSSATAGSTPSSTSSSYESISSASETTFTSANSAAASESLSVSGTESAPIAAQ
                     TSQVSSSETPTTKSASTSVGETSSVSSSVVDETTSTNSATSESQTSSSSSEESSAVAA
                     ASTSTSASASVSSPTSTSSSSSSSSAPSSTSSESDASSNVASTVSLITSASSETATTA
                     ASGLAASSVSTSSGERMIAGTTGVMVATMLALFVI"
     gene            307330..312105
                     /locus_tag="CNL04680"
                     /db_xref="GeneID:3254879"
     mRNA            join(307330..309082,309141..309810,309861..310477,
                     310526..311033,311084..312105)
                     /locus_tag="CNL04680"
                     /product="protein-tyrosine-phosphatase, putative"
                     /transcript_id="XM_024658157.1"
                     /db_xref="GeneID:3254879"
     CDS             join(307855..309082,309141..309810,309861..310477,
                     310526..311033,311084..311699)
                     /locus_tag="CNL04680"
                     /codon_start=1
                     /product="protein-tyrosine-phosphatase, putative"
                     /protein_id="XP_024513832.1"
                     /db_xref="GeneID:3254879"
                     /translation="MGRQAPPTLSDFPSASEPRSPPPVDPLSPSPTRSPAASSPFRSP
                     SRPSPASRSSSGFSLPVQQPTPLATTNTGFSSPWAALAASSGAPTPSSEVPMGRNSPH
                     LGSPFERLNIGGGGNNSSSMLRDDSPRIQFGESLASPFEGQFSHAAPAMSSPTSNKQA
                     STGAAPPIRGGLSAETLMRYKAIATSAGKPDIGGEPNPLAAAARKKNSLPTKLSSASL
                     GASTPHSTKSPSPLASSVSGSQSPGGMKPQMIAPTDLAKLLPNSTTLILDVRPPSSFQ
                     SSHIPSSHSLPIPSTLLRRPAFTLNKLTQMLSPHSMQEVSKWREKSDIVLVDADSGSA
                     PDGGVLDGLAGKFGREGYSGRLWFVKGGHAAMKLSGALPLVSDDDEGPQPQQGAAAAG
                     AQKGLMAGRLASLAFSHESTTRGKSSGRQPPPKGLTIPPTPSLNFQSNPFGSSFPLTT
                     AVSERPAALHRLDKGPVTTTGMADSTQAKFQPANPFFDNIRQNLELSHGGITERIPLN
                     LPDSVRERADQFPDWLRELVTMPEQDSMDKLAHQFYQLELHEQKRLQAIMEWHAKGSG
                     ALLQPAVGYDEQILKSASERKGWEWAIQRESDLNELKRLMNWERGTEDIEYFPFSITA
                     GVERGTKNRYKNIWPYDFSRVRLDSPPDQDSDYINASFIQPRGTSRRYIATQGPLDAT
                     YRDFWTLVWEQNVRIIVMITKQFEGGLIKCGNYWCEERYGHIKLQLISQSGGEDTALP
                     AANSGFDFGTAGATPKSSKFPQESDSNIKRVFLISRDDKPDQPPRKIVQLQCIGWPDF
                     DVPETPDTLLKLIQEVNDAAHEAKPEGCYRKADEPPVLVHCSAGVGRTGSFIVVDAIL
                     DGLHRDFSQRSAAEARSADGPARLPEVISPQHSSSATPATTLSAVASPEPVSQSFDLG
                     VSSTSVAPQLSGSPGTIPTQPEHQVALDFSFPPKKRGSNETMEVDPPKAANSADDRFM
                     MYRMASEGTSVSSDTDTRRPSLVSVQTSSDRVSSESIPGRLADPEPVTSLNRPRREPS
                     PLSKMRDPVSCVLESMRVQRMSLVQTLRQYLFVHRAIIHHYLHMLDHNQVKERPNPSP
                     LQKHVPSVGSSVSGSAIGSLGSIGTLNSGSGSYTDSLSTNSPADLTKGSVDEDSHTKR
                     RASPTELHPDVRLGGEGGSELSKRPSFKKMKPGTTSGRMGRKSSAMWKGMEEEAVAEE
                     AVTEELKN"
     gene            complement(312669..314416)
                     /locus_tag="CNL04690"
                     /db_xref="GeneID:3254814"
     mRNA            complement(join(312669..313215,313269..313640,
                     313692..313834,313943..314003,314059..314416))
                     /locus_tag="CNL04690"
                     /product="membrane fraction protein, putative"
                     /transcript_id="XM_568012.2"
                     /db_xref="GeneID:3254814"
     CDS             complement(join(312914..313215,313269..313640,
                     313692..313834,313943..314003,314059..314332))
                     /locus_tag="CNL04690"
                     /codon_start=1
                     /product="membrane fraction protein, putative"
                     /protein_id="XP_568012.1"
                     /db_xref="GeneID:3254814"
                     /translation="MSSCCGGNNSNGCCKSNSQQESNAAVPLLRGNKNSNVNSRPSSS
                     NGTSYGAIWSVDNAAHPSNRTQQLQDVLGDVQPLGSKCGAHESGGQCCKDLKGDDERH
                     LVSPEIVRDVVIGLSDGLTVPFALTAGLSSLGSSSLVVTGGLAELCAGAISMGLGGYL
                     ASQAELDHFHYLRRQTQARVLRSCSGEMEREIHSILGPLGVKEPLSRLVAEDLRSVED
                     EIYGSSGAEGSEGVMSGANVVSESGNKKWALLNWRPKKVEEEDGGMRGNEEMGMTAFL
                     LKFGEGMEEVPVSRLYISALTIGLSYFIGGLIPLIPYMATSTAEEGLLYSAIVTSIIL
                     FIFGGFKTYFTGATGGWYGYAYGAISTMIVGGCAAGAAFGLVKVLDVQD"
     gene            complement(314684..318089)
                     /locus_tag="CNL04700"
                     /db_xref="GeneID:3254838"
     mRNA            complement(join(314684..316246,316296..317506,
                     317575..317734,317798..318089))
                     /locus_tag="CNL04700"
                     /product="expressed protein"
                     /transcript_id="XM_568013.2"
                     /db_xref="GeneID:3254838"
     CDS             complement(join(314826..316246,316296..317506,
                     317575..317734,317798..317840))
                     /locus_tag="CNL04700"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568013.1"
                     /db_xref="GeneID:3254838"
                     /translation="MSCPPAPNRIHQLPVRVSYYIPASSQTYSTIFPSLQQVYIHPQS
                     AGGDDETWGSIYLKTVVKGVLAASPELHPAYPGTSDLSLYVLDPRETYFRRARVGSAH
                     HGNTDTTGSEVWTGKGLVSWSLAEHGQGKNLIAGRLERDVAFTTAIRTQGMSALEALM
                     AADQMGNVSEESWGIDISLGLNMGLGAPGGFARARASSPAVRRRRSSLEKEERGHITP
                     PYPRQQKRASVPPAPQTFDIQEKLPAHPSSSSYSHDQPFRPGHNISHASSPIDPPRAR
                     GRPTKSASTGGRPRKVTASSHSSSTSIDGADPRQRPAHSQRPYEIPLPSSEGPNVYDA
                     LSSIPENILARPESLTREQAQRLLASPAFIDMLGKITGTSIPTGKPNPNNKRLRDGEE
                     PEFQPPKRKRGRPTKAEKAAKEAQEAAARLAEAVKQKAEAVDGPQEDSRNPVCWNCGR
                     TKSAIWRTKVMENGQSVRVCNACGLYWNKLGTMRPPNLWADGDDDRRSERAQSTFSEA
                     PSEHGPAHRVDKPLARAQESFKRTLSAAVEQDARRMATRHKGRAPTSPNKHSKLGPMT
                     SPPRGSASATKSLKQRKYTAASSPGGFVETMHDSFESEVNEASPEDEDESPHFRARPA
                     PHPHRLTRNPPSNTDTRTLDLPLSDDGLGSGASRGNNEWNDEVSAFFDVEGFSMSTMA
                     QHEIPEYSRRHHRQEVIQETKLGAHRSNPIHVTSSSMMENGHVGTDSTLEEDTVLSQL
                     FNRTSSIAGPGSSPSGFDFSQLPPSSPPMSVLSSDALPHSALLLSSPVKKNTPSVSGQ
                     TPSASGLTPVDGNRLPQSSSKLRHSVNAGDSHDNDRQAGGNGGVQQLDFEGIQRMFNL
                     MSHPDYVSQENTSAGTNHTPLSTFEDPQYGALNELIDGLGGGASGMKVNVGGEVVCGG
                     EGETSSASAVLADGNGEDIFASFLDGGAFV"
     gene            complement(318257..321720)
                     /locus_tag="CNL04710"
                     /db_xref="GeneID:3254760"
     mRNA            complement(join(318257..318444,318498..318546,
                     318594..318849,318899..318973,319026..319109,
                     319161..319445,319499..319597,319657..319758,
                     319813..319882,319928..319932,319987..320008,
                     320060..320274,320330..320423,320478..320515,
                     320566..320821,320873..320929,320988..321001,
                     321058..321149,321218..321244,321304..321310,
                     321376..321393,321456..321720))
                     /locus_tag="CNL04710"
                     /product="phospholipid:diacylglycerol acyltransferase,
                     putative"
                     /transcript_id="XM_024658158.1"
                     /db_xref="GeneID:3254760"
     CDS             complement(join(318306..318444,318498..318546,
                     318594..318849,318899..318973,319026..319109,
                     319161..319445,319499..319597,319657..319758,
                     319813..319882,319928..319932,319987..320008,
                     320060..320274,320330..320423,320478..320515,
                     320566..320821,320873..320929,320988..321001,
                     321058..321149,321218..321244,321304..321310,
                     321376..321393,321456..321644))
                     /locus_tag="CNL04710"
                     /codon_start=1
                     /product="phospholipid:diacylglycerol acyltransferase,
                     putative"
                     /protein_id="XP_024513833.1"
                     /db_xref="GeneID:3254760"
                     /translation="MPPRKKEAKSSPSLPASSSPSSSAIEGMPAPATPNLRQRRSQNT
                     DKEARGKDNVEFNVRLKKNNDGRYHLLAPGTPFDEIDLSEYSFFSHHDETPSQDKPTS
                     WKQWIFGRKFFFSAGILLGIIIAIWAMDFSSLPADIKDVWTALPTSLDPRDLISNLTV
                     VDTARRALENRDFTVGEAVKAEFGIEKHHPIILIPGIVSTGLESWGTEVVARSFFRKR
                     LWGTSTMIRAVLSNKERWVQALSIDPETGLDPPGFKIRAAQGLDAASEFIQGYWIWQK
                     VVENLATVGYDTNSMDMAAYDWRLAYYNLEIRDAYFTKLKNKIEMLHWHNKQKVVLCS
                     HSMGGTLLVYFLKWVESDPIANGFGGGGGPHWVEEHVEAWINVAGSLLGVTKAMTAFL
                     SGEMRDTVELHPAGSWVLEKFFSRRERAKLFRRWPGSSSMWLKGGNRIWGNESHAPDD
                     PEDATDTHGRFFSFRHPGVSPDDKSLSEWTVSPNLTVNEAGPYILTHTPPSFQRMMES
                     NYSQGFETDEKKLKENGKDHRKWSNPLEVQLPDAPSMKIYCLYGHGKGTERSYWYMQG
                     EYEQDESRSDAAGDQAYCDASDPSNGCDNSTVNRTALDFPLARRHWIDSAVTIKGSSP
                     EVRSGVKFGDGDGTIPVVSLGSMCVKGWKGKTKWNPAGIEVITQEYKHTPEGLDLRGG
                     AQTADHVDILGASPLNSAILKIAGGRGDLVTEQIGSKILEYTERMDWD"
     STS             319123..319632
                     /standard_name="Msp1"
                     /db_xref="UniSTS:470730"
     gene            complement(321968..323235)
                     /locus_tag="CNL04720"
                     /db_xref="GeneID:3254765"
     mRNA            complement(join(321968..322262,322322..322488,
                     322526..322736,322791..323107,323154..323235))
                     /locus_tag="CNL04720"
                     /product="u3 small nucleolar RNA-associated protein 11,
                     putative"
                     /transcript_id="XM_024658159.1"
                     /db_xref="GeneID:3254765"
     CDS             complement(join(322029..322262,322322..322488,
                     322526..322736,322791..323107,323154..323175))
                     /locus_tag="CNL04720"
                     /codon_start=1
                     /product="u3 small nucleolar RNA-associated protein 11,
                     putative"
                     /protein_id="XP_024513834.1"
                     /db_xref="GeneID:3254765"
                     /translation="MVNAARKNLMSRRNHKERAQPLHRARLGHLEKHKDYVHRARDYK
                     SKQERIRKLREKAAFRNKDEFYWGMVKGKTKGGVAIGERGFEALSTEVVKLLKSQDLG
                     YIRVQIAKDEKAVTKLRAELEVTAPASSATEEWSAASELAEVEKLAEMGIVLSPALTR
                     KKGKGKGKAPSEGHVVFVDERSDFENYGNEYEEEEQQGTEEEQIDLGWEEPQPVKKRK
                     SKAVELAKEEFDEEAAAQEAREYRLQLLSDLSAHLNRLKLLRQAEAKLETTKGLMGKG
                     AARKIRDHGWVEDESQPEDRNGDRKKWQGKIWKWKMERRK"
     gene            323344..326156
                     /locus_tag="CNL04730"
                     /db_xref="GeneID:3254759"
     mRNA            join(323344..324015,324065..324660,324713..325237,
                     325288..325415,325466..325962,326011..326156)
                     /locus_tag="CNL04730"
                     /product="ATP-binding cassette, sub-family b, member 10,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_024658160.1"
                     /db_xref="GeneID:3254759"
     CDS             join(323405..324015,324065..324660,324713..325237,
                     325288..325415,325466..325783)
                     /locus_tag="CNL04730"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family b, member 10,
                     mitochondrial precursor, putative"
                     /protein_id="XP_024513835.1"
                     /db_xref="GeneID:3254759"
                     /translation="MLSRQGLGLAANFIRTPLRRRFPANIPVPAHAATLHPQLRALLL
                     QSRLRYYSQSSKKQEKIDKEKEPEEERAPSPIPIHPPASIKLPSATASPTTSPTSPGK
                     DAKPDTSSILKLLTLAKPQWKLLTVGVAFLSVSTAVNLSIPWAIGRIIDFFAPGSEET
                     LLFGLPLEHATGALAVVLLIGAAANSGRSVCLRLAGQRTVARIRNKTYDKYLSMPPSH
                     IEASGVGDALSRLGQDTSIVGQSLSENLGEGLKAVLGAGAGIGAMWLISPTLTVVMLC
                     IIPPIALGTFFYGRFIRKLSLKTQEAMGGMSKLAEERLSAHRTITSSNTQAMEKGLYA
                     SKVDGVYKLQKKETVANGIFQGANEVAGDIGMIGLLIYGGVLVKRGEISVGDMTSLFI
                     YVNWIEWSLNTLAGFFTGLMKGVGASQRIIGLHALPSPIPLSSGKLLPKTDAGSIELR
                     NVDFAYPSRPDAKVLNGLNLKINKGERIALVGGSGSGKSSIQLLLLRFYDPTSGSVLF
                     SDNDIRKYIPESWRSRIGVVQQDPVLFGGTIEENIAYGHPNATRGDIKRAAQVAHCDF
                     IEKLPQGYDTLITKNSLSGGQRQRIAIARALVGNPSVLLMDEATSALDSESEHAVNAA
                     LNDLFANSDITVILIAHRLSSIASANRVVLLEDGRVVEDGTYEDLISRRDGKFRKMVD
                     GQLAKIQVGEVEEGPEPVSEEEGQHQVEEVKEDAEVKVERKKE"
     gene            326315..327974
                     /locus_tag="CNL04740"
                     /db_xref="GeneID:3254811"
     mRNA            join(326315..326563,326613..327974)
                     /locus_tag="CNL04740"
                     /product="protoheme IX farnesyltransferase, putative"
                     /transcript_id="XM_568017.2"
                     /db_xref="GeneID:3254811"
     CDS             join(326360..326563,326613..327863)
                     /locus_tag="CNL04740"
                     /codon_start=1
                     /product="protoheme IX farnesyltransferase, putative"
                     /protein_id="XP_568017.1"
                     /db_xref="GeneID:3254811"
                     /translation="MISRKGLGLAANFLHPIPSDKVAAVHTLHRTFSIQSTQCLPPWP
                     SRSQTLAREMFAPCEGSNHRARKSLTWALFAPRCQKRSSHSIARQTGDTSVDSTRPFF
                     SAHPTPYSPPFRTVYGAANAPVPELPDLRLPHPTSPAAPVSAYKPLPPLTWKRLLGVY
                     SALSKRNLTILMTLTATTGLALSPLPLSIPLLLNLTVGTLLTSAAANTFNQIFESPID
                     AQTPRTRVRPLVTRRISPFHAAVFGLVCTVMGGAILWYGCNPTTAALGIGNLLLYSAV
                     YTPMKRFSVANTWVGAIVGAITPLMGWTATGASLWPTSDQPLLLHTPWSDLPNLPNPL
                     TPLTLFVLLFSWQFPHFNALSHMIRPFYALSGYPMLSVLSPRLNALVSLRHAVLLVPF
                     TAILGPLSGCVDWSFALTSSVPNYFFVRDAWRFYKLTNEANARKLFFVSLWYLPAVLG
                     LMLVHKNVMGWLDGRREAEEQEKVEMEVPVEGRS"
     gene            complement(328063..331019)
                     /gene="CXT1"
                     /locus_tag="CNL04750"
                     /db_xref="GeneID:3254907"
     mRNA            complement(join(328063..328431,328484..328575,
                     328633..328718,328768..328881,328932..328984,
                     329042..329631,329685..329869,329920..330150,
                     330199..330249,330304..331019))
                     /gene="CXT1"
                     /locus_tag="CNL04750"
                     /product="cryptococcal xylosyltransferase 1"
                     /transcript_id="XM_568018.1"
                     /db_xref="GeneID:3254907"
     CDS             complement(join(328342..328431,328484..328575,
                     328633..328718,328768..328881,328932..328984,
                     329042..329631,329685..329869,329920..330150,
                     330199..330249,330304..330896))
                     /gene="CXT1"
                     /locus_tag="CNL04750"
                     /codon_start=1
                     /product="cryptococcal xylosyltransferase 1"
                     /protein_id="XP_568018.1"
                     /db_xref="GeneID:3254907"
                     /translation="MPLNLPFSSPLKLPLPRRFIILILSASILILFLHTFAPSTLPPV
                     LTPNLPHHEPDASYFSPSKWLPPILNPNAPTRPLEFDEDGQCLFLSPFDALSAAEKAR
                     ARVLSLDEISPGIVRADAPPAEGTDADPDFDDEFSELSNATRKMPAGLTHPILGLLRD
                     GEAKWNSMVTMQSQTLEQAVDVYMDRWGRRPPKGFDEWWHFAKANNVLLPDEYDPIMN
                     SLLPFYALPIDTLKERLVEAEKIPETFTLIVHDGKVELKWNDDYSRDTWWASRPRADS
                     QINLMEPFIKHIGTFRATFTIHDQPSILLDHERQEELLTAARHGKISTHPNELDRAEQ
                     NWRKACPPDSPLNKGEEELEAPDSFISSHLAAMDICQHPSYMENHGMLLEEKNSDSHP
                     KPHTKLYPILVPSKTALNGDIPVTPIGKDGRRDDIGHDPEWNRKSGKLYWRGLATGLQ
                     HNKKAGAKWRQSHRERLHFLANDKSDTYTEVLSPVGSSGEAELARMPLRELGQYYMDV
                     KLAGGNWQCDWGDGTCEEMEKEIDFAPKDSSERSNDFKYVFDTDGNAWSSRFPRLMAS
                     NNVVIKSTVFPEWNTNSLPEWYAYVPSKMDYSDLFSIMTFFRGTPSGRGAHDEVARRI
                     ALNGQCWVERTWRREDLQAYMFRLYLEYARLTSPDRDNGKMDYVSTQKKASKEADDVP
                     AAADIETPVIDQ"
     gene            332125..334574
                     /locus_tag="CNL04760"
                     /db_xref="GeneID:3254757"
     mRNA            join(332125..332824,332879..334574)
                     /locus_tag="CNL04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658161.1"
                     /db_xref="GeneID:3254757"
     CDS             join(332206..332824,332879..334416)
                     /locus_tag="CNL04760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513906.1"
                     /db_xref="GeneID:3254757"
                     /translation="MDPISTLQQTALSHIMEPHSTLMPVAIMQTGERPQQAHTRHSSW
                     TSIHRPVSQPPIGSSASMPSTPQQTWAPTGSIHVQHPQAASAPSAFDPHLLGFGADQT
                     VIASQVTSGRSADYQPVQSQPPHLFGSELPPVHATADPSFSHSWPSEQGQVHPSESPQ
                     DPSNQQAYHLWSLLKSDYRGPGGMVQPSNVAAVQSEQPAENVIRRFNPRASLSAVGPM
                     HPQSAPSRPPRNRKREPRAHSAFRKSVISSLPPVTPARPLPPRGSQVPARSSRSGRNI
                     PASQPYAQFPHFSPSLQPSQPTYGFFCQSLPLEKQTGPAVAQQPADRQSASCRGGKEE
                     LRSSGTEYNGEPTKKPSQRDGIERTTCIDSSWPNDRKSSEHEGRIQELWQTANPVIPS
                     STLPLGQEGLPTVTGYNETNHLTEKQTVSAEKMEEIYQSFEAGQRRHTQQDPMQGHIS
                     SDTPSQMSSSSQTPAAAVAGCESVMPDDSSSHPISSMPVASTVQSFLPDPPVGDPQPS
                     RPVVPPSTVGDVQPVFDQQIRMNPSDQKITTSSGPDLSDGVGSGDYTVPYTGASQLEA
                     YPAPDPATWVNQFLGHTNTAPVSLSSYHGQQTSLGYDSQQLYVQQPHIGTSAEPGLAM
                     QPPAMYGGMIAEDNMSANKGGEGKWGSIDEKGTSQSTEYPSQINPIISDNPFTVNPID
                     LRLGSGGQGCHLESQDVVAKGWNFSQPMNFSMYPPS"
     gene            335161..336308
                     /locus_tag="CNL04765"
                     /db_xref="GeneID:36393120"
     mRNA            join(335161..335336,335390..335411,335520..335641,
                     335767..335853,335922..336308)
                     /locus_tag="CNL04765"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658827.1"
                     /db_xref="GeneID:36393120"
     CDS             join(335308..335336,335390..335411,335520..335641,
                     335767..335853,335922..336033)
                     /locus_tag="CNL04765"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514660.1"
                     /db_xref="GeneID:36393120"
                     /translation="MPTLKFCGECNNLLYPKSDNNAKVLLYQCRNCNYTENATVEPGM
                     AGCVYKHDLLTVAREQPGETKDLDTDPTLQRSAIECPACHHHGAVFFQDQGRRITTNM
                     TLFYYCTNCKHLFRDPTVRHR"
     gene            complement(336200..340319)
                     /locus_tag="CNL04770"
                     /db_xref="GeneID:3254872"
     mRNA            complement(join(336200..336460,336528..336812,
                     336871..337190,337245..337362,337428..337550,
                     337608..337714,337766..338069,338124..338712,
                     338773..338934,338986..340319))
                     /locus_tag="CNL04770"
                     /product="DNA helicase, putative"
                     /transcript_id="XM_568019.2"
                     /db_xref="GeneID:3254872"
     CDS             complement(join(336299..336460,336528..336812,
                     336871..337190,337245..337362,337428..337550,
                     337608..337714,337766..338069,338124..338712,
                     338773..338934,338986..339674))
                     /locus_tag="CNL04770"
                     /codon_start=1
                     /product="DNA helicase, putative"
                     /protein_id="XP_568019.1"
                     /db_xref="GeneID:3254872"
                     /translation="MGKLDEIKGWVEADYTPPDENISWDEALNIPLSPAPPMEEFPDF
                     FAAPHHLPRKSEITPPVFNFTIESDTSSVDDTALTSNIPAIPLAADGYPLDGNTRFDW
                     RARALGQLRRPLPPHLRPRNRHWMFAKQPRRYQPVVTKLPSDHPLSIALERYRRHFSQ
                     LLKAELQEEARLFNQRLEEWSTEKLVKAGYTLVNVRGDEVSQKHNSQGERSFIYSFVR
                     GKGTMIDAAKFTFGQYVMLSRTHPFQDAVKDDESRPILATVNSKTKGVVQVLSPVPIP
                     DIRQGVWRLDIGHSDYVYRKQLEAMSFLNNNPLEQDVSDYVEDSFESYPQFPLDMPKK
                     NPLVVSTPSSAAPSNQAILKGTSLRETLLRAFSKDFCPPVPSASSPSDSSSPISNAKS
                     DGFVSNAHALSPTDLDAIPKPHLASGTGETKKSGILNRNTLIRSWAERHRSERETPVE
                     VEGDPYVPLNRTQLRAMGMMLSEALSLVQGPPGTGKTRVIVETIKLLKHHFQIPHPIL
                     VCAHTNVAVDNLLAGMVKHGVKAIRTGMAERVPTDLKQYTLGIKMESHPMWTCVQTMT
                     EKTKRLKDEIFRLDFGNPERQQKSSELKKIWRQIWGIQQSITRELLLDADVVCTTCIS
                     AISANLNSIDFPIVFLDEASMATEPLTLLPLMKGSSHVAIIGDHKQLPPVIVSQDAHA
                     GGLSTSLFERLIHEKNVPSIMLDTQYRMHPSLAAFSSKTFYSSLLKNGTPASERPPPE
                     TAFLIPEDPIPDPSTGELRLWGEKTNLTFLNHSHLESPVLQSMANEGEAEIIVDVVTD
                     LLHKNPDLKGSQIGIIAPYLGQIKVLSETLFASETQDSLKRILGDERTEEIQDVEIKT
                     VDGFEGREKEVIIFSTVRSNAGGYIGFLGDWRRVNVGLTRARRALIMVGNKETLKRAK
                     MGKIVAENLPQGGTRVWQDLMAYLEEGGMILDTDQGVD"
     gene            complement(340424..341966)
                     /locus_tag="CNL04780"
                     /db_xref="GeneID:3254901"
     mRNA            complement(join(340424..340670,340723..340788,
                     340841..341049,341113..341200,341295..341384,
                     341449..341966))
                     /locus_tag="CNL04780"
                     /product="carbonic anhydrase protein, putative"
                     /transcript_id="XM_024658162.1"
                     /db_xref="GeneID:3254901"
     CDS             complement(join(340581..340670,340723..340788,
                     340841..341049,341113..341200,341295..341384,
                     341449..341625))
                     /locus_tag="CNL04780"
                     /codon_start=1
                     /product="carbonic anhydrase protein, putative"
                     /protein_id="XP_024513836.1"
                     /db_xref="GeneID:3254901"
                     /translation="MPFHAEPLKPSEEIDMDLGHSVAAQKFKEIREVLEGNRYWARKV
                     TSEEPEFMAEQVMGQAPNFLWIGCADSRVPEVTIMARKPGDVFVQRNVANQFKPEDDS
                     SQALLNYAIMNVGVTHVMVVGHTGCGGCIAAFDQPIPTVENPGATPLVRYLEPIIRLK
                     HSLPEGSDVNDLIKENVKMAVKNVVNSPTIQEAWEKARKGEFREVFVHGWLYDLSTGN
                     IVDLNVTQGPHPFVDDRVPRT"
     gene            343984..345708
                     /locus_tag="CNL04800"
                     /db_xref="GeneID:3254774"
     mRNA            join(343984..344199,344247..344346,344400..344735,
                     344782..345082,345137..345266,345316..345457,
                     345502..345708)
                     /locus_tag="CNL04800"
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /transcript_id="XM_568021.2"
                     /db_xref="GeneID:3254774"
     CDS             join(344025..344199,344247..344346,344400..344735,
                     344782..345082,345137..345266,345316..345457,
                     345502..345661)
                     /locus_tag="CNL04800"
                     /codon_start=1
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /protein_id="XP_568021.1"
                     /db_xref="GeneID:3254774"
                     /translation="MSRQSLFTPALGQRKGLISHTVDLVRALLFDRRYFWHTAFLLFL
                     GEVALSLLVIWKIPYTKIDWPAYMQQVDMFLAGERDYSKIEGETGPLVYPALHLYIYT
                     AFHRLLPSIENVRPAQFVFLGFYLATYLAISTIYYLAGRPSNGGHHFPQVLLIPLTLS
                     KRAHSIFLLRLFNDPIAMLIFYLSVIAFQIGGRKGWRLGCVLFSLALGVKMNILNFLP
                     GLLVLLFQYRGIVGTVEGLSIIGLIQFLLPAPFFFSKSNPYLIRAYFTSAFDFSRQFL
                     YEWTVNWRFISEETFLSRERAVTLLAGHLTVLGLFAAFKWSPVPGGTLRVLRKGFSDP
                     LNQALEVSQVPAYHIPLVLFSANLIGMLFARSLHYQFHSWYFHQLPFLLYSGAGWGNM
                     LTSVLIWVTVQYAWETAPSTISTSAALLAGHGAMVFGLFFHGMKRPSSSQKSKAK"
     gene            complement(345679..347942)
                     /locus_tag="CNL04810"
                     /db_xref="GeneID:3254863"
     mRNA            complement(join(345679..346555,346606..347203,
                     347253..347668,347731..347942))
                     /locus_tag="CNL04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_568022.2"
                     /db_xref="GeneID:3254863"
     CDS             complement(join(345750..346555,346606..347203,
                     347253..347668,347731..347797))
                     /locus_tag="CNL04810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568022.1"
                     /db_xref="GeneID:3254863"
                     /translation="MRGIPVFVAILIGLACSFVQSLGLTIQRKSHIQEDLLPLPARRP
                     AIRRPLWLIGFIIYMTSNVFATLFQLDALPIVILAPLGAISLVFNALFAHVLLGDKFG
                     MSWVVGTALVAGGAVMIAVFGVVPDEEHGLDELLLLLKRGPFVAFFTIVLIAVAAVLA
                     AAHIASWHVYRHQSNQISLSGASSPVSVPSNYASPRSTIAIPFRSTNPRHRSTSNSDD
                     HEDEYAKPNPRLTLKSPSVQKPLSLSISPRIQEVSPKSTAESSLTHTLTLCGLAFAAA
                     AGTLSGLCLVLAKATVELFMKTVDHWRTGVGRNEFARPQTWALMLGMSVIAVAQIWYL
                     HHSLKFTGPALVCPLAFCFFNLSSIFDGLIFYNQFGQLATYQILLVSFGTAILLLGVW
                     IVSAIQPEGSVEVGTWAEEDVMSDSTSISSHESRDEVEAGEGATLLGRGTTEEPEDDE
                     SLWPLPHHDIGTVSVPPTPTGHYQPVFAPSPSSPHSPMSPRSFHTHSHSLSHAHHHHH
                     RGPRYGSLLPDIGPHAAPMGFSIGLGAASPGFALRSGSMSEHHHGERERNRRSRSDGP
                     LGLGAIIRGEDNSSLQTDVEEGRGENATEVALRDWDVGERRRNNWWDVRRFFESQGNI
                     RLTK"
     gene            complement(349233..352045)
                     /locus_tag="CNL04820"
                     /db_xref="GeneID:3254762"
     mRNA            complement(join(349233..349827,349885..350064,
                     350112..350378,350427..350524,350580..350611,
                     350662..351391,351438..351538,351592..351662,
                     351738..352045))
                     /locus_tag="CNL04820"
                     /product="methylenetetrahydrofolate reductase (NADPH),
                     putative"
                     /transcript_id="XM_568023.1"
                     /db_xref="GeneID:3254762"
     CDS             complement(join(349540..349827,349885..350064,
                     350112..350378,350427..350524,350580..350611,
                     350662..351391,351438..351538,351592..351662,
                     351738..351824))
                     /locus_tag="CNL04820"
                     /codon_start=1
                     /product="methylenetetrahydrofolate reductase (NADPH),
                     putative"
                     /protein_id="XP_568023.1"
                     /db_xref="GeneID:3254762"
                     /translation="MKITEKLQKAEKEGRPFWSFEFFPPRTAQGLQNLYDRIERMRDL
                     GPEFIDITWGAGGKNADLTNSLVQVCQATIGIETCMHLCCTEMPKEKVEWALREAKSH
                     GCQNILALRGDPVAGTSTWEPTPGGFMNAVDLVRYIHEHYPGDFCVAVAGFPQGHPET
                     PDTPEGRAQEMEWLKAKVDAGAEFIFTQMFYDTSIFFDWVKRVREAGINVPIIPGIMP
                     IQNWEKFEKWVQRENIIVPSHFYEALNPVRGDDEKVRQVGTKLVADMCKTILDNKEAG
                     IKGLHIYTLNLEKGARMLLRELGFEGRREQIAPLPWRPSLTPSRREETIRPIFWANRT
                     RSYLSRTADWDEFPNGRWGDSRSPAYGDLDGYPVSIGITAPDAYNLWGHPTTSSDLHA
                     LFARFCRGDLAKLPWSTQPPASETSLIIEQLAKMNELGYLTINSQPAVDGVRSDDKVH
                     GWGPPGGYVYQKAYLEFFVSPDLLSPLIRRIEKDPRITYYAVNKQGDLRTNTHSESPN
                     AVTWGVFPGKEIVQPTIVEAVSFIAWKDEAFELGLQWAHLYPAESPSRKLITDTMNTS
                     YLVNIVANDFRDGMSIFEPFLLDQTTVRKVVEGVKGTVEGIVEGVKGVVGA"
     gene            352509..355730
                     /locus_tag="CNL04830"
                     /db_xref="GeneID:3254807"
     mRNA            join(352509..353181,353329..353634,353686..354660,
                     354711..355730)
                     /locus_tag="CNL04830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658163.1"
                     /db_xref="GeneID:3254807"
     CDS             join(352898..353181,353329..353634,353686..354660,
                     354711..355257)
                     /locus_tag="CNL04830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513837.1"
                     /db_xref="GeneID:3254807"
                     /translation="MAHRTNTRSPSGLNRRPTDRCTSQSGSLQTASSPVQSTFGGRIY
                     AAPEEDRGLIMRDRSERDRGENDWADEKGNSMGKTRGMDVGVTRPKRRLSSLPNLLVP
                     PPLHRAMSSTSVSSPPQSPIGQPGHGSYHSLQQPFHNQKAHGSSTANNFPSYSRSNPP
                     KLDDKVGMVGYATAMAAASREKEGPPSLWGIELKWISLITLALQNAFLTIIMHYSRIS
                     TAPNRTYSAAAAVLLNELLKGGISVFIALKRIDNEMTASPPPPVYSEKLDDKDFDKRS
                     GQKLPSIIHPTRLQALSKAVFSPDCYKLSVPAILYVIQNNLQYVAASNLDVATFQVTY
                     QMKILTTAFFSVLLLRKRLSRTKWASLILLAIGVGIVQIQSSSAPAASHHTHVTVSHE
                     RQLRSEIPVSDEPIMSPERVMHPVRGFVAVTLACMTSGLAGVYFEFILKSSSGSSAPD
                     LWVRNTQLSLFSLVPALVPIIVNPSGPNGMGYFSKVMSCFDNFNGWAIGTVLTQTFGG
                     LITALVIRYSDNIMKGFATSLSIIISFLASVALFSYPITLSFIVGASIVLFATYTYNS
                     PAPPASSTRKEIAVPGSPISTSAPILGEPEKPSRASSVINLLGLGSNNGSRKPSVSDI
                     KSYASSQLGLSSYPVSASVSAPGTPRTNMNDYAESGRSSPASFGAVQTSHGGSGAGFG
                     RGNVGDKVRPILSLDIDRKHG"
     gene            358086..362069
                     /locus_tag="CNL04840"
                     /db_xref="GeneID:3254767"
     mRNA            join(358086..358334,358464..358539,358666..358959,
                     359068..359345,359394..359643,359703..359805,
                     359853..359995,360044..360239,360287..360960,
                     361020..361128,361180..361271,361326..362069)
                     /locus_tag="CNL04840"
                     /product="exo-beta-1,3-glucanase"
                     /transcript_id="XM_568025.2"
                     /db_xref="GeneID:3254767"
     mRNA            join(358086..358334,358464..358539,358666..358959,
                     359068..359345,359394..359643,359703..359805,
                     359853..359995,360044..360239,360287..360960,
                     361020..361128,361180..361269,361326..362069)
                     /locus_tag="CNL04840"
                     /product="exo-beta-1,3-glucanase"
                     /transcript_id="XM_568026.2"
                     /db_xref="GeneID:3254767"
     CDS             join(358681..358959,359068..359345,359394..359643,
                     359703..359805,359853..359995,360044..360239,
                     360287..360960,361020..361128,361180..361271,
                     361326..361685)
                     /locus_tag="CNL04840"
                     /codon_start=1
                     /product="exo-beta-1,3-glucanase"
                     /protein_id="XP_568025.1"
                     /db_xref="GeneID:3254767"
                     /translation="MPRPSYDPVANPNFSPDSNISPDPNRNSSFLDPEANNLFGRPGS
                     EYAPAPSLMSRDSTAASMNLAGGTPSLAGTHRDSWGSGVGLTGAEGATNGNRNPGRSG
                     LAHSTVAYESGDRLSTSEEDDEQGHITPAVAAIGAGTAARGFSEKPRWADHESGQGKK
                     NRKWLWAALAALLIVAIGLGVGLGVGLTRNKDSKSLVASAGNENSSSQAPSGTSSVSG
                     STTATSTSATASATPTTGTQGSLITLEDGSTMTYDNPYGGKWVWDEANPFNNEAQANS
                     WTPALNQNWTWGQDKVFGVNLGGWLVTEPFIVPGLYEKYANGSAGTAIDEYTLSINMG
                     DNLTDALTEHYETFITERDFVEIVAAGLNWVRIPIPFFAIEVWEGEPFLPKVSWEYFL
                     KAIKWARKYGLRINLDLHSVPGSQNGWNHSGRQGSVNWLNGVMGLANAQRSLDYVRTL
                     AQFIAQPEYAPVIQMFGFLNEPNGNAISKGPVASFYIEAHNIIRDITGIGAGNGPMLS
                     MHDGFLGVAAWYGDLAGADRMMLDQHTYMVFQDQPQGTLDTLKTMPCQWWASSTNTTS
                     QQWGPNTAGEWSAAWNDCGKWVNNVGSGSRYDGTYDGYADKVTGSCDYWNDYTQWNAS
                     TIEALNHFVSGSMDALQNFFFWTWKIGNSTDAIQQPNPFWHYRLGLEKGWIPKDPRTV
                     AGTCQADGVSMNNFDGTFSNAYVTGGAGAGTIAASASSSYPWPPASFTNVASDSISLL
                     PQYTQTGTPITMPGPTFTSPGSTATISAGSGWYNANANDRQAYAAISGCSYPAEYSAA
                     DLAIPTGACGAGLSQANKRSAQPTPAPTR"
     CDS             join(358681..358959,359068..359345,359394..359643,
                     359703..359805,359853..359995,360044..360239,
                     360287..360960,361020..361128,361180..361269,
                     361326..361510)
                     /locus_tag="CNL04840"
                     /codon_start=1
                     /product="exo-beta-1,3-glucanase"
                     /protein_id="XP_568026.1"
                     /db_xref="GeneID:3254767"
                     /translation="MPRPSYDPVANPNFSPDSNISPDPNRNSSFLDPEANNLFGRPGS
                     EYAPAPSLMSRDSTAASMNLAGGTPSLAGTHRDSWGSGVGLTGAEGATNGNRNPGRSG
                     LAHSTVAYESGDRLSTSEEDDEQGHITPAVAAIGAGTAARGFSEKPRWADHESGQGKK
                     NRKWLWAALAALLIVAIGLGVGLGVGLTRNKDSKSLVASAGNENSSSQAPSGTSSVSG
                     STTATSTSATASATPTTGTQGSLITLEDGSTMTYDNPYGGKWVWDEANPFNNEAQANS
                     WTPALNQNWTWGQDKVFGVNLGGWLVTEPFIVPGLYEKYANGSAGTAIDEYTLSINMG
                     DNLTDALTEHYETFITERDFVEIVAAGLNWVRIPIPFFAIEVWEGEPFLPKVSWEYFL
                     KAIKWARKYGLRINLDLHSVPGSQNGWNHSGRQGSVNWLNGVMGLANAQRSLDYVRTL
                     AQFIAQPEYAPVIQMFGFLNEPNGNAISKGPVASFYIEAHNIIRDITGIGAGNGPMLS
                     MHDGFLGVAAWYGDLAGADRMMLDQHTYMVFQDQPQGTLDTLKTMPCQWWASSTNTTS
                     QQWGPNTAGEWSAAWNDCGKWVNNVGSGSRYDGTYDGYADKVTGSCDYWNDYTQWNAS
                     TIEALNHFVSGSMDALQNFFFWTWKIGNSTDAIQQPNPFWHYRLGLEKGWIPKDPRTV
                     AGTCQADGVSMNNFDGTFSNAYVTGGRCWYHCGVRVLFLPLAACFVHQRRLGLHISPP
                     SIYPDGYSYYHARTYIYLSRVYCDHQRG"
     gene            complement(361800..362947)
                     /locus_tag="CNL04850"
                     /db_xref="GeneID:3254896"
     mRNA            complement(join(361800..362165,362222..362306,
                     362364..362621,362672..362947))
                     /locus_tag="CNL04850"
                     /product="HDEL sequence binding protein, putative"
                     /transcript_id="XM_568027.2"
                     /db_xref="GeneID:3254896"
     CDS             complement(join(362118..362165,362222..362306,
                     362364..362621,362672..362922))
                     /locus_tag="CNL04850"
                     /codon_start=1
                     /product="HDEL sequence binding protein, putative"
                     /protein_id="XP_568027.1"
                     /db_xref="GeneID:3254896"
                     /translation="MNIFRFLGDLSHLASILILLHKIQTTRSCRGISFKSQLLYLIVF
                     LTRYVDLVTHPLVSVYNTAMKLFFIASTAYTLYLMKFKYRPTHDASLDTFQLSYIFGP
                     VAVLALLFNYKFTPFEITWSFSIWLESVAILPQLFMLQRTGEAETITTHYLAALGLYR
                     GLYIPNWMYRYFTEGAFDAIAVVAGIIQTAIYADFGYIYVTRVLRGQKFELPA"
     gene            363130..367817
                     /locus_tag="CNL04860"
                     /db_xref="GeneID:3254768"
     mRNA            join(363130..363224,363269..363435,363477..363566,
                     363605..363668,363717..364063,364111..364237,
                     364286..364516,364572..364889,364946..365066,
                     365123..365286,365339..365625,365691..365816,
                     365876..365990,366070..366720,366770..366966,
                     367034..367170,367227..367479,367533..367817)
                     /locus_tag="CNL04860"
                     /product="ATPase, putative"
                     /transcript_id="XM_024658164.1"
                     /db_xref="GeneID:3254768"
     CDS             join(363409..363435,363477..363566,363605..363668,
                     363717..364063,364111..364237,364286..364516,
                     364572..364889,364946..365066,365123..365286,
                     365339..365625,365691..365816,365876..365990,
                     366070..366720,366770..366966,367034..367170,
                     367227..367479,367533..367748)
                     /locus_tag="CNL04860"
                     /codon_start=1
                     /product="ATPase, putative"
                     /protein_id="XP_024513838.1"
                     /db_xref="GeneID:3254768"
                     /translation="MNARISYTTAASLESASRVRVIPKKGRGKGEIVPLDRKTAPGAT
                     EPAYSFSYQRDTYVYNRADNVFTPIPYPCDSSPPLSTFQTARGILTHPAARPKPTAPE
                     AGLPSLEALKATYGLNECHIPIPKFAELFAEHAVAPFFVFQMFCVALWCLDEYWYYSL
                     FTAFMLVVFECTVVFQRVKTLQEFRTMSITPYNVQAFRDGKWVSVISSELVPGDLVSI
                     LRTNPDSGIPCDLLLLRGTCIVNEAMLSGESTPLLKESIELREGTDRLDMNGADRNNV
                     LFSGTKALQVEKAGEGGMTTPDGGCLAVVLRTGFGTTQGQLVRTMIFSTERVSANTFE
                     AFLFIGFLLIFAIAASAYVWIKGLERGMVKGKLLLDCVLIITSVVPPELPMELSLAVN
                     ASLVALQKYAIFCTEPFRIPWAGRVDVCCFDKTGTITGEDLVVEGIAGVNSADPKALR
                     PVTESNKETTLALAAAHALVLLDDGTIVGDPMEKTTLAALDWKLSRGDQISPVSKESP
                     YKAQIHIRRRYQFSSALKRMSTISSVSDSQGKKWVAAVKGAPETLKSMYVQVPDWYEE
                     TYRWYTRRGSRVLALGVKYMDVQADKINQIHRDHVECKLSFAGFLVFHCPLKPDAVET
                     LKMLNDSSHRCVMITGDNPLTAVHVARDVEIVDREVMILDLKEGTTSNELVWRNVDET
                     NVIPVNSSEPFDQSLFKNYDICITGAALKQYDALPSVTDLIKHTYVYARVSPAQKEFI
                     ITTLRSLGYITLMAGDGTNDVGALKAAHIGVALLDGSPEDLKKIAEHQKLERMKKVYE
                     QQVRISARFNQPPPPPPPALREAYPELVKTQQQVAKAHEGAKKANPLEKFDMATITSK
                     LSELDEDQDVPQIKLGDASCAAPFTSKLSNVSAISNIIRQGRCTLVATIQMYKILALN
                     CLITAYSLSVQYLDGIKFGDYQVTITGMLMSVCFLCISRAKPVEKLSKERPLGNIFNL
                     YVLLSVLLQFAIHIVALVYITGLSKSLEDRGEIDLEKKFEPTLLNTAIYLLGLSQQVS
                     TFVLNFQGRPFREGIRENPPLYYGLLGVSAVAYCGATDFVPELNRWLQLVEMTTSFRV
                     KLTISMVLDFILCWAIEKTCKALFADLEPVEFVTRGRERREKRRAQEAKKLKEDERLR
                     LLAEGEKKAQ"
     STS             367492..368292
                     /standard_name="Pst18"
                     /db_xref="UniSTS:470732"
     gene            368190..371964
                     /locus_tag="CNL04870"
                     /db_xref="GeneID:3254747"
     mRNA            join(368190..368593,368649..368901,368965..369321,
                     369387..369605,369677..369838,369910..370184,
                     370242..371399,371481..371964)
                     /locus_tag="CNL04870"
                     /product="calcium-transporting ATPase, putative"
                     /transcript_id="XM_568029.2"
                     /db_xref="GeneID:3254747"
     CDS             join(368459..368593,368649..368901,368965..369321,
                     369387..369605,369677..369838,369910..370184,
                     370242..371399,371481..371786)
                     /locus_tag="CNL04870"
                     /codon_start=1
                     /product="calcium-transporting ATPase, putative"
                     /protein_id="XP_568029.2"
                     /db_xref="GeneID:3254747"
                     /translation="MAAGRRLLGKKDYDERRMEEEEKRLSTERRQRETPSSIYAHKSV
                     QETLDIFATHPTDGLANSAVAPLLARYGPNEFEVPPSDPLYLKFAKQVYENPLILLLL
                     GSSVVSALMGQFDDAACVVIAVGIVLTVGFVQEQRSEKSLEALNKLVPHYCHLIRNGT
                     PLSPLANALLPGDLVTFSVGDRIPADIRLITANHLEIDESALTGETRPARKNTQLCER
                     GEGEDTHGEGGGKALGERHCMAFMGTLVRSGNGSGIVVGTGKDTEFGVIFSMMQDVEE
                     KRTPLQLDMDNLAKQLSIVSFIVIGFIVLIGVIQKRDWLEMFTIGVSLAVAAIPEGLP
                     IVTTVTLALGVLRMSKRKAIVKKLPSVEALGSVSVICSDKTGTLTKNEMTVTHMYSVD
                     ELVDLTPHLNVTSPFGPRRPDSQQLWISPALLKVALVGNLCNDAFKNEQGINVGQATE
                     VALLNVLPVLKAEDQRKNFIRKSEIPFSSETKTMSITGSLNNSPDMIYLKGAVEQVIA
                     RCRYYYVTDSSTPSLDTATQKIILDRAMEVSKRGLRVIAMAYGFPGKGDDEPNNLVFV
                     GFEAMMDPPRNGVVHAVSALHSAGVQIVMITGDAEPTAVAIAKQLGLKVSASTSGTLD
                     DHPHSLFSGSSCILGSQIDQMTERELVERVSSITVYARTTPRHKMAIVKAWQMRGAVV
                     AMTGDGVNDSPALKMADIGISMGKSGTDVAKEAADVILVDDDFASILPAVEEGKSIFY
                     NIQNFLSFQLSTAVAALSLITLSTVFKLANPLNAMQILFINILMDGPPAQALGVDPVD
                     EEIMRQPPRKKGSHVLSTRLIYRVLFSAAMIVLGTLWIYTVETSDGSMSRRDQTMTFT
                     VFVFLDLVSALQNRGLTTPMFRNRMLFLTISVSFICQLALIYIPLLQHVFQTEALSAR
                     DLFMLLGLAGTSMGLHEGRRWWERKQVEAEILEKSAGGMV"
     gene            complement(371892..373906)
                     /locus_tag="CNL04880"
                     /db_xref="GeneID:3254816"
     mRNA            complement(join(371892..372127,372184..372274,
                     372328..372676,372732..372913,372978..373419,
                     373474..373508,373570..373647,373703..373726,
                     373777..373906))
                     /locus_tag="CNL04880"
                     /product="ornithine-oxo-acid transaminase, putative"
                     /transcript_id="XM_568030.2"
                     /db_xref="GeneID:3254816"
     CDS             complement(join(372065..372127,372184..372274,
                     372328..372676,372732..372913,372978..373419,
                     373474..373508,373570..373647,373703..373726,
                     373777..373871))
                     /locus_tag="CNL04880"
                     /codon_start=1
                     /product="ornithine-oxo-acid transaminase, putative"
                     /protein_id="XP_568030.1"
                     /db_xref="GeneID:3254816"
                     /translation="MSPIASTASPIPSSKPTLSSQEVMNLEHEYSAHNYHPLPICFEK
                     GLGAHVWDPEGNEYLDFLSAYSAVNQGHCHPEILNTLVTQASKLTLSSRAFYSSNLGP
                     FAKKITSMFGYDMVLPMNTGAEAVETAIKLARKWGYEKKKIPDGKAKVLSVEGNFHGR
                     TIGIISMSTDPESRTGFGPFLENVGPRWDTGLIRYNHTEDLEKVLEKHGDEVAAFLVE
                     PIQGEAGIFVPDDGYLAKCAEICKKYNVLLICDEIQTGLCRTGKMLCYEWDNIRPDMV
                     ILGKALSGGMYPVSCVLADKDIMLCIKPGEHGSTYGGNPLGCAVAMTALDVLVKEDLA
                     NRSLKLGEIFRSELAKLNSPFIKLIRGRGLFNGVVIDETASKKGRTAWQLCLLMKSKG
                     LLAKPTHVNIIRFAPPLVISEEDVRKAVKIIGESLEELDTIEKIPGDEGEEHKAAIKL
                     DD"
     gene            complement(374221..377854)
                     /locus_tag="CNL04885"
                     /db_xref="GeneID:36393121"
     mRNA            complement(join(374221..375505,375567..375803,
                     375853..376164,376216..377854))
                     /locus_tag="CNL04885"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658828.1"
                     /db_xref="GeneID:36393121"
     CDS             complement(join(374273..375505,375567..375803,
                     375853..376164,376216..377811))
                     /locus_tag="CNL04885"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514661.1"
                     /db_xref="GeneID:36393121"
                     /translation="MPRPKPQIGPGKWIDTRRPDQNSATKPPSQRPLRPLSSHGLPTP
                     PTTGLRKRGELSNPGVDGSAEGKRTPMSHKQSSLSRFIKGKGRTEKLRTNEDRSPSGG
                     SGSPLPLGGNRSALRRKSKLEIFDDNYQADDTWSNDAPQSRERASTRRTVEERDENLL
                     TSRIGRFSSKVIAQSRSEGRTRSRSRSPTKPPQQALRSPSRKHTPSPSKSPPLFPPHT
                     PVALVSRDDLLQSESMYSPTPVPETDMKRHRRMAGQDESTKRIVESPWKNDFPDQYSD
                     DNKRKREISPTESEKIRRRAKEVFEEYKLEEYKRDKNRLRGTSSDENALPKPPPKKQK
                     IYSTPSVRAKVFRRDPVGKAGPPIPTILPRDVGRSYSPLPRTSVLKSSSPDMTPEMVN
                     RRTSPGPSPGKRLKNNSSPLIPPSSPAAAAVPSSPSQQMGQPQVTATVNNQPSSDPLM
                     LRHPDPCMSHEETLLIVPTKAKAPDRSISPPLNGSQVWFNPGADEARPMPPTSEIERG
                     KVMHDERNAGNVEHVGPGKIVDPELEDTQGFTFRIPSPSKTATMSLGSTPVRRSQRIA
                     SQRTASPSPRIPGRASATPIKSPRRSSLMKTPPSGRPSQKGVNRSGKRSPRLPFGSQY
                     EADDDIPSSHPDLANTLLPGMFSVGSDQTIPASQSSKVKSPLQPLRHSQASAKNTSPL
                     PSQTSLNSSQMSPSRSRNHPASFRIFDETGSSGLEETVYFRAFNIPSPPKHCLTDMLP
                     PSPSFRRHPSQHHGTQRTGSLASPVAPGQSSVEEAMRPGPSPIQKLSSSAPKGQGKRK
                     LRGDIPSNKSGEVLVSGSDSFRASQLKFSPSKEERDAKEGTEERDNKRMRVGDPGGWD
                     VTDKEDEENESEPVKMTPWTRAAAAKATASSTPNTSTPTARKGNCKATTKKTKTSGKK
                     TFAPAQEKAAYLESFGFFKTKKQKVKGFEFKTSFDEELDVEPEQSDDEEVRGSQVITA
                     AKSVTGSDKTLARIPSPPPHPSLRPAGLRELRRRKAEEASQAVQSIECLPVATQSSSQ
                     TTATLPLSLPPSSFPDTQNKAAADEDEKDEEHPLFEEYIRLRGRPSSSQIMASQRTGE
                     GFSSQSTSMSLRTPASTRAYMTELRKGRAGLPMSDEE"
     gene            378506..379398
                     /locus_tag="CNL04890"
                     /db_xref="GeneID:3254843"
     mRNA            join(378506..378737,378925..379057,379109..379220,
                     379273..379398)
                     /locus_tag="CNL04890"
                     /product="cytochrome c oxidase polypeptide iv,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_568031.2"
                     /db_xref="GeneID:3254843"
     CDS             join(378568..378737,378925..379057,379109..379220,
                     379273..379334)
                     /locus_tag="CNL04890"
                     /codon_start=1
                     /product="cytochrome c oxidase polypeptide iv,
                     mitochondrial precursor, putative"
                     /protein_id="XP_568031.2"
                     /db_xref="GeneID:3254843"
                     /translation="MASAIRSLRTALPALRRTVPAPAFTARAFSISAARSAGHGPPQL
                     LGPGAKAGEVPNDENQSTGLERFELLGNLEGVDVFDMKPLEITRLGTVDEPIPIYSLF
                     PERQIGCTGFPVDSHDTIWLNVNHTLKNHRCPECGSVYTLNFQGDEALLHGGGHHH"
     gene            complement(379504..380626)
                     /locus_tag="CNL04900"
                     /db_xref="GeneID:3254810"
     mRNA            complement(join(379504..379746,379800..380311,
                     380504..380626))
                     /locus_tag="CNL04900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568032.1"
                     /db_xref="GeneID:3254810"
     CDS             complement(join(379675..379746,379800..380311,
                     380504..380606))
                     /locus_tag="CNL04900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568032.1"
                     /db_xref="GeneID:3254810"
                     /translation="MFSINLVRPAMTVAAPLRVRMLSTTSLLLKKKNIDTTLPTVPKG
                     PPTPYTLWFKDHIANVSEKYRRPDGKLDMRRLTNEAATEWASLTSSVKAELQSRADEG
                     RKLADKAYLEFWNSTTPETRTAIEKATGKKVSPPGGKKAFKQSVKERPGNPGKPLTPY
                     FAFAKEVRESGKVELPSDLEGNVRNQQLARETGALWKQLSDSEKQKYKDAYVQARAKW
                     DEWRQTQPDL"
     gene            complement(380953..384129)
                     /locus_tag="CNL04910"
                     /db_xref="GeneID:3254875"
     mRNA            complement(join(380953..381109,381174..381342,
                     381404..381449,381508..381641,381694..381902,
                     381961..382396,382456..382551,382600..382671,
                     382724..382879,382934..382957,383008..383022,
                     383079..383121,383189..383298,383365..383731,
                     383788..384129))
                     /locus_tag="CNL04910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658165.1"
                     /db_xref="GeneID:3254875"
     CDS             complement(join(381027..381109,381174..381342,
                     381404..381449,381508..381641,381694..381902,
                     381961..382396,382456..382551,382600..382671,
                     382724..382879,382934..382957,383008..383022,
                     383079..383121,383189..383298,383365..383679))
                     /locus_tag="CNL04910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513839.1"
                     /db_xref="GeneID:3254875"
                     /translation="MASAASPGEPSQPLTPSQGQTNLGRQNSRLSNTLTHIRSIEAYP
                     PRDDEMIDRPPDQTGPSKNSEKQAVKGLNAIDIEHLPVDNDPRKWSDRKKWTVLMIMT
                     FAMLGPMMAPSIYNPVISDVREDLHATESELGLSISLYILFQGCTPVLWAAIAELNGR
                     KTVYLVSYTLYVIALVVASRANSMPLLIVMRILQSTGSGPTVSLGAGSLADMYETHER
                     GAKLGLFYGVPMIAPAVAPLIGGALGQSFGWRSVFYFLAVYAFIMLCCFMVFPDSWRR
                     QRSRVYQRALTKAIERAENRDAKDLKRKAKLAKQSQVLDTIPATPDATPGNSPGNSRR
                     PSAEAGGAAVTDTTLVDVTLSNDQKQTVGRSGRIKVKMMKWLPFGAKEEKIQAENEVE
                     FKPTFRDLNPLPSMALILKQPTNLLILTSSALSFSAQYTIVYTASITLGKAPYSYGSL
                     KIGLVVLAFGIGNILASMIGGKYSDMVLKKLKKKNGGVGNPEMRLRSTVLAMPILVAS
                     FLAYAWTAEEKVHIAALVVCLFFAGFSLLWIYSSTLAYVVDANPGASSSAVSCNSMFR
                     GICACVMSQVATPIQNGIGDGGLYTLFAGILAFACACNLLLMVKGEQWRSPEHRWPWQ
                     KKREEGNDEKE"
     gene            complement(384747..386681)
                     /locus_tag="CNL04915"
                     /db_xref="GeneID:36393122"
     mRNA            complement(join(384747..384907,384968..385311,
                     385371..386283,386333..386681))
                     /locus_tag="CNL04915"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658830.1"
                     /db_xref="GeneID:36393122"
     CDS             complement(join(384818..384907,384968..385311,
                     385371..386283,386333..386632))
                     /locus_tag="CNL04915"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514662.1"
                     /db_xref="GeneID:36393122"
                     /translation="MFDLSPTPFVPSKSLVPSSPSRITIHRNQLHRASSSENLIVGGL
                     ANWRRKPRPSTSHSQYSVKSVGSKVSGCEVKNGSKRGLGMGMQATPARKRRLTNNASI
                     GAMSTPKTMQSRFRSTEGDLTSSTCRSISSNELLDSAEDATSPSISADDINPIANNWD
                     SVRTMDEDSSTPNILYSSGSHTLFPAALDILVPLNDIFSVSQQYPHIIPTSGDAFSEL
                     EWDIRVPLNDVLSTPRATRITSSWQAASKIDQRRSTPYRHGGSSGPVAISIDVASGID
                     NGVLDESVEFVRSICPSPEGLNHYVLGPDSRHENDIAASSDVQLFETPIRKRVMEDIL
                     LDPELEEFGGQKMASRVLTPISNNMEHLSTRFLRRDKRWERAENLISPAQYHEVSWMD
                     PFGFWWMCHIVSDKSPAVYDPSSPPRPVARHSSTPLIFPSMTSRTTSLETTDYLSHGS
                     VEEKEGAPISGKWRGAEMMARMEGDFIAAEGQGSHVSEEDRHAAADHQERPRRQNRRY
                     RRGNKLAQFTEEFSRQREARIQHYKDLEEHYSLKVELVLG"
     gene            complement(386688..388061)
                     /locus_tag="CNL04920"
                     /db_xref="GeneID:3254848"
     mRNA            complement(join(386688..386872,386918..387634,
                     387689..387823,387878..388061))
                     /locus_tag="CNL04920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658166.1"
                     /db_xref="GeneID:3254848"
     CDS             complement(join(386864..386872,386918..387634,
                     387689..387823,387878..387997))
                     /locus_tag="CNL04920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513840.1"
                     /db_xref="GeneID:3254848"
                     /translation="MGADGGSIPDRRDLVKTKGKTEQADKESLKALFFLCALSKKPLK
                     KPVVIDPLGKLYNKDDLIEYFLDKSKYGDGEQICGHLKGVKDLTTLNLTPNPDFTFSS
                     ASATVTTSRAPFICPLSLREMAGTFPFIALKSCGCVFSDAALRAVVPNLTKGTGAKVI
                     PKDDVPEEGKPVVKENTTEVACPNCGKTFNPTISAAIIPVNPPKEVQDVLLEDLLTSR
                     AAAKSSKKRKADKSTKANNDTGSPATLEPPPKSARISSSSPAPRATPTVNTPASLARS
                     VHEKLAEQEKKRLQAQENMSEAVKAMFKPKTNEKKSGADDFFGRTFNRYA"
     gene            388231..390148
                     /locus_tag="CNL04930"
                     /db_xref="GeneID:3254864"
     mRNA            join(388231..388334,388537..388557,388948..389278,
                     389333..389430,389492..390148)
                     /locus_tag="CNL04930"
                     /product="expressed protein"
                     /transcript_id="XM_568222.2"
                     /db_xref="GeneID:3254864"
     CDS             join(388966..389278,389333..389430,389492..390028)
                     /locus_tag="CNL04930"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568222.1"
                     /db_xref="GeneID:3254864"
                     /translation="MSQVSLSAQYLASARPSGAAPPSISGTPRPVPTSTGNPSQASAR
                     PPYRPNINVPKRSNDDVFARSKVPQTPTTSSSQVGNDSISGAGAEKKKKEDSLRGTMR
                     NEIAKLMYGAGDVADPDIDTVDYMEDMVVEFLSDLCRPVPPIRSNPSQPHQPVPLSGE
                     VVRHRLATTPMLHKYLARFDHMVHMADVLKAHRRVADPSLKDLVDQVGNDYLGLNEHG
                     VPTGTGDAGAAGAGGVGRQKRPAEGEGEDAPKKKGRPPKPPGERKKPGPQKGWKLNRD
                     PNAPPVKKLPRDPNAPKRKYVRKAPLKSQMGTPTASSGV"
     gene            complement(390116..391118)
                     /locus_tag="CNL04940"
                     /db_xref="GeneID:3254873"
     mRNA            complement(join(390116..390291,390351..390469,
                     390529..390552,390605..391118))
                     /locus_tag="CNL04940"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658167.1"
                     /db_xref="GeneID:3254873"
     CDS             complement(join(390169..390291,390351..390469,
                     390529..390552,390605..391064))
                     /locus_tag="CNL04940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513841.1"
                     /db_xref="GeneID:3254873"
                     /translation="MAIIEEVPASSTIRSRAPTKDNKQKGKSNGQPTIPLVHPSALPK
                     PTAPPLLNVPPPGTIPDGARVHTVGSAEEIEQLQQQLEGKRGEEEDDEDEDEDEEHER
                     EEQGDDVIFNTLIMAVPFTFLYLMLDILVHLQYSHKAGWYLLGEHALKALPTLSLLIY
                     YTNEYPTHPLTNSFLMSASILSGCRLVWLVNKASWSVVTAQAPPMGTLWILTIVQLPL
                     GRALLALMFVGGWFWYADLKFAP"
     gene            complement(391258..392672)
                     /locus_tag="CNL04950"
                     /db_xref="GeneID:3254946"
     mRNA            complement(join(391258..392224,392299..392545,
                     392594..392672))
                     /locus_tag="CNL04950"
                     /product="diphosphomevalonate decarboxylase, putative"
                     /transcript_id="XM_568247.2"
                     /db_xref="GeneID:3254946"
     CDS             complement(join(391334..392224,392299..392545,
                     392594..392643))
                     /locus_tag="CNL04950"
                     /codon_start=1
                     /product="diphosphomevalonate decarboxylase, putative"
                     /protein_id="XP_568247.1"
                     /db_xref="GeneID:3254946"
                     /translation="MVYEATASAPVNIACIKYWGKRDTRLILPTNSSLSVTLDQDHLR
                     STTTSRADASFEAGDKLWLNGKEEVIKEGGRLAVCIKELRGWRKEMESKDKDLPKLSE
                     WPLRIASYNNFPTAAGLASSASGLAALVASLASLYSLPQSPSQLSLVARQGSGSACRS
                     LFGGFVAWREGTDPAGSDSLAEEVAPREHWPEMHALICVVSDAKKGTSSTSGMQKTVE
                     TSTLLQERLRIVPKRMDAISQAIKARDFSEFAKLTMADSNSFHAVCLDTAPPIFYLND
                     VSRAIIAVVEELNRAAGEIIAAYTFDAGPNAVIYTLEKNMPVVLGAIKRFFPTGEEFE
                     DPFQTGVRDLPEGFNTGVVREGGWEKGAVKGLIHTRVGDGPRVLKKEESLLGENGVPK
                     VLA"
     gene            complement(393037..396249)
                     /locus_tag="CNL04960"
                     /db_xref="GeneID:3254914"
     mRNA            complement(join(393037..393334,393392..393741,
                     393794..394020,394069..394207,394260..394384,
                     394435..394686,394749..394947,395000..395215,
                     395264..395384,395433..395540,395593..395916,
                     395978..396249))
                     /locus_tag="CNL04960"
                     /product="membrane organization and biogenesis-related
                     protein, putative"
                     /transcript_id="XM_568036.2"
                     /db_xref="GeneID:3254914"
     CDS             complement(join(393118..393334,393392..393741,
                     393794..394020,394069..394207,394260..394384,
                     394435..394686,394749..394947,395000..395215,
                     395264..395384,395433..395540,395593..395916,
                     395978..396189))
                     /locus_tag="CNL04960"
                     /codon_start=1
                     /product="membrane organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_568036.1"
                     /db_xref="GeneID:3254914"
                     /translation="MNQTPQIAQDLLKNPPQELQQLLNDPRTPDSARKAVQELQAPFV
                     GPGTAGNKDGAKESPRLQIVNENQEFTKELSPYLAKWDLLDKGFAYDVVAVFGSQSTG
                     KSTLLNRLFGTTFDVMDESKRQQTTKGIWMCPSQYSNTLVMDVEGTDGRERGEDQDFE
                     RKSALFSLASTEVLIVNLWEHQIGLYNGANMGLLKTVFEVNLGLFGGGGDNTKPKPQE
                     KTLILFVIRDHVGATPMSNLTATLTQDMERIWDSLSKPAHLEDAVLSSYFDLSFAALP
                     HKVLMPEKFEEAVLELRQRFTDRSREDYVFQPAYHKRIPADGVSFYMEGIWQQVLTNK
                     DLDLPTQQELLAQFRCDEISTVVFEAFLASAKIVRRPVEAGSVVEGLGALMRDWLETA
                     LGKFDRDASRYHSAVYQRKRLDLLASLHASLSPLFLGQLKNLHKIETAKFSKDIVAGV
                     KEPGYDFGVVVEEGKRRARERFLAGAKEVKVEETDWEYEHELALLDEDLKLIADKCRA
                     DETKKMVNAIERNVKRQILEPVEVAMSQPTKTMWDTVLKTYSDVIEAAEEAYLSKAKS
                     YNCSDEENSTALASLRARAWLALRRKLEEQTSDSTVLTTLRTKFEDSFRYDEAGVPRV
                     WRPEDDIEAAFRKAKDETLGLLPLFANIAPTEGSLLPELPPPEPSFDVESDPSPFDPS
                     TAFTLLTATKLLSLESRFKRDADAAYVEAKRSMVSSVAQIPVWMYGVLVVLGWNEAMA
                     VLFNPLYFAMLLVLAASGYIILQLGLAGPILQIASTVIREIRQMVVKKLREAFADVPE
                     AQRILAQPVTASSSDEQERKGDLIKGEMLEK"
     gene            396444..397854
                     /locus_tag="CNL04970"
                     /db_xref="GeneID:3254915"
     mRNA            join(396444..396702,396760..396829,396877..396929,
                     396991..397079,397141..397173,397228..397854)
                     /locus_tag="CNL04970"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658168.1"
                     /db_xref="GeneID:3254915"
     CDS             join(396479..396702,396760..396829,396877..396929,
                     396991..397079,397141..397173,397228..397673)
                     /locus_tag="CNL04970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513908.1"
                     /db_xref="GeneID:3254915"
                     /translation="MEQGDMKAASHSDHRREQSHAQPEAQRAAPTQHTTTASHDLRFI
                     DHYLDDEEAALGHVRGRFQSIVSRVEELFGFLYSATKPYTDKVVAVAEQNPILFTFAS
                     IWIAFSIIPIIIFAGFVAFCTVTIFSIATFFICATIVGILLLTFFAVIGTVVIASAIL
                     IPTLAITTILSTLTLSFLLGLFVIHRLYLHLSAATSDEWSLEAVGQGFKGWVEEVGER
                     VGLDGSETIVLKQSPDDDDGRAKIIDEKNDSSGGATSTTAASESEQAGHIEDEKANTR
                     ELNMVTSSTLEKTSQNHDNRRLRDAAST"
     gene            complement(397741..399685)
                     /locus_tag="CNL04980"
                     /db_xref="GeneID:3254958"
     mRNA            complement(join(397741..398384,398434..399136,
                     399184..399357,399412..399685))
                     /locus_tag="CNL04980"
                     /product="homoserine O-acetyltransferase, putative"
                     /transcript_id="XM_568037.2"
                     /db_xref="GeneID:3254958"
     CDS             complement(join(397899..398384,398434..399136,
                     399184..399357,399412..399635))
                     /locus_tag="CNL04980"
                     /codon_start=1
                     /product="homoserine O-acetyltransferase, putative"
                     /protein_id="XP_568037.2"
                     /db_xref="GeneID:3254958"
                     /translation="MSDNAPTPQKIRDTNPYASLISQQIAIIPSFTLESGVTLNNVPV
                     AYKTWGKLNEKADNCLVICHALTGSADVEDWWGPLLGLNKAFDPTRFFIFCGNVIGSP
                     YGTISSVTTNPETGKPFGPEMPGSSVKDDVRLHYIILKSLGVKSVAAVVGGSMGGMTV
                     LEYPLNTPPGFVRAIIPLATSARHSAWCISWGEAQRQSIYSDPDYKDGYYYEIEEEGG
                     KVDLARQPARGLAAARMAALLTYRSRDSFESRFGRRAGGGKSSVPKGGVRIMGGQETT
                     DPSVPSESDLAAKSPSWRAWREHNDGHRSSGARPISRSGSEGPNRGEGDAAQAEVVKT
                     QEVKANGNKIGTGGEAPPKIFSAQSYLRYQGDKFTGRFDANCYIHITRKLDTHDLSAP
                     SRDTSLSSLSSGLPSSADATEEELNARLIHALSLEPPALVIGIESDGLFTTSEQRELA
                     AGIPDAELVVIPSPDGHDGFLLEFEAINGWVEGWLKRKMPEFYEKRVIDPEDYVQGEE
                     GFDIKKESVFGEAEADVTRW"
     gene            complement(399871..403228)
                     /locus_tag="CNL04990"
                     /db_xref="GeneID:3254746"
     mRNA            complement(join(399871..402621,402683..403031,
                     403088..403228))
                     /locus_tag="CNL04990"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658169.1"
                     /db_xref="GeneID:3254746"
     CDS             complement(join(399911..402621,402683..403010))
                     /locus_tag="CNL04990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513842.1"
                     /db_xref="GeneID:3254746"
                     /translation="MLPTTRQAYSRRLTSVASITSLSASPALPAESSRQAFLRAIASR
                     PTHTDAAGLSRSGTRHQSTAPVSGSKGRSMSSGVAAAAWAIAEDDGTGRYSNQQSWGK
                     LAGPTGSDPIKPLSANKLKSFQADLDVHDDFSLHPLPKEPPSEWLDSWLQSYDPSQLP
                     PSPLPPLETFRGLIPSHPLLALLTLPKLPHADLLTIRHAEVRALIWGVTKVTRDIPKV
                     LLRINPEDCAKAIRVLRAIIYALPSCKNSSDPFMGRYLRGKILRNLLTLCYRLKCHRV
                     AKIIFQERLREQLATDSNPPILPFEGIAEDLAAAREWQVIVELFSPETFPHRYFTSEL
                     IAFYMQAHFGIHQSSKVPRIFELHDVLDLEPSVNAMNHLVQAFLHMGDLPTAKAIAKE
                     ANITGGVDYACQQLAILWGYRSLGRDKDLEIKVLDDIERLELPLEARLLHALIRLRLD
                     ANEISKAEELLKKFNLTEWGVEGGGHVTPTSKTASLLFMIASRKGDLKEVKRIWDKMC
                     TSSEVVDEEVVTNLLRALFEQGKSDDALAALQSALPDAPSTDSEWKLPHGVKPDIRAM
                     NFVLGALSRERGIPGLEIAMSLIHSFGIKPNNLTLKTIVDFSRSTLQHSPYDLATLVS
                     RIMESTPTLPPSQSLLDSILADAVSSSARTRNRDASSTKFFPSHNEDTFHPTAGLVLS
                     PPLYSALSAIIESLESIDSRSTSRSLANRLRYDAMTNTDISGVPSARIVWNALIARGF
                     NPDHRHIVALMQGYADAGHMYEVQDLLILASQIGISTTKDMLMVVLTGWGKKRKPRHA
                     RKAYERIRSLGGKEGEGLDLLAVTAMIQAYSFAGKYKEAAQLCYTDLQRLGVRLDEKA
                     VAVVAQALRSDGDLRGALRVMEANGKALGVTGRKITRGIKLYARKQLLKGLDKEQQQD
                     MNEVVQLAEQMIREDELARPTTLKKWNRLGGPTRGRLENAWSGVVSEGRNQEGVRGRR
                     ARTGKRAIVGRGRGIGFRALEARRERRRLVAERRKNGVAL"
     gene            403435..406272
                     /locus_tag="CNL05000"
                     /db_xref="GeneID:3254943"
     mRNA            join(403435..403540,403597..403723,403776..404018,
                     404065..404121,404177..404370,404424..404550,
                     404605..404934,404987..405132,405186..405567,
                     405632..405811,405881..406272)
                     /locus_tag="CNL05000"
                     /product="nicotinate phosphoribosyltransferase, putative"
                     /transcript_id="XM_024658170.1"
                     /db_xref="GeneID:3254943"
     CDS             join(403466..403540,403597..403723,403776..404018,
                     404065..404121,404177..404370,404424..404550,
                     404605..404934,404987..405132,405186..405248)
                     /locus_tag="CNL05000"
                     /codon_start=1
                     /product="nicotinate phosphoribosyltransferase, putative"
                     /protein_id="XP_024513843.1"
                     /db_xref="GeneID:3254943"
                     /translation="MPDKLHLPIDDVQIPFSILDTDLYKLTMQNAVLHHFSDAHVVIK
                     FTNRSPQMLFSKECFDWVQQRVNDLSKLKLTSEERKELSKACPYFSESYLDYLSNMQL
                     DPVKQVKLTFIPQGSNEKGEKMGEIGCVIEGPWKDTMLYEVPVMAILSEGYFKFVDTD
                     WDYDGQFELAKKKALDLLNPPAPTTSLSFSEFGTRRRRSFKAQDIIMRGLIAGHEEYK
                     SKGGSQGILSGTSNVYLALKYGLNPVGTIAHEWIMAVGATYGYRGANGRAMDMWEEVY
                     PPGTKFSSPLTMLTDTYTAAIFFKDFISDPARALRWAVLRQDSGDAFKFVEDAKEAWR
                     TIEDKAGIKRDVGPNGEEEVAKGKKVIFSDGLDVEKAIKLQQGCDKAGMAASFGIGTD
                     LTNDFRKASDPSQKSKALNMVIKLNKINGKDCIKLSDDKGKHTGSLEEVRKAQQELGI
                     NKN"
     gene            407184..409825
                     /locus_tag="CNL05010"
                     /db_xref="GeneID:3254951"
     mRNA            join(407184..407577,407630..407682,407742..407776,
                     407813..407897,407951..408103,408153..408209,408259,
                     408312..408374,408424..408503,408549..408616,
                     408668..408711,408763..408889,408942..409166,
                     409220..409335,409391..409442,409502..409825)
                     /locus_tag="CNL05010"
                     /product="GabA permease, putative"
                     /transcript_id="XM_024658171.1"
                     /db_xref="GeneID:3254951"
     CDS             join(407311..407577,407630..407682,407742..407776,
                     407813..407897,407951..408103,408153..408209,408259,
                     408312..408374,408424..408503,408549..408616,
                     408668..408711,408763..408889,408942..409166,
                     409220..409335,409391..409442,409502..409674)
                     /locus_tag="CNL05010"
                     /codon_start=1
                     /product="GabA permease, putative"
                     /protein_id="XP_024513844.1"
                     /db_xref="GeneID:3254951"
                     /translation="MGVDESEKTTSVHQQPVNKVENPSTLTPGDRDGAAARLEEMGYK
                     QELTRNLGMISVLGLSFAIMAVPFGTSTTLNIALTDGGPVTILYGWIFVSLVSLCIAS
                     SLAEICSVFPTSGGVYYWSAMLSTKKYSSFASYLTGWLGTVGNWTVTASITFGGSQLI
                     LAAATLYHEDYVPTAWQTCVVYWAALLVSLLINIFFHKYLDKLNTVCLWWTGSSVIII
                     IVTLLAMADTRNSGKFAFSHFDAQHSGWPAGWAWFVGLLQGAYTLTGYGMVASLCEEV
                     KEPAREVPRAMVLSVAAAAVTGLVYLLPINFVLPAIEPLLAVASLQPMPLLYKEVTGS
                     AGAALGLLFLILGVWVFAAIGSLTAASRCTWAFSRDGGIPASGWWKKVDQRFGIPVNS
                     LILSAIVCALLGLIYLGSSAAFNAFTGVATICLGCSYAFPVLCSLLRRREAVRNASYS
                     LGKFGYAVNIITVVWITFSIILFCMPTAIPVTAESMNYASVVFAGFSFIAALWYVVNA
                     RKHYHGPTLSTVRISDTTEIVEEY"
     gene            complement(409798..411054)
                     /locus_tag="CNL05020"
                     /db_xref="GeneID:3254744"
     mRNA            complement(join(409798..409981,410035..410152,
                     410211..410272,410327..410476,410536..410731,
                     410791..411054))
                     /locus_tag="CNL05020"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658172.1"
                     /db_xref="GeneID:3254744"
     CDS             complement(join(409953..409981,410035..410152,
                     410211..410272,410327..410476,410536..410731,
                     410791..410946))
                     /locus_tag="CNL05020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513845.1"
                     /db_xref="GeneID:3254744"
                     /translation="MSRGGWRGGRGGGRGGMPPGVGFGYGQISQTEWKEGINRIKAQS
                     QTNGTLYPPLDNISISYLTGPTDHETLVLSHAISLNITLSTGKLPEGEEGVQLVQSGQ
                     VPPWRITGERKVVGIEIESYSDRFNPPASSEPSKLDPVALRMDQSMFPPSLWAAYFDG
                     QTDKLKGRPKKRRKLDDLDQEGDDKVEEESEISEEEDFDFDDDESDHQDYDANYFDNG
                     EGDDDEGGDDEGGDVYED"
     gene            complement(411186..413805)
                     /locus_tag="CNL05030"
                     /db_xref="GeneID:3254960"
     mRNA            complement(join(411186..411467,411528..411742,
                     411794..411967,412018..412167,412226..412302,
                     412351..412462,412526..412685,412746..412935,
                     412998..413113,413173..413259,413320..413349,
                     413456..413561,413622..413805))
                     /locus_tag="CNL05030"
                     /product="hypothetical protein"
                     /transcript_id="XM_568042.2"
                     /db_xref="GeneID:3254960"
     CDS             complement(join(411359..411467,411528..411742,
                     411794..411967,412018..412167,412226..412302,
                     412351..412462,412526..412685,412746..412935,
                     412998..413113,413173..413259,413320..413349,
                     413456..413561,413622..413676))
                     /locus_tag="CNL05030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568042.1"
                     /db_xref="GeneID:3254960"
                     /translation="MSTISLDKIPDVPTDDDATVKQFTDETGAPASLPEIGSGGEESK
                     LKVLMGLMRKLMGVKDVANLRLSLPASLLEPIPNLEYWQYADRADILAAVGDSDNELE
                     RMLAVLRFSFSKELKFIRSRLGKPYNSALGEHFRCSWRLPPLLIDNETKEPVVRTHIH
                     VPLPGEPLYGGQGGSGWITPVLRPEDGGKPNSEASSIISSSSKTSKKQPVKALSPESV
                     DRVVPGPGKEVEADPDAGVLESEKVTVVFLCEQVSHHPPISAAYYYCPEKGIEAYCMD
                     QIAAKVSGMSVKLGPGSSNKGIFVKIARDGPGQNEEYQITHPAAAVNGILKGSYYGTI
                     SDVVQVICRGGEKTTTKLKALLDYKEESWLGKPKFLVDGIIYRYTVGNEEEEGWTKAK
                     QVPADKILGYLEGCWMKQIRYKLKGQKEWKVLLDLDQLALIPKDVRPLHEQDEHESRK
                     LWESVTENLISKNWGEATKSKQTIEQRQRDKAAERKTKGETHQARYFQPDYEDGRPKL
                     TNEGQKALEDEIQRCRGQ"
     gene            414049..416845
                     /locus_tag="CNL05040"
                     /db_xref="GeneID:3254725"
     mRNA            join(414049..414464,414518..414859,414913..415005,
                     415064..415073,415127..415200,415264..415565,
                     415621..415713,415769..415902,415961..416162,
                     416236..416253,416316..416845)
                     /locus_tag="CNL05040"
                     /product="beta DNA polymerase, putative"
                     /transcript_id="XM_024658173.1"
                     /db_xref="GeneID:3254725"
     CDS             join(414057..414464,414518..414859,414913..415005,
                     415064..415073,415127..415200,415264..415565,
                     415621..415713,415769..415902,415961..416162,
                     416236..416253,416316..416451)
                     /locus_tag="CNL05040"
                     /codon_start=1
                     /product="beta DNA polymerase, putative"
                     /protein_id="XP_024513846.1"
                     /db_xref="GeneID:3254725"
                     /translation="MGVSFVSLFCLVSHYLSWLIDRYSTIVIISRVCTTFRFGLLTTL
                     MPSRPPVHPYTSSSTSTGVHGHHNAAPHQLYKLFANLTFHIVPAKLEDDLARIYECID
                     ELGGKCVGPEDAWVIVTALKGRQRLSRSLDQKWMETKQIVYVSYIFDTYQACLEHAVS
                     PKTSTPKLPLRKNYLHVLSKEQSPIKISCRLDPGDPSISQPSTKRRKVNDGYVTAYRD
                     DMTLLKEDVPLEGIPASCAQRPCPLVCINQDIVDAIKPIFEEREFEEAQQKNSNVLSY
                     RRSLSMLKSVPRRITSGKEALSLQGVGEKVATRIDEFLQTGEIAESQEILASSRFNAL
                     QNFASVYTIGHFRAKELYERHHCRTLDDVKRHFADMEKDGEAKQGRGKDKRRMRGGMK
                     EHEIVEEWMKLKNELDQKIPRKEVEEIAACVLDNLEAFIPGCEYTICGGYRRGKAQSS
                     DVDIVFRPPKDDQDIGLLRALYLRLSELGIVTHVLQVTHRDSNQPIRAAAQNFDNLDK
                     AFVIFKLPGEGRLHRRVDLISAPRDRYASAVLSWTGSMMFERDLKRYAENEKGHKFRA
                     GLIKIATGEEINLETEREIFDYLGLRYIPPELRNADG"
     gene            417542..420124
                     /locus_tag="CNL05050"
                     /db_xref="GeneID:3254968"
     mRNA            join(417542..417758,417818..417925,417989..417999,
                     418058..418158,418209..418578,418637..418716,
                     418778..418841,418903..419156,419215..419554,
                     419712..420124)
                     /locus_tag="CNL05050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658174.1"
                     /db_xref="GeneID:3254968"
     mRNA            join(417584..417758,417818..417925,417989..417999,
                     418058..418158,418209..418578,418637..418716,
                     418778..418841,418903..419156,419215..420124)
                     /locus_tag="CNL05050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658831.1"
                     /db_xref="GeneID:3254968"
     mRNA            join(417584..417758,417818..417925,417989..417999,
                     418058..418158,418209..418578,418637..418716,
                     418778..418841,418903..419156,419215..419596,
                     419712..420124)
                     /locus_tag="CNL05050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568044.2"
                     /db_xref="GeneID:3254968"
     CDS             join(417716..417758,417818..417925,417989..417999,
                     418058..418158,418209..418578,418637..418716,
                     418778..418841,418903..419156,419215..419551)
                     /locus_tag="CNL05050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513847.1"
                     /db_xref="GeneID:3254968"
                     /translation="MTYTENTNVVIVGAGIFGMSTALWMLETGKYSVTLLDKSEVLPA
                     PDAASTDINKIIRAADYKDPLIAALALDAVEHWRKPEWEGTYHECGVVALSATHEKEG
                     MEFIDCAYKNCRDLGLDVTLLPDATAIKPVVDRNNAFPTGSFGGRQGYINPIGGWGEA
                     GRAVEVGLTRAKKLGAIVRAGSEVIGLIKDGKNVKGVELKSGEKIFCDLVVVAAGAWT
                     PKLFASPAFAARLPPIVATGQSVAILQLTPEESKKYAKVPVVFNLDDGWYIFPPNPTG
                     LMKMAIHSAGYINPVEEINNVSVPRTKLTPGAEDGAIPKVMLQALRKGLSEVYPDLAK
                     KDYAMTRLCWYCDTVTGDWLIDYHPDYNNLFLATGGSGHAFKFASNIGREILRLIERD
                     SSSEFKVRFSFNPPKEMVEPPSEKGDVSAERTQVTDTGADVRSGMRKLLVIDELIRPE
                     DLKAY"
     CDS             join(417716..417758,417818..417925,417989..417999,
                     418058..418158,418209..418578,418637..418716,
                     418778..418841,418903..419156,419215..419551)
                     /locus_tag="CNL05050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514663.1"
                     /db_xref="GeneID:3254968"
                     /translation="MTYTENTNVVIVGAGIFGMSTALWMLETGKYSVTLLDKSEVLPA
                     PDAASTDINKIIRAADYKDPLIAALALDAVEHWRKPEWEGTYHECGVVALSATHEKEG
                     MEFIDCAYKNCRDLGLDVTLLPDATAIKPVVDRNNAFPTGSFGGRQGYINPIGGWGEA
                     GRAVEVGLTRAKKLGAIVRAGSEVIGLIKDGKNVKGVELKSGEKIFCDLVVVAAGAWT
                     PKLFASPAFAARLPPIVATGQSVAILQLTPEESKKYAKVPVVFNLDDGWYIFPPNPTG
                     LMKMAIHSAGYINPVEEINNVSVPRTKLTPGAEDGAIPKVMLQALRKGLSEVYPDLAK
                     KDYAMTRLCWYCDTVTGDWLIDYHPDYNNLFLATGGSGHAFKFASNIGREILRLIERD
                     SSSEFKVRFSFNPPKEMVEPPSEKGDVSAERTQVTDTGADVRSGMRKLLVIDELIRPE
                     DLKAY"
     CDS             join(417716..417758,417818..417925,417989..417999,
                     418058..418158,418209..418578,418637..418716,
                     418778..418841,418903..419156,419215..419551)
                     /locus_tag="CNL05050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568044.1"
                     /db_xref="GeneID:3254968"
                     /translation="MTYTENTNVVIVGAGIFGMSTALWMLETGKYSVTLLDKSEVLPA
                     PDAASTDINKIIRAADYKDPLIAALALDAVEHWRKPEWEGTYHECGVVALSATHEKEG
                     MEFIDCAYKNCRDLGLDVTLLPDATAIKPVVDRNNAFPTGSFGGRQGYINPIGGWGEA
                     GRAVEVGLTRAKKLGAIVRAGSEVIGLIKDGKNVKGVELKSGEKIFCDLVVVAAGAWT
                     PKLFASPAFAARLPPIVATGQSVAILQLTPEESKKYAKVPVVFNLDDGWYIFPPNPTG
                     LMKMAIHSAGYINPVEEINNVSVPRTKLTPGAEDGAIPKVMLQALRKGLSEVYPDLAK
                     KDYAMTRLCWYCDTVTGDWLIDYHPDYNNLFLATGGSGHAFKFASNIGREILRLIERD
                     SSSEFKVRFSFNPPKEMVEPPSEKGDVSAERTQVTDTGADVRSGMRKLLVIDELIRPE
                     DLKAY"
     gene            complement(419803..421550)
                     /locus_tag="CNL05060"
                     /db_xref="GeneID:3254778"
     mRNA            complement(join(419803..419925,419981..420110,
                     420170..420264,420319..420396,420536..420598,
                     420650..420830,420889..421035,421091..421550))
                     /locus_tag="CNL05060"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658832.1"
                     /db_xref="GeneID:3254778"
     CDS             complement(join(420681..420830,420889..421035,
                     421091..421123))
                     /locus_tag="CNL05060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514664.1"
                     /db_xref="GeneID:3254778"
                     /translation="MEKGDLRRQADVHIICAATSQSYEAIVDLPSKLSLVGPETPVVT
                     SWIALHELIQPSLHTEELLWAKELCRNLPKVKKACEATGVEKKAVADYNASKTRTWLI
                     ENPNETR"
     gene            complement(421794..424113)
                     /locus_tag="CNL05070"
                     /db_xref="GeneID:3254745"
     mRNA            complement(join(421794..421928,421991..422289,
                     422341..422511,422563..422673,422723..423131,
                     423178..423339,423390..423422,423472..423532,
                     423583..423767,423816..424113))
                     /locus_tag="CNL05070"
                     /product="Aldehyde dehydrogenase (ALDDH), putative"
                     /transcript_id="XM_568049.2"
                     /db_xref="GeneID:3254745"
     CDS             complement(join(421913..421928,421991..422289,
                     422341..422511,422563..422673,422723..423131,
                     423178..423339,423390..423422,423472..423532,
                     423583..423767,423816..423943))
                     /locus_tag="CNL05070"
                     /codon_start=1
                     /product="Aldehyde dehydrogenase (ALDDH), putative"
                     /protein_id="XP_568049.1"
                     /db_xref="GeneID:3254745"
                     /translation="MRRTITLRHLLPLGIRSKHIMPTHAKLNVPSLGEVEVPVGLFIN
                     NEWVESTSRETFSTVNPATGQKLLDFAHAKKEDIDKAVIAARKAFKTTWGNNVLAAER
                     GVLLNKLADLMERDSDKLAALESINSGKGIRIAREADVADSVACIRYYAGLADKIHGQ
                     TVSSFGKEKFVYTLHQPIGVCGQIIPWNYPIMMWAWKIAPALAAGCTVVMKPSELTPL
                     SALALCDLVKEAGIPAGVINTVPGHGATAGDAISRHMDIDKVAFTGSVSTGRRISIAA
                     AESNLKKVTLELGGKSPVIVFDSADVEEAADWAALAIWFNSGQDCCAGSRLYVQEGIF
                     DKFLAAMKKRAEACAIGQPHDEKTSFGPLISEGQRDKVLNYIVSGKEQGARVVTGGQK
                     WPESNDGYWIEPTILADTTPDMTIVKEEIFGPVVVAAPFKTEEEVLEVANDTSYGLAA
                     AVFTNDTRQATRVSAALDAGTVWINQYALLHPGVPFGGFKQSGIGRELGTYGLEAYMQ
                     IKAVHNNLTQTSPWPV"
     gene            424320..427307
                     /locus_tag="CNL05080"
                     /db_xref="GeneID:3255009"
     mRNA            join(424320..424520,424578..424588,424640..424750,
                     424813..425083,425134..425490,425544..426035,
                     426086..426311,426362..426496,426548..427307)
                     /locus_tag="CNL05080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568224.2"
                     /db_xref="GeneID:3255009"
     CDS             join(424461..424520,424578..424588,424640..424750,
                     424813..425083,425134..425490,425544..426035,
                     426086..426311,426362..426496,426548..427143)
                     /locus_tag="CNL05080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568224.1"
                     /db_xref="GeneID:3255009"
                     /translation="MAEGDASQNTSRKRSSRACDSCKIRRSKCEDIKEISGVGPTCKA
                     CREENQECLYTLPVRKRGPARGFKNHINQSSQNVEGSQQSQAQHSGFSGSSVYYGQDQ
                     AIRRNSGSHSPVADSSNRPHILLRQVEPFFGIPTNMVDRLLAVYFTHVHNVWPLICKP
                     VFNPHHTSAHLLLSMLAVAVCVAPEGAADGFNSETLFVMAERALLQRRMEIRVDIIQS
                     FVLMSLRQTGCGDKKSAAVYANRASTMAFIMGLHLDPGTPPAGSGHAKTALTYEHDTR
                     ARVYWNCYVLDKVIAEETGRPFILPYRRSSIPFPSINEVDELEAWPPLPMSSAPLPQS
                     VRHVNPKRGYVMSCFVWTCRMAMLVEEILDLEMEGPNLQGSSEWWDRQFSEEAGQRRH
                     LGQERERIARQLTLWKQSLPSWLDVDTKSEASPLPHHVVGVTWYHTSRILLYSRFLRR
                     HPVASSPTTGEDDTRAFHAICSDAAQAVVDLLSMLDKHRLLQHVSSDIIHLLSLTTLF
                     EAYDSVSSDPALANRAKINFSQCCLWLREFSSSWASASAHRVFFEGLIRGGLHLSSPE
                     DDQRGTKDQNAGQIEPPPSIEDGLRAVRQQFTSNGPQQAYAIPTLMENPTDLAPVNLF
                     QLPQYYWNHLSVNESDANQFPDHPTPERNSTNLQFVQSSEPSHLPATSPITQLNHLPS
                     DPAASVSANKNMRARWDSRLSGETRPTDIESLKDDHVEGEHFVNPMSGVDQNAIYSAL
                     MTYMVDAIKGGS"
     gene            427547..430444
                     /locus_tag="CNL05090"
                     /db_xref="GeneID:3255002"
     mRNA            join(427547..427614,427666..427681,427749..427785,
                     427846..427918,427988..428060,428116..428361,
                     428420..428543,428581..428772,428822..428850,
                     428903..429046,429102..429216,429266..429348,
                     429387..429681,429733..429855,429900..429931,
                     429988..430058,430106..430181,430242..430444)
                     /locus_tag="CNL05090"
                     /product="expressed protein"
                     /transcript_id="XM_024658175.1"
                     /db_xref="GeneID:3255002"
     CDS             join(427578..427614,427666..427681,427749..427785,
                     427846..427918,427988..428060,428116..428361,
                     428420..428543,428581..428772,428822..428850,
                     428903..429046,429102..429216,429266..429348,
                     429387..429681,429733..429855,429900..429931,
                     429988..430058,430106..430181,430242..430404)
                     /locus_tag="CNL05090"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513909.1"
                     /db_xref="GeneID:3255002"
                     /translation="MRSNHAQYRFDKRPPLTKGSACSECKARKVRCPAEKPACSNCVR
                     HSKTCHYPPSRSNIGRTVDGDRSTQSLRALDPPRAVTHPYSPRQRASQSQTPGPDPPR
                     QELHQTTSNLAFFHQPSLGERNQPMPSHLDEVDLSWLLSIPDPRATDVPDMDATAQEH
                     CLWLYFSNQVSSGMEMNIARFYERLISSDPLDRPHPALLNAMFLSVCQASPLEHIRAR
                     EESFFEKGDFALKEAIKDSASLPGNMLDLMRAAALMAEWLWGQSRKAEAVLMTSTACR
                     IVLSAGFEHISSSTDLGGPRRELLLRTRNPICLPARDYIEIADRIYAFWDVIMLDLAA
                     SIAFGLPANIDLAQIRTPLPRPWPEYGPDPPSPDVYVSDLFKATIAQEDHYSRAHFVY
                     IIQATILLYYSTFQNISSRYPSSWHEHHLPPLPPRRFTSHFASSPTPSSLTTANSSSS
                     TFDLNSVVERFASSLPKELKSFEPATSDPLKAATVFMMQTILSATRMYLADTNDYESP
                     NDAALYQARRIVDLMRITNANGALPPSLSLFILWTLACKILIREVKRLTQLGENIATI
                     PLDADIDQLFQTFSVAAQKAPLVASVFQVLQMIRATPVSGFEQFSPGEEESPTSRSES
                     THVQASGEESQVPSEGNI"
     gene            complement(430390..432462)
                     /locus_tag="CNL05100"
                     /db_xref="GeneID:3254999"
     mRNA            complement(join(430390..430710,430766..431214,
                     431276..431445,431508..431525,431586..431648,
                     431721..431812,431873..431886,431945..432016,
                     432070..432098,432152..432260,432319..432462))
                     /locus_tag="CNL05100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658176.1"
                     /db_xref="GeneID:3254999"
     CDS             complement(join(430627..430710,430766..431214,
                     431276..431445,431508..431525,431586..431648,
                     431721..431812,431873..431886,431945..432016,
                     432070..432098,432152..432260,432319..432328))
                     /locus_tag="CNL05100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513911.1"
                     /db_xref="GeneID:3254999"
                     /translation="MLDCITPGWCNYDVGSVNTVTGKVVWQGYMYKPSLAASETYLPL
                     FTIITAILVVLTFYRRIWWAIYTILCGAVLEVLGWAGRYMSASSIQWDPSNGGQWTTD
                     SNGFIMQIVCLIIGPTFFSAANYIILGRVVRRTGSNYSSITPSSFSVMFTITDFFCLL
                     VQCAGGGLVGTADTDSGMQNGLYVMAAGVLAQLAVTLAYIFMLSEFIYRHARSKKASR
                     QYDLLAWAKICCCCCSKRKRQSVDSSHRMDDANKTEAGFTASNEGEQEGEDRKFVNLV
                     LCTLIVATVLIVVRYVLCQFALETLLHLFFTRRSVYRCIEMLNFQPNHPGAYGDQTLF
                     LVLDSAFMLALLIVYALIHPGWILARTLGLSRPVV"
     gene            433306..435467
                     /locus_tag="CNL05105"
                     /pseudo
                     /db_xref="GeneID:36393123"
     gene            complement(435464..436354)
                     /locus_tag="CNL05110"
                     /db_xref="GeneID:3254921"
     mRNA            complement(join(435464..436023,436084..436354))
                     /locus_tag="CNL05110"
                     /product="expressed protein"
                     /transcript_id="XM_568050.2"
                     /db_xref="GeneID:3254921"
     CDS             complement(join(435540..436023,436084..436340))
                     /locus_tag="CNL05110"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568050.1"
                     /db_xref="GeneID:3254921"
                     /translation="MTGPKPNPTNTLPQAYKIVHQILSSAKSGLHTKDIVKQGVALYA
                     DQLPPQAFEIEEPVDERKHKGKKKHIPEPKLVPPGHPFISTNFLKHHVLPTLQSQNLI
                     YKHAVPLEDSESAPSTSTKRGQARRQFVWSLRELPDVESQSTSWSYSEHWQRLLSGAH
                     PKDVGSEHKHFMEQLKKDQRRQAVESGAERRTEEEIRAWEDRKVGVTTEKERGHLNKR
                     RELKRPQKEWKRYGRWEQLFRDQGTATV"
     gene            436512..437342
                     /locus_tag="CNL05120"
                     /db_xref="GeneID:3254793"
     mRNA            join(436512..436573,436612..436976,437027..437122,
                     437226..437342)
                     /locus_tag="CNL05120"
                     /product="30s ribosomal protein s13, putative"
                     /transcript_id="XM_568051.2"
                     /db_xref="GeneID:3254793"
     CDS             join(436529..436573,436612..436976,437027..437122,
                     437226..437304)
                     /locus_tag="CNL05120"
                     /codon_start=1
                     /product="30s ribosomal protein s13, putative"
                     /protein_id="XP_568051.1"
                     /db_xref="GeneID:3254793"
                     /translation="MHLLGHNLPDHKPLKIALLTFYGISHALSARLLPRLGIHSEATV
                     AQLTEPQVTALSAYLSSPSTTARPSEQQIELAPPGGKVLKPVGHPAIFGELNKGKGKG
                     QEDPLDDLKIETEKRRAMQADIAHLRMVGTYRGRRHAAGYPVHGQRTQTNAKSAKKHN
                     RVERRNFGTQTFTRFTPTDLPQPPTVLSLLGRRQ"
     gene            437792..439767
                     /locus_tag="CNL05130"
                     /db_xref="GeneID:3254856"
     mRNA            join(437792..438872,438948..439184,439241..439767)
                     /locus_tag="CNL05130"
                     /product="expressed protein"
                     /transcript_id="XM_568052.2"
                     /db_xref="GeneID:3254856"
     CDS             join(437854..438872,438948..439184,439241..439265)
                     /locus_tag="CNL05130"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568052.1"
                     /db_xref="GeneID:3254856"
                     /translation="MSCAHCHLHRPAPLIDIQTLEPLPAEVRNRIFVLYLEDPVDRLC
                     APHLIDFLLISRRMYQAHAWRLYEIIMINDKNCKTFFNGLYDLRARTKKKEVVDVLHN
                     WSPIPYQTSDYNSERNIPVTLPHIIRKFRLLRHCRCLGFETHTAYLQFVDILGKLYKY
                     VDKHIKGIHDLHDWAECDFFPGMTEVSFGRQFMEQYFETKSTDLTEKADSLNFRPRTR
                     LWESMHVKHVCLFMPEWRADIPMWPNYGFISDPYLAYRFRTAALLEYIGFLGPEGGPE
                     GSSCNLHNAHMEVLKSGWEADEVTFDLAPEELEDLEDRGESHLDEILEYSIFLFSQYL
                     VNERKASSEQQPYRIRFTNYGTCYLSSDKRLRKLKRDEEGMDLMDYANEELQSVLDSC
                     DFYEGQSVKVKGNTGGCRVCIQITKNKRTIALNV"
     gene            complement(439758..443289)
                     /locus_tag="CNL05140"
                     /db_xref="GeneID:3254891"
     mRNA            complement(join(439758..440830,440878..440972,
                     441021..441573,441622..441756,441807..442079,
                     443126..443289))
                     /locus_tag="CNL05140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568053.1"
                     /db_xref="GeneID:3254891"
     mRNA            complement(join(439758..440830,440878..440972,
                     441021..441573,441622..441756,441807..442805))
                     /locus_tag="CNL05140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568054.1"
                     /db_xref="GeneID:3254891"
     CDS             complement(join(439907..440830,440878..440972,
                     441021..441573,441622..441756,441807..442079,
                     443126..443260))
                     /locus_tag="CNL05140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568053.1"
                     /db_xref="GeneID:3254891"
                     /translation="MSRIPVPHGGFHHTLPHSPQPTRTDSMSTSSPASDTRRKQSKRD
                     ESLRKKIESELSRKRPGSNATQQSNGGKRSSKRPQKGTVAGLRPSPALTVPEGMSVAD
                     ASQLCAAKRADCVLVVDEEEGLSGIFTAKDLAFRVTAEGLDPRSTSVAQIMTKNPMVT
                     RDTTNATEALQLMVSRGFRHLPVCNEDGDVVGLLDITKVFHEALAKVERGSTATSQLS
                     AALAGVQSELGPGLNHNPQAAAMLAYVETLRERMALPDLTTVIDTRSAPPTVTPRTTV
                     REAARLMKERRTTAVCVMEANAGTSAVSGVSGGNVVPKIAGIFTSKDIVLRVIAAGLD
                     ASRCSVVRVMTPHPDTAPPTMVVQDALKKMHNGHYLNLPVVEADGRLIGIVDVLKLTY
                     ATLEQIESMNEDRSNESGPMWSRFFEGLPGAGGDDDTASIVSASERPDTPSRSHLGHG
                     RGLSSMTSPISEIMPNDSASVVDDNISDLGGKHGPTSSVAAPGLPIDDGTYIFKFRTP
                     SGRTHRFQARHDSYELLRDIVAGKLLTDPFFTAPGAKEGEAVHLPDPSNFTLHYTDDE
                     GDLVTMTADSDVADAVRIARGQKSDRIVLLVDGGKVWEEAARDLGGEKAVEKLKEVEQ
                     EVKVVEEEEKQMAEPTANPAVEPTYGNEHVHAQKWKDHGKTIRADGQELVGGVIPKDM
                     VLPAAIGFLGVVILGVFIAGRK"
     CDS             complement(join(439907..440830,440878..440972,
                     441021..441573,441622..441756,441807..442595))
                     /locus_tag="CNL05140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568054.1"
                     /db_xref="GeneID:3254891"
                     /translation="MPSSSTTTTTGCDVPPQHIMTSQKPLDTPPASLHSSDSSSSSSN
                     HAVENAVHAVNPIPAAQSAATTTTLPTNSPSKLPHSFSFSLNRKSKKSTKSYKTSAGP
                     PVPFPAPSAPTRSHVASEPSSTLNSSTVTDGTATATPSNADDETRPRYHSAISHSTIS
                     RSQSSSFAGKLQSLRKKIESELSRKRPGSNATQQSNGGKRSSKRPQKGTVAGLRPSPA
                     LTVPEGMSVADASQLCAAKRADCVLVVDEEEGLSGIFTAKDLAFRVTAEGLDPRSTSV
                     AQIMTKNPMVTRDTTNATEALQLMVSRGFRHLPVCNEDGDVVGLLDITKVFHEALAKV
                     ERGSTATSQLSAALAGVQSELGPGLNHNPQAAAMLAYVETLRERMALPDLTTVIDTRS
                     APPTVTPRTTVREAARLMKERRTTAVCVMEANAGTSAVSGVSGGNVVPKIAGIFTSKD
                     IVLRVIAAGLDASRCSVVRVMTPHPDTAPPTMVVQDALKKMHNGHYLNLPVVEADGRL
                     IGIVDVLKLTYATLEQIESMNEDRSNESGPMWSRFFEGLPGAGGDDDTASIVSASERP
                     DTPSRSHLGHGRGLSSMTSPISEIMPNDSASVVDDNISDLGGKHGPTSSVAAPGLPID
                     DGTYIFKFRTPSGRTHRFQARHDSYELLRDIVAGKLLTDPFFTAPGAKEGEAVHLPDP
                     SNFTLHYTDDEGDLVTMTADSDVADAVRIARGQKSDRIVLLVDGGKVWEEAARDLGGE
                     KAVEKLKEVEQEVKVVEEEEKQMAEPTANPAVEPTYGNEHVHAQKWKDHGKTIRADGQ
                     ELVGGVIPKDMVLPAAIGFLGVVILGVFIAGRK"
     gene            443402..444067
                     /locus_tag="CNL05150"
                     /db_xref="GeneID:3254978"
     mRNA            join(443402..443454,443499..443541,443586..443665,
                     443713..443939,443989..444067)
                     /locus_tag="CNL05150"
                     /product="Gim complex component GIM3, putative"
                     /transcript_id="XM_024658177.1"
                     /db_xref="GeneID:3254978"
     CDS             join(443446..443454,443499..443541,443586..443665,
                     443713..443939,443989..444034)
                     /locus_tag="CNL05150"
                     /codon_start=1
                     /product="Gim complex component GIM3, putative"
                     /protein_id="XP_024513848.1"
                     /db_xref="GeneID:3254978"
                     /translation="MSLLPPEEEGDGVEVAWEDQQRINTFSKLNNRLSDIQDLLKAKN
                     EEKEYYDDLSTELELADEDDPQPVMYKIGEAFFYLPLRDARRQLKGDLKKYEKEIEGL
                     ESKAEECEKGMKELKVLLYAKFGKQINLETTS"
     gene            complement(444038..445280)
                     /locus_tag="CNL05155"
                     /db_xref="GeneID:36393124"
     mRNA            complement(join(444038..444594,444670..444793,
                     444845..445280))
                     /locus_tag="CNL05155"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658833.1"
                     /db_xref="GeneID:36393124"
     CDS             complement(join(444062..444594,444670..444793,
                     444845..445135))
                     /locus_tag="CNL05155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514665.1"
                     /db_xref="GeneID:36393124"
                     /translation="MLPIRAILHSARILPRLTLFASPSVGLFVRNPPALYSRLLLARP
                     YSSKKKNKEIELGEWEDDLFGEESSIRPGQKPLVLDEEVVLNETPFSWEDPPLLVKEL
                     PIRPRLPGSIKKLNRILSRQRKVEIPENELEERFVKGRGPGGQAINKTNSSVSLTHIP
                     TGIRVQAQPTRSREENRKVARRILAERLEVLRATGQLPGMSGLEGIEGVSVDMGGGEG
                     EEGGEKLSKKERRKLEETRLSETYTKAEIRAEKERRRKANRAKKAKKKYAMTDKDGKV
                     LAKELENEDNEVDLLEMDAEVTEQPVEMDEEFKRAPKGV"
     gene            445817..448411
                     /locus_tag="CNL05160"
                     /db_xref="GeneID:3254877"
     mRNA            join(445817..446139,446205..446265,446468..446593,
                     446642..447010,447060..447268,447328..447867,
                     447919..448411)
                     /locus_tag="CNL05160"
                     /product="Eukaryotic translation initiation factor 3
                     subunit 6, putative"
                     /transcript_id="XM_568056.2"
                     /db_xref="GeneID:3254877"
     CDS             join(445831..446139,446205..446265,446468..446593,
                     446642..447010,447060..447268,447328..447867,
                     447919..448200)
                     /locus_tag="CNL05160"
                     /codon_start=1
                     /product="Eukaryotic translation initiation factor 3
                     subunit 6, putative"
                     /protein_id="XP_568056.1"
                     /db_xref="GeneID:3254877"
                     /translation="MADPSAFYEPEEDELLSQLAIPVQNYQPLSEGDEYRRLQQLEQH
                     AYAQQTAMAQEQEMEQLAVLELIPEDVKRFLVMFHQAILENDLPTITSMYESGWNKLT
                     QAHYLNNEWPEAELIAPLVGNDQVFLTLYRELYFRHVYARLQPTIDDRFQSYENICEL
                     FNYLLNSEGPVPLDLPIQWLWDMLDEFVYQFTSFSHWRSSPKAKTEEELEMLAESPNI
                     WSSYSVLNVLYSLVQKSQINEQLKAERAGKSVEEVTEVAGEYGSKPLYKNLGYFSLIC
                     LLHVHVLLGDPTLALQTMENVDLGNAAFLTRITACHVTTYYHVGCAYMALGRWPDAIK
                     TFVSVLIFFIRMKQYHTRSYQYGSIAKTCERMYALLAICTTLSPGPSDENIMTIVKEH
                     YGDQLAILQRGGPEALEAFKDLYLQACPKYLNVNPPPYEDASALEAWLANPPADATQR
                     HLELFLSDVQAVQGVNGMRNLLKLYTSIDAAKLAAFSVSGEEEGEEEVLQQLMVLKSA
                     SSTYGRGQAETTLLDGERKVTNNLDFTIDGTMVHVEETTSHRRYAGFFIRNAEHAQRA
                     LTSIKSAPLPVRKPASSSAPAPATTAAPISKSGESAAPAPAEAPAAPEKKAGTWVPKS
                     RQARIAA"
     gene            448601..450721
                     /locus_tag="CNL05170"
                     /db_xref="GeneID:3254881"
     mRNA            join(448601..449755,449814..449901,449956..450721)
                     /locus_tag="CNL05170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568057.2"
                     /db_xref="GeneID:3254881"
     CDS             join(449216..449755,449814..449901,449956..450512)
                     /locus_tag="CNL05170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568057.1"
                     /db_xref="GeneID:3254881"
                     /translation="MEYGLSSEIKQQHGIMDNTLSTNVLGIYLPAQGISERDDYEDPQ
                     NDEVPIQPNPDPQNVDRNIVLADYSGFLYSALSNRLPIWPDFTCCCSEHDDHPCYVLG
                     SDCPLLACRPYECPDYRAFGIISVGAHGIIHRATDTRRNEVVAIKVTKEYHGSETGDA
                     HMRWELWKRSFAAREVAMLDVCDHPHIVRPRDIVESPDGKLGLVIDYFPGGDLQKYLR
                     TYGSLSEFEARYTFTQLLSAVTHLQDRHMVHHDIKPENILIDLDGNVVLSDFGVAHIF
                     DESYVPALPICGTIVYAEPELVVRKTRYSPFKWDIWSLGIILFFLLTGRTPYIGYKGF
                     PGHHAHIMDVCTFVASASVDYPRLIPWGPRNLMEKMLEVDSEMRAGCSQLWEHSWIKG
                     TL"
     gene            complement(450634..451892)
                     /locus_tag="CNL05180"
                     /db_xref="GeneID:3254828"
     mRNA            complement(join(450634..451069,451122..451224,
                     451281..451892))
                     /locus_tag="CNL05180"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658178.1"
                     /db_xref="GeneID:3254828"
     CDS             complement(join(450713..451069,451122..451224,
                     451281..451843))
                     /locus_tag="CNL05180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513849.1"
                     /db_xref="GeneID:3254828"
                     /translation="MSSPSALSTASPLPFLQEEEEHLEVSDRKDASSVWALKVPNFLL
                     QRWQTVQEPGVELGRLVVDNSVTPPNITLKLTNAEEGTEEGERAKRAKYDVEGLPDEF
                     KVEVPMERSKNTFLFSEVKKIYDKGNRDGTQQADAPRDAWGKRKREKAHPKLLARVDH
                     EGHIQPIRTQKYLDFLKARRMEAEQSRRPVVRMEDTGLSQAEQNQLASGFRSANSTFG
                     RNMILASKQASGERFARLERHELTDRIFQCFRDHPYWALGALKQTLEQPDAWLREVLR
                     DVAEQVKEGQYQGYWQLKPVWREDSWKGGEKGESVKNEVKEEGDVKPDIDVDDDEDED
                     DLEEVM"
     gene            452062..455688
                     /locus_tag="CNL05190"
                     /db_xref="GeneID:3254749"
     mRNA            join(452062..452294,452354..452476,452523..452671,
                     452719..452962,453018..453321,453372..453455,
                     453513..453824,453874..453948,453998..454348,
                     454402..454641,454693..455135,455190..455246,
                     455300..455375,455437..455688)
                     /locus_tag="CNL05190"
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily a, member 3,
                     putative"
                     /transcript_id="XM_568059.2"
                     /db_xref="GeneID:3254749"
     CDS             join(452166..452294,452354..452476,452523..452671,
                     452719..452962,453018..453321,453372..453455,
                     453513..453824,453874..453948,453998..454348,
                     454402..454641,454693..455135,455190..455246,
                     455300..455375,455437..455552)
                     /locus_tag="CNL05190"
                     /codon_start=1
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily a, member 3,
                     putative"
                     /protein_id="XP_568059.1"
                     /db_xref="GeneID:3254749"
                     /translation="MSHIDYFGGQPSTAQKRPRQTQPTSSSQEEDDDQQSRAIEHDEH
                     FATFRSDVVGVQYYRGLVGRGEYVLLRREPTNKWDSNAVQVVNAGGSQVGHIPRAVAA
                     NLATLMDRNQISVEGRMIGQNLDGAKHFKLPLDVSIYLNHSMRESLEPALRWVSPGDR
                     VNNQARRPVYTSQSQVRGAAGSGVGLPQPADSTMKELLEGLSKDNADLKQVDKVMDAL
                     TSDVDVSKLPLHPAPPGTANGQLLTDLLPHQSQALQWMITRENPQLPKSPSEPAVQFW
                     VKQKGVGSKPDYWLNVATKTPQSEAPQLGRGGIIADGMGLGKTLTTISLVLATKNDPV
                     GDKVSKSTLIVCPLSVLSNWEKQIRDHVAPSQLRFYTYHGAAKGLTAKKLGGYDIVLT
                     TYQTVAGEDAAVPHTGDTPLAKKSRPSTTKSGPLATIKWKRVVADEGHQLKNPKAKMT
                     IAFANLSAERRWICTGTPIVNSPNDLGSLLTCLHICAPLSNPQYFRALLLRPLSRGDP
                     TASKLLQAVVSQILLRRTKDSKGANGENVVELPDIEFFRVPVKLDNETRKVYEEVLEH
                     SKRRFEETLRTGEGAANVLSMLTRMRQLCLSLELIPQSFLDEIRAPPTSQNGASATSI
                     ASLSTEEMEALVKKLRQIVEDETECGICMDEVEFAKDPAITDCGHPFCLPCIERVITS
                     QGLCPMDRHPIAHGSILRLPSDESLYLPSSQARSINSAKIDELVKYLRIFPRDDKTLV
                     FSQFTSFLDCVGVRLEQEGVKFVRFDGRMPGKQRTEVIKAFQEPVKGDDDEEAPTVML
                     ISLKSGAVGLNLTAASNVFLCDPWWQSAIEAQAIDRAHRMGQKKVVRVFQLIAEDTIE
                     SRVLDIQKRKDAMVAKAFEKSSKESQRTKKEARFEDIKELLGMK"
     gene            457218..460607
                     /locus_tag="CNL05200"
                     /db_xref="GeneID:3254866"
     mRNA            join(457218..457276,457325..458473,458520..459041,
                     459092..459493,459551..460102,460155..460607)
                     /locus_tag="CNL05200"
                     /product="WD-repeat protein, putative"
                     /transcript_id="XM_568060.2"
                     /db_xref="GeneID:3254866"
     CDS             join(457241..457276,457325..458473,458520..459041,
                     459092..459493,459551..460102,460155..460460)
                     /locus_tag="CNL05200"
                     /codon_start=1
                     /product="WD-repeat protein, putative"
                     /protein_id="XP_568060.1"
                     /db_xref="GeneID:3254866"
                     /translation="MVKSYMRHGPTQAFGIICSPTANSSYNGRLAYVPGWEDVLVWDT
                     KRGEMVAMWHSTGLTSPVTYLIPAPTPYTSTSTTPVTFAVSYQDGSIRLWSYDPSTPD
                     VEASETVTFNGHKKSVTTMTWDYDASRLASGGTEGEIVVWDRIGEVGLFRLKGHRAPI
                     TGLAFIPHPRGGHPGWLVSTSRDTYLKVWDLGTQHCVQTVVVGRGEVTSLAVREEAEE
                     SIIGQGEGEAEDEEEIKGRWTVVTGSGDGEAKVYTIEKSQLARGMAEDEKGELPALIT
                     SVCTLPLPSSTHPISQITWHPALPLLSLQTSDRGVAILRLRTEEEVSAKRARRKKRDR
                     EKKKKGKGDKQKEEDKEEDEKDEPVKWEERVAVWCMVRANAKVKSFAFADENVVSVKG
                     GVSLLLALSNNSIESYTIPTPGSKSKLADGTTPEPTKTHSIELPGHRQDIRTISISSD
                     DQVIASASSGTLKLWNARTTACIRTMECGYALCSTFLPGDRHVVIGTKGGELMLYDVA
                     ASSLLKTYKAHTGPVWSVSVRPDGRGLVSGSADKDVKFWDFEMREEGEGEKVVSRLGV
                     ETVYKTKQLALVHVRTLKMTDDILCLKYSPNGRFLAIALLDSTVKIFFSDTLKFFLSL
                     YGHKLPVLSLDISLDSKLLVTCSADKNVKIWGLDFGDCHKSIFAHDEAVMGVMFEKEA
                     GSHNFWTVGKDRMVKYWDGDKFELIQKLSGHHGEIWALSTSQSGQFVVTGSHDKSIRI
                     WEKTDEPLFLEEEREKEIEAMYDSNLADTLNREPGEGEGEGDEAEAVQKLTAETLIAG
                     EKIMEAIELADADRAATRQWQVDNAKSNIEIPRPPRNAELIARGDLEPDEYVLKVVQK
                     LPAAQMEDALLVLPFRMVVSLMGYLDEWAMQGKEIILVSRILFFLLRTHSSQIVSNRI
                     MRTPLLTLRHHLRDALAQQRDVMGYNLAALKFLKGRWEGERVAGLYEQEGLDEEAVRK
                     RLEEGRGKRKRIEVRA"
     gene            complement(460455..462633)
                     /locus_tag="CNL05210"
                     /db_xref="GeneID:3254948"
     mRNA            complement(join(460455..461238,461291..461785,
                     461841..461979,462045..462078,462132..462179,
                     462228..462239,462301..462469,462533..462633))
                     /locus_tag="CNL05210"
                     /product="hypothetical protein"
                     /transcript_id="XM_568061.2"
                     /db_xref="GeneID:3254948"
     CDS             complement(join(460667..461238,461291..461785,
                     461841..461979,462045..462078,462132..462179,
                     462228..462239,462301..462469,462533..462548))
                     /locus_tag="CNL05210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568061.1"
                     /db_xref="GeneID:3254948"
                     /translation="MDLIENLAKQASQLTMYDVKSYYNQAKNAVLNISEMEAKVREAT
                     NDDPWGASSTLMQQIAEGTHNFAQFNEIMPTIYSRFMEKEAREWRQIYKALTLLEFLV
                     KNGSERVVDDARAHVSTIKMLRSFHYIDEKGKDQGINVRNRASEIALLLGDVDKIRTE
                     RRKARANRNKYQGVGNDGGMSFMSSTGSRYGGFGSDSVGSGSSAGRYGGGDDFRSSSR
                     GFRDTSAQQSQFDEYEGADDFDDQPPRRTTSISRSTAQAPPKPVAKEKEVEKPKEINL
                     FDFDDEPVAAPATASAATANAAPAVGGDDEFDDFQSAVPAPAPAPAPAAKPANTNVFD
                     LLNPATSSTPTSAPSISTPAYSPPASNSSGPTFGYGAMSPPLNAAPSIPFSNAAKPPA
                     SSTHPSYTSASTPSALSPKPTGGSSNSTFDDLFASSLSSIGKSSTAQSQNRGGKTIKD
                     LEKEKMVNSLWGSTPSVPSQSTQPAQPAQPAQPKASGNFDDLLL"
     gene            complement(462896..464003)
                     /locus_tag="CNL05220"
                     /db_xref="GeneID:3254842"
     mRNA            complement(join(462896..463553,463602..464003))
                     /locus_tag="CNL05220"
                     /product="hypothetical protein"
                     /transcript_id="XM_568062.2"
                     /db_xref="GeneID:3254842"
     CDS             complement(join(462922..463553,463602..463728))
                     /locus_tag="CNL05220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568062.1"
                     /db_xref="GeneID:3254842"
                     /translation="MHPTSTSLCFNQYDWDYTSKYMSCEDFLFTDDIFPSKSTIEADQ
                     DGQQNADNKEEADLVNTANTTNDNGFVNTYKSDCTVDAVLQNLTPSNSNDIKGYIMTW
                     AGKGNFLRGEIPFRLYHKVVVVLPYGQYPITQEDEILAFRLASNLRRRIMYRMYARYR
                     CQKHSQLPTEIEAAKLHLAIEAKKLLQRDAFAGFVHVSFGDRHLMSRVASTAYKPKIS
                     YDQRCKIAGTIDCEVGGSRTWAELEASWDLERIE"
     gene            464299..464389
                     /locus_tag="CNL05230"
                     /db_xref="GeneID:3254935"
     tRNA            464299..464389
                     /locus_tag="CNL05230"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:3254935"
     gene            464883..465917
                     /locus_tag="CNL05240"
                     /db_xref="GeneID:3254795"
     mRNA            join(464883..465585,465638..465795,465848..465917)
                     /locus_tag="CNL05240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568063.2"
                     /db_xref="GeneID:3254795"
     CDS             join(464931..465585,465638..465795,465848..465865)
                     /locus_tag="CNL05240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568063.1"
                     /db_xref="GeneID:3254795"
                     /translation="MPRSPSPSRDHDRPRSRSRSPPPRKKPKELSFYKKSSSSMGSLS
                     HRRDPLDEPTSKERAEARERGEVPRRFGGTREQGVRNTMGNVPSASVGSFKRGGDPLD
                     RYGVRGDPRDERRDDYGRGDAYRLDRDRDDRRDRDRDDYRKDRDRRDRDRDRDRDRDR
                     DRDSERRTERDRDGSRRDAPRAAAPSSTSAPPQRPAAAPSATSMRLIEVIANDRLGRK
                     VRVKCLPTDTVGDLKRLIAAQTGTTAQKIQLKKWYTAFKDHVSLQDYEIHDGMSLEMY
                     "
     gene            complement(465886..467339)
                     /locus_tag="CNL05250"
                     /db_xref="GeneID:3254945"
     mRNA            complement(join(465886..466157,466213..466487,
                     466542..466634,466692..466917,466967..467071,
                     467127..467157,467216..467339))
                     /locus_tag="CNL05250"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024658179.1"
                     /db_xref="GeneID:3254945"
     CDS             complement(join(465938..466157,466213..466487,
                     466542..466634,466692..466917,466967..467071,
                     467127..467157,467216..467303))
                     /locus_tag="CNL05250"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513850.1"
                     /db_xref="GeneID:3254945"
                     /translation="MASKQHAHILSLARSMIPPLHPKLHKGQAGRIGVLGGSGDYSGA
                     PYFSSMGAMRFGADLAHVICEPSAGAVIKTYSPDLIVHTILDPQKSREDIRSALKGVM
                     SRLHVLIIGPGLGRDDHMQSCAKIAFELAKDMEQMGVVVDADGLWLVQNEPKVVMDWP
                     GVPRIILTPNVMEFKRLCDTMKINASGPHTSLCPQLATALGNATIIQKGPSDIISNGL
                     KIPSALLSDESEEQNYLEVKVEGGLKRVGGQGDILSGSTGVLLAWGSEWVRGTYEHVG
                     HPPPQDKAIAENIPVLAAYGASTFNRTVSKRGFQKKGRSMVTGDLVDMVGEVYEEVFG
                     KPGEMEGRGKL"
     gene            467564..470092
                     /locus_tag="CNL05260"
                     /db_xref="GeneID:3254867"
     mRNA            join(467564..468069,468122..469038,469092..469182,
                     469235..470092)
                     /locus_tag="CNL05260"
                     /product="histone deacetylase 3, putative"
                     /transcript_id="XM_568065.2"
                     /db_xref="GeneID:3254867"
     CDS             join(467646..468069,468122..469038,469092..469182,
                     469235..469338)
                     /locus_tag="CNL05260"
                     /codon_start=1
                     /product="histone deacetylase 3, putative"
                     /protein_id="XP_568065.2"
                     /db_xref="GeneID:3254867"
                     /translation="MVPSTSSTNHSAFRVSYLWSPALQRLSDDLPSNVGRSSMVHDLI
                     RSLDLLDFEELKERFLKSDNPEDEDGKSEDDDDNEADRNEVNNGDKQGADGEPQRRKP
                     GSPTASPPHAQNKKATVVFPQPSLGTKACLLKYHDRSYIERLLMAHTDRDPNDPTHLP
                     SSPSSSASSPRPAKIARTDPYNLSHDNPVFPTLASYISHVTAATSTACRLLATDKADW
                     AVCWDGGRHHAKRKEAGGFCYVNDLVLGGLLLSREGRIPLPLKEGEDPKRQRTRAPRI
                     LYLDMDLHYSDGVSAAFHSPTVYPYPLKEGITPPKPPNVLTLSVHHSSPIFFPPPTPL
                     SLLPSPDTESPFSLSIPLSAYPSRQTYAKVFNQCIQPIREAWDPDYIILQLGTDGLPG
                     DRVGQYGNWSVDGEGGIKWVVERVKEWGKKVCVTGGGGYRHDNAARAWAEVTGVLLDR
                     DFVEDMPIPHHDHFEQYAPSFTLQVPDSHMRDENKPEDLEKAAEVFNVLAERIKIIVD
                     ANS"
     gene            complement(469319..470878)
                     /locus_tag="CNL05270"
                     /db_xref="GeneID:3254730"
     mRNA            complement(join(469319..469598,469650..469723,
                     469781..470081,470132..470183,470241..470291,
                     470338..470618,470670..470878))
                     /locus_tag="CNL05270"
                     /product="AY086643 putativepod-specific dehydrogenase
                     SAC25, putative"
                     /transcript_id="XM_568066.2"
                     /db_xref="GeneID:3254730"
     CDS             complement(join(469395..469598,469650..469723,
                     469781..470081,470132..470183,470241..470291,
                     470338..470618,470670..470801))
                     /locus_tag="CNL05270"
                     /codon_start=1
                     /product="AY086643 putativepod-specific dehydrogenase
                     SAC25, putative"
                     /protein_id="XP_568066.1"
                     /db_xref="GeneID:3254730"
                     /translation="MSLWSNIWLWIRYQVNVIIHCGFPCFFWVQPTWSIDKIENQEGK
                     VVLITGGNSGTGYATALALYNAGATVYIACRNLTRAKEAAEDIKKGGERGIWGVTYPR
                     KELDKAGGNKKGRVEIIQLDLTDLASVEKCAEEFLNKEKKLDLLFANAGIMATPEGQY
                     TKQGYTLQFGTNTLGHHRLITLLLPLLLSSPPSLPSRVILTSSAGHSMAPKGGVNFKS
                     VVRDPSDTGSGQGKYELDKWTEYAQSKWGNIASAKYLEDTYGKEGRLIAVAVHPGLVA
                     TNLTNHLPFVGIFYRWVPWLRHLFTRDPSTGALNQLYAATLPLPDAWFLNGEYVVPYN
                     TVGICRSDLLDKKRIEEVWNWCDEQGKKFA"
     gene            complement(471271..473414)
                     /locus_tag="CNL05275"
                     /db_xref="GeneID:36393125"
     mRNA            complement(join(471271..471931,471977..472288,
                     472339..473414))
                     /locus_tag="CNL05275"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658834.1"
                     /db_xref="GeneID:36393125"
     CDS             complement(join(471470..471931,471977..472288,
                     472339..472890))
                     /locus_tag="CNL05275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514666.1"
                     /db_xref="GeneID:36393125"
                     /translation="MSFNIASERPRSSTRIRSKSIPRTISHQLKQHTYAKEPILSDSD
                     DDTSPQAASESSINSENAYPKIHDVDASVLQFLAGLQPPAITPWQDAGPHLDWVPKWW
                     HNEQSQVFKAASIDKKSLNEWDYLEAPWLDRLKCKMSPRKRFTIPQLQILEVQWNNDI
                     SPPKVDRQRLAMWMGTRTKHVNIWFQNRRQYEKKAHASGEIPEPAYTMVEGLVEPTAA
                     MKVIVSKIAIGELKADNLTVEAAFFNISNKRRAFRPSVTMGNTRSTNVPSSTPSYEEL
                     QTPTQANRKSTHGQQSGRRQEEVKRPKNIHARQHSDTGQKVRPNEAGARTDVQEQRRT
                     DIKSSIQVYHHTPQQRHFASINKTLPAYKCDWSRESSSSFGATGDDDNVVAKPDLAGT
                     DGKIRSSSYGFGLYEPSPVYPLRESKQADWEVQEVLMAADILMGMQRTR"
     gene            complement(474566..475423)
                     /locus_tag="CNL05280"
                     /db_xref="GeneID:3254903"
     mRNA            complement(join(474566..474650,474704..475423))
                     /locus_tag="CNL05280"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658180.1"
                     /db_xref="GeneID:3254903"
     CDS             complement(474711..475328)
                     /locus_tag="CNL05280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513851.1"
                     /db_xref="GeneID:3254903"
                     /translation="MSSFFRPLAPIARPLLRRAYAAAAKPSGGNPHLHQPADSRSEVL
                     RNTLYPHDSYAPTSSSPTGSYHPDYLERLQAVIPSAEAYETIERAWQLYQRELREARK
                     IALDAKYKSMVEACDELERITNHENGGPESADGKGGLYHRQVYNLAVASVRQAHRRGE
                     QPKGKKTLEQRWLETRVEGLVPREAWVPVESRGKGWNYDWQRPGA"
     gene            complement(475557..477260)
                     /locus_tag="CNL05290"
                     /db_xref="GeneID:3254805"
     mRNA            complement(join(475557..475630,475684..475749,
                     475805..476115,476163..476279,476331..476432,
                     476480..476585,476636..476812,476885..477260))
                     /locus_tag="CNL05290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568068.2"
                     /db_xref="GeneID:3254805"
     CDS             complement(join(475607..475630,475684..475749,
                     475805..476115,476163..476279,476331..476432,
                     476480..476585,476636..476812,476885..477157))
                     /locus_tag="CNL05290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568068.1"
                     /db_xref="GeneID:3254805"
                     /translation="MSHSRPLIRTLQTRHIPRLLSTPTPRATTSITSRYIRPCSIRLF
                     GTTVARQVQIPENMKAVLIKNGTGHADDLYLGHEPTPEPGNGQVQVKIRNFGLNRMDI
                     LQREGKYPLPPQASKTILGVEFSGIVTKLGEGVNKWKEGDEVFGLSYGGAYAEYIVSP
                     EIMLLAKPEKLSWVQAASIPEVWMTATQALTLEAPLKEGQNVLIHAGASGVGIAAIQI
                     ALHALGAAKVFTTCGTDEKVEFLKQLGHSDRLHVFNYKTQNFEEEIKKITNGVDLVID
                     FIGTNYFLQNVNVLRLDGTLYSLAFMSGAKFPAGASMAPFLGKRLTFKGSTLRSRSPE
                     YQAKLLKTFEEKILPKILDDTMTIKVHEIYPWSKVTEAHKAMEGNKNSGKIVLEVTE"
     gene            477423..479921
                     /locus_tag="CNL05300"
                     /db_xref="GeneID:3255000"
     mRNA            join(477423..477592,477660..478147,478200..479921)
                     /locus_tag="CNL05300"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658181.1"
                     /db_xref="GeneID:3255000"
     CDS             join(477717..478147,478200..479805)
                     /locus_tag="CNL05300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513910.1"
                     /db_xref="GeneID:3255000"
                     /translation="MFPLIPQFLFALPVCLTSLKSSQISPNIQTVSTMATNRMSHKYI
                     VPTSNCMPHESSSASINDPLAPYQSPMGSSPNFRHQSSGNFRYTSALIKGDNREDEQW
                     GVQSHWSDWGSENSRAGGKKDDRRSGGLRRMFTKSGKNGKVDRSRCSSADFLLSQPKE
                     RSSPVKDIKSPIRSSRPATEFFPNFLKVSSYSPSRQHTRLDDSHGAGCSPRSIERSIS
                     KHKRTPLKTSDVVPLHWKSADRARSPSTGRNSESSTSPLIDRTGSLVQRLQNLDNLPD
                     SRYPGPKAKGSYGTPTPDRPRPFRRASQSSDLLPRLDCQSPCAQKGGPQTRESEEDVF
                     SALASQQEPSRRKRSATQPTRRNDLHEQPSRQPSRSLSIKRPSEANIAHWTNYPASSS
                     AQHHRQGSMDRAEALVMLERMKSTGKLRIANPDPPGVSNLSMTRQLSPSPTKPVNACS
                     LYGGLASDSDDSLSVNKTPHCLPDKYFSKESQGNFPAKSYTTPSRSQAYASFRKAQSS
                     RKTNTPTSNRPERSPHCPLLGSAAAGKSPLHNDEPFVDSLAYLTSPQSPSQSLARSST
                     GNMSVFHGSHIGSPSPKNKHGKEEEELLLDSDADSNVDSGDYRTLFGSVRRLSEGNSS
                     VTDMYLESFYSDDVNGQDTRDESPEPRIVEDGPLLPKSLSLRKTRKVGDRLVKA"
     gene            complement(479958..482467)
                     /locus_tag="CNL05310"
                     /db_xref="GeneID:3254752"
     mRNA            complement(join(479958..480064,480124..480820,
                     480885..482251,482295..482467))
                     /locus_tag="CNL05310"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_568069.2"
                     /db_xref="GeneID:3254752"
     CDS             complement(join(480020..480064,480124..480820,
                     480885..482251,482295..482363))
                     /locus_tag="CNL05310"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_568069.1"
                     /db_xref="GeneID:3254752"
                     /translation="MYAQLRTAHYRAPRSLRPQPQRRLLATPPPPPPPASGLPPNPPP
                     PTGVVHPRPAVAHAKPPAVPGSSTVARPPPGRPRRFRRVFVYTALGVAGFYALSGYVG
                     TKSDAYRDLFTQYVPGGEAVADYADDNDWDNVSGKAVRAWQSITGARPETRTEKVERK
                     IGEVRQEAAKVPAQVKDKADEAKDHVVGKHTASQKIHERAEELRKAVEQKTHEAEARL
                     KELTGEAKHKVQEATKDAPFNFSEGVEGIVRAAESALHKTEHKAAEAADKVKPAEARP
                     SSPFPDTQRPRELKPETVTPQVPSYEGKKLYTGPPLPLGHEPPPGYYLPPPPSTKKEK
                     VEEKVEEIKERLPLLVPKVKEFASEEPIISQLASTIDSLTSSLSTPSKALSSDATGIL
                     NKAQDDLTALNARLQEVKKAEKAKLEQSISEKKKEFEALLKSMEAEKAKSEEGLKQTW
                     QHERQTMVEDWRKELEGELEQQRQSIEQRLREEVVSQGIELQRRWLRSIKTQVETERG
                     GRLAKLDSLTTSLKQLERITLDNSATLDDNVRLHKIWSALRAVQSKVDSGDLAFDDEL
                     RALKSLSTPTASSGEGVVRSALEQIEKSGIPQTGVKSFAALSSWFTNTVAPRIQSSSL
                     VPAPEEATVISHLASAGLSKIMFRPQAGRVPGDSVGAVLARAEWCLAEKDLDGAAREI
                     NSLTGWPAKLANDWLQQARRKLEVQQALEVVATEATLSSLLLV"
     gene            complement(482482..485410)
                     /locus_tag="CNL05320"
                     /db_xref="GeneID:3254888"
     mRNA            complement(join(482482..482695,482751..483083,
                     483140..483515,483572..483757,483812..483939,
                     483994..484021,484074..484208,484283..485242,
                     485313..485410))
                     /locus_tag="CNL05320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658182.1"
                     /db_xref="GeneID:3254888"
     CDS             complement(join(482508..482695,482751..483083,
                     483140..483515,483572..483757,483812..483939,
                     483994..484021,484074..484208,484283..485239))
                     /locus_tag="CNL05320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513852.1"
                     /db_xref="GeneID:3254888"
                     /translation="MLADPSPNITNICFYISLIVSHPTSNTSFNSLNNMLSQDNFSRQ
                     REREGTPFPDNLTPRPMPVDLASNDSPATLHAASSQTPPLLATLADASDLQGIEKVGL
                     ELSEKVQGKQRNVAVNQPGLEEEGGEGPPTISPTSVYFNIGPSSDLAGKRATKAATPA
                     LLSRATTPSREMSVHLEKYLESPTNPRREFTLSPQTSFPKRVKPHSSDPSLVGRASSA
                     SSPIMLRPPPPPVPERINRLAFLPNRHAQLCEDDGPEVRAGSVLLETTAKFPTLGTFL
                     LETHCIGCMNNDEQSTETLGVLWSGEKVTQICKGCNLVRFCSHNCWMKEGESHLQECL
                     GLAKAIRENNIPSTLVRLVVKIFREQRRNPTETFLPEHEIFDNFGYYEEFDVDLAAQE
                     IDAYMENDEGKGPEYEEIMTTVRKVLSCSFTMYGADAAPVGLCISPVISNVGHDCRPN
                     AQIVFPLGAVANGGMKIVAVESIQPGEEVRISYVPPTMPCYQRGLFLEKYGFHHEANC
                     SVCNASLSFDIRWAAKHYCHGTKSNDHGYQGLLRRITLASVDGEKEEIVSASPTVCTR
                     CGAVGEAKDINQIWAADALAVMRPFQTLEEEGHYLSDSRDAGLERLEYYHQRLLEGYS
                     SATYPIPLLTYRLARLQLHVGEARGKAELLFRGIETLNRAFRALSMVSDNVITFQLFW
                     LVFRMVRARLYVCELLKGEYSAKPPGYKIHDHVAEHVHAAGQWLGGLCDYERALPLDG
                     RMRSRVRVLREQAAELGRWAAEHGAVMHEGGPRGNV"
     gene            complement(485440..486153)
                     /locus_tag="CNL05330"
                     /db_xref="GeneID:3254989"
     mRNA            complement(join(485440..485495,485548..485666,
                     485722..485892,485976..486153))
                     /locus_tag="CNL05330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658183.1"
                     /db_xref="GeneID:3254989"
     CDS             complement(join(485549..485666,485722..485892,
                     485976..486115))
                     /locus_tag="CNL05330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513853.1"
                     /db_xref="GeneID:3254989"
                     /translation="MATTDDFVINSNGLGYMAPSSEKITGGVQTDAGVKGDDTMEVRF
                     EFGGGLHLLFSSQPKHVAHLPRFVPGTTPPEPLNMRYVVKWMKENLLSEREEMFGEGD
                     GVRPGILVLINDADWELEGELEYELRDRDEIVFISTLHGG"
     gene            486816..488187
                     /locus_tag="CNL05340"
                     /db_xref="GeneID:3254797"
     mRNA            join(486816..486998,487054..487351,487402..488187)
                     /locus_tag="CNL05340"
                     /product="riken protein, putative"
                     /transcript_id="XM_568072.2"
                     /db_xref="GeneID:3254797"
     CDS             join(486848..486998,487054..487351,487402..488038)
                     /locus_tag="CNL05340"
                     /codon_start=1
                     /product="riken protein, putative"
                     /protein_id="XP_568072.1"
                     /db_xref="GeneID:3254797"
                     /translation="MSVQVSPEQMATLKATLLNTPGNVPLHERFRALFMLKAVGGDEV
                     VDIVSEGLKDPSPLLKHELAYVLGQLLNTRALPTLSRVLENPTGEHCSMVRHEAAEAL
                     GAIGAEESLPILRKYMQDENREVRETCEIAVGKIEFDLSEEGKKTNANPDFPTIDPAP
                     SAAPSDIPSLRADLLNTSLPLFQRYRAMFALRDFGAGSKEAVEALADGFRDGSALFRH
                     EIAYIFGQLSSPYSIPSLLSRLRDAKEDDMVRHEAAEALGGIASDGVESENPEVVLPE
                     DERLPEGGVLAVLREWAVKADAPTVVRESCQVAIDMWEYENSADQFNPLDSLSAKQEE
                     REKTEKVNTTGMERSAHAAVAAMGIAA"
     gene            complement(488158..491412)
                     /locus_tag="CNL05350"
                     /db_xref="GeneID:3254986"
     mRNA            complement(join(488158..488526,488575..488872,
                     488925..489099,489152..489624,489687..489846,
                     489900..489958,490010..490279,490327..490472,
                     490522..490672,490718..490821,490871..491057,
                     491104..491412))
                     /locus_tag="CNL05350"
                     /product="Phospholipase A-2-activating protein, putative"
                     /transcript_id="XM_568073.2"
                     /db_xref="GeneID:3254986"
     CDS             complement(join(488253..488526,488575..488872,
                     488925..489099,489152..489624,489687..489846,
                     489900..489958,490010..490279,490327..490472,
                     490522..490672,490718..490821,490871..491057,
                     491104..491335))
                     /locus_tag="CNL05350"
                     /codon_start=1
                     /product="Phospholipase A-2-activating protein, putative"
                     /protein_id="XP_568073.1"
                     /db_xref="GeneID:3254986"
                     /translation="MPKQYKLAFSLNGHAADVRNVTAPSQQVPLLLSASRDGSAIVWG
                     PSNASREWDVKLRVEGPEKRYVSCVGMTRWDGQAFLLVGSSSGILASYVLPAMDSPAP
                     ADDSPLPEPTHTLIEHSQNLCCMDVSQGGLIASGSWDKTVIVWKDFKKVIQIKAHEQA
                     VWSVKFVGEDRLLTASADKKIILHSVDPASGRTTPLQTYTGHTEPVRGLALKPDRQGF
                     WSCANDGNVNIYSFDKPSPIRTLSGHTSFVYSIATFPDGSGAITTGEDGTMRVWSETE
                     LIQTIPHTSNSLWSCAVVPSLVASSPYIVSSSSDSTIRFFTNEGALVAGPEELAAWDD
                     EVKGRQLDKSQVGDVKHSDLPGIEALGREGKKDGQVLMIKNNGVVEAYQWSAPSSTWQ
                     QIGQVVDAIGQGRKQLYEGKEYDYVFDVDVSEGMPPLKLPYNVAENPWIAAQRFLERN
                     ELPTSYVDQVVEFIQKNTGGVQLGTGEDTASYADPFTGGSRYTGGGVPTTGAGGSSGG
                     FGDPFTGDSRYTGGGISTTGNTTSSGDPFTGGSRYTGAVTASSAPVQQSGAKGILPVK
                     TYLPFKQINVSAAKNKIQQFNDELKTSKPELALTLEEEKTLTEVYAFLSLPAVALPNP
                     NSQDGKEKFDTGAILALVQKWPEDKRFPLIDLARVLAAASPAFALSPPHPFFIAASLS
                     LPFPDPPSKPRETNTLLALRAIANLFVTANGRMVLSTEDVAKDILANVGGVEWGKVGK
                     NVRIAGATIVLHLSILAVEGNLPVALGSPLLDLINQILDSEKEDTEVVYRSAIALGNL
                     VSSPKAAGGLAVGKVAKGKESVKRWAGKESRLGSLATEIEGLGL"
     gene            491548..495481
                     /locus_tag="CNL05360"
                     /db_xref="GeneID:3254980"
     mRNA            join(491548..491657,491701..491805,491877..491893,
                     491945..491967,492023..492345,492390..492428,
                     492479..492855,492908..492937,492986..494551,
                     494604..495092,495142..495481)
                     /locus_tag="CNL05360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658184.1"
                     /db_xref="GeneID:3254980"
     CDS             join(491621..491657,491701..491805,491877..491893,
                     491945..491967,492023..492345,492390..492428,
                     492479..492855,492908..492937,492986..494551,
                     494604..495092,495142..495417)
                     /locus_tag="CNL05360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513854.1"
                     /db_xref="GeneID:3254980"
                     /translation="MPDLLTPQALATAGPLLLDTLFKHYLSPRQHSDDDKNKAREDLM
                     YDEAFVLMKTFLEMATKHPVAALQRFGQVRTLSPPWVAVHRVQVPFPSLQLAAEYMIT
                     AFGGEEMAFKVAGGTKWWQVRAGQGVEAEWIVMKKDWKDVIAEEKKEKGKRKGKKKEA
                     EGEPEDNEFLPEMDRLRCMLYIHGGAYYWGSINTHRYTIWRHARKMHGRCFAVNYRKA
                     PQYPFPCAIQDCLAAYLYLINPPPGAPHRPVDPKSIVLAGDSAGGGLCLALLQILRDT
                     PGLELPAGAALLSPWSDLTHSFPSILQNTATDIVPPYSFIHKPSSLWPPPPPTVTQAV
                     QSRLRSRVKEAAARVRDHDKEAKSRESHSEGTKGDKLYSVVSRISARSHGKANEGHEN
                     AGGDSRIESPNAVHASAPTGVEASDPSTSPSSTLHPTTSSPSDPKAHPAPREGPHNPS
                     FANPASLFSTLVPPSPNETRPTTLAQCTTPLYLKVKDEKVVLDTQIQIYATNAQLCHP
                     WVSPVLGYLGGLPPLYIMCGDKEVLRDEIIYLAHKAANPSAHPLRPDVVALLPSLEGI
                     ESRYGPTNVHLQVYDGVCHDLPLFSMTTAARGCFRAIASFARYVTPSTPGSLYIGRNS
                     NAAEESEISTPATPNTLITPIDPVDPEKHNKILGAPMDSSPVQVTPRSSQASLRPPGV
                     TSMPLRRTEPLLSEIPSLSGLAMHDNDRCFEETVELETTHGKVDGMKEKKKNEMGILP
                     LRRRTSLPESSTPSGSGPQSTAMTPTASATGDQVLGDETGPRFAFGAGDQTKKDKGKS
                     VEFEKREEEAKEEGEEGFSGLNDSRAKKGEAGWPGIYRGDNPFTDHMIRERVSNTGVT
                     RPLTPPSEIQALTMPREEIGKIKEGPAMRYINGQTLWDKKYRRTGERVKKRRERNLLQ
                     AHKAGEKIGTGLDGVIRESMRAEKAKKRKEIIKEKIKGKKSYEEDEEESETESAVEDE
                     PTTVRTSMTWTWALKGEAPPPSAIVSRRDFSEARQLALMADRIDSPASHSTPLHGLNI
                     WVGLAGFFSTSAEKEKTKAVLKQVKEEKGKKAISVEDDAGEVGETKKSRGKVWKMFRW
                     GWGKK"
     gene            complement(495462..497643)
                     /locus_tag="CNL05370"
                     /db_xref="GeneID:3254834"
     mRNA            complement(join(495462..495794,495847..496278,
                     496332..496784,496839..497175,497226..497301,
                     497361..497643))
                     /locus_tag="CNL05370"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658185.1"
                     /db_xref="GeneID:3254834"
     CDS             complement(join(495494..495794,495847..496278,
                     496332..496784,496839..497175,497226..497301,
                     497361..497570))
                     /locus_tag="CNL05370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513855.1"
                     /db_xref="GeneID:3254834"
                     /translation="MFKKPLAHQSNATPIRSSARRQLLSAILEQYPSLLPQDGMDDNS
                     KKELNKLILPEGVRTATFETSTGLEGTFWLSPNGDPLWMTLGRNSKEYIPTLSLLALP
                     LPRPPLPIIQIYHPLPPPILTGAPLFIPAVRNIDKPHRLPAVKKNQLVAFVTSPTKDD
                     NVHYIGVGRVAAEGGMKGAWERRLDHLMDGGDREEGKFSDILCIIDDHLWDLGSKPTL
                     STFILPPPHNPLIAPPEGSEPIPKSSSPPAVQHLSISAEDDAKASMPVSTSLSPSEIS
                     SLLSLSLLQALSGLQPSAFPMSASLLYSSHILPSRPAHIPQAKRDEVVIGKSEWKRLA
                     KWMKEAGKEGIVKIKESKGEVTVVSFDSRHPSLQAHVDYMTIAQEETKAAKKAAREAA
                     SDQPTSGYKQSLDIEELWKPAGGAISFWEACGISKSDYHSPSALKQAVDGYITSHNLL
                     HPTNHRFILLDDELGRAVGIKKPEAGEKMARDEIINKLKNGVSWVVSIGGTIKKGALQ
                     PITMTVKSRGGRRTVTHVTGLELFNVDIESFAEDMRKRCAGSASIQPREGVSPKLGLQ
                     EVLVQGSQQKLITEALVERGVPKRWIMDEGDKKGKK"
     gene            497760..497849
                     /locus_tag="CNL05380"
                     /db_xref="GeneID:3254920"
     tRNA            497760..497849
                     /locus_tag="CNL05380"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3254920"
     gene            497996..500586
                     /locus_tag="CNL05390"
                     /db_xref="GeneID:3254855"
     mRNA            join(497996..498409,498471..498529,498589..498718,
                     498780..499148,499204..499558,499606..499721,
                     499779..499948,500005..500586)
                     /locus_tag="CNL05390"
                     /product="cAMP-specific phosphodiesterase, putative"
                     /transcript_id="XM_568076.2"
                     /db_xref="GeneID:3254855"
     CDS             join(498222..498409,498471..498529,498589..498718,
                     498780..499148,499204..499558,499606..499721,
                     499779..499948,500005..500012)
                     /locus_tag="CNL05390"
                     /codon_start=1
                     /product="cAMP-specific phosphodiesterase, putative"
                     /protein_id="XP_568076.1"
                     /db_xref="GeneID:3254855"
                     /translation="MGNGTQFRSRIDISATGKTTAARASEHNSMKGFQDVIDQTSEPA
                     FEIVVLGSGGGPLETDCAGYLVKAIDQRWEDGILGLEGGSGLGALSALFSSQSPDTMF
                     PGITFPTDYSTPLLQASYVFSFVSGYLITHAHLDHVQSLIMLTGSAPPRPNLAASTCA
                     SVSQPLPPLCPIVYGTTGTLEKLSTAYTGQIWPELVAWVPGHNEDRKTEAPKKRRKVN
                     QADKHTKSKSPESDTRLPCNKNSTASLVLSPLQTNSPPQSLIGAPSLGVRLYPLVHGS
                     TSKETYESSGAFIRHMPLPYLSPKPVTSVRSRRKPVEGKEFLFLGDMESAYRKSGENG
                     THQELRAKAGRLNSVIWEEAAKSWIEGRLCGIFIECSYDSSRLGQHMYGHLSPPAVYH
                     ELKVLAGHVSRTKTRPLDGLKIFITHIKESLVPHPEGKTQHEIIMAQLQELEKDGKLG
                     VAFIRPVKGDRIIL"
     gene            complement(501096..505232)
                     /locus_tag="CNL05400"
                     /db_xref="GeneID:3254955"
     mRNA            complement(join(501096..501315,501366..501452,
                     501508..501610,501665..501836,501890..502076,
                     502124..502185,502238..503284,503337..503603,
                     503653..503721,503772..503914,503988..504046,
                     504106..504197,504252..504337,504385..504481,
                     504534..504571,504628..504840,504911..504947,
                     504992..505232))
                     /locus_tag="CNL05400"
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /transcript_id="XM_024658186.1"
                     /db_xref="GeneID:3254955"
     CDS             complement(join(501142..501315,501366..501452,
                     501508..501610,501665..501836,501890..502076,
                     502124..502185,502238..503284,503337..503603,
                     503653..503721,503772..503914,503988..504046,
                     504106..504197,504252..504337,504385..504481,
                     504534..504571,504628..504840,504911..504947,
                     504992..505130))
                     /locus_tag="CNL05400"
                     /codon_start=1
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_024513856.1"
                     /db_xref="GeneID:3254955"
                     /translation="MTVLLAFPAKWVTQAHTLIGSLAFAVTLFVGWASGLWQPLCTNS
                     VAKWPVEWFPSVSATIGDHAPPRAPFHILIALCATPRFFLLLVQWLVHRNPPQTSTHS
                     GNIRNAERSSAVLVDIELLVGVARTLCCGGWVYITSRDQHDLHDLFMIFYLLLTVPWM
                     FLSSGNANRDSQHKRRLPFYGFLATIPPLMWFYYRHSALRIPGAYTYYSMFEWSLVFW
                     DLAFDALSVLELNHLQITFIDTSSPSSQIGIAENAGQSAFYLAKPSIPEHLEDQIHID
                     WTSQGVGKPSPAWRQAVAWLSDVYFAICFWTVFTGLGFQLFYWSVWKLALAGSEFALA
                     ANLAGYLFAFKSAHRYLVSRDGQITQRIVTVICGMGCYFFPWPAARLLGVTIGTWAGW
                     SAMFGTWTRVKGSQEMIAEGQIIGLGMVIVMLLKYANKSTNPFWCLVNEASGGWNKTG
                     LVLATICLAEFACRPTDLHPASPLVDSSSKKTEKQIPRPLPTKMHTRLITIGLGTLIH
                     LLQTFMMDAGTIISWTWTGYPIKGPTLHPHAGFVIAAASAGLIAPRFSLTSAWSLLGC
                     ISAYVLYFYPDWIGFYGGLGLTTYLTSITPAYIRAASACNPATTFGNALLVKIIFDVA
                     SVVTTAYAFVPLGWTLRERTDLILGGCMLATAIGAWASNNLVLPTASELPLRTQRRTR
                     AVTQFTLIASAFLSIFSVVFGYSQVPTEKPLPYYPEHRIFSGGIWTVHFGVDKEGRDS
                     QRRMRELVRDMQVDVLGLLETDLHRFVYGNRDLTRSIAEDLGYYVDLGPGPNKHTWGA
                     ALLSKFPIVNSSHHLLPSPHGELAPAIFATLDIHGEEVNVMVSHNGQEEDLLDRELQT
                     TEIARILRSTASTPAVFLGYLVTRTGDRRPWPYQILMEDGKMWDIEIGDRWRWCEYIA
                     FRGLWRIAFARVHESDITDTELQVGKFMLAKPGERVVYENNQELYWHIGENDIPQPWR
                     MPSMFRGKGARGHRYVVWDGPLYYMPPVQSQLRGYGWDWSNDFESAAVERI"
     STS             506146..506395
                     /standard_name="AG17"
                     /db_xref="UniSTS:470731"
     gene            complement(509259..511538)
                     /locus_tag="CNL05410"
                     /db_xref="GeneID:3254823"
     mRNA            complement(join(509259..510304,510352..510594,
                     510632..510779,510830..510901,510948..511012,
                     511064..511114,511163..511192,511258..511538))
                     /locus_tag="CNL05410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568080.2"
                     /db_xref="GeneID:3254823"
     mRNA            complement(join(509259..510304,510352..510594,
                     510632..510779,510830..510901,510948..511012,
                     511064..511114,511163..511200,511258..511538))
                     /locus_tag="CNL05410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568079.2"
                     /db_xref="GeneID:3254823"
     CDS             complement(join(509543..510304,510352..510594,
                     510632..510779,510830..510901,510948..511012,
                     511064..511114,511163..511200,511258..511411))
                     /locus_tag="CNL05410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568079.1"
                     /db_xref="GeneID:3254823"
                     /translation="MVIDCVMSEHRAIRKHAAQHDLFNRLHSIATDEEFVKRVGKSWY
                     NNRFEVVPNQRCGNWYCDPTSSSNAYAYFKSTDGHMFHWDFNLRRSNLSLASYAEAKG
                     GLILVDSTRQGKRMPDGLSKTVPIWCAVINIAVSLRHDVPQDWDTNIYLSPQIVPPTE
                     RSQIESKLRAWAESLERSSLPLPHLARPLRPFFIHPSTSYAPSIPETPEYIPIICLSA
                     SRWVSKGGDDIPSVTSIGQRKVGFEYVPGGGDDDELWARGLKPLLFHQHKKDLLSVER
                     DDLPSLVDRLVKSADPVAGINTSLMDCDLSSSVLAGVPTPNSLMALDIGPPSTKAPWS
                     LSPSEVLRVVPVDKYPKNTPFLLGVHPSERVLAVPSAKTDGKFYATALRELVDHVRKV
                     SIEQSKPIVLRPGKAVDVRKAIASVNNAQSIDPAAIKITSPSFLVDARKVILPLALVI
                     LCALPGISESSTHALPAESNLSKDHVADRLHRLVALWPDGNPPRVALKRVNEFLMSES
                     RK"
     CDS             complement(join(509543..510304,510352..510594,
                     510632..510779,510830..510901,510948..511012,
                     511064..511114,511163..511192,511258..511365))
                     /locus_tag="CNL05410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568080.1"
                     /db_xref="GeneID:3254823"
                     /translation="MRLSTICSTDCTPLQQMKNLLNEWGSHGTITVLRSFRCGNWYCD
                     PTSSSNAYAYFKSTDGHMFHWDFNLRRSNLSLASYAEAKGGLILVDSTRQGKRMPDGL
                     SKTVPIWCAVINIAVSLRHDVPQDWDTNIYLSPQIVPPTERSQIESKLRAWAESLERS
                     SLPLPHLARPLRPFFIHPSTSYAPSIPETPEYIPIICLSASRWVSKGGDDIPSVTSIG
                     QRKVGFEYVPGGGDDDELWARGLKPLLFHQHKKDLLSVERDDLPSLVDRLVKSADPVA
                     GINTSLMDCDLSSSVLAGVPTPNSLMALDIGPPSTKAPWSLSPSEVLRVVPVDKYPKN
                     TPFLLGVHPSERVLAVPSAKTDGKFYATALRELVDHVRKVSIEQSKPIVLRPGKAVDV
                     RKAIASVNNAQSIDPAAIKITSPSFLVDARKVILPLALVILCALPGISESSTHALPAE
                     SNLSKDHVADRLHRLVALWPDGNPPRVALKRVNEFLMSESRK"
     gene            511669..511757
                     /locus_tag="CNL05420"
                     /db_xref="GeneID:3254916"
     tRNA            511669..511757
                     /locus_tag="CNL05420"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3254916"
     gene            complement(512436..512524)
                     /locus_tag="CNL05430"
                     /db_xref="GeneID:3254913"
     tRNA            complement(512436..512524)
                     /locus_tag="CNL05430"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3254913"
     gene            complement(512920..516445)
                     /locus_tag="CNL05440"
                     /db_xref="GeneID:3254979"
     mRNA            complement(join(512920..513154,513214..513301,
                     513356..513523,513579..513640,513690..513703,
                     513757..513818,513870..513989,514044..514094,
                     514149..514228,514282..514341,514394..514486,
                     514535..514559,514606..514674,514728..514802,
                     514852..514938,514997..515109,515159..515542,
                     515610..515844,515895..515912,515969..516022,
                     516074..516141,516191..516217,516272..516445))
                     /locus_tag="CNL05440"
                     /product="glycosyl hydrolase, putative"
                     /transcript_id="XM_024658187.1"
                     /db_xref="GeneID:3254979"
     CDS             complement(join(513059..513154,513214..513301,
                     513356..513523,513579..513640,513690..513703,
                     513757..513818,513870..513989,514044..514094,
                     514149..514228,514282..514341,514394..514486,
                     514535..514559,514606..514674,514728..514802,
                     514852..514938,514997..515109,515159..515542,
                     515610..515844,515895..515912,515969..516022,
                     516074..516141,516191..516217,516272..516340))
                     /locus_tag="CNL05440"
                     /codon_start=1
                     /product="glycosyl hydrolase, putative"
                     /protein_id="XP_024513857.1"
                     /db_xref="GeneID:3254979"
                     /translation="MLEPTDIPNKSLDKSGSPVRSIQDHALIGNLRTAALVSVDGSIE
                     SMCIPYFDSPSVFARILDAEKGGHFSIAPTWPFKPKQAYAPNSNVLVTKFLSERGVGV
                     MTDLLVPRGANLNNSSSRAFLPWLIRKVESIRGTVPFKMECAPAFNYCRDKHTAEIVP
                     DDSSSNVISQGTKVLFKSPSFTLDLRTITWSSDQCVSDPEIKLQIEDLSERGLLGPAA
                     ACDFELEEGQCVVFVMREVGDYSYANEEHQEFANPTTSKAKAMGVPVEQMFEATNRLR
                     PKENPILTKSLVAALIRDTTSYWKKWIGGIKYSGRWRQAMLRSALTLKMLVFEETGAI
                     VAAPTFSLPEFIGGQRNWDYRFTWVRDSSFTLYALIRLGFTEEADAFVNFILERLKDR
                     NSDGSLQIVYTIHGGKDLEEIELSHLAGHKGSKPVRIGNGAADHLQLDIYGELLDCIY
                     LAQKYSKPLGWDSWVAVRQVVDYVCGQVDNPDLSIWEVRGQQKNFTYSKIMMWVAIDR
                     GIRLADKRCLPCPNRSKWLETRDRLYETIQNKAWNPAKQIFAQSYEDLNTLDSAVLIM
                     PLVFFISAADPRFTNTLDAILKTPEKGGLTANNSVYRYNAQLSDDGVGGEEGAFSLCT
                     LWCVEALTRAGVYNAKYLDYAMNMFIDFLGYGNHVELYSEEISPGGEGLGNTPQAFSH
                     VTLISAGFNLDRALSGNGRSAWA"
     gene            516878..518244
                     /locus_tag="CNL05445"
                     /db_xref="GeneID:36393126"
     mRNA            join(516878..517121,517191..517263,517316..517393,
                     517456..517731,517788..517878,517928..518244)
                     /locus_tag="CNL05445"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658835.1"
                     /db_xref="GeneID:36393126"
     CDS             join(516976..517121,517191..517263,517316..517393,
                     517456..517731,517788..517878,517928..518013)
                     /locus_tag="CNL05445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514667.1"
                     /db_xref="GeneID:36393126"
                     /translation="MSSDKNRSQRLQPSSVASSPPRTPNSAPPIIVLPKRRIIPAPLT
                     ANSLHPVEKEIERLTAACEEHERVIRSTLSTVRHHIMTNTQGILERLSKVDDDAEAIT
                     ASIQQAIQSSIPQFQSNLRESLQLRSGDVELMRERTTPWRDVVDEDGAARLGVSTGGI
                     GALRAKKLKRVEGGGGEADALTRVELWADEVEMYLNNEIIRANESTKVKRARQIGLYY
                     AILYSLMVLGIMGGIFLLYYPSAAIWGWIRP"
     gene            520458..523052
                     /locus_tag="CNL05450"
                     /db_xref="GeneID:3255029"
     mRNA            join(520458..520557,520620..520656,520714..521240,
                     521297..521446,521494..521898,521949..522043,
                     522098..522180,522230..522362,522414..522516,
                     522569..522640,522702..522763,522830..523052)
                     /locus_tag="CNL05450"
                     /product="sodium:inorganic phosphate symporter, putative"
                     /transcript_id="XM_024658188.1"
                     /db_xref="GeneID:3255029"
     CDS             join(520509..520557,520620..520656,520714..521240,
                     521297..521446,521494..521898,521949..522043,
                     522098..522180,522230..522362,522414..522516,
                     522569..522640,522702..522763,522830..522889)
                     /locus_tag="CNL05450"
                     /codon_start=1
                     /product="sodium:inorganic phosphate symporter, putative"
                     /protein_id="XP_024513858.1"
                     /db_xref="GeneID:3255029"
                     /translation="MPVLHQWDYLFAFGVLFAALDAYNIGANDVANSFATSISSRSLT
                     LRQAAMLAAICEFLGGVLAGAQVASTIKNGIISMSAFRNNPGIELLAFVCALAASATW
                     LMIATRKAWPVSTTYSIVSALAGVGVALDGPGAVQWGWNDGKGIATIFAGFAIAPAIS
                     AGFGATVYLITKYAVLTRKNPLKAGLYVSPIYFFTVAAILTMSIVYKGAPQLKLNKLP
                     QTTIALAIVLTGVVIAFLSVIFWLPFVYSKVIKKDYTLRWYHFFYGPLLWRRAAPPPP
                     PEGARHVPDYRVYDRDDEHKEPTTETPTNPVSEGSTEGEGAPLETNLTVTSHEKDKDI
                     ESAPLQSLSKGKPYASALEDLEKDDHKIEGAIILPRNLWILFRYKLPKMLLHGTSVDI
                     HAMQSHEGKGKESDRMMKMYQHAAQYDNETEHLYSFLQVLTACTNSFAHGSNDLANAV
                     GPFAAIYYVWSTGTVTPSETETPVWIFVAGGLMLVIGLATYGYNIMSVLGNRLTMHSP
                     SRGFSMELGSSITVLLASQYGIPVSTTMCITGATAGVGIVSGGIKSINWRAFGWIFLG
                     WVLTVPIAGTAAGCLTGIIINAPRF"
     gene            523273..527349
                     /locus_tag="CNL05460"
                     /db_xref="GeneID:3254929"
     mRNA            join(523273..524103,524149..524336,524384..524600,
                     524654..524744,524802..525305,525356..526090,
                     526143..526274,526338..526352,526405..526563,
                     526622..526855,526909..526961,527013..527349)
                     /locus_tag="CNL05460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658189.1"
                     /db_xref="GeneID:3254929"
     CDS             join(523609..524103,524149..524336,524384..524600,
                     524654..524744,524802..525305,525356..526090,
                     526143..526274,526338..526352,526405..526563,
                     526622..526855,526909..526961,527013..527195)
                     /locus_tag="CNL05460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513859.1"
                     /db_xref="GeneID:3254929"
                     /translation="MSSTATTCQPHQNNTEIMLETPDLAVRPQKVQATSPPTGSITEP
                     LSPQPPPAYLQPQSTPKVDSTPKDSGTSASSALTPPKLLSTHLVKHPNHTVAKAIRTN
                     FPQPNPLLRLIKRFRVKHSVIEGLTEQEMRKCEERGEELRRKAGWKFEGEKGEGAVVS
                     QLFWKMYISLLPTLDRDPLSGLVPPDLLGSTTTMPLSIISLIPDIMQHYRDVIVRAKK
                     EVFLATNYWQPSNSVNTISQALHDLSARVLKEGRPKVIVKIMYDRGSWEQLWNAHAPV
                     HHSEWTPLDLPAKEDTKGLDMEVINFHKVLLGTFHAKFLIVDRKVALINSNNIQDRPN
                     LELMSHFEGPVVDAFYEIALHSWYNRLNPPLPCMTKPYEPPRGPDGKVHYLFQDQNPY
                     FDDIEILKAAKAARILLRRQTKDNEAEAAHHEGAGERLREAVRKVVDQQRQSLADWKP
                     GEEFEAKAQTAMKELREFKDRWGLGMGMMGTGSRANSRGPSRRPSKEKHRDEEKTHTL
                     PAPSEANSSPTITAELPPKSKTYPLPNDRTDGVWNSYILGDEIPRENESDVISRHSPE
                     GGCVAEERALSKKHVCFAPLEMKGVDGMGKIFPDAGTTESPNITTTHLPLETTQDASS
                     NCSPIEDITPQTGFHVQNSTIPEEDATYTADSIATKPASKMDGPRTSETRTREPPASE
                     TNEPLPLSAQMPEESGETYEKTKKHLEMDISQEKNAWKPKKEEIQPEGTGSRRMFQLS
                     KKFNAGALSDAWATVEDSDELDNFRPHVVHAPHDPFPIAMCCRKPHGLPGHHDIRNPQ
                     NAAWLAGFRYAKRKVFVQTPTLNARPIVRAIKQACRRGVEVVLLLDLGFNDKGESIPF
                     QGGTNEEVVDRLYKKLSSEKKEQYLKVYWYTGKDQVRPLNAVKKQRNCHIKFAAYDDE
                     VLIIGNGNQDSQSWFHSQEVNVMIDSKQIVAEMMDTLLSNQNTIKYGLVSSDGIWRDK
                     DGHTLEHYGATAKGAFRGLSGFIAFAKSI"
     gene            527596..529301
                     /locus_tag="CNL05470"
                     /db_xref="GeneID:3254819"
     mRNA            join(527596..527748,527799..528074,528125..528184,
                     528240..528522,528571..528679,528731..528962,
                     529010..529301)
                     /locus_tag="CNL05470"
                     /product="alanine-glyoxylate transaminase, putative"
                     /transcript_id="XM_568084.1"
                     /db_xref="GeneID:3254819"
     CDS             join(527711..527748,527799..528074,528125..528184,
                     528240..528522,528571..528679,528731..528962,
                     529010..529160)
                     /locus_tag="CNL05470"
                     /codon_start=1
                     /product="alanine-glyoxylate transaminase, putative"
                     /protein_id="XP_568084.1"
                     /db_xref="GeneID:3254819"
                     /translation="MSDFHQAPHKLLVIPGPIEFSDPVLAANATPGTAHTSPAFIPVF
                     GEALSLLRDVLLSAKESGSQPLLIAGSGTLGWDAVAANLIEKGEEAVVLNTGYFSDSF
                     GECLEAYGAKVTHVKAEVGGIPTDDAIISALASKPKLLTITHVDTSTGVLSPADHIAS
                     LVKKHSPDTLIALDAVCSVASEEIKFDEWGLDVVLSATQKGLGVPPGLSVVLASKRAV
                     ETVEKRKTPIPAYYVSWKKWIPIMQNYESGKPSYFATPPVQLVYALHTSLKSITSAPL
                     ADRFKAHKAASAYVKDSLAELGLEFVPKSRDIAANGMTAVRFPKGVKAPDVLPKLAER
                     DIVVAAGLHKAIVSEYFRIGHMGITAVDRQRGDLEKVVKGIKEVLGKA"
     gene            529453..529543
                     /locus_tag="CNL05480"
                     /db_xref="GeneID:3254911"
     tRNA            529453..529543
                     /locus_tag="CNL05480"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3254911"
     gene            531422..533575
                     /locus_tag="CNL05490"
                     /db_xref="GeneID:3254860"
     mRNA            join(531422..532029,532083..532195,532248..532368,
                     532418..532442,532494..532630,532682..532843,
                     532904..532931,532985..533142,533196..533251,
                     533313..533575)
                     /locus_tag="CNL05490"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_568085.2"
                     /db_xref="GeneID:3254860"
     CDS             join(531662..532029,532083..532195,532248..532368,
                     532418..532442,532494..532630,532682..532843,
                     532904..532931,532985..533142,533196..533251,
                     533313..533422)
                     /locus_tag="CNL05490"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_568085.1"
                     /db_xref="GeneID:3254860"
                     /translation="MSQTSAFDSSVPSATDRVSNINSDSESNVGTLAVESSTTSISAS
                     DSFIVSTSGTHASISSFGASSQSDSTSASTTFSQSKWAQPSDSSASLTGVMSQNNAIV
                     YTIDVTIGDGGTTLPVLVDTGSADIWIAASKCENCRAASMVDSGLILPEGCKEEDKGY
                     GSGSVKGCLVNTNITIGTYELEQFHVLAASDSQGFDGSYMSGIFGLAMNKSSINNQAT
                     PMDILSQLGMISTPEVGFYLTRTESGSELVFGSPHNNPHADQSKKVTLPKVATDDGLY
                     RVTMDGFVSHGYMVQSSKGSVNMENIEVILDTGTSDIRVPEDMLLPIYAALGNGTYYS
                     DTLTGDLVVPCNNNDDDAALALQFEGQQFSLSWQDLIANPSSTDANYCYCRIQASPSE
                     ISDYLIVGSIFFHNVYHVINTDTGNTTLYGLVD"
     gene            533609..536197
                     /locus_tag="CNL05495"
                     /db_xref="GeneID:36393127"
     mRNA            join(533609..534158,534237..536197)
                     /locus_tag="CNL05495"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658836.1"
                     /db_xref="GeneID:36393127"
     CDS             534350..536158
                     /locus_tag="CNL05495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514668.1"
                     /db_xref="GeneID:36393127"
                     /translation="MPIDPDAYMAGAIPTLSRGGSWLQGERQLRDSTLPPSHLHEGSR
                     YSSSPGSNYNPQIPPTPGPSQFGGNPFILPRSPFQRPLSISDWALPSIYNGGRPPPMP
                     MLSQLQTDISGASFIQGLKSEQVFGPVQHHAWLKSSSEADQNSVTSRSFDVQSLVSGA
                     RSVTSSVSVPQNVKSIRRMQYSHHHFDEHSSPEQGRSWENRGGSPKPLAPEPGYGMKK
                     SPYMKLDGHLRRTSDASNQPPPYRKLSSQQIFPPVSSHDDYFLSSPTSSRHDGQLAIA
                     KHRYPHSPNFLSPRPRHKKLGDQDLFRSAQLNSRTARLSLAGRECRTPDPEPSPDLSG
                     YTIAPHAALRPSGGDDKRPSMERRHTASHIPEPTHASSSLPISPPIHKTLHQLKRTRH
                     NSSSRALSFESSSYDEQATSGSTIDFTMSSPMSSRSSAGSNQSTPVNKQFPHLKADSP
                     RKIALNFPVVHSEERNSSAEYVSPLFDDPYDRYATHPNAPTPDRIEKLLSLSPYPSPS
                     TSKPSSTPLRPPQPKAPKDGHYTPPGFAKPTKNLSWNRDGPAMRTYGIAWKREGDPEK
                     LPEGPEGPRLVQARPPRVDHVLGGSWWESGGEESRR"
     gene            537469..542352
                     /locus_tag="CNL05500"
                     /db_xref="GeneID:3255015"
     mRNA            join(537469..537633,537692..540229,540281..540551,
                     540741..541222,541278..541810,541865..541925,
                     541978..542352)
                     /locus_tag="CNL05500"
                     /product="sulfite reductase, putative"
                     /transcript_id="XM_024658190.1"
                     /db_xref="GeneID:3255015"
     CDS             join(537692..540229,540281..540551,540741..541222,
                     541278..541810,541865..541925,541978..542220)
                     /locus_tag="CNL05500"
                     /codon_start=1
                     /product="sulfite reductase, putative"
                     /protein_id="XP_024513860.1"
                     /db_xref="GeneID:3255015"
                     /translation="MSVLAAISSLPATSYYHPIAQVPAGASKLNPYLPLPQSSTPTVL
                     FTNANLLHSLPTASLSRTVIHVFDAEEIVTPKGANAVSLISRSSQGAYDHALLSLRLA
                     QDKDAVVYHFIPSGLEGEIQTLEDAQAWLSGPLDAPDLSNGDDAEPSAEAKLIAAYES
                     ISLSLLKLTRRPQRPFIHSKAESSRLVVNFLPSPVKSENTIDVVLAIPAPKEKLSSSL
                     SGVQEVVVVEAGSGKYGPAWASVVDALEGADVTIRSVLVGASASSEEIAAAITGDTPI
                     TRIGKPLSYNIPSNAVTVPSPESTYTELLASSPSPLEVLNDPSHLAANESTSPLYAFG
                     KAVAIRKERARLVELAKKVLKAPNTKPEVHEALSAWLLVRDEKKGAVEAGKKVEAAIG
                     AGKGDEKEIVELGQKGHWEKRALWIVISNSWAVDLASSGLHHALASGLDINLLVYETA
                     ASPFSPNAPAQPPKERKKDLALYALNMGDVYVASVAVYADYAGVLNAMREAENYSGPG
                     LVLAYLPWGEKEDGQAVSDSENAGPLERLRETKRAVSGGWWPMFRWNPSLPDEKRFSL
                     DSSHIKAALSEFLDRQSHLSQLTLATPAIDSSVTSSAGTELLAARKEKARKAYDALLN
                     SLDGPGLLVLYASDGGNAEKLAKRLVGRAKMRGVSASLRVLDEVAGSIVETLSQEQNV
                     LIVSSTAGQGESPLNGREFTKALSKLSPSDEFKETKVAVFGMGDSHYWPRPEDAGYYN
                     KPARDLFPKLISLGCQELLPLGLGDDSDPDGVQTGYKPFEASLWRALGVDSVEVTEEK
                     EEVVANEHIKIASDYLRGTILEGLADKSTGAISASDAQLTKFHGTYMQDDRDIRESLK
                     AQGLEPAYSFMIRVRMPGGICSAKQWLDMDRISDEHGNGTFKLTTRQTFQFHGIIKSH
                     LKKAMQAINKSLLDTIAACGDVNRNVQCTVNPSLSKTHATVYEFSKAVSEHLLPATNA
                     YHEIWLDKKKISGDAVQPFDSDSEPLYGPYYLPRKFKIAIAVPPDNAVDVFTNDVGFI
                     AIVENDEVIGYNVSVGGGMGVTHGNKKTYPRLGDVIGFITPEDGKKVAESIMLVQRDH
                     GNRQDRKNARLKYTVDRLGLPKFKAFVEERWGKKFAPARAYHFDSNLDHYGWSQGHDG
                     KWHFTMFIENGRVEDNSRHQFKAGLREIASVHKGTFRLTANQHLILSDIASEDLDEMK
                     RLLAKWGLDNLDHSGVRLSSSACVAFPTCGLAMAESERYLPVLIDKVEKICEEAGVKS
                     DDLVMRMTGCPNGCARPWAAEVAFVGKAPGSYMMMLGGSHLGTRLNKPFLESASEPEI
                     LAVLKPMIKRWALERHEGERFGDWTIRAGYIKPTTHGTNFWEDAFPAQAGTTVTA"
     gene            544265..545294
                     /locus_tag="CNL05510"
                     /db_xref="GeneID:3254829"
     mRNA            join(544265..544359,544434..544456,544701..544821,
                     544888..544906,545010..545294)
                     /locus_tag="CNL05510"
                     /product="expressed protein"
                     /transcript_id="XM_568087.2"
                     /db_xref="GeneID:3254829"
     CDS             join(544330..544359,544434..544456,544701..544821,
                     544888..544906,545010..545041)
                     /locus_tag="CNL05510"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568087.1"
                     /db_xref="GeneID:3254829"
                     /translation="MPAYIRRTQLGFAGITPERLRFWGTSAAVWGVAAGAAVSFYLSE
                     VPIFQKDVLIKVPVVGSYFKDTTPDSDKPF"
     gene            545372..547871
                     /locus_tag="CNL05520"
                     /db_xref="GeneID:3254813"
     mRNA            join(545372..545453,545776..545834,545923..546018,
                     546313..546369,546429..546457,546506..546573,
                     546626..546860,546906..547294,547352..547871)
                     /locus_tag="CNL05520"
                     /product="ras-related protein ypt1, putative"
                     /transcript_id="XM_024658191.1"
                     /db_xref="GeneID:3254813"
     CDS             join(545802..545834,545923..546018,546313..546369,
                     546429..546457,546506..546573,546626..546860,
                     546906..547005)
                     /locus_tag="CNL05520"
                     /codon_start=1
                     /product="ras-related protein ypt1, putative"
                     /protein_id="XP_024513861.1"
                     /db_xref="GeneID:3254813"
                     /translation="MSAPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGV
                     DFKIRTIELEGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDRDTYTNVKQ
                     WLQEIDRYAVEGVNKLLVGNKSDLATKKVVEYAEAKSFADELGIPFLETSAKNATNVE
                     QAFLTMSKQIKDRMGSSTMASGPGAKSTIKGLGQNVEQKTAGGCC"
     gene            547906..549692
                     /locus_tag="CNL05530"
                     /db_xref="GeneID:3254892"
     mRNA            join(547906..548147,548218..548304,548351..548619,
                     548670..549266,549327..549432,549486..549692)
                     /locus_tag="CNL05530"
                     /product="hypothetical protein"
                     /transcript_id="XM_568089.2"
                     /db_xref="GeneID:3254892"
     CDS             join(548123..548147,548218..548304,548351..548619,
                     548670..549266,549327..549432,549486..549544)
                     /locus_tag="CNL05530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568089.1"
                     /db_xref="GeneID:3254892"
                     /translation="MSATASIETTIQQGADGQFLDLSSFVFPKMYDEQEMFDPFPGFD
                     SSTSAPHALVATPEVPHSGSPIELFAGQHPSRASTPIQQYTGLEMAVEEDDYSEEDLF
                     RENEKEVAYNEDTDWKMDDDDMHVTNVHIQDLPQYAPLCISTPRISPHLYASAPPPAL
                     PELLVSRLDEQHSARYPQLGRARVDLPAKKSNANKRESSTWVRRSTRVRSRNASELQH
                     RQCTIPDSPPNSSSTAASIATSSAESNYTVSPSPEPSRSRHCLSKGSTSCTPRLASSS
                     PEAQLIQLARQAEGAIRKKEKGRRASAKRNLQNKNAQKKYRDKKKNLAIRTFDFAVEM
                     TKLGCIIEGRMAKAFRDRVNGYLKDISAMDDNYLKEFMERTEMDCR"
     gene            549790..551977
                     /locus_tag="CNL05540"
                     /db_xref="GeneID:3254983"
     mRNA            join(549790..550428,550509..550617,550687..550824,
                     550876..551072,551155..551781,551835..551977)
                     /locus_tag="CNL05540"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658192.1"
                     /db_xref="GeneID:3254983"
     CDS             join(549850..550428,550509..550617,550687..550757)
                     /locus_tag="CNL05540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513862.1"
                     /db_xref="GeneID:3254983"
                     /translation="MTMSPPANPSSPRRSLRTRPSAVASTSTGTIVVNNKVERDGAAS
                     VNCQVVVDTNTTSSSSRSRPSISSASASIDTFARRLSKRPSNEVKEQEGEEELGTSGT
                     EEDEADEDRLSGEEDEDRKQEEEEQLPSGLGQSHGLSRSMTKPLTKYEEEGDSSVLNG
                     RLKKKRRVTERRTLQNKTAQKKYRDKKKFLALRTLDFAVSMTRVCSRGLEGKERKAFK
                     QILKDYLADVSELDQSYLADFLTKTGLHSKLLAE"
     gene            complement(550758..551846)
                     /locus_tag="CNL05545"
                     /db_xref="GeneID:36393128"
     mRNA            complement(join(550758..551137,551205..551846))
                     /locus_tag="CNL05545"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658837.1"
                     /db_xref="GeneID:36393128"
     CDS             complement(join(551006..551137,551205..551720))
                     /locus_tag="CNL05545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514669.1"
                     /db_xref="GeneID:36393128"
                     /translation="MPSESKSKLKPNSPPSSSSSSIIAKETHALTLSTLSSHCPHLST
                     PIIRLSTLLDIPLTVSLIFLLAAWGIAHLYIPIFAIPHWSGILTLISPLWGSMQTILE
                     ERGRGEEGGAGKPGKGDGAQWLVYWLFYIVLGWMRGMVRVYRPGWVGVFEVGRSGTLV
                     AVGGGWFSKSVLMREKSKELIEAEKREAKEESQTSMRREENEKKDGKKHEKQEKK"
     gene            complement(551960..554153)
                     /locus_tag="CNL05550"
                     /db_xref="GeneID:3254874"
     mRNA            complement(join(551960..553309,553376..553882,
                     553953..554153))
                     /locus_tag="CNL05550"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658193.1"
                     /db_xref="GeneID:3254874"
     CDS             complement(join(552218..553309,553376..553882,
                     553953..554042))
                     /locus_tag="CNL05550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513863.1"
                     /db_xref="GeneID:3254874"
                     /translation="MMETMTSTYTPLARRIRQAAQFVGDYFDDEKMSPYPILAFLSNK
                     LDRPPSVLAHSFLLLLLSGVLLNPYHLSGVIVNILGLLWPGWLTIRHISSLQASSDAK
                     VNPKPKFLARARVRTTRTGEKEWPSQTKRLIDYWILYSFSTVVESTVAQDTLLALIPL
                     WWAFKILAIVWGSISLSLGAADAAGASSGAKEKTRPRPLKLRTNSNLIRIPSPTIAKT
                     SQTAYGDIDSSSSSSSPSQHSSSATAVDTSYTNPYPGISTGTGTGTGTRTGAAAETGP
                     TPNSPELQASRDELGQISPVLSRTPEHLRPRHESAGPEGKEEGPATATSEYGSGVFGL
                     SEVDRESEISDSDSDSDTGPDSDSNSETDPGSGSESDSNTNSDSDARSDSDPNAPFSD
                     SSPLPRPPSPSPSLATNPTSPNTSARPSHSNNPNPNPNPITANAANAAFTDDSNDIRL
                     PLDTPLDELALRGLKTIELEVEEEEEEQDGDGQAEIGHWEGREGREKEKSMKIDPAPV
                     PSSPGNPTKPPATRPQNPLGEMGEGSITRLTLDDLLALEDNGSFSPPPPPSRPV"
     gene            554527..559608
                     /locus_tag="CNL05560"
                     /db_xref="GeneID:3254858"
     mRNA            join(554527..554724,554766..556470,556535..558371,
                     558438..558585,558651..558924,558986..559163,
                     559227..559608)
                     /locus_tag="CNL05560"
                     /product="SSK22 like MAPKK kinase, putative"
                     /transcript_id="XM_568092.2"
                     /db_xref="GeneID:3254858"
     CDS             join(554544..554724,554766..556470,556535..558371,
                     558438..558585,558651..558924,558986..559163,
                     559227..559364)
                     /locus_tag="CNL05560"
                     /codon_start=1
                     /product="SSK22 like MAPKK kinase, putative"
                     /protein_id="XP_568092.1"
                     /db_xref="GeneID:3254858"
                     /translation="MSNPTSPTDPPDAGPPAPAIASSSKTGRRSVRLFAPDEEDSSDE
                     DGLIGVPAETTFNDDEVPPSNTRSASYPGPPAHTSPTSKISSIVSSASAAQPKLARSI
                     TYVAPSAISSRPAYPLHPAGPETLHASYETWRKTRYTLESFSRAKADGKNAAQRGRSY
                     TDPDVGYFSPDAGDDGWGSDDEDELRSPGWGISHHNMDSGGKTDGSPQLPIKPADVTE
                     DEGQERLDWQGMLESVLNSDVFKVEEQRIYNSMPTDSFREEIGKTLWWQIRAKLRGRT
                     EAEEKKRVQERRARVVDPVLEEINEFKYDPKNNPEGEEDSDADPQDATSTAAPQSKAL
                     NQVNTILAKLHAVKGLYPNLAAMRADKSLYTDENFRKRADALTSWSIIVSSLQTQLKL
                     LQKWTGSDELDITKPNTTHEKALVGKYKYHHSIDSKGTPGRDAADDSSFLDRVIKEDN
                     LQRTFERRAFVDMINLVRNAKETVINYLPQFQEQNLPDFQYEIVRLIGFPGRLIIEAV
                     KVRLDAASRLLDPNPMVVEDFIENLRLSISLAVLIRKQYDEIMAPDAEGRWKIPHCLP
                     TEYNDVLLDALRTFFKLLHWRLRGVGKASYYKETEVLEEEAPFLYEAAEAIVGGDMVV
                     AEQYCALSNKLLIRSANYLDQQLRVPIHSHSRDKERGGDKERDGSSSSQRDRNRDGSL
                     AGPPKHMKVEELFSWYSKLLDSARMRHRKTQRFCRKLTQRFDNSAEYSIEETDVDVLV
                     ETLQDTGHFLVYTGKFEANGTYIVADGSLWGQPDDVRHLLKRVFSVTIPGSRVRPRQT
                     TSQVSGGGGVLANGQVAAAQPDPADPYPEADDFDDEALAAYILLISPRQNFVWSGAVM
                     TLDVDYIDYELADNRVRLIADGPTKRLALCKHYFTQALIHPDTGETIDLPCVVEAQAH
                     LPTIQKQLVKIAKSSYRLSECIVQSAPLVRNAFRGKPGSQELVENWYSFATEHGTRVL
                     VHIEPSAWDRFNRLLMRLAISWISFISQECNPTDRKTFRWTVAALTYAFNMTRGSNIL
                     ALDRSEFSLLRRYVGVCVSLLVSHFDILGARSSMEAKKEADRIEAMRRLQRLQENLDD
                     EFLPRTPTESGGQPRIDRSIRLTVEERLRLIAELEARRSELAPAPVGQVLDEEVSEDR
                     ALVFLAASKSNISMRWQQGAYIGGGASGSVYLGYSLQDNTVFAVKILPTVDLQSSPAL
                     YESIKRESDVMSLLSHPNVVGFLGLEVHRNRVCLFQEYCEGGSLAGMLEYGKIDDEEV
                     VGAFTIQLLRGLEYLHTNRIEHRDLKPENILIGANSVLKLADFGTAKIIKSNKTLART
                     RGGAHAKMEGLEGTPMYMAPEMIKNQRTGKLGACDIWGLGCIVLQMITGRKPWSFLDF
                     DNEWAIMFHLGATKEPPPLPDPNEMSDQGIEFIDQCLSLDPEARPVASELLQDEWLVP
                     MLEQMAELEQEYPDVLAMGQSDSLVPPPENASLTSNAPTLQDDITPPPLE"
     gene            complement(559575..562278)
                     /locus_tag="CNL05570"
                     /db_xref="GeneID:3254822"
     mRNA            complement(join(559575..560189,560255..560432,
                     560487..560819,560878..561180,561245..561421,
                     561478..561669,561731..561811,561908..562278))
                     /locus_tag="CNL05570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568093.1"
                     /db_xref="GeneID:3254822"
     CDS             complement(join(559651..560189,560255..560432,
                     560487..560819,560878..561180,561245..561421,
                     561478..561669,561731..561811,561908..562261))
                     /locus_tag="CNL05570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568093.1"
                     /db_xref="GeneID:3254822"
                     /translation="MEEPSSPRKPSPSSPPSSSSSPAGSLDLPSLQPLSHDHPLLTAP
                     TFDPDAFLLSRIHIPLEELRGELREYLGELREELVKLINEDYEEFLSLGIGLRGEEER
                     LKRLEGPLQGVRKEIVSVRDVLAEHQAKLQEKLDERAALREEKALLDLLQRLFDTLAK
                     AEALLDLPHTDELETSKLVTRVAGEYSQIVYLMNKARTEECAIVNVVEERIKNIKSRL
                     SKDLSTVLLSELENLNATGLKQCLKTYELIEGWEEAEEVVRKVFREYCRNTISSSALS
                     LPTSPTAPQTPHQLRNPLDVPRLPASYNTPLALLFNRVLAQVASYQPLLDASKEVSEK
                     FDFFARVFWPEIGDTIIERLGSVIFAAGRPDDLHKYYTTSHKFLDLLETIAPSAHNVL
                     AMRSSPSYTAFERRWQLPVYFQLRWKEIVSSLEQSLAGQPSYTSTSDHKGSKWVLVQS
                     GAVWKALESCWKEDVYISELAPRFWRLSLQISSRYGTYLKSTVDSYVITEEDNSQEDA
                     ALRFASAAVVDLENLAAKVKDLDVVKELNLGEHLTLPTTQYTSKILSILTRRCTDPLK
                     LIRSIASQFRSSPTPSTPSSTRQPSYFVPSVFKPLHSLLSSQPQLKERYQQDFSRQIA
                     DAVFVNYASTLASVKKTEDLLRKHRKSKKSGITSFFGGGGHDGGSGEKEEERFTNQMK
                     VDIDALKEDAKGLGVDPESMNSWNELLAVVNKPDEA"
     gene            complement(562458..564519)
                     /locus_tag="CNL05580"
                     /db_xref="GeneID:3254734"
     mRNA            complement(join(562458..563571,563623..563679,
                     563736..563792,563850..564041,564115..564405,
                     564467..564519))
                     /locus_tag="CNL05580"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658194.1"
                     /db_xref="GeneID:3254734"
     CDS             complement(join(562801..563571,563623..563679,
                     563736..563792,563850..564041,564115..564405,
                     564467..564478))
                     /locus_tag="CNL05580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513864.1"
                     /db_xref="GeneID:3254734"
                     /translation="MVHNGTNMPTRPVDKPTSAVSTATTTTTATKKVCQHLSPSVYPL
                     IKHLYQRPSLPSLHSLRNKSTCSVFSVNSVPQGEQNPVMIVPTPAQAAAPCFNVEDEM
                     TYPRRMSVYSPASNETADFIPPRRGIRPLFLQEKYGTSSRESLKNKNKNTASGGVAAE
                     SEHARNIESTIEAAKAVCEIGLTDRTSIPARERARSNSAPTIKSKASSNRISFKTNSF
                     AARITSAFRRSSKPISLKIDIPSSSNFVQQPAKPHLQPLEFGGRFDDNPFIGQPAKFA
                     ADAVSSTVTISTPDLVFSSLRSPFPSSVSSTSSLSAYSADSYVESSQAISVVVTPPTE
                     PPSGSQTPNNEPEEPPLTAASTDTEFSDMAIHTPTDSSFVQPTFYSQEAQSHITTTEL
                     VTRPALIPTACGSRFIEMFDTIIAFPDSTSGSASPEIRTPVLTPIDYQAYPQPAYRDI
                     NTFLAYSPP"
     gene            565803..567289
                     /locus_tag="CNL05590"
                     /db_xref="GeneID:3254931"
     mRNA            join(565803..565978,566047..566067,566139..566416,
                     566478..566490,566549..566623,566698..566846,
                     567036..567289)
                     /locus_tag="CNL05590"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658195.1"
                     /db_xref="GeneID:3254931"
     CDS             join(565868..565978,566047..566067,566139..566416,
                     566478..566490,566549..566623,566698..566846,
                     567036..567078)
                     /locus_tag="CNL05590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513865.1"
                     /db_xref="GeneID:3254931"
                     /translation="MRFLRSVARLYNTNFDRRPVATLVVTNGVLNTIADVLAQYSTIL
                     MHNPTPQTPTPAYDPLRTLRFAIFGMGMGPIIGRWMRFLERAIPIPAKATLGRAGKGA
                     GGILTGPAGASAGVGKGSGEGIQLVKRVVADQIIMAPIGLVLFVGSMGIMEGHSTEEI
                     KEKFQDIYVSAILANWKIWPAIQGINFKLMPIQYRVPFQSTCGIAWTLYLSLLNAKGN
                     KDLEAHQTHQV"
     gene            complement(567256..569092)
                     /locus_tag="CNL05600"
                     /db_xref="GeneID:3254933"
     mRNA            complement(join(567256..567417,567488..567560,
                     567621..567727,567778..568084,568147..568403,
                     568462..568540,568595..568642,568714..568818,
                     568883..569092))
                     /locus_tag="CNL05600"
                     /product="pyruvate dehydrogenase e1 component beta
                     subunit, mitochondrial precursor, putative"
                     /transcript_id="XM_568096.1"
                     /db_xref="GeneID:3254933"
     CDS             complement(join(567407..567417,567488..567560,
                     567621..567727,567778..568084,568147..568403,
                     568462..568540,568595..568642,568714..568818,
                     568883..569080))
                     /locus_tag="CNL05600"
                     /codon_start=1
                     /product="pyruvate dehydrogenase e1 component beta
                     subunit, mitochondrial precursor, putative"
                     /protein_id="XP_568096.1"
                     /db_xref="GeneID:3254933"
                     /translation="MASTITRSIPRALRARTAPLSTAARLVARNALLTTAAPTVPRSP
                     ARFLLAEGQRRAASSDEGVTMMTVRDALNQAMEEEMIRDETVFIIGEEVARYNGAYKI
                     TKGLLDKFGEDRVIDTPITEAGFTGMAVGAALAGLRPVCEFMTWNFAMQSIDQIVNSG
                     GKTHYMSGGNVPCPVVFRGPNGAAAGVGAQHSQDYCAWYGSVPGLKVISPWSASDCKG
                     LLKSAIRDSNPVCFLENELLYGVQFPMTKEELSEDFLIPIGKAKIEKAGSDVTIVAHS
                     KMVTHSLEAAELLEKEEGIKVEVINLRSIRPLDIETIITSVKKTKHLITVEGGFPAFG
                     VGSEILAQICESTAFDFLDAPPERITGADVPTPYAESLETMAFPDTPLIAKVIRRHLY
                     RQ"
     gene            569255..571326
                     /locus_tag="CNL05610"
                     /db_xref="GeneID:3254750"
     mRNA            join(569255..569452,569498..570954,571018..571326)
                     /locus_tag="CNL05610"
                     /product="essential conserved GTPase, putative"
                     /transcript_id="XM_024658196.1"
                     /db_xref="GeneID:3254750"
     CDS             join(569294..569452,569498..570916)
                     /locus_tag="CNL05610"
                     /codon_start=1
                     /product="essential conserved GTPase, putative"
                     /protein_id="XP_024513866.1"
                     /db_xref="GeneID:3254750"
                     /translation="MRRIAPVLLRPLAARAYAAKPLDIDHVQDPDFEDVLGELTRRRR
                     KADAKRRQYGSSFVDHAIVTVRGGKGGNGAAALEASLRGPSFPSGGNGAHGGSVYITT
                     SPELTSLATVKKRLIAGAGGSGGGAFKHGRKGEDLVVQVPVGTIVRELKREGEEERME
                     REEDDLGLSDAEKKKKRWQRWFIAHPSTKGEVSEEEYADGEDLLRRERRWIAHTPSFD
                     QTPPFHLDISEPLDEPVLIASGGSGGLGNPFFPSPRLASRGTLPPTHTFEFELKLLAD
                     VGLVGFPNAGKSTILRALTGRRAEVAGYQFTTLNPQIGVVRVYEDGSWGVGKEEVVET
                     WIEREREDFSRQTGGPFPASRIKNGREDKMERLRFTLSDNPGLLPMASQNVGLGHSFL
                     RSIERSPVLAYVLDLTKPSPVQDLQVLKTELEAYKPGLSERAGVVVLNKGDAVPEEEG
                     KKRVEEVAAFVSEHKSGQVIVLSGRYGLGMETLVALLADNVEKARIERAEMLDRERKA
                     VKEEPVSHRVSGFGLKK"
     STS             569659..570463
                     /locus_tag="CNL05610"
                     /standard_name="Eco20"
                     /db_xref="UniSTS:470733"
     gene            571360..573113
                     /locus_tag="CNL05620"
                     /db_xref="GeneID:3254950"
     mRNA            join(571360..572167,572219..572516,572582..572637,
                     572692..572751,572804..573113)
                     /locus_tag="CNL05620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658197.1"
                     /db_xref="GeneID:3254950"
     gene            complement(571783..575802)
                     /locus_tag="CNL05630"
                     /db_xref="GeneID:3254990"
     mRNA            complement(join(571783..572935,572984..573037,
                     573097..573840,573930..574046,574119..574442,
                     574503..574637,574701..575394,575539..575802))
                     /locus_tag="CNL05630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658198.1"
                     /db_xref="GeneID:3254990"
     CDS             join(571882..572167,572219..572516,572582..572637,
                     572692..572751,572804..572904)
                     /locus_tag="CNL05620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513867.1"
                     /db_xref="GeneID:3254950"
                     /translation="MIIPVLLLLLPQIFSLPTSRHDNTNTACNLLTSDHTAYDCLPDL
                     SLESAITTSQEAHGISREGLLTCPDAKNTIMYYEVTDWRLVKVCECWGKHQFYNEATR
                     QCHCPPSFTPSYDNRGILSCHPRPSQLTADQAQRQQTLKFISRKKKGSMRESSGANDQ
                     APMKGIEAERKGSEGLLCGWGQRACKVGGEWACLDVTFGLTTCGGCPGESETVDCTAI
                     PGVSSVQCVLGQCHIDSCQSGFVLDGKDSGSPSCLFNPRQRFGARKQQ"
     CDS             complement(join(573148..573840,573930..574046,
                     574119..574442,574503..574637,574701..575394,
                     575539..575615))
                     /locus_tag="CNL05630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513912.1"
                     /db_xref="GeneID:3254990"
                     /translation="MVGVSTSSFIGVGIACAGNILISLALTIQKLAHRNNEEALHVDQ
                     DPSASDSEPPSPPLRPRSRTRFGDPSPILEESEPPTPHHDRFIHDDDGSENGGSSRDD
                     RMGEGRYGLGLEDVVAVPVTFISERSKSNPEATRITSYQSNDLSRSSSRGPPPVPIFP
                     PKHTSLRVKLDPNPPAPRHSRHDDPEDESEDEEEDGDDETVGLKITDGRDIGKVEEGM
                     YLKSKLWWLGMVLIAVGEGGNFLSYGFAPASVVAPLGTVALIANCIFAPLILGERFRT
                     RDMVGMALAIIGAVTVVQASSDTSPRLDPDQLLMALTRLPFLLYTLFSLLLLPPLLFL
                     SNSSFGQVHLTIDVGICALFGGFTVLATKALSSLLSGDFVGAWKSGVTWACLAVVGGT
                     SLGQIRWLNRALMRFQSKEVIPTQFVLFTLAAIIGSAVLFQEFRDITLSRFINFAFGI
                     ATIFLGVHLLTSITSPTLIEKDEEGNQAAAEQSYEHVPIPYTTSSTSLHRFFSNTSER
                     TPLIRSITPTAVPVPTPFSTGRTAGIDGLPRRHSDAPLARAPYSAPLVGPSVYAPTAA
                     THGRTRLGKRTSASSFQSSIPKLGLGSQAGLLLIATTPPNTGYLASRGREWSVGPTGK
                     TGGGGVGVGEEEASLETSLGDEDEGRRGRSKSSASLFPRSRTPSVARPGGRDKGR"
     gene            complement(576040..577399)
                     /locus_tag="CNL05640"
                     /db_xref="GeneID:3254996"
     mRNA            complement(join(576040..576639,576695..577024,
                     577141..577208,577273..577399))
                     /locus_tag="CNL05640"
                     /product="Baker yeast's zinc finger protein RTS2,
                     putative"
                     /transcript_id="XM_568228.2"
                     /db_xref="GeneID:3254996"
     CDS             complement(join(576121..576639,576695..577024,
                     577141..577208,577273..577330))
                     /locus_tag="CNL05640"
                     /codon_start=1
                     /product="Baker yeast's zinc finger protein RTS2,
                     putative"
                     /protein_id="XP_568228.1"
                     /db_xref="GeneID:3254996"
                     /translation="MGRAEAGSTKAIANAIKAKGLGRLRWYCQVCEKQCRDENGFQAH
                     CRSEPHMRKIMLLGPKAGQAISDFSRQFQSEFLLLLRTRHLTNRVQANKVYNEYIQDK
                     HHVHMNATRWVTLSGFIQTIGKEGLVKVDEDEKGIWIQWVDNRPETLSKQAAAMKVER
                     SQMDSEERERKMLEEQIARARAQQADQPDLTVGLQKKEGEKIKLNLFGASEPKTEEGK
                     EEESASASAETKPTIGFGKLSAPGTAKPLAVSTNPLKRPAPVNVFKSSKAAKTESGGS
                     AINGDSNGAPKYKSEAERLMMEDQARKASRGQGQGQGYRGFGPSRGGR"
     gene            complement(577892..580062)
                     /locus_tag="CNL05650"
                     /db_xref="GeneID:3254927"
     mRNA            complement(join(577892..578065,578125..578742,
                     578796..578893,578950..579322,579377..579514,
                     579570..580062))
                     /locus_tag="CNL05650"
                     /product="expressed protein"
                     /transcript_id="XM_024658199.1"
                     /db_xref="GeneID:3254927"
     CDS             complement(join(577958..578065,578125..578742,
                     578796..578893,578950..579322,579377..579514,
                     579570..579947))
                     /locus_tag="CNL05650"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513868.1"
                     /db_xref="GeneID:3254927"
                     /translation="MSSITLLGTHASSLSLSTLSKPFSSHLAPTSVTLPLPSRFPKNS
                     NPAVAVSPSGHIFLYNSESSFVWEYDSKGRRISEITLGKGEKVRRVACWEDRVVLSIG
                     KKVRVMVKECEGKVGKWHCSKELEGPRSNVSALCTDGNLLAVGSEAGELVVFEINTGS
                     MVSLPLNEDFSGPISSSITFSPSLPNTLIVPSSTTPTLLRITFPVPLDASSPQFQFIR
                     PFTPSIDAPIANVAFSPVTITSSGEKKGGLCGLVADGEVVLVGLDREKPGLGKKVEFG
                     CKVDALGFLDGASLAARKGSGSLLIKDLRALDKAPVEMGLKDPILNAQVMPAGPRVPR
                     PRVSVASTTSTSHRSTLGEVNNNLPAHQDIHDVKGKGKAPLRPTNEEGPQLRTVSTSA
                     VEDSKRTGRREERKARRSISGPMSTANQPVERRVRHSDMGSKPRMIEAIQEEEPEQSE
                     NAAGPSSSRQGQPSSSSSQPEPQEDRYKEEPSIDLTWALRPSAPRTQLPTMPIEKDMT
                     DKEKIAELRREIGNLQLDILRMGRTFRNEIRQAVQPLAEEIRRNKEIIEEQRLEIARL
                     RAPR"
     gene            580145..580234
                     /locus_tag="CNL05660"
                     /db_xref="GeneID:3254908"
     tRNA            580145..580234
                     /locus_tag="CNL05660"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3254908"
     gene            complement(580487..581156)
                     /locus_tag="CNL05670"
                     /db_xref="GeneID:3254949"
     mRNA            complement(join(580487..580691,580740..580840,
                     580893..580952,581007..581156))
                     /locus_tag="CNL05670"
                     /product="hypothetical protein"
                     /transcript_id="XM_568101.1"
                     /db_xref="GeneID:3254949"
     CDS             complement(join(580624..580691,580740..580840,
                     580893..580952,581007..581089))
                     /locus_tag="CNL05670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568101.1"
                     /db_xref="GeneID:3254949"
                     /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     A"
     gene            581468..583360
                     /locus_tag="CNL05680"
                     /db_xref="GeneID:3254954"
     mRNA            join(581468..581908,581979..582845,582929..583360)
                     /locus_tag="CNL05680"
                     /product="expressed protein"
                     /transcript_id="XM_568102.2"
                     /db_xref="GeneID:3254954"
     CDS             join(581703..581908,581979..582845,582929..583286)
                     /locus_tag="CNL05680"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568102.1"
                     /db_xref="GeneID:3254954"
                     /translation="MSTRPQGYSLRKDAISSSVPTSSQSPANARLPAHLPLYHRLLFP
                     HHPLGEPLPQFIIGDAPEIDLLNERIYNLIALALRGYILPWYTRFSKDRSLLPSIHST
                     VIHPIFSPICTRAYDNPERIVKWILRDLLCSVEIHVKVYWEAKAALGGGTLGDRYHAR
                     LPLPSVSVSSFPAPHSPVHPTYTLSSEYLTSLSVALMQPTETEEERSPMGLQDLMIRE
                     ILARAILAGGMRRLCFGWFWYGLILKFLGEPGDPFPWRRWTPQKQDEPKSIHQLVISY
                     TRTITSLFTAIYSAIITLVAMYTAAPPPSPEYEGCTDTWMAVMRIIMGVDGYAGVEAK
                     KWRKRMVWDGVEMVVGLISPILDRIIPHLLSSQLTPKLSFRLIDLAEKLLFPLDGYPG
                     PTPIDPTPAEAAHMRDRAERRIGEIIPRPLRVVFCPEDKDAGRLMEWMSDAGCNAHLV
                     GMILVSLVATLLPDLVDRTDLEDGQL"
     gene            complement(583306..584810)
                     /locus_tag="CNL05690"
                     /db_xref="GeneID:3254906"
     mRNA            complement(join(583306..584336,584389..584511,
                     584563..584810))
                     /locus_tag="CNL05690"
                     /product="ARF GTPase activator, putative"
                     /transcript_id="XM_568103.2"
                     /db_xref="GeneID:3254906"
     CDS             complement(join(583437..584336,584389..584511,
                     584563..584790))
                     /locus_tag="CNL05690"
                     /codon_start=1
                     /product="ARF GTPase activator, putative"
                     /protein_id="XP_568103.1"
                     /db_xref="GeneID:3254906"
                     /translation="MAENYQKKELLALMNTGGNKVCVDCNAPSPQWASVSYGIFICLE
                     CSGVHRGFGVHISFVRSITMDKWSDEQLNKMKTGGNEKFKDFMENYGPEGGYTKGMGM
                     QEKYNSWAAAQYREKLTAECAGQPWSASSPPANFGLPSRPASSQTTRKSRAAGGITGS
                     SLNPSRTNSPSIPQGSDDFYGQKSANEAFFERMGNANATRPDHLPPSQGGKYSGFGST
                     LEPDVASSHPSYSLSSHAAPTLDEFQRNPLGALTKGWGLFSSAIVSAGREINNAVVQP
                     GLDRAQALAAGENSEEWKRYVNQASAQAKDAGGWLGQRAHEGWEGLNDVAKTKGGVDL
                     NESFGKLGLGKSSIPGSRGYGQVGALDRAEDGLLSPHGAGNDDEEDFFESWGATPTAS
                     TTSATTGAKSIADKGKKKDDEKNE"
     gene            584958..588026
                     /locus_tag="CNL05700"
                     /db_xref="GeneID:3254893"
     mRNA            join(584958..586071,586120..586188,586235..587294,
                     587364..587524,587591..587658,587733..588026)
                     /locus_tag="CNL05700"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658200.1"
                     /db_xref="GeneID:3254893"
     CDS             join(585020..586071,586120..586188,586235..587294,
                     587364..587524,587591..587658,587733..587968)
                     /locus_tag="CNL05700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513869.1"
                     /db_xref="GeneID:3254893"
                     /translation="MPKEDAQLHPPPLKRGDACLYCRKRRIRCSATKPTCTHCAKIGR
                     ECVYDVRKPTSRVQQLEEKVAQLESLLKNGAMKGDGAPSGSGLQASGSTPPLPHQSSG
                     YTPSEATALPQQTSTSTSYSLLNNETIDVNLFGGKYPAIPPAGDDSNLFPSFGGSIFG
                     SMGSIMSQPQPQAEQAFDFSTLDPTFMNMINSFQTSTGLAEPVPQQEQQQLPTAFGQS
                     PAPLASPSYLNPAHANINSHAAQPFPSSTATERMPQSYTSLPKLPFLNNNFCTSVVSE
                     ALPENPSVVAELASANANVHEDMAALLKAAAASNAEQWATGIVQGSDFEGGQENMQLV
                     GGWFDANDLPKVARDHLLNMFFSGMRLFGQEFHVPRFMASLSLPLSKRPHNCLLYSMY
                     TMASRISTSQPIRNLEPHFHSIACRQLELAIAQVDKLLDAIRASSILAVYKYSIARYH
                     EAWMMSGQAARLAIACGLHQIQSSVWKSYNNEAHEMTADFGGLMRRRSYILPPPVDAV
                     EHGERIWAFWSIFVVDRCGSISTQWVPAIPDDAIITPFPRPLHEYELGLVTEADNISI
                     SSIYAPSPPRSRPLRYDYADLVKIRLRALTLLERASKLMYLPPEPGWDKNIERHRSES
                     SGSTFFVPKRPDEMYEYLPSPSGSGPTFSSGSNHTDTAGDFRKNRGWTRTAKVRNPKA
                     YNEVREALLLIEEDLPEEWRTNWLEWDGKVQAWHFNGARKDIISLHLVLGCAWMFIED
                     VYVFGAENTTAVNIAKRLTVTVRYLAQQAAHSDLDVFTAMIWSFMSKVLIREMKRRES
                     SGDKLGAAALELDIDTLVQALKQFGRGYAMAVMQAMRQERYKNSSWENVESMEGDNEG
                     SSDEETFGRKEGLEWAGRHFGGATS"
     gene            588182..592545
                     /locus_tag="CNL05710"
                     /db_xref="GeneID:3254966"
     mRNA            join(588182..588602,588675..588938,588994..589192,
                     589241..590290,590356..590451,590511..590620,
                     590683..590938,591017..591137,591197..591388,
                     591443..591892,591946..592545)
                     /locus_tag="CNL05710"
                     /product="insulin degrading enzyme, putative"
                     /transcript_id="XM_568105.2"
                     /db_xref="GeneID:3254966"
     CDS             join(588367..588602,588675..588938,588994..589192,
                     589241..590290,590356..590451,590511..590620,
                     590683..590938,591017..591137,591197..591388,
                     591443..591892,591946..592460)
                     /locus_tag="CNL05710"
                     /codon_start=1
                     /product="insulin degrading enzyme, putative"
                     /protein_id="XP_568105.1"
                     /db_xref="GeneID:3254966"
                     /translation="MLRSFASSTGASTHLTRTHRSLHRLVTPRSRSFTLVPGRHLTTT
                     SLVKPTTKTQSFQSHRLSNTAQSLFKRSFATPVSRQIPPIKLPIEPIMESPYPPCPPI
                     PKANGPVDLILPPTEDRKHKYFTLSNGLEVVVVSDPKADKAAASMDVGVGHLSDPDDL
                     PGCAHFCEHLLFMGTKTHPSENAYQQYLSSHNGHSNAWTAMTSTNYYFDVSPDALEGA
                     LDRFSGFFSEPLFNEDCTEREIKAVDSEHKKNLQNDVWRFYQLEKHLSKPGHPYGKFG
                     TGNYESLWSIPKEAGRDPRRQLIEWWEKEYCARRMKLAVAGKEDVDTLEKWVREKFEN
                     VPVRTEGKPEVGRDGVRVVFDESPYGKEQLGYFTFTKPVRDMRALELMFPFPDMDHLY
                     KTRPTHFISHFLGHEGRGSILSYLKKKGWVNSLSAGNYHDAAGFSLFKISVDLTPDGL
                     EHYQDVALTVFKYISLLRSQPPSVDAFNEIKAIADISFRFAERGRTSSYCTNLSSWLQ
                     SPVPREKIVSSKWLVEEYNQQELEWALQLLDPRRADIGVTSKVLPKNVSGEFENKEPI
                     YGTEYKRVKFDEEFLKEAMSGAPIADLQLPGPNLFIPEKLDVHKFDVQEPAKRPVILR
                     DTSLSRLWYKRDDRFWLPKANLDVMLHSPILNVTPRNAVLSRLFCDLFSDSITEDVYD
                     ADLAELNFNLWNTSHWIQISAGGFSDKLAVLTEKMLEKFVNYKVDEARFQEVAEATRL
                     HWKNFGMSDPWKIGRFYNSYATQEIAWTQEEKLKELEYITAADVQAFGKELLTRLHIE
                     TLIHGNTSPEGAKEIQDMLERVLKPRELTPTELKAPRSLVLPSSSEYVWQISVPNKSE
                     VNGSVIYEIHVGDPSDITLRNHLSLFSQIAAEPCFDILRTKQQLGYIVSGHASQSTGT
                     MGYTVLVQSEKDPVYVETRIEAFLDGLKETIEEMSEEEFEKHKQSLIAKKEEKPKNLG
                     EETKRFWGRIQDRYFEFARRENDVAELRKTTKQDILNVLMTYIHTSSPTRAKLSVHLK
                     SQYRGIKFDLASAAPLVKSFTEAGIAVDPAAIQKLLSNNPTLEQVKEFANSTIDAAAN
                     VADDVKAQLKDVVAELKGQEAGPGAEAGAGPGPEDVKLRPGNVWIEDIQEFKARLVPS
                     KAAVPVEPLKTLVAEL"
     gene            complement(592506..593354)
                     /locus_tag="CNL05720"
                     /db_xref="GeneID:3254766"
     mRNA            complement(join(592506..592823,592881..592974,
                     593044..593095,593153..593176,593239..593354))
                     /locus_tag="CNL05720"
                     /product="hypothetical protein"
                     /transcript_id="XM_568106.2"
                     /db_xref="GeneID:3254766"
     CDS             complement(join(592698..592823,592881..592974,
                     593044..593095,593153..593176,593239..593287))
                     /locus_tag="CNL05720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568106.1"
                     /db_xref="GeneID:3254766"
                     /translation="MPPPPQHSTGGSTLDKIKMGAIMGSCVGLTIGFIFGSFSIMRAG
                     PGPRGVVATLSQYMLSSAATFGFFMSVGSVIRTESEHKYILPPMTNRAASEPWRMAWK
                     RAEERRRAEASQ"
     gene            593521..593603
                     /locus_tag="CNL05730"
                     /db_xref="GeneID:3254923"
     tRNA            593521..593603
                     /locus_tag="CNL05730"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:3254923"
     gene            complement(595829..597121)
                     /locus_tag="CNL05735"
                     /db_xref="GeneID:36393129"
     mRNA            complement(join(595829..596357,596414..596538,
                     596594..596674,596728..596755,596808..597121))
                     /locus_tag="CNL05735"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658838.1"
                     /db_xref="GeneID:36393129"
     CDS             complement(join(595986..596357,596414..596538,
                     596594..596674,596728..596755,596808..597005))
                     /locus_tag="CNL05735"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514670.1"
                     /db_xref="GeneID:36393129"
                     /translation="MSAISRPITSRLWNHYTTALRERPLRTKMIQSGVLFITADIVAQ
                     LGIEGRSLRRAISGEEGDEVYEPLRTARLVSYGTIIFAPLAHMWLSTLEKISLSSRWT
                     TLASRLVLDMTVWSPCVTFMFPTSLGLLEGKSIKEVRHKVAMGWFPTWQKAVCVFGPT
                     QILNFTLVPAQHRLLFVQSVGMCWNIFLSWQNNRNNKVLAAATLKLAVARVHVSEIES
                     EENPEENEVEQAEKELEKAQAAVKRAEEKKERMRKEGGEAGVGVRMGWS"
     gene            597324..598552
                     /locus_tag="CNL05740"
                     /db_xref="GeneID:3254812"
     mRNA            join(597324..597550,597609..597717,597769..598174,
                     598227..598277,598333..598552)
                     /locus_tag="CNL05740"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658201.1"
                     /db_xref="GeneID:3254812"
     CDS             join(597503..597550,597609..597717,597769..598174,
                     598227..598277,598333..598363)
                     /locus_tag="CNL05740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513870.1"
                     /db_xref="GeneID:3254812"
                     /translation="MGNGLSSALDPTQGKGVISVPDGYTTPPWPSLYLPTLDSTVEQR
                     GIFLYEAEAIWRFTLYWTILLVCSLFLICALMASFTLLLSLTVFRSPDPLPLVPKSDD
                     SKSNETPPYRTTSPNTGASATSFSTPLFKRHRPFERPKRKKPPFWPVILLPIVMTVAA
                     GIISIISSTIVGFALAAIYSAGGFSMSTWVPFLWALIQALVLVISSYSTLATIL"
     gene            complement(598539..601759)
                     /locus_tag="CNL05750"
                     /db_xref="GeneID:3254844"
     mRNA            complement(join(598539..598727,598803..598933,
                     599009..599216,599280..599445,599525..599703,
                     599762..599837,599899..599987,600039..600286,
                     600353..600492,600543..601100,601155..601759))
                     /locus_tag="CNL05750"
                     /product="expressed protein"
                     /transcript_id="XM_024658202.1"
                     /db_xref="GeneID:3254844"
     CDS             complement(join(598606..598727,598803..598933,
                     599009..599216,599280..599445,599525..599703,
                     599762..599837,599899..599987,600039..600286,
                     600353..600492,600543..601100,601155..601619))
                     /locus_tag="CNL05750"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513871.1"
                     /db_xref="GeneID:3254844"
                     /translation="MEAPTADPMVHAEKEAERAENELVEVDTPDVVQEAISKNTETAE
                     VSVNSTITTNEEVTERMQVDAAVVSVEGSERPLEPSMGSGKEPLGTLGEAVEDGVEKN
                     DVEDPEGDAEVEGEGEEDGEEGSGSEDEDEEEDEEEEEDESDGDESEDLEGSHEIIAI
                     DGPDGSPHFTLHPVVKTEPTSPGSMPTTLPTEPIETLPTTDGAENVLVPKKKKRARLR
                     SPSEDEDLAPPPPPMKTIRLERPLVQNGETMEWNILDDARANGLCVAWGVGVVDDLPG
                     SVPGTMTPGAAGMSGLTEEGMEIDGSPVAGSSTGGVLGIGFADEDPEEIARKLEEKYG
                     DKKKTKKKKRPTDYDLEDPFIDDSEIMIDAPTHYARPAREGFFVHSGPLQLMKESPLK
                     KRNVSNKPKSNQAKSKGAPSSPEPKAPRTSLAASLLARIRAREGLRDPSSHEDIQDGP
                     ISVTPNLDTAGGNDGDDNNDVLWQSLFQRDLEKQPPVDRVMFRTASRHDKYLPPYPAV
                     PQEVARALLALRLESLEYDWDHANRSKFPEHLKPSLKRASTIAYQHDVFDVFDHTSED
                     KGFAICLQSVYPYNVFTLRKLVTKLIYEGYLKWLQDCEDEGIRQFKEEIDKDSAMWIE
                     KYETSKRDWEVEVAAWDEKHPFGSHISPPLIDVTDPSSSAQPAPKPEDIRPPEPQRRF
                     VWTSEMRDIFWQLIENLRVTTELIKKGADWHAAGAKNGKEWTEQGLKSRLYKKIVDIF
                     PEGYTNNNIISRELTKLKKRKEEAQKKSDDTKKPGVSKEEEPEGVKSENASKD"
     gene            complement(602363..603079)
                     /locus_tag="CNL05755"
                     /db_xref="GeneID:36393130"
     mRNA            complement(join(602363..602837,602902..603079))
                     /locus_tag="CNL05755"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658841.1"
                     /db_xref="GeneID:36393130"
     CDS             complement(join(602493..602837,602902..602919))
                     /locus_tag="CNL05755"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514671.1"
                     /db_xref="GeneID:36393130"
                     /translation="MYVSSIVHFLLSVAPKIDNVDISEHDSVYYFATFFFRNLEDVEQ
                     QAIIDFYDEKVHRMASLPACFSLTDMDGYRACGRRPERIFGRNKTSSSKCRRLFIPKQ
                     TIPRNAPTRRWCNPYAVE"
     gene            603285..606089
                     /locus_tag="CNL05760"
                     /db_xref="GeneID:3254796"
     mRNA            join(603285..603611,603723..603828,603885..604344,
                     604401..604686,604749..605280,605334..605789,
                     605841..606089)
                     /locus_tag="CNL05760"
                     /product="carnitine acetyltransferase, putative"
                     /transcript_id="XM_024658203.1"
                     /db_xref="GeneID:3254796"
     CDS             join(603336..603611,603723..603828,603885..604344,
                     604401..604686,604749..605280,605334..605789,
                     605841..606004)
                     /locus_tag="CNL05760"
                     /codon_start=1
                     /product="carnitine acetyltransferase, putative"
                     /protein_id="XP_024513872.1"
                     /db_xref="GeneID:3254796"
                     /translation="MIIPSSIHRIQSVHTPLRTLRTTSFFPVLAPAHPASITARNVSR
                     RMFAASTYRDNQLKTFENQSKLPRLPVPDLEASLEGYLQSLGPLLEEKYDKASLSNEV
                     EKRRLYVKDFASAGGLGRVLQERLKDLDHVSPNNWLNDTLWLALAYHTWRAPLLVNSN
                     WWLCFAEDPLSPPPPSLPSSTNESNSMGAQTATIKVPNPSPLTDVPAGGQGGGKEWLV
                     SGSIDPPVQYEKVVKKEWITPWQIRRAAWIARRFAEFRTKLERQEIKPDEIKGVKFCM
                     NQYANMFNLSRIPLPNCDAFSNPSPLSTHLSLLVDDYYYAIDIFSPPSSSADGVPEPL
                     PAGEIEKRFQAAVDDAKRRKQRGERAVEVGVLGADDRDNWTKNRERLLLLSPSNRSTL
                     TSLSTSLLALSLDPYTLPSVPPPSGDPLRLPAVDAQVRNCATGIDGGRNRWFDKAVSV
                     LVETSGRAGIMGEHSPVDALIPSIVVEYVLDKPVDESQFKTSTPVVVATGKGGEGWEK
                     LDWAVDETILQEIEQVKQKNQKLIDDSDASQLWWGEYASEWIKKTAKQAPDAYIQQAL
                     QLAWFLDQGYPTATYETASTRTMLHGRTDVIRSLTSESRAFVKAMTNPESTADERYRL
                     LSSACQAHNALTKRSSSGHGYDRHLMGLKVQLRAGETHPLFEDEVYAKSQEWKLSTSG
                     LSAGGKFTATGFGAAWPDGYGINYMAGPHLIKFGIESKFSCEKTSTQRFKHNIAQVLR
                     DMRAVCEAVGGVDASRAKL"
     gene            606188..609184
                     /locus_tag="CNL05770"
                     /db_xref="GeneID:3254830"
     mRNA            join(606188..606618,606673..606765,606825..606896,
                     606953..607071,607127..609184)
                     /locus_tag="CNL05770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658204.1"
                     /db_xref="GeneID:3254830"
     CDS             join(606207..606618,606673..606765,606825..606896,
                     606953..607071,607127..607138)
                     /locus_tag="CNL05770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513873.1"
                     /db_xref="GeneID:3254830"
                     /translation="MRHLTLIRPALQPIVPRTFARTLITTPPRLLATPSNDTGPQHVT
                     PGPPKSPNPLDTATQSAISAQKYPDYSTGPSAIDKASQILFLTEIVRGMWVVLEQFFR
                     PPYTIMYPFEKGPLSARFRGEHALRRYPNGEERCIACKLCEAICPAQAITIESEARED
                     GSRRTTRYDIDMTKCIYCGFCQEACPVDAIVETQNQEFSTETREELLYNKEKLLLNGD
                     RAEAEIAANLQSEHYYR"
     gene            complement(608565..610815)
                     /locus_tag="CNL05780"
                     /db_xref="GeneID:3254876"
     mRNA            complement(join(608565..609317,609373..609578,
                     609631..610815))
                     /locus_tag="CNL05780"
                     /product="hypothetical protein"
                     /transcript_id="XM_568111.2"
                     /db_xref="GeneID:3254876"
     CDS             complement(join(608709..609317,609373..609578,
                     609631..610789))
                     /locus_tag="CNL05780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568111.1"
                     /db_xref="GeneID:3254876"
                     /translation="MTPASDPAQPDTPPDGRVPARSPSSSPRSFGAPDGHGHGTQPSP
                     RQVPLPTSTSSPTLSPRSALSYTLSFQNASPSSLHALEHENFPPILEGNAIGNGIDAE
                     DGDLSAPFESIPLSSTPPREVPTVPLPSSPREMLSPKSVKKRRSWGGFGMSSDGHQTA
                     RGELPEHPPPHSSQSAEPLPSTHDGHNGQGIPGRASTATPPRRAAPPPHPFPWPIPTS
                     PRPSSSKRLSTVSNASNGTHATQASQGSTSANPSHSPGQTHQHTPALGAKGVSTFEKV
                     ISHTRPSWLPPKDRIEDVTHLHQWEDMMRHAREHEKVLAKQAEIRRLEKEKRLTAEAP
                     KWEKLLSDEKDFSAKKVKENEELRKLWFEGVPSHLRGKAWSMAVGNPLALSKDIYKTY
                     LARARKGLATNRFPPDLLKTIEGDMDNTLVTLKVFTRGSPLRDDLRELICAWLVFRSD
                     EGLGYAPYINLLCAMLLLASPPPTAFLTLLNILSRPLLRAFFTPLSPEISAYYRILEN
                     LQADRYPKIYANCKALGVGVPENWFRSLLVEQVGFESSCRLWDQIMLDGDGFVFRAAL
                     AIFGYLEPRLYYPDKQEVLSVLEGHNPASLAILQRERERAKLRGETFVQEGIDGTLTA
                     FGLDEGKLFGMIESDGWREKDFERLVMREMPDY"
     gene            611160..612172
                     /locus_tag="CNL05790"
                     /db_xref="GeneID:3254835"
     mRNA            join(611160..611609,611692..612172)
                     /locus_tag="CNL05790"
                     /product="hypothetical protein"
                     /transcript_id="XM_568112.2"
                     /db_xref="GeneID:3254835"
     CDS             join(611176..611609,611692..611830)
                     /locus_tag="CNL05790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568112.1"
                     /db_xref="GeneID:3254835"
                     /translation="MPTMTSPYSSYPQTPQSNPHSHTHSPNLLNLPYLQPQTSGSSSS
                     LLEAVVGRPQPRTPPTAYASQLATQVTPVSVSRPPPAVYPHRQGPGSDAGAGHGSTEP
                     STSASSGSHGESDWDMVSKASGVNCDGQSEEAVKDLEQKVEKRRSQLPRLESQLAELE
                     AQIKAAEERIARAQSVGSKESVAQAQTGQR"
     gene            612305..>613668
                     /locus_tag="CNL05800"
                     /db_xref="GeneID:3254769"
     mRNA            join(612305..613034,613117..613293,613404..>613668)
                     /locus_tag="CNL05800"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658205.1"
                     /db_xref="GeneID:3254769"
     CDS             join(612541..613034,613117..613293,613404..613668)
                     /locus_tag="CNL05800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513874.1"
                     /db_xref="GeneID:3254769"
                     /translation="MRIYHPLVPLLFAVPSLGSLFGSDSSSTTSASSSSSTTSSSATS
                     DEVTFLQTLQAAEISSMSCLITLVNMTTSSLGSCLSLTSLASLISNPSSSSVSSAGQG
                     FSDQLNTYLGTVCSSTCSESDLLDGKSQLAAVCDTNNTLVSVLDAVLDNYSSSYRTLA
                     CQVYYNGTSELCLPSTLNTSTTANSYTFFDALVAGSSSDLETYQDSVFTQAECTGCMY
                     EMFKAAQYTIPSIRGQSLTETFANHLKNDCPSSSGDNSTSSIDWSDVDDQQIPDSLEV
                     SQSTQVTTSAAVGRQVEVGMVGVLGVVGMGAIWIL"
     gene            613853..615839
                     /locus_tag="CNL05810"
                     /db_xref="GeneID:3254922"
     mRNA            join(613853..613996,614132..614246,614313..614377,
                     614441..614511,614578..614662,614734..614838,
                     614896..614982,615038..615147,615212..615839)
                     /locus_tag="CNL05810"
                     /product="expressed protein"
                     /transcript_id="XM_568114.2"
                     /db_xref="GeneID:3254922"
     CDS             join(613914..613996,614132..614246,614313..614377,
                     614441..614511,614578..614662,614734..614838,
                     614896..614982,615038..615147,615212..615585)
                     /locus_tag="CNL05810"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568114.1"
                     /db_xref="GeneID:3254922"
                     /translation="MARLALLASALLATAAYAAKSNWGEACAQANTHLNQDNYELVTD
                     CNSLTYCADNGTCAWKGCRKDTYPFGYNDYSFDQLPPLCPTGEFCPDEGDHCLNQVPV
                     GSSCQKDRDNECQPPPNWKQLNGYLNSNGSICLDYTCYYANVTVGQTCVNDNTVYTAY
                     KDDGSAYAFIVSRDNCANGHYCDATELVCYKSKAFGATCSGNKECLSYNCEDNGKCGK
                     AANDVVHPPAWQYVLVGLGIVILIVAVMTGLWFMHRRWRNEKQVMLEQYYNEQIAYRQ
                     SIMSMSHAKQSLLSLPPNTTAGAARASLYGDTAWTSGTDYQSVPLPPNLRRDSTSGWS
                     HDSDRVGHDSEVFLMQNGRYADAPEVSKYR"
     gene            complement(615847..617722)
                     /locus_tag="CNL05820"
                     /db_xref="GeneID:3254832"
     mRNA            complement(join(615847..616220,616323..617336,
                     617398..617722))
                     /locus_tag="CNL05820"
                     /product="NADPH-adrenodoxin reductase, putative"
                     /transcript_id="XM_568115.2"
                     /db_xref="GeneID:3254832"
     CDS             complement(join(615885..616220,616323..617336,
                     617398..617667))
                     /locus_tag="CNL05820"
                     /codon_start=1
                     /product="NADPH-adrenodoxin reductase, putative"
                     /protein_id="XP_568115.1"
                     /db_xref="GeneID:3254832"
                     /translation="MIPRSARLRLPSSSLSAHARRRLYTPVRPPLKLAIIGAGPSGFY
                     TASRILSLIPPTSPEGQKLEVHMYERLPTPYGLVRYGVAPDHPEVKNCQHKFDELAHD
                     SRFKYFGNTLFTSHPSSTFSPSPTEKAPSYTYPHALRLSFSDIMPYYSTLILTYGASL
                     SNPLNAVPGSSSNSDPLTGVYPALALVSWYNSHPAYADLPVNLEKVKQVSVVGQGNVA
                     LDVARMLLKPVSSLAETDLSEEVLDVLSESSVEKVRVVGRRGPGQVAFTTKEFREMLS
                     IPDVGYAGIDPALMEYAKENIEKGNGERMKKRLLQLMDKTKQQDGRKIFELDFLKGPK
                     SFLPSTENASQVGEVEWNLNQLETRPATESQPASIVAKSTGETIRTPADMVVESVGYR
                     SEPLTGPGHEWDLPFDIARGRVSNLNGRVIAEEGGFVPGVYAAGWAARGPVGVIATTM
                     NDAYALASTILDDIYAPTTSSPAACMLNSRPYAGIPEKVQNAAMEGKIVVDLEGWAKI
                     DKAEVERAKRMGSGKEREKFRRVEDMLAVLQ"
     gene            617971..621762
                     /locus_tag="CNL05830"
                     /db_xref="GeneID:3254880"
     mRNA            join(617971..618194,618262..618348,618405..618525,
                     618584..618891,618944..619351,619416..619676,
                     619744..620066,620122..620291,620353..620474,
                     620536..620817,620878..621007,621059..621078,
                     621137..621227,621291..621354,621409..621762)
                     /locus_tag="CNL05830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658206.1"
                     /db_xref="GeneID:3254880"
     CDS             join(618093..618194,618262..618348,618405..618525,
                     618584..618891,618944..619351,619416..619676,
                     619744..620066,620122..620291,620353..620474,
                     620536..620817,620878..621007,621059..621078,
                     621137..621227,621291..621354,621409..621685)
                     /locus_tag="CNL05830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513875.1"
                     /db_xref="GeneID:3254880"
                     /translation="MGDPALSQLIDMGIPVGRARAALKRSKGDAMSAAERVFAGEFDD
                     IPSDDEGEDGTEGSSSVQVKADPVVIDNNEDDAMDEDEMGHEDEEDDYDDMNDGNFDY
                     DEDMSDGEQMASDPYAGIFFSKNRVEEIIEPIETEETMTISIPGGSTVEVKILGRGEW
                     MSGCPEGGEQSFLFQLYNTLEEGGMPCSAGCGHSFTRKKQDFFCLFPKFPQYTTYLNS
                     IIRPNCPQCHQITCLACGERVDRPSALHSQHSKDKAPMTSAPSIPSETTQEALLHCPN
                     LQGVILGVGLHMIEKTFSQGRDHNSCAEKSGRTPPSKKRKTDDNPPFLKGKGAVKGTG
                     YAGNVQEDRTGQVAAEKAQKKADQKVATILQQVQHFLPNPHRAGGPATSDYLVHPTAL
                     AHLRRRSTFMNDLLRNDSLFDMSQRGDIYRALFDWLEIVSNNESLASMLGMPQMRPAK
                     SVPSPTVSNSLIVTYEGAPSPRELLENIVLQAKAALKGLEGIQPAQIEGIALTEEELR
                     TNIKEMEKKEAERIEKESLDENSVLKAFCLRIIKSAEIIDKRLVETKGKAFVQRMKEQ
                     LPRIDESGVQIEENPVENGTDEEIIKIYEEWATRARFQYVDLRAGSDITGAPSYKHAY
                     STLIAGIELNNAPKRSLAIAKELAILTTSLPVAWHSSVFLRVDEARVDVLKAMIIGPE
                     GTPYENGCLLFDIFLPLEYNQRCPLVKYMTTNGGKWRYNPNLYADGKVCLSLLGTWQG
                     PGWIAGQSTLLQVLISIQSLILCEEPYLNEPGWANMSGSAQSKAYNANIRRMVLADAM
                     ANNIKSPPHPFENEIKTHFRLKAKAIRQQIEKWREMDDSKEVEADYWGGAHTSAASAL
                     SNRSFEAAAKEVLRLLDELEGKVQPVPKAEEEARIKSPKEEKKKSSSVIWNKMIGGSK
                     KKSKKDV"
     gene            622062..623850
                     /locus_tag="CNL05840"
                     /db_xref="GeneID:3254975"
     mRNA            join(622062..622290,622348..623850)
                     /locus_tag="CNL05840"
                     /product="hypothetical protein"
                     /transcript_id="XM_568117.2"
                     /db_xref="GeneID:3254975"
     CDS             join(622184..622290,622348..623689)
                     /locus_tag="CNL05840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568117.1"
                     /db_xref="GeneID:3254975"
                     /translation="MQSPLKGTGRPGIITSFDETRAIKRRRGRNVDVIGTMPTPRSHQ
                     LPTPETVRRPSKSEVSQDEPTLSSQLPTPQTQRHRRHASPKSGDAFPASPSGQTTFYL
                     AANHPTSRAEISRRRPGLMFAQQMGLISSSISRGVGVGMGGHTIGQQKVDLVQATSHE
                     DNPFLVSKADEQTMDVPVGLASPGAITTHRPGDLSSDTEDDAEPLCSFTLLKQSPART
                     QPSSSIQPSPVYPASGLLSPPPTKPAPRIADPNSKTVLTRAEHAAKIASRRKAEERRQ
                     MLDVEHNPFLIKPGEPSTRRAGPIVDEDQPTVTYLFRGAKRVFANPLWNSKMPFPRAE
                     LPPEDDDFEPHPLPKPKLLWPEGPSPSKRINLEKVTRSSTPSPSRIAGLSPESSPVAT
                     PTILRRFGGTSLSTDSPNPLGVGQGAFTDDENDLNHQDAEGESDFEPEEEQEELPVRR
                     GLLFGGTGMKRDRPSSPGGTRTVKKLKGAERL"
     gene            623975..625070
                     /locus_tag="CNL05845"
                     /db_xref="GeneID:36393131"
     mRNA            join(623975..624180,624267..624324,624404..624437,
                     624517..624592,624650..625070)
                     /locus_tag="CNL05845"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658842.1"
                     /db_xref="GeneID:36393131"
     CDS             join(624067..624180,624267..624324,624404..624437,
                     624517..624592,624650..624724)
                     /locus_tag="CNL05845"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514672.1"
                     /db_xref="GeneID:36393131"
                     /translation="MPITETTYPPSPSTIDSSGSPTFLIFYSDAQDGRMWCSHCRDVE
                     GVVKSAFQGGSKPRGIITYIGNYTQWKTPSHPARSAYGVKSVPTIIKLENGKETGRAT
                     KMEILNSSKFEEFLGV"
     gene            complement(625071..627244)
                     /locus_tag="CNL05850"
                     /db_xref="GeneID:3254940"
     mRNA            complement(join(625071..626702,626766..627244))
                     /locus_tag="CNL05850"
                     /product="hypothetical protein"
                     /transcript_id="XM_568118.1"
                     /db_xref="GeneID:3254940"
     CDS             complement(join(625441..626702,626766..626949))
                     /locus_tag="CNL05850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568118.1"
                     /db_xref="GeneID:3254940"
                     /translation="MQLPATNNNTNEKITSDDIDGFEIVTQMVTEKSATPTPVTETET
                     LVSEARRSNKDDTPDTIIEGAMNLRIGSPELDNNDDQARPRHRGFDHHHGHFYRPRDF
                     MGPSPGFMPFHFDGSMPPHPAIFHRGPPGLTFDGPFPPEFAFGCGFGKHHKHGKHGGK
                     FAKRINGTGHKHRHHRAYSPPSFEEVKAESGLDSHKKYMKDFFGPRGRHDRRHHKYAF
                     DDEVAAQKPAEKQATTSESDSASPSVSDSETYSAATISEGEKKYAEYYAGMRGGLAFG
                     GRGRGKAQHRGMKGMGHGKGRYMGPMGMDMRAIPGMGFDGEHPPPPPPFVPEFEMGMG
                     KGMGKGMGKGKGKGKGMGKGMGMGMDMGGRHCPRGFRGKGGLRGMHGCSFGPMSGMGP
                     DAFFGRGEGGPKHMPMHGRHHCGPPPPPEFMSNEQGPRAPFLPHPNHFGRHHDHHGRR
                     GFGGRFAQFDYEMRGTSPSSATSPAPAAAAA"
     gene            627664..629847
                     /locus_tag="CNL05860"
                     /db_xref="GeneID:3254976"
     mRNA            join(627664..628153,628281..628668,628719..629150,
                     629208..629847)
                     /locus_tag="CNL05860"
                     /product="Succinyl-CoA:3-ketoacid-coenzyme A transferase,
                     putative"
                     /transcript_id="XM_568119.2"
                     /db_xref="GeneID:3254976"
     CDS             join(627769..628153,628281..628668,628719..629150,
                     629208..629688)
                     /locus_tag="CNL05860"
                     /codon_start=1
                     /product="Succinyl-CoA:3-ketoacid-coenzyme A transferase,
                     putative"
                     /protein_id="XP_568119.1"
                     /db_xref="GeneID:3254976"
                     /translation="MIRTALPTTRALARSRVLHRAAALARPGAITASRYINTEPVKGS
                     PSDLKSVPSQGTHGRSRITPSEKSKVWPDAKTAIRDIKNGQTILSAGFGLCGTAETII
                     KAMRESDLKDLTVVSNNAGNAGTYGLSPLITSKQIKKMILSYLGTNKGLQDAYLSGEI
                     EIELCPQGTIAERLRAAGAGMPGFFTRTGAGTDVETGGIPQKWSKPDADGKQTIAIPG
                     VKKDTQVFDGKKFLFEPAIHGDVAVFRAWKVDKAGNCVFRYTTRTFGPLVARAAKLSI
                     VEAENIVEIGELDPMEIDLPGIFVDRVVPATEDKQIEIFTTREENENVSPSSGEETSV
                     NKSVGQAQREKIAQRAGKELYDGAYVNLGVGIPVLAANYLPDGMKVWVQSENGILGMG
                     PYPTKEEVDADIINAGKETVTLVPGASVFDSSESFGMIRGGHVDVSILGAMEVSANGD
                     LANYMIPGKLVKGMGGAMDLVSNPDETKIVVVTTHTDKHGRPKIVESCKLPLTGVSVV
                     SRIITDLAVFDVDRTGQNGGGLELIEIAEGVSLEEVQEKTGATFKVREPLGRF"
     gene            complement(629694..630996)
                     /locus_tag="CNL05865"
                     /db_xref="GeneID:36393132"
     mRNA            complement(join(629694..629862,629918..630069,
                     630128..630773,630825..630996))
                     /locus_tag="CNL05865"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658843.1"
                     /db_xref="GeneID:36393132"
     CDS             complement(join(629946..630069,630128..630773,
                     630825..630936))
                     /locus_tag="CNL05865"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514673.1"
                     /db_xref="GeneID:36393132"
                     /translation="MDAKSLLRAKKAEAKINHPYATYNVSGVLRCSICAVPVKQWDAH
                     LLTKQHRTSVAREKAEREKIERAKRPRPESEVIAGSSSKRPKVTQQPQPHSGEGPYDG
                     NDGPSGLPAGFFSAKNRPAPEPQSEAPPSPSTAPGPAIAARTGDAELDDFLASLAEDS
                     SAPDPSAPAAPPTAISQAQANRAAKRKTTYKQDIIPGQASYEAAPVRIVQAGEEQQEE
                     QKEEPEESEAERKERLQREEREDIMARLEEEERAQEDADSRVMALKQRMEMLRKKREA
                     KGGIKGKGAAKDASLNA"
     gene            631367..634048
                     /locus_tag="CNL05870"
                     /db_xref="GeneID:3254850"
     mRNA            join(631367..631675,631734..631877,631933..632536,
                     632589..632617,632665..632789,632841..632847,
                     632897..633363,633414..633417,633482..633548,
                     633602..633697,633753..634048)
                     /locus_tag="CNL05870"
                     /product="meiotic recombination-related protein, putative"
                     /transcript_id="XM_568120.2"
                     /db_xref="GeneID:3254850"
     CDS             join(631448..631675,631734..631877,631933..632536,
                     632589..632617,632665..632789,632841..632847,
                     632897..633363,633414..633417,633482..633548,
                     633602..633697,633753..633877)
                     /locus_tag="CNL05870"
                     /codon_start=1
                     /product="meiotic recombination-related protein, putative"
                     /protein_id="XP_568120.1"
                     /db_xref="GeneID:3254850"
                     /translation="MLESISCLPAQLQPYFIWLSALTLGEIWLTIYNPPNRVNLSIAF
                     IIISFKLPTWARKYNSWKNERKVVRFGYPVPKEASKQWEGRVIENPNLLSHLEDESLL
                     PPETGLSGRKREHITCYDPSTGYHLNTLPLHTAEEVSLQISKANSAFFAWSRTTFAQR
                     RHFLRNVRGWVLRDMDYIVQVACRDTGKTNVDAVFGEILTSLSKIDWLLKHGEKTLSP
                     QKRAGNLLLAHKVSKVHYHPLGTVLALVSWNYSFHNLLSPIIAALFAGNTIVVKCSEH
                     VAWSSMWFIGGIKECLKICGLDPEVVQLVICLPGGAEKVTRNPIFKHITFIGSEPVGK
                     KVAAAAAEIMVPTCIELGGKDPAFILPGTDLDFFASTWMRGAFQSAGQNCIGIELFLV
                     HRSQYSRFLEILTPRVQALRPGHDVGSLISHAPISKLQSLLASSISSGARLLAGGHPY
                     VHPLYPQGAYFEPTLIADVTMDMAVAKEELFAPVMTVVPYDDVNEAVEWLNKGKFGLG
                     GGVYGKDKKECRRVAEKLECGMVAINDFGVFYLNQAMPFGGVKASGHGRFGGEEGLRS
                     LCSVKAITEDRFFSWIRTTIPRPVDFPLPEDGTAWQFLKGLVGLAYAPTTPGRVSGLV
                     NLVKAST"
     gene            complement(632908..635377)
                     /locus_tag="CNL05880"
                     /db_xref="GeneID:3254817"
     mRNA            complement(join(632908..633397,633469..634099,
                     634149..634380,634431..634775,634831..635134,
                     635182..635377))
                     /locus_tag="CNL05880"
                     /product="cysteine synthase, putative"
                     /transcript_id="XM_024658207.1"
                     /db_xref="GeneID:3254817"
     CDS             complement(join(634003..634099,634149..634380,
                     634431..634775,634831..635134,635182..635319))
                     /locus_tag="CNL05880"
                     /codon_start=1
                     /product="cysteine synthase, putative"
                     /protein_id="XP_024513876.1"
                     /db_xref="GeneID:3254817"
                     /translation="MVVSRSASILRSVCPTFISSRAYATAAPAFGKPVNGFVGAIGNT
                     PLIRLSRLSEETGCNILAKAEFMSPGGSIKDRAALYLVQDAEEKGLIRPGGTVVEGTA
                     GNTGIGLAHVCRSKGYKCVIYMPDTQSQEKIDLLRMLGADVRPVPAVAFDNPQNYNHQ
                     AARYAASLENAVWTNQFDNVANRNAHIVSTGPEIWEQTDGGKLDAFICSTGTGGTLAG
                     VTRYLTEKSNGRVEAWLADPPGSVLFNLVENGEIKREGNGSITEGIGQGRVTNNLAPD
                     LSLLSGAIHVPDSASINMIYRLLDEEGLYVGASSALNVWSAVELAKRKGKGSTVVTVL
                     CDGAYRYQARLFSRVWLESKGLVSHIPDHLQKYIVLP"
     gene            complement(636214..638623)
                     /locus_tag="CNL05890"
                     /db_xref="GeneID:3254997"
     mRNA            complement(join(636214..637185,637243..637533,
                     637581..637702,637748..637821,637869..638623))
                     /locus_tag="CNL05890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568122.2"
                     /db_xref="GeneID:3254997"
     CDS             complement(join(636359..637185,637243..637533,
                     637581..637702,637748..637821,637869..638033))
                     /locus_tag="CNL05890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568122.1"
                     /db_xref="GeneID:3254997"
                     /translation="MVTSVVSSVNDSFDGLAIAPEADVVIIGAGLAGLCAARSLHEAG
                     KRVVVLEARGRVGGKTLTVTSKSGGRVDVGGAWVNEHTQPEVCKLNKEAGNILFKQRV
                     LGTTCWELSEDRQLRYYDDGGVGDNSPIPLEGEELEDYNRIFKELDRLSRTVSLKNPN
                     DTPGAVEYDSVTVANWLDQMDAGQISRQALIPLVRALVGAEMHETPLFYFLHYAKTAK
                     GFFDLIAADETGGQFQRTRYGNQTMSTWIQNHILPPGAVKLNAAAHQIIQSPDGESVR
                     VITRDGRQFTGRRVICSIPTPLYPNIVWQPSLPVDKTLLVQRSFLGTYTKVVLLYEKA
                     WWLEAGFSGFALSSEWPVSLVFDTCDGWYGSDDPSIRPRQHSLSCFVVAANGVAFSEL
                     SRDRREQVVKQQVARMIGSPELVNNTVEVLEFQWIKEEFSQGAPCPVTSTGAFTLYGD
                     SLARPHGLIHFAGSEFSDVWKGYMEGAIISGRKTAKEVLELL"
     gene            <638546..639987
                     /locus_tag="CNL05900"
                     /db_xref="GeneID:3254930"
     mRNA            join(<638546..638605,638662..638720,638817..638851,
                     638903..638979,639035..639436,639491..639573,
                     639622..639987)
                     /locus_tag="CNL05900"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658208.1"
                     /db_xref="GeneID:3254930"
     CDS             join(638546..638605,638662..638720,638817..638851,
                     638903..638979,639035..639436,639491..639573,
                     639622..639661)
                     /locus_tag="CNL05900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513877.1"
                     /db_xref="GeneID:3254930"
                     /translation="MSSKKTHIDQIVLIGDSLTQFALGEKGFAGQLANHFQRQFDVVV
                     RGFSGYNSRWVLEMARLFMPELKRIRLAVIWLGTNDALLPPEPRAIDPESYKANIAKI
                     VSLVPLSAKVILVSPPPYSLKGKAKDLGLEYYPGVKLDRDPAHSLLYNLKARELADNL
                     NEAGDRKGNVAFCDTRTSMERAALEESPDDLEEGLFKYLRDGVHLSPDGYQCMYETLL
                     HVIKSRFPELGQEPYFFADYETVDHTQPERYFG"
     gene            complement(640671..643545)
                     /locus_tag="CNL05910"
                     /db_xref="GeneID:3254803"
     mRNA            complement(join(640671..641037,641093..641940,
                     641999..642145,642205..642273,642327..643545))
                     /locus_tag="CNL05910"
                     /product="amine oxidase, putative"
                     /transcript_id="XM_568124.2"
                     /db_xref="GeneID:3254803"
     CDS             complement(join(640678..641037,641093..641940,
                     641999..642145,642205..642273,642327..642516))
                     /locus_tag="CNL05910"
                     /codon_start=1
                     /product="amine oxidase, putative"
                     /protein_id="XP_568124.1"
                     /db_xref="GeneID:3254803"
                     /translation="MPPPVTDDGYHWTRSTGMQQGVLRCKGVVDPPSRIDNSFLEYDV
                     VVIGAGYAGLIAARELVQRGHSVALLEARDRVGGRTWTAEVDGYMYEMGGTWVTHWMG
                     YLQKEMERYGMEDDLITTRLKGAGDDFYTLNVPGAKPRKMSHAEAGALAARAWDIFVN
                     VDGNGGRTVCPLPHAPFNNVRTTKADVEAIDQLSAVDRLEQIGHLLTNEERGVLEALL
                     LHISGGTLETTSTWDIVHSNALQGHSSVNFEEVWTTYKLREGQSGLARAMFDEACIAG
                     LDYAFKTPVDTIRDLRNFVEIHTTTGSTFRATRVISTIPLNVLHTIKFDPPVSPTRAE
                     AFRLGHVNHMSKIHAEVKGDIASWCGLTYPAKLMFGYSDGLYPNGNTHIVTFGADETD
                     DFVPEKNPEQVIEAMNRIRPVDVQRMVFHNWNTDPWSMAGPAWYRPGYATKYQEELQS
                     RHGNIFFASADWARGWRAAIDGALEQGFCNAQSVSRELQGRHWKRGYFLPQGDSVSDS
                     IPHVGAMKGGVNGKDGVNGLSNGVNGFHI"
     gene            643454..644395
                     /locus_tag="CNL05920"
                     /pseudo
                     /db_xref="GeneID:36393133"
     gene            complement(644533..645834)
                     /locus_tag="CNL05930"
                     /db_xref="GeneID:3254924"
     mRNA            complement(join(644533..644658,644712..644868,
                     644923..645217,645270..645340,645418..645593,
                     645645..645662,645718..645834))
                     /locus_tag="CNL05930"
                     /product="L-xylulose reductase, putative"
                     /transcript_id="XM_024658209.1"
                     /db_xref="GeneID:3254924"
     CDS             complement(join(644631..644658,644712..644868,
                     644923..645217,645270..645340,645418..645593,
                     645645..645662,645718..645770))
                     /locus_tag="CNL05930"
                     /codon_start=1
                     /product="L-xylulose reductase, putative"
                     /protein_id="XP_024513878.1"
                     /db_xref="GeneID:3254924"
                     /translation="MSPLTPKTAPALADNVLDLFSLKGKVAVVTGASVGIGLAAATAF
                     AEAGANVVLLYARSKHTEKTASDLAARTGVKVKAYQLDVRDYDATQRLVENVVKELGR
                     LDIWVANAGIPQDDTILDGNRKHWEDIIAVNYTAVVYQAQIVGKAFKKQGNGSFIITA
                     SAAGIANIRPTDQGVYNSSKAAVIALARSLAQEFKDFARVNSVSPGYMGDAQGAPESE
                     ITNALTRQVLNRTGEYRELAGAYLYLASDASTFCTGTDLIVDGGYHC"
     gene            646085..647150
                     /locus_tag="CNL05940"
                     /db_xref="GeneID:3254726"
     mRNA            join(646085..646455,646508..646577,646629..647150)
                     /locus_tag="CNL05940"
                     /product="Maltose O-acetyltransferase"
                     /transcript_id="XM_568126.2"
                     /db_xref="GeneID:3254726"
     CDS             join(646189..646455,646508..646577,646629..646933)
                     /locus_tag="CNL05940"
                     /codon_start=1
                     /product="Maltose O-acetyltransferase"
                     /protein_id="XP_568126.1"
                     /db_xref="GeneID:3254726"
                     /translation="MPPAPAPHLTNKLIPPPEEGEDPTQLSLMISAKPYLALDKYLDR
                     LRNRGAIKLDEITRTPDHEKRMELWKEFANIGENVSITQRFFCEYGFNLHFEGENFIA
                     ADCTFVDVCPIYIGKRTMIGPNVRIYTPDHPISPEARAGLTGEEWGKIVRIEEDCWIC
                     GSAIILPGVTVGKGSTVAAGAVVTKDIPPRSLAMGNPARVVKKILEDGTIVKA"
     gene            complement(646965..648284)
                     /locus_tag="CNL05950"
                     /db_xref="GeneID:3254938"
     mRNA            complement(join(646965..647717,647791..647920,
                     647990..648284))
                     /locus_tag="CNL05950"
                     /product="hypothetical protein"
                     /transcript_id="XM_568127.2"
                     /db_xref="GeneID:3254938"
     CDS             complement(join(647475..647717,647791..647920,
                     647990..648042))
                     /locus_tag="CNL05950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568127.1"
                     /db_xref="GeneID:3254938"
                     /translation="MSSIPFHAVDTKGKVLGDNFAPAAAVILPANAKTLYISGVVGEN
                     EDGSFGDFRTQVFLIFDRITEILLNASPSYKSAGNAWKHVFEITAYHVGPLPEHLPIE
                     LEAVDKYLKGAHPTWTSAAVEKLFHDEQLYEVHVKAIVP"
     gene            648269..649305
                     /locus_tag="CNL05960"
                     /db_xref="GeneID:3254932"
     mRNA            join(648269..648888,648947..649305)
                     /locus_tag="CNL05960"
                     /product="hypothetical protein"
                     /transcript_id="XM_568128.2"
                     /db_xref="GeneID:3254932"
     CDS             join(648410..648888,648947..649295)
                     /locus_tag="CNL05960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568128.2"
                     /db_xref="GeneID:3254932"
                     /translation="MSADFFIVSCTQLKSILLPSRTSLISQLSHTPQSDCQTPYLPNK
                     MSESFVKTLQDLTFHPYSSAPVATTLQHDHLKIQAPKLVDWWRNPEPVKVNRKDGPFA
                     HIAIDGSRPFQVEIWLRSGLKGLYDQACLVLHGGDLADTSAHWLKTGTETFDERQWIN
                     AVVAAPWCDVSAVPSDRELSSEAGGDWIYLRLVKELSITGHTILIKWARQSIVDTDNP
                     PTEDELANLREVQAFGVKENGERSHDFNWSIGVMVSGLMNDEGAFAEFKGFKFKYLD"
     gene            649499..651243
                     /locus_tag="CNL05970"
                     /db_xref="GeneID:3254728"
     mRNA            join(649499..649918,649970..650316,650373..650576,
                     650627..651005,651051..651243)
                     /locus_tag="CNL05970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568129.2"
                     /db_xref="GeneID:3254728"
     CDS             join(649870..649918,649970..650316,650373..650576,
                     650627..651005,651051..651148)
                     /locus_tag="CNL05970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568129.1"
                     /db_xref="GeneID:3254728"
                     /translation="MPINVALLGGGIFAVDAHLPALAKSGTLASLEAVWSRSESSSTK
                     AAEAWKSLTGQEVTKYSETGCDNLDKLLSREDIEAVIIALPILSQPDIIVRALKARKH
                     VLSEKPVSQDVTSATKMLKDYQENYQAQGLVWRVAENWEVEPAHIFAAQALKAGHIGN
                     LNTFSISSVLFVDNEDNKYFETEWRKRPQHQGGYLLDAGVHNAGVLRTVLPSPITHLS
                     AHTALNNEHLPPYDWLSVITRSEPNNIHGQILIDYGARGREPMWELRLTGSDGEIYSE
                     DINDDGVDSIKVQVRSGKFGRTNREIKIFPKTGVYEEQRRFFEAIAGKPDEYGSVQGA
                     LNDVALIQAALTSNGNEVALNILK"
     gene            complement(651239..653917)
                     /locus_tag="CNL05980"
                     /db_xref="GeneID:3254784"
     mRNA            complement(join(651239..651892,651943..652203,
                     652268..652316,652368..652524,652582..652716,
                     652769..653420,653486..653505,653573..653583,
                     653651..653917))
                     /locus_tag="CNL05980"
                     /product="expressed protein"
                     /transcript_id="XM_024658210.1"
                     /db_xref="GeneID:3254784"
     CDS             complement(join(651275..651892,651943..652203,
                     652268..652316,652368..652524,652582..652716,
                     652769..653420,653486..653505,653573..653583,
                     653651..653787))
                     /locus_tag="CNL05980"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513879.1"
                     /db_xref="GeneID:3254784"
                     /translation="MSGSTSSAPKTAGKARTKQGSLLAAVQLVPDGDKPYRRSRTGCL
                     TCRKRKKKCPEQYDDNSCLRCKAGGWKCIREEDVSGGSSRSQMTDSSPKARGSPATQQ
                     RQQQQQLQAHQHQIQHHQVAGTGPSQFHQLHDEVRSPSDGASSEQSTAAAATEAYHNM
                     DENSLSMAAHGAPTNPDNLVGNYRSNFLPDDIWMDQPLDAILSATAPTFDISFYGSLG
                     DPSAPDPFHFTPALDFDMVNNGSGSGHRDPTLFDNLPSELTLEHISSEEELLYDFYNR
                     YVLPAWSLTYPSKTRKAVIARYYEVTNAHRVTQLCRLAVAAVYITHLRRRASYQAGWV
                     GHSGLPMDYVPEKYLSLKVDAEEMVREAMLLVRSPKDLNITMEAHFWALSDLHMAVGS
                     FCDSSKAYAIMDLAEGLLALTYGLHPEVDFLSLNSYIPFYLRAFAMIDLNRSICQRRR
                     TFFAFLETPQMGASGFLNDGSHDQWFGLPAGLAVSFASLSNLVAHIRDPSCTLSPNDI
                     SSASKRIEANFKAYQSPFAVHDISFDRHPIAWAAELSVETEIWRHLGLLLLWRLVDQQ
                     SVLSTPMRDTVHLVINLLKSLQYVSTPRVESENNVIDFWSLNYTTPAFLIGTLLVDRD
                     DRAFCKRFLERLGGEKNLEDMIVALETTWAATDRSGQVADWFEECTRLDLAVTFF"
     gene            654085..655513
                     /locus_tag="CNL05990"
                     /db_xref="GeneID:3254984"
     mRNA            join(654085..654412,654466..654683,654738..654830,
                     654881..655183,655245..655513)
                     /locus_tag="CNL05990"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658211.1"
                     /db_xref="GeneID:3254984"
     CDS             join(654208..654412,654466..654683,654738..654830,
                     654881..655183,655245..655442)
                     /locus_tag="CNL05990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513913.1"
                     /db_xref="GeneID:3254984"
                     /translation="MMELPQPNTFVYRTVHQPEPAGTLQLKVDVYSPPEATDNESPIL
                     VYFHSGGLTAGSRQLNSWFPTWILDHALSLGFTFVIPDYTLLVPGNAHDLLEDVKVLT
                     NWLHTHLNKALQDAGLRDVRTEDIVVVGQSAGGYLAYLMSIHINPPPKAVAIFYGMGG
                     DFLSDMHIVPKKEKFQHWVPFLTDSRPFETLENRGREEGIILGCSTEDETRVQFFSWM
                     LQNAIFLDRLLGIPGISAELSIMPRAEREAYIIHRAGRKFLPQLLIGPDFPPSYLVHG
                     GADTAVLVEESRNVVRKLEEFGVEHIYQEFEDLEHGFDWHDCPRRPELDDVVPFLLRH
                     VNSG"
     gene            655821..658308
                     /locus_tag="CNL06000"
                     /db_xref="GeneID:3254898"
     mRNA            join(655821..656131,656193..656232,656305..656461,
                     656517..656683,656734..656834,656888..657012,
                     657066..657177,657232..657443,657491..657531,
                     657582..657668,657724..658051,658116..658308)
                     /locus_tag="CNL06000"
                     /product="GabA permease, putative"
                     /transcript_id="XM_568131.2"
                     /db_xref="GeneID:3254898"
     CDS             join(655949..656131,656193..656232,656305..656461,
                     656517..656683,656734..656834,656888..657012,
                     657066..657177,657232..657443,657491..657531,
                     657582..657668,657724..658051,658116..658206)
                     /locus_tag="CNL06000"
                     /codon_start=1
                     /product="GabA permease, putative"
                     /protein_id="XP_568131.1"
                     /db_xref="GeneID:3254898"
                     /translation="MSHQGEIRPASQLSVPVDVAGSDGGHSNKKATSSSTRIEIVGDV
                     QPDNEISAMGYTPQLKRNRGQLTIQTMLLSLFAVPFGISSGFYTAMIGGGPASLLWGF
                     ILVGCLQECVAVSLGEICSRFPTSGGPYYWSYALAPPGIRTMLSYVTGWLYMLAIWML
                     DLGTHYGTAILIAGAINIYYPDWNAPVWVTLLICYGLYVLSTLITWKGHRWVPMLDTV
                     NAVFTGICLVAIVASLLGIAAEGRRSASFVFTHYDWSYSGWGRGFTFCIGLLPGCFVM
                     CGIGFISSMSEEVAVPTKQIPRAMVIGIPMAVFSGLIFILGCLFTLPDVDKLLNAPGG
                     SPMPVILATATGSKAGGVALLSLIISNATIACVANQYISSRTTWSFSRDHALPKSRFW
                     SAVTEDSQPRNALIMSSVVQMLVALIGLGSSSAFNAFLNVGIIGVDLAFGMPIAISLW
                     SGRKLVKDAPWYAGTVGKVCNIISVLWVSFSLVLFSMPIAIPVDAVSANYAPAVLVFF
                     MGFSTLWYIFRARRVYKGPPSVDFLVSLDIPELSQREEQ"
     gene            complement(658834..660907)
                     /locus_tag="CNL06010"
                     /db_xref="GeneID:3254909"
     mRNA            complement(join(658834..659297,659352..659455,
                     659518..659628,659684..659824,659891..659983,
                     660048..660132,660211..660236,660312..660436,
                     660517..660674,660757..660907))
                     /locus_tag="CNL06010"
                     /product="expressed protein"
                     /transcript_id="XM_024658212.1"
                     /db_xref="GeneID:3254909"
     CDS             complement(join(659198..659297,659352..659455,
                     659518..659628,659684..659824,659891..659983,
                     660048..660132,660211..660236,660312..660436,
                     660517..660674,660757..660779))
                     /locus_tag="CNL06010"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513880.1"
                     /db_xref="GeneID:3254909"
                     /translation="MSAHGSAEAYEKYVQAGRLAAEAYYHALQLAKMNSDITLAELSE
                     AGDKYIQDRSFGQINDGICHPTTAQLDYIICNNALKSGNLLKADGSQLLKLQLGAHID
                     GYGAVVGGNFLLGESLAAKQLSKTATEVAKLVLDLIKPGTTNGDLVKKVDEYMRRTPY
                     RGVPGLLAHNHTQYDIQGPKEIDLFPSGDKQHEEGITFETGEVYTVEVWITDAKDPSP
                     QPAADLDKTLHQIPPSKDISSLSAEIKEAYNCITKKVGTFPFHTRVLGDSALVNAGDV
                     LEAADILATYPAFTLKDRSKAVAQSVVSFIVTIDGVHVLSAPILS"
     gene            complement(661207..664131)
                     /locus_tag="CNL06020"
                     /db_xref="GeneID:3254964"
     mRNA            complement(join(661207..661990,662047..662209,
                     662274..662491,662553..662689,662749..662831,
                     662885..663058,663112..663240,663296..664131))
                     /locus_tag="CNL06020"
                     /product="CAT1 catalase, putative"
                     /transcript_id="XM_568133.2"
                     /db_xref="GeneID:3254964"
     CDS             complement(join(661307..661990,662047..662209,
                     662274..662491,662553..662689,662749..662831,
                     662885..663058,663112..663240,663296..663813))
                     /locus_tag="CNL06020"
                     /codon_start=1
                     /product="CAT1 catalase, putative"
                     /protein_id="XP_568133.1"
                     /db_xref="GeneID:3254964"
                     /translation="MSARNLASGTPYRKNLSPANSSHFDAPSVSSTSDSVKSAYSVGY
                     TPVPTADRSYSGLLHGTLSKVFRKGGQEIIVSEEPVSFSSSKEDSESTRFNGCPYMNG
                     SIPQTPTPKSTSKSASVAVPVPLPPPSAARLKVQKQNDSIPRENGNALADDVGKLTVR
                     SYEKDRDLKSQEVIYTTSNGVPVPHPYAVQRAGVNGPLLLQDFHLIDLLSHFDRERIP
                     ERVVHAKGSGAHGTWECTDGLEDLCLANMFQKGTTCPLTIRFSTVGGESGSPDLARDP
                     RGFAVKFRTAEGNWDFVANNTPVFFLRDPAKFPHFIHTQKRDPATHLSGGDDSTMFWD
                     YLSQNPESIHQVMILMSDRGIPAGWRHMHGYYGHTLKIVNDNGDWVYAQFHLISDQGN
                     KFFTSEEASTKSPDWGQKDLYEAIGRGEYPSWTMKVQVMTQEQAEEAWEKKRINVFDL
                     THVWPHGDYPLRTIGKITLNENPSNYFAEVEQATFNPAHMIPGVEPSADPVLQARLFS
                     YPDAHRHRVGANYQQLPVNQSATPYATGNFQRDGAMAFYNQGGRPAYLSSIEPIKFRE
                     KRVNLNKVHGQFIGEAVSFLSEIRPEDFNAPRALWQKVFSDESKERFIQTVAGHMSTC
                     KRKEIIARQIAIFRQVSPDLGARLEKATNVRGYGSIEGMSFNGTHNGFGVKRGANGLR
                     QDADVVFNNGAPQKTQRAR"
     gene            complement(665268..668040)
                     /locus_tag="CNL06030"
                     /db_xref="GeneID:3254982"
     mRNA            complement(join(665268..665580,665639..665828,
                     665883..666221,666277..666480,666534..666783,
                     666832..666895,666943..667339,667468..667544,
                     667937..668040))
                     /locus_tag="CNL06030"
                     /product="protein-nucleus import-related protein,
                     putative"
                     /transcript_id="XM_024658213.1"
                     /db_xref="GeneID:3254982"
     CDS             complement(join(665516..665580,665639..665828,
                     665883..666221,666277..666480,666534..666783,
                     666832..666895,666943..667339,667468..667544,
                     667937..667997))
                     /locus_tag="CNL06030"
                     /codon_start=1
                     /product="protein-nucleus import-related protein,
                     putative"
                     /protein_id="XP_024513914.1"
                     /db_xref="GeneID:3254982"
                     /translation="MEDDREMRGDEPMAPEAGDRYRRDDRDRSRSRERHSSRRDEDRY
                     RSRRRSYSRSHSRSRTRSPHRHRHRSPSRSRSRSRDRRDRDRSRSRDRGERRSYREDR
                     HGGDHRGSGRPRSPRRGSGRYGAPRQDWEKSVDGPMNAPASEAEAHAKVSKRENRLYV
                     GNLAYDCNYKDLANFMERGGGKVVFSEVLTTPAGQSKGCGIVEFASQEEAQRAKAELS
                     DKAFFGRSVFIREDREETARFGAPPIPGKIGIALGEARHFLGNQQPHGFHGHGPAIPN
                     RNLFVGNLPLQASWQDLKDLMRQAGEVIRADIGFRPDGTPKGNGTVVFLNADDAKAAI
                     EMFNGFDWFGNVLEVREDRFAHGGAFRGRGGFRGAFFPRGGFGFRGGFRGGFRGGFMG
                     GGMGMGHMGMNAVAGGVGAGGAAAAGGRNFSNDLYADYNGPEGGEGMAVDQVAPSGLE
                     PIPAEPNQQILVRNLPWSTSNEDLVELFETIGTVTLAEILYSGGQSKGEGIVQFAETA
                     DAANASEKFMGWPYGGRALDVQFNPRWHEFSASAIKVPQA"
     gene            complement(668307..671450)
                     /locus_tag="CNL06040"
                     /db_xref="GeneID:3255036"
     mRNA            complement(join(668307..668581,668638..668715,
                     668769..668865,668919..668978,669034..669069,
                     669118..669230,669285..669311,669361..669436,
                     669491..669564,669616..669736,669788..669825,
                     669892..669991,670041..670138,670270..670513,
                     670576..670845,671337..671450))
                     /locus_tag="CNL06040"
                     /product="expressed protein"
                     /transcript_id="XM_024658214.1"
                     /db_xref="GeneID:3255036"
     CDS             complement(join(668411..668581,668638..668715,
                     668769..668865,668919..668978,669034..669069,
                     669118..669230,669285..669311,669361..669436,
                     669491..669564,669616..669736,669788..669825,
                     669892..669991,670041..670117))
                     /locus_tag="CNL06040"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513918.1"
                     /db_xref="GeneID:3255036"
                     /translation="MSSIEEISKAAITADLARNLTPLIISLGVDALMMGVIGNQFLRY
                     LLITEHESVHIKLVIYFATAAAVATTCFTWAMEVNMFAYNYGQYAQFTSQHWSAWYGL
                     LCSLTKIPVQAFYGERAWRINNRSVIISATLLFTLSLSAIGSIGYTALDHRLDFSADI
                     SYAGTVFFYLWPTACIVSDLINTGGILWGLYKSRTGWIVTDKLIYKLMRIAVEAQIPP
                     TIFASIVLMAWSREMASISTLFMIMLPKVYLTGALSVLNSRDTIRQNNSTYYSNSDFN
                     SGQKSSRRQADTGVTVSTDTYVESHFSYEAPKMGLNRILAKDHRHDSVDDLEAGMSLS
                     AIPVQMSKEELIDDDKGRVHI"
     gene            671772..672838
                     /locus_tag="CNL06050"
                     /db_xref="GeneID:3254773"
     mRNA            join(671772..672019,672071..672200,672273..672838)
                     /locus_tag="CNL06050"
                     /product="hypothetical protein"
                     /transcript_id="XM_568134.2"
                     /db_xref="GeneID:3254773"
     CDS             join(671841..672019,672071..672200,672273..672527)
                     /locus_tag="CNL06050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568134.1"
                     /db_xref="GeneID:3254773"
                     /translation="MLAAKNCLNKSLRALRPLTERSASPVIARSARASPLLRSRATSA
                     RTFVTSLPRQSQPLPPPPTSTLSHDEYEHVSERDMETLNESLEIFCEDFGNGNWEIEY
                     SSGVLNLTLPPYGTYVLNKQPPNLQIWMSSPVSGPSRFEYINGSWVHHRKEGVKLGEL
                     LSGELKEILEKSGNEAAAGVWEGVGLP"
     gene            complement(672580..675790)
                     /locus_tag="CNL06060"
                     /db_xref="GeneID:3255034"
     mRNA            complement(join(672580..672941,672999..673071,
                     673148..673191,673251..673272,673325..673381,
                     673429..673770,673830..674359,674417..675503,
                     675618..675790))
                     /locus_tag="CNL06060"
                     /product="expressed protein"
                     /transcript_id="XM_024658215.1"
                     /db_xref="GeneID:3255034"
     CDS             complement(join(672871..672941,672999..673071,
                     673148..673191,673251..673272,673325..673381,
                     673429..673770,673830..674359,674417..675182))
                     /locus_tag="CNL06060"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513917.1"
                     /db_xref="GeneID:3255034"
                     /translation="MSATPDTPLPQFHLDHPFLLYHPAPSIAGNASVCSISTNSAIQY
                     QVPSPCRSSSSQLGVSPAPSWDPAETRQSWGGYEWCGQEGTYASGSRPVNQYYNQTTT
                     INTYSFQPPRTNSYAHSQPAKFYSINQTPSFPQSYIPTPNNSSPPLLPHQHTHPPTLP
                     PREDSAHLPLYHSFETFDLRPSLQFLASKTPPPEKPLPPPPTLVNSIPIHQRPIPPRT
                     MSDSEIAKTDGAGPAAFACLSMDFGLTSGMSDPGTKSSAVSPPTTCFAPGQNPWGGNS
                     AVRDPIAQGRNQGQHGIGGVSVNGFEVIFNDPFHSPDTMVPPSVSLPCLSPTTPIKFR
                     FAKHRQVELQLQPQPHLHRDTQLQHQASPIPVSSRPITQPANRTRSSRPLFRTRSHSY
                     PNQLGSLPLTSTEPMSHIPVYTDMVNERGKRTNENGFTTSGFDSSFHSSSATTARPTP
                     GTLHFSATVPGDFDMNEQLNESKLQSKCHFDQSDHLPLMTTEPMSLVPIADNLPSRAV
                     RTSTGLRRRRPSDGRSTKVNEGRAKKRVRTTLSGLKHFKRFTCSECCEGFTRKNDMDR
                     HMQCKHSDKLPFVCPACSKAFGRKDKLDLHIERSEDCKRSAPPKEQRLVRHRGSPKSH
                     MRTAEPCRIE"
     gene            complement(676509..678830)
                     /locus_tag="CNL06070"
                     /db_xref="GeneID:3254777"
     mRNA            complement(join(676509..677048,677219..677431,
                     677495..677567,677630..677850,677900..678082,
                     678139..678385,678545..678830))
                     /locus_tag="CNL06070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658216.1"
                     /db_xref="GeneID:3254777"
     CDS             complement(join(676928..677048,677219..677431,
                     677495..677567,677630..677850,677900..678082,
                     678139..678385,678545..678596))
                     /locus_tag="CNL06070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513881.1"
                     /db_xref="GeneID:3254777"
                     /translation="MSKPDEIPALSYILEPAFVASLLTAGCLLNRRPPSLIVQAQAAT
                     NEDVPPPGDNSWNWKDMMFLKWPVRVPGNERFRGRWTSRLLGMFPFLMEVWYWLLTYW
                     IYQVARAIQALTMGADFRVLAEKHAREIIAIERWLHIDCELSLQKFVMKTNWLLMFFN
                     KTYAMVHIPATIAFMAYSYRYFKPYIFQSTRRTLVLCNCLAFIVFSSWPCMPPRLMPY
                     EEFGYIDTLHTGKAASIWTTNKFQNQLAAFPSLHFGYSFVIGLSLFLYSPHRPIRAIS
                     LLYPLLILLVIMATANHYLLDAVGGFFVTVLAHRINRLVLNLRPLEEWFFWLIRTERP
                     MDKVVFDSVISRENVSHRDSSDISHRPLIFQGNPA"
     gene            complement(679132..680149)
                     /locus_tag="CNL06075"
                     /db_xref="GeneID:36393134"
     mRNA            complement(join(679132..679469,679582..679712,
                     679809..679859,679923..679999,680063..680149))
                     /locus_tag="CNL06075"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658844.1"
                     /db_xref="GeneID:36393134"
     CDS             complement(join(679241..679469,679582..679712,
                     679809..679859,679923..679999,680063..680093))
                     /locus_tag="CNL06075"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514674.1"
                     /db_xref="GeneID:36393134"
                     /translation="MPKMLSTSDIGPISQQYAAAATVPLIKSPSLWLPQPVELPNEIH
                     PLPEDITAYFVYPFTLEEHVLSIHPSPHEAIALKRAKCAEILHKREEAEEQKERDNLK
                     RIAPGYNPSSVLMPTSASHTPTSSISQPLVPHGTAQSVTSPNSKSQAHGRTESDPMDD
                     LVARLEEMESKR"
     gene            complement(680154..684535)
                     /locus_tag="CNL06090"
                     /db_xref="GeneID:3254770"
     mRNA            complement(join(680154..680598,680660..681407,
                     681460..681843,681926..681980,682054..683848,
                     683899..684165,684219..684535))
                     /locus_tag="CNL06090"
                     /product="eukaryotic translation initiation factor 2B,
                     subunit 2, putative"
                     /transcript_id="XM_024658217.1"
                     /db_xref="GeneID:3254770"
     gene            680306..682047
                     /locus_tag="CNL06080"
                     /db_xref="GeneID:3255013"
     mRNA            join(680306..680381,680440..680507,680561..680706,
                     680756..681299,681351..681860,681912..682046)
                     /locus_tag="CNL06080"
                     /product="eukaryotic translation initiation factor 2B,
                     subunit 2, putative"
                     /transcript_id="XM_568136.2"
                     /db_xref="GeneID:3255013"
     CDS             join(680361..680381,680440..680507,680561..680706,
                     680756..681299,681351..681860,681912..681984)
                     /locus_tag="CNL06080"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2B,
                     subunit 2, putative"
                     /protein_id="XP_568136.1"
                     /db_xref="GeneID:3255013"
                     /translation="MAVDSAPQMQKSADPNARLTDTLCTSLRRRQIVGSLNVALATAA
                     LIQNIVRSARYNTIDELLALIKAVGRKLTEANPKELAAANIIRRILRLIREEYRAAAA
                     AHVSSAPNSIPSTPLMGPSTPGINAPLDHYLSAAQSATVDAQYFPTHIQMSRQTSLSN
                     FVAMRHSRAQMERSGALSGGTAEGYSANTTNLFATPNGNGHGRGSSGMATPRASVDSD
                     EFMKHSAKLKPLLIQAIEEVVGELETTHEDVAKGAREHIHSSEIILTMGHSRTVEAFL
                     KQAYKDRKFTVVVAESAPSYLGHSLASSLSASGIPTLLIPDSSIHALLPRVTKVILGA
                     HSVLANGGLFALSGSLACALAAKTHSKPVVVTTGQFKFAPAWNLYHEYGAVDFQGPGA
                     VIGEQGKGGGGGMEGVEVVDPYYDYIRPELVNLFVTNEGDHPPSYIYRLIKEAYDDED
                     VEI"
     CDS             complement(join(682058..683848,683899..684165,
                     684219..684428))
                     /locus_tag="CNL06090"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2B,
                     subunit 2, putative"
                     /protein_id="XP_024513882.1"
                     /db_xref="GeneID:3254770"
                     /translation="MSSSLRTTKPCARCLAAIRARPPAETTVSIAGPSSYQAYMTESF
                     PSKRRSRLTSTRAFTSPPSLRGDFYQGQPDCLQYPTQHSIQSKRQRSPHIKSTFTKGF
                     SSTSRDVTSAPLLQNDAARKIAHSIAGPSAYQAYVIEYNPFLKGSPRSTLASERLCQG
                     QLDYLRRPSHHSTLNIFRKYFQTTAASANSIPRPDPVLQHLSHMAIPDFKPPPPETKA
                     SPIPQHTFSPKERSAALSALQRSTSSPPSQDITSAQLLQSYTDLYMSSPQSQLFTVSE
                     VQDVLKALKLLQAREAGDRQVAEEQIEPLLEEIKALVGDERKSSQGLELLALSSRTKH
                     SRRIKTKNLVDAEKTFRSLFPEPPPEKDIGGRRRYKAALNHLIYLCALAGQGGRLEDW
                     CNRLERDGLKADGHTWLSRMILLDRAGKGEEVNGILDKVLENFDEEVVTKEDMSILVN
                     YAMVVYAKLGRWDVVSEVYGRLRPTDSHDLSIIRSSLPNPSYFDGTHPHVPHHIPLPP
                     FSVRLTRRSYSPLLVSLSVQGHLPATLTIFKHIFEDGHTPSVDDYTALFKGFVKHGVT
                     PSIDTGGFGNAGQVSEAGKMLGVASASGGGELDGLGGSFEQRMSGIWERGAMFAEPFQ
                     WPVEKFREGNGEWTLEALQDIFESFLTLRPILPSFSPLTFSDPQSGPDLKSDVNILQA
                     EKQARLYAKAPGRKAVWTVLKAFGRVTHGDEEVLRQVWERMETKFGPENEEGWKGWRV
                     DKRLDWFRKALFAEE"
     gene            685323..689778
                     /locus_tag="CNL06100"
                     /db_xref="GeneID:3255019"
     mRNA            join(685323..685923,685980..686117,686167..686389,
                     686437..686635,686685..687730,687798..688664,
                     688720..688995,689050..689778)
                     /locus_tag="CNL06100"
                     /product="serine/threonine kinase, putative"
                     /transcript_id="XM_024658218.1"
                     /db_xref="GeneID:3255019"
     CDS             join(685783..685923,685980..686117,686167..686389,
                     686437..686635,686685..687730,687798..688664,
                     688720..688995,689050..689126)
                     /locus_tag="CNL06100"
                     /codon_start=1
                     /product="serine/threonine kinase, putative"
                     /protein_id="XP_024513883.1"
                     /db_xref="GeneID:3255019"
                     /translation="MPDSNAQGSREKESGHHRSHKERIGNYVVGAEIGRGSFATVYKG
                     YRSKTRVPIAIKAVSRQKLTSKLLENLESEINILKVINHRNIVALTDCFKNDTHIYLV
                     MEYCSGSDLSVYIKQRGNIPTLDFVPKAGSSMALLPTDDEGKIYWPHPPTGGLDERVT
                     RSFLGQLAQAIKFLRAQDLMHRDIKPQNLLLQPATETEVAEGHPYGIPVLKVADFGFA
                     RILPAAAMAETLCGSPLYMAPEILRYEKYDAKADLWSVGAVLFEMSVGRPPFRANNHV
                     ELLRRIEKSNDNIVFPDEKERDSKSSDETSIPVPSDIKALIRALLKRKPNDRMGFDDF
                     FNCGVWDGHMAESTEEESLSLDVSTDSSAGLGESDRIRQMVASTEQSKDRLIPTRAPQ
                     PLAADAALNPQPAVPISRDTSEGRSRLSTPPSRPTPTRRSTPKYYVGDATPSEPTAII
                     PPSPSSAPTPTSAPDPGLTTQQSPTSRANPRPIITAASSAQRRMSGKGDGREASSVEE
                     AAPITPPFAGPSPTMARPSRGINEGSPLAAAPPITMGPDGRLERSSALEGSTSGVGTD
                     YVVVEKQTVEINALADELDQASKRPMIRRSSRGSVVSRPVSSFKPISPNIAKNDPTLG
                     PISYSPPFALSSTPPFAMQVPRHASGGNSFPRNPSIPSSLNAFPPTTISASPSYGQDA
                     AARFGVSPGSLQTGALARALTNTAIRLIGTSANTAATAIARATAKRRPNIVRVSDMDA
                     AEDDLLCTVEDLARKAFVLFELADERLLAQTQLAQTARTSSTPTGLTGTTPPFSMQAA
                     AAAQAGSRRKSSSSSMNSEVWILRQQEAAANDAVVLYMKSLAFIVKAMDKVKRYWKNR
                     TDVYDGYVASQELNEMGQWLRARFNETFEKAEWAKTQAGDTLLFPDWLVHDKARDTSR
                     QAAVAELQGDLTTAEQGYETSLWLLQALLDESVYENGSIPDEDKVAYDRLMVPIKTRL
                     DALRKKLAESSGMTAR"
     gene            complement(689909..693172)
                     /locus_tag="CNL06110"
                     /db_xref="GeneID:3254764"
     mRNA            complement(join(689909..690128,690206..690325,
                     690398..690497,690566..690780,690834..690860,
                     690917..691018,691080..691147,691215..691296,
                     691357..691378,691504..691569,691621..691697,
                     691758..691792,691860..692030,692102..692390,
                     692450..692684,692741..692804,692861..693172))
                     /locus_tag="CNL06110"
                     /product="GTP-Binding protein lepA, putative"
                     /transcript_id="XM_568140.1"
                     /db_xref="GeneID:3254764"
     CDS             complement(join(689995..690128,690206..690325,
                     690398..690497,690566..690780,690834..690860,
                     690917..691018,691080..691147,691215..691296,
                     691357..691378,691504..691569,691621..691697,
                     691758..691792,691860..692030,692102..692390,
                     692450..692684,692741..692804,692861..693135))
                     /locus_tag="CNL06110"
                     /codon_start=1
                     /product="GTP-Binding protein lepA, putative"
                     /protein_id="XP_568140.1"
                     /db_xref="GeneID:3254764"
                     /translation="MSSLFRISRLCPQCLSKNRVFRPVKTTLASPLVGPSGYKHSLET
                     RSLLPRVQNTIRGVRLLSTSVARLAKPSASLVDKRTVDMSQFPPERIRNLSIIAHIDH
                     GKSTLADRLLQMTGTVPASSSPQFLDKLKVERERGITVKAQTVSLIHQHKDGHKYLIN
                     LIDTPGHVDFSYEVSRSLGACEGALLLVDCSQGIQAQTLSVFHHALEADLEMLAVINK
                     VDLPHAYPEETSEEIESSLGLEKSKHMRISAKSGLGVEGVLDSIIEGLPAPGTWVGGE
                     DGKLRGLIFDTFYDQFRGVVSLVRIFSGSLKKGDKVRFLQAERKYEILEVGINNPDEV
                     PVVELKDGQVGYIVCNMKNSEEAFIGDTICWADKPVEPLPGFKPMKAMVYAGVFPMDS
                     ADFPKLEESIERLTLNDRSVSVQRESSAALSQGFRLGFLGTLHMDVFKQRLEDEYASE
                     VIVTAPTVPYKVVYNDGKEVYISNPVEFPEVSDSKMNVSHVEEPMINATIFVPNDYIG
                     PMMDLCARYRGVQQEYRILENSDRAVLRYTLPLSEIVTEFFSELKSQSSGFASFDYEE
                     AGYEKSNLVKMNILINGKPVDALAMIVHKFAAQSIGKAWVTKLKEVVPRQQFELSIQA
                     AIGAKVIARENVKAFRKDVTAGLYGGHYDRKLKHLNKQKEGKKRLKKLAGNIEIPQTA
                     FYKVLSSRPRK"
     gene            693988..695853
                     /locus_tag="CNL06120"
                     /db_xref="GeneID:3254738"
     mRNA            join(693988..694516,694579..694612,694667..694746,
                     694805..695071,695136..695853)
                     /locus_tag="CNL06120"
                     /product="expressed protein"
                     /transcript_id="XM_568141.2"
                     /db_xref="GeneID:3254738"
     CDS             join(694103..694516,694579..694612,694667..694746,
                     694805..695071,695136..695708)
                     /locus_tag="CNL06120"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568141.1"
                     /db_xref="GeneID:3254738"
                     /translation="MPESRQVIAPSPLFILPSYSSMGSPSKCLLQPPITPIPVLPQTQ
                     TDPAVPFRSSVDRLNSATPLLPKKEGSFFHDLRRGHWHFPWRRHRSVKCSTHYNGHAR
                     LQGCVWLLWKLMLAVLIGIFLYWWGWQDARDQRLTLFNQLEQLPISINTTISTKGVTK
                     IWANSHNDEMQGKGALTLALKQGFGYIEIDTHLDASSLRNSSLTLLTGHDISDLNSNR
                     TVKDLYLDPLLAILDAHNQGWTPGGEKNWTGVYEDDPREEVTLFFDIKSDGDATWPYL
                     EAALEPFLSKGYLTTYNTTSNTLTPGPLTVVGTGNTPLHRVYYSSLRYIFYDAPLLEL
                     YQPYTLPASQYGPETTIYWHPTISPIASAKFPLQSYLALGPGSRGGGINPFSCNLKLT
                     SAIAKQMGIQSRWWGVLHKPGWARRILWEMVWESGAGVMNADELEDMGNWLRAHEGKE
                     RSLKC"
     gene            695933..698143
                     /locus_tag="CNL06125"
                     /db_xref="GeneID:36393135"
     mRNA            join(695933..697846,697930..698143)
                     /locus_tag="CNL06125"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658845.1"
                     /db_xref="GeneID:36393135"
     CDS             join(696005..697846,697930..698085)
                     /locus_tag="CNL06125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514675.1"
                     /db_xref="GeneID:36393135"
                     /translation="MSKTQESAQMANPSDMTSPKAQIPAGNREPTSEAGCTPNNHVVE
                     QGMNEVHTMDDLGDAQGTTMACKNEDGDEEEEADVEGILSPAMDTSTLLSPDEEVGDT
                     PRDLSLGASVGLGLKGVTMNSSTVISSGHENQREEHVRESELTLNDRGDFSFPPIRSR
                     QIRITPIAAPTPSDTSHTSQGSNSTDPTTPSSISLLQPSTPSTPISSQAQAPRSSTPN
                     SNTGMNTCTDMHDVTTPRYTLPNRRPTGWISSFGQTGIGIGTVTGGRVLSDNPVPLSV
                     SSLVENQHQFPLRPRAVSTAHHHPAGQSPRVTSVYAQQPERKVSGTMQYAIAPPDQVR
                     ENGERIIERGRVTSGYSEVGVDTGVEFDLIHAGADTAALNGEHHEGEHQIMRGGEETV
                     EQEEYRLRFQVSTAQDEDEIWMAYVRQQLGVLFPDFFPTDPDQLARSAESAGLEGVST
                     QPQDDDEEDEGNTSARSSSSVQEAGNDIFSPSAGDTSFTTATSSTEDSSLSLATPPST
                     SRPGHGHSLGRMMGGMGEIGVPNVREEISGLRDEIMRLRSVVGGLAEGLRGEVAEMTE
                     MGEDDQDQQDAYIRGPEGGTEDSAGNLIEEDIHAEGTRDDQPPRAFLKTARISISILR
                     LLDNLVHPSEGSASRRSHEQVFGEENLGGILQYVSALAKSD"
     gene            698227..699862
                     /locus_tag="CNL06130"
                     /db_xref="GeneID:3254755"
     mRNA            join(698227..698756,698817..698892,698952..699173,
                     699232..699862)
                     /locus_tag="CNL06130"
                     /product="expressed protein"
                     /transcript_id="XM_568142.2"
                     /db_xref="GeneID:3254755"
     CDS             join(698373..698756,698817..698892,698952..699173,
                     699232..699815)
                     /locus_tag="CNL06130"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568142.1"
                     /db_xref="GeneID:3254755"
                     /translation="MCDVKIYPLSSTFFLAPTHHSTYMMPKGKQLAAEQKQDSGQADT
                     ATTKRKRHRTVNWENDLGSDQRNANDHLIDWLGMPDSDGTLMFYRWKSDNVTGKTREH
                     WSKVALEYLVQKGCASNRDVQSVLRQIKKMWGTFKNTSDEINKTDSEGPNGNYAIRIC
                     PWYSELMPIMSHSAAAMVGPGRSTLDEGEDKDRERLRKRIRHAKEEEREDDDNGQCDT
                     GLEQFGLDETADTADATPSRPSSSVCTQALVPIPFSTRPDHSKVIADTASASSSVAPS
                     LPTPRTVFESRGSPYDAPSGLLTPDSQGTAERNSHPRATQRMLSVNEKAEACSAEDQL
                     QRLVEASEVNWERRHRDMLLLQEEENAILKDIIAAEEKKAATAVKRLDFEMWKEFLAL
                     HRAEGASYEKAKKRAMDDVKEWNDKHGRM"
     gene            complement(700957..702461)
                     /locus_tag="CNL06140"
                     /db_xref="GeneID:3254956"
     mRNA            complement(join(700957..701353,701511..701586,
                     701770..701803,701915..701972,702107..702206,
                     702400..702461))
                     /locus_tag="CNL06140"
                     /product="expressed protein"
                     /transcript_id="XM_568237.2"
                     /db_xref="GeneID:3254956"
     CDS             complement(join(701282..701353,701511..701586,
                     701770..701803,701915..701972,702107..702206,
                     702400..702419))
                     /locus_tag="CNL06140"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568237.1"
                     /db_xref="GeneID:3254956"
                     /translation="MPLQTAPYPHVFNALNGPTAPAVSYIVFYSNIVDGQMWCPDCRA
                     VENVVKETFDAPDKPNAAIFWVGNRQEWRTPNNQARTEWNVNSIPTILRLENGKETGR
                     LVEDEILDKARLQAFLK"
     gene            702519..705568
                     /locus_tag="CNL06150"
                     /db_xref="GeneID:3254772"
     mRNA            join(702519..703950,704017..705168,705277..705568)
                     /locus_tag="CNL06150"
                     /product="hypothetical protein"
                     /transcript_id="XM_568143.2"
                     /db_xref="GeneID:3254772"
     CDS             join(702589..703950,704017..705168,705277..705501)
                     /locus_tag="CNL06150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568143.1"
                     /db_xref="GeneID:3254772"
                     /translation="MSPRPTRKTPRPVAPLPATANTVNASSQLDIQLGTGIARHHNGD
                     EDDDADRDRGYGGQYRGSGLVPGSLAAQDADGGASGNSPKSPSGSASRSGIVVKRQVT
                     VEVQPLSTSTSRPGERRSARVRGKERGRDKRPDGGQPERLERPVELASVDGQQAAGQG
                     SDGTVEHEVEKLVGLPSSATEVTGIGQKPASTDGQPSAAVSQPTESGISENKPRAKVS
                     SSITTTVVKPAPPRKSTPRTKPPMRSKGTSSTPSANPAPALAPASASTPASTDPKYKG
                     KPIERRVLPARIRRAAGGGLEGMRDVEEMVVDWLQRWGEPVTTPPDGLPILLTTLPLE
                     MLNPPPVFTSTASSSGQEQSSRPPITLTPSRKIDPASIEMVRVKMEGTDALVDVKGEN
                     TLGQEEMIETPGWVMVKPGEDDEQEAREELKNGPLIGTGTGGVGKGKGVVSPVKRLRR
                     MHDEPEEDTSDAHYIQLHRRHEAFERRQRLREKEKLQFERYKLRSRIDLLRNLSKPAW
                     ASIVATVLARDEDGWKSGRVKVEKEGEEWLRERLLKEGEEVMKRYEELLPPENRKHKA
                     GAGINAQHHHHHLPTDATPNSTRFSSPSGSTCASRIQSLTPEPTVLPARVAALRDPVV
                     ASTGKRKRSSMGAGTSMGTSKGRHSSALGDRNRDRNENENGKPDGVGEEEGDSSGWKK
                     VAKACTRKKQSVQSARRLDVDVNEGEAQVVGDGDGDGDDDGNGERAEQLWKNQNSLPD
                     PMVSSLPPPQISQPQVPAPPPLPPPFFPPFTASGLPCLIEAASRRESALQEAEASKAR
                     AAEPRKGRLISREKTRMSTRLGVVSPFGLPIPGVVEYKYEFTLTEEEDFWPIIAEREA
                     AANRHRRESLLGQNGLSGLGNMGTSSNGSVHNEGSTRQVEQAAVSGAEKMENIVVL"
     STS             703132..703933
                     /locus_tag="CNL06150"
                     /standard_name="Eco1"
                     /db_xref="UniSTS:470736"
     gene            complement(705398..706494)
                     /locus_tag="CNL06155"
                     /db_xref="GeneID:36393136"
     mRNA            complement(join(705398..706001,706060..706189,
                     706262..706494))
                     /locus_tag="CNL06155"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658846.1"
                     /db_xref="GeneID:36393136"
     CDS             complement(join(705600..706001,706060..706189,
                     706262..706404))
                     /locus_tag="CNL06155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514676.1"
                     /db_xref="GeneID:36393136"
                     /translation="MRTSIAYCCFVFSFIALCVRADTEIINFRLPLPPHTTIYPTPNS
                     LIYTISPYETLTLNLTDSSPERWFALDMGNGKGSYKSWTLRASWPGSSPTKIVLSPPL
                     SPGYFTLHAAPLSPRFPHHPPFLTYIPYMNHLTSFISSLLTTPPPKPKLSDDQFHTPL
                     HLTLEPLLFGFLPNTALPAVGLIILCAAAAGMGVPYVIRGLECAGNWAQAEDRGRTER
                     GRVKEE"
     gene            706713..708720
                     /locus_tag="CNL06160"
                     /pseudo
                     /db_xref="GeneID:3254971"
     gene            708968..711053
                     /locus_tag="CNL06170"
                     /db_xref="GeneID:3254736"
     mRNA            join(708968..709184,709238..709660,709716..709986,
                     710048..710125,710181..710339,710390..710644,
                     710702..711053)
                     /locus_tag="CNL06170"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_568144.2"
                     /db_xref="GeneID:3254736"
     CDS             join(709030..709184,709238..709660,709716..709986,
                     710048..710125,710181..710339,710390..710644,
                     710702..711004)
                     /locus_tag="CNL06170"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_568144.1"
                     /db_xref="GeneID:3254736"
                     /translation="MSSTNQKPLSAFVSFPSPYTQSLLVQALVSTLPALSLSLVQFPE
                     DQPPALQWADYDLMSFDIPHKSPSKYLISSYIYRKALTRKHQLHNTIIAYLAKCSHRK
                     IPSILSPLPEGPVGNGDGTDVLGGGAPKGWIVDLQFADELDEALMDDLYELEAGMREN
                     EGKEEGERRWWILKPGFADRAQGIRMFSTEEELRAIFEEFEPSSSDEEDDDEDKEEED
                     DEQESEEARQMAKGGVDGMIDMLAKKAVELGFSGEDDQDSNEKEDEDGEGGTGVMTSQ
                     LRHFVIQEYIPKPILFDIFNIPEEPSSSLEGYKFHLRAYVLITGAYTVHLARTMLALF
                     SGSPYTPPKPTEDGQLDLRPHLTNTCLQTDAYGAPTPPEELVKLFWELEGISALNCSS
                     SPSSDGKYSYIPRGEVTKEWLDKTFAKVGDVVAETVKAGAECGSFGLQFMPNAFEIFG
                     VDLILSFPPSSSKSTSLPIPTVTLLEFNASPDFHQSGDRLRSELLHMFKGVIRLSVAP
                     FFGLETAEDDEKNEEEMQLGEDRWGWRLVGKGEVRGSEW"
     gene            711258..713247
                     /locus_tag="CNL06180"
                     /db_xref="GeneID:3254825"
     mRNA            join(711258..711458,711524..711935,711992..712119,
                     712175..712837,712895..713044,713102..713247)
                     /locus_tag="CNL06180"
                     /product="class III aminotransferase, putative"
                     /transcript_id="XM_024658219.1"
                     /db_xref="GeneID:3254825"
     CDS             join(711456..711458,711524..711935,711992..712119,
                     712175..712837,712895..713044,713102..713185)
                     /locus_tag="CNL06180"
                     /codon_start=1
                     /product="class III aminotransferase, putative"
                     /protein_id="XP_024513884.1"
                     /db_xref="GeneID:3254825"
                     /translation="MLKDRASPTTMSPIALNQRTGVSTTHLKSSVAPTPISTAATSTY
                     QLHHTVPNPVATKGDGMHFTLTTGETVLDAAAGGAAVSCLGNGNSEVIETMYEQAKKM
                     AYTYHQSLDAEGSEKLAKWLCDRSEGALVAGAFLNSGSEAIEAAIKMARQYWVEAGKP
                     ERKYIIARFPSYHGNTLGALAIGNAPGRRDIYKPLISMNAFHHVTSPVYKRYAQPGET
                     EEAYSARLADELEAKILELGPENVIGFFAEPVVGSALGVMPPPKGYFPAMDKVIKKYG
                     TLFIMDEVMSGSGRVGQLFAHQAVGEGVKPDIVAIAKGLGGGYVSISGVFVGQRVADR
                     VREGGQWKNSHTYQNHPINCAVAAKVMEIVERENLLQNVRERGEQILEELKEAAKGVP
                     TIIDVRGKGLFIGVEFDGPSSLKPRFASRVKDQAFKNGLIVMGISGTIDGVEGETTII
                     CPAYTVTKKQISEIVRLLVKSIKEVVEEL"
     gene            complement(713524..714773)
                     /locus_tag="CNL06190"
                     /db_xref="GeneID:3254897"
     mRNA            complement(join(713524..713666,713720..713815,
                     713866..714350,714407..714578,714631..714773))
                     /locus_tag="CNL06190"
                     /product="aldo-keto reductase, putative"
                     /transcript_id="XM_568146.2"
                     /db_xref="GeneID:3254897"
     CDS             complement(join(713610..713666,713720..713815,
                     713866..714350,714407..714578,714631..714732))
                     /locus_tag="CNL06190"
                     /codon_start=1
                     /product="aldo-keto reductase, putative"
                     /protein_id="XP_568146.1"
                     /db_xref="GeneID:3254897"
                     /translation="MPRAISIRLFNTPRNILSEMSGPAPVKSLDARLKMHDGNAIPQF
                     GLGVYEMNDKETYDCVKWALEAGYRHVDTAEWYENEAPCGKAIADFLKATGTSREEIF
                     LTSKLKNNSSYEQAFVDLKGSLKRSGVEYFDLYLMHSAIGGPVIRKNVWKALCDAQSQ
                     GLVKSIGVSNFGKKHIQEFIDQKVPLPTVNQVDLHPFMRHPEIVEICEQNEILLEAWG
                     PLARAMRFDHPVVVKIAKEKGKDAAQIMLRWGIQHGFVVIPKSVSQKRIVSNSKIFDF
                     ELSSEEMKELDGLDEYLVTDWDVVDCE"
     gene            714929..715752
                     /locus_tag="CNL06200"
                     /db_xref="GeneID:3254799"
     mRNA            join(714929..714987,715034..715106,715156..715277,
                     715329..715526,715588..715683,715731..715752)
                     /locus_tag="CNL06200"
                     /product="expressed protein"
                     /transcript_id="XM_568147.2"
                     /db_xref="GeneID:3254799"
     CDS             join(714958..714987,715034..715106,715156..715277,
                     715329..715526,715588..715680)
                     /locus_tag="CNL06200"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568147.1"
                     /db_xref="GeneID:3254799"
                     /translation="MPQHLVSPEEFLTKLGQCFSDPSSSSSVWLTHKRLTYSDDADVQ
                     MNDEERENNSEGPEHEVLIRCTQGNNKFSARIPASSLPSFHAAYGSLLKTSMAPLMRK
                     RDKKKEKARAEALTKKRKELYVEVVIGNEGKRGKGRRQRQRKIAAQKKKETEREKLEI
                     RQAQQKASGDL"
     gene            complement(715693..719533)
                     /locus_tag="CNL06210"
                     /db_xref="GeneID:3255004"
     mRNA            complement(join(715693..716966,717036..717171,
                     717238..717389,717456..717523,717575..717804,
                     717856..717909,717975..718079,718140..718158,
                     718218..718339,718399..718719,718772..719533))
                     /locus_tag="CNL06210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658220.1"
                     /db_xref="GeneID:3255004"
     CDS             complement(join(715817..716966,717036..717171,
                     717238..717389,717456..717523,717575..717804,
                     717856..717909,717975..718079,718140..718158,
                     718218..718339,718399..718719,718772..719039))
                     /locus_tag="CNL06210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513885.1"
                     /db_xref="GeneID:3255004"
                     /translation="MGISPFYFWSDVPIPHHSTIAILKNMSLSHGEPTVKYRGLFIND
                     EHPALWGWAAEKWNRDPWEPAFQVEMYELWFEMMLRLKANYFWPAMWASKFSVDGLDI
                     TNGLPRPAIPGPNQILANKMGIVMGTSHHEPMSRNKPEWDVFGKGPWDWTNKDVLKDF
                     WRYGAERAKGVETLFTMGMRGDGDEPLTDASNELVQNITKVQQDILKEVYDTDDLEGS
                     GVSQMWCMYKEVAGYYKNGLEVPDDVTVLFADDNYGNIMSVLPPERQGHKAGAGIYYH
                     VDYVGFPRDYKWINTVNPAKTWDQMNIARSFNTTQIWILNIGTLKPLEMPTEWFLDLA
                     WDFDRWERNSWKRWLREWAGREFGDEWKEEVGDIMGKYSLYASRNKAELVNSKSWSLS
                     NYREAERVLTEWQDLTTRAGMVYDQLPKETQPAFFQLVYMLCAAQENLNKLHIAVARS
                     ELYAFQAKTAANVFAHEAIEAFYQDANITETFHSLLNRKWDHMWDQTHINYYTNLEPI
                     RDSLPPIHLVNPFQPSRPGIPLKERDLPGQIGYVRLTVENSLGAWPGDNVRNCERGYK
                     CPDPTLLPMDPWGEQSRWIDIGAGGPKNVSWKMEVDVDWLTVEPRKGKTVWDGSGDER
                     VWVSVDWDKVPASTKGERVEKEGHIEFSAADRTNVTVSVPIIIPPSPPSSFRGHVQGD
                     GYVVIEAVHYTRNTSEEGYAFEELEGYGRTLSGLEMFPVTTQNFTLGKGPKLEYDFWT
                     HGDSVDGNGKVEITVQVGPTLNFLIGEELAFGLQLDDLPPREIHPVPIKGLGESGSDR
                     NSGEVGSVPKDWMEVVSSEIRNVTMEVTKDDWEAGRHTVTIWGLTTGVVVERIWVDMG
                     GIRERGYSYLGPPESKRV"
     gene            complement(720737..723992)
                     /locus_tag="CNL06220"
                     /db_xref="GeneID:3254961"
     mRNA            complement(join(720737..721842,721897..722065,
                     722121..723398,723653..723992))
                     /locus_tag="CNL06220"
                     /product="expressed protein"
                     /transcript_id="XM_568236.2"
                     /db_xref="GeneID:3254961"
     CDS             complement(join(720925..721842,721897..722065,
                     722121..723398,723653..723705))
                     /locus_tag="CNL06220"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568236.1"
                     /db_xref="GeneID:3254961"
                     /translation="MPSASNGWKPSTSPVGEGLTAPRTPEQSTSSLAATSPSSSTFPR
                     PKKLRSRTSTMTNIYTPPLPPVMSRENSAEDVRGEYGQDSYRPPPGTLLPSAHGRRAS
                     KSVSSVRPSVVVTPSKYYTPQTHNQISFVNTPNSNTGNGVMDSPEADKKNMLKRRTST
                     PSLFKRATRGDEDEEDEGLRGKLMSKEEPQQSQLLQQQQRSEVRARSTSTSVVVPQTQ
                     GLTEHSTYTSNPIRPSMPPSSFTQQPPPPRPWSPGPASPSSHVEGASHERSSGFLSSA
                     YNYTESGIVQLFNYVRPSSFSHHSYARHEPSDVDSEKGLNGSEDETEESSVSYFTLPP
                     TPPEQSEFSSFASALPSDSLPTPTLSTQSLSRDEPKRGKLRRAFRRRSGLEGDNGNGL
                     LSAVWSKVMGSGGGNGKLSEVLRDLGWIVGVLALTFVVTLGIVIWLIQGMPITTLKHI
                     PQSTTDVQLLSAEIRGYMASSSYGWWHTVGVLTFVGCWKHAWSVPGAVVLNILVGSLL
                     EPMPALGLLTIITASGSLGAYLLSRPLAPLIAVLFPKPLALVRAALAPESIPAPDSVE
                     PTLNETITPIQASSDPSAQAIGGPTEASTIWRRLLVMRAMGFVPWSGMNVACGVVGVD
                     WKVFWLTTAAGSASWSYVTASVGNILSRLKVPNSAISAAPGEMTGESLTSLLRDPVLI
                     TKLVFLSGLTLLPVILKRRSPASPSPTPRSTSSFELSELPTSSSASSSRPLNPKINTL
                     RLSGLDNQPMSPLSQSLAKFTPTPRIFDLLSFGRIAVRQSGRIVVGGVRSVVGGVRGA
                     VRSVTQQ"
     gene            complement(724786..727967)
                     /locus_tag="CNL06230"
                     /db_xref="GeneID:3254963"
     mRNA            complement(join(724786..726739,726791..727019,
                     727292..727967))
                     /locus_tag="CNL06230"
                     /product="expressed protein"
                     /transcript_id="XM_568235.2"
                     /db_xref="GeneID:3254963"
     CDS             complement(join(725087..726739,726791..726985))
                     /locus_tag="CNL06230"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568235.1"
                     /db_xref="GeneID:3254963"
                     /translation="MSVLDPFLIAHPPARATHLSAQAEEAPFEVYCIVCDKRIVQIEA
                     SEKGKEGEKKSKKKMAGGTIRVKNPDGTTTTRNANGKVIRPPLKRNPNSAARTAVTNA
                     AKGQCLTRTETNEGVVSPSESPQSKKSPPLSSSPPFKSAIYCSRECMETDAGRSTEVY
                     KDLARTMSFDFSNTFFSPDENVPVTDQGKSPNAPPSPLFVSGSDTESSTSNSAGLTRD
                     HNTSSSAPKIMDYFRFSKEDSDRTWNEIERQRRSSMQPAVRRPAPSTESLTSLWHQEA
                     ELGQSSSGGGKLRAMTPLHGCVSNKERRPSGSAERSAPIPVRPIPRSNMSHTSLVGSS
                     SSYRSTALPVDLGSAPSHTLGLLHSYASAFSVRSSNNTPSSYTQRGFVYPDGTVVPSS
                     VSPPMAASRTDSTSSITRPVGGTIKARKSEPTWDSFGKVEVQAHNERIHRRSGAGANA
                     CTDSTPVAVPRRRRDISSGPSENTPRQNLEREGSNWKITYVVPAGVERQTTVKRSQGP
                     ACSLPPDRYHPQGVLIPRSSAQLSTSNSTAYGSHTPSSRHMPLRAATSAAFPDIGGLK
                     VSDDKIVPVPSSQSVPRRIGFNWDQAKGVKTYEIPGKVDRNPKGLFYFQ"
     STS             726318..726877
                     /standard_name="Hae3"
                     /db_xref="UniSTS:470735"
     gene            730881..733153
                     /locus_tag="CNL06240"
                     /db_xref="GeneID:3255008"
     mRNA            join(730881..731126,731175..731445,731502..731824,
                     731878..733153)
                     /locus_tag="CNL06240"
                     /product="glutamate-5-semialdehyde dehydrogenase,
                     putative"
                     /transcript_id="XM_568149.2"
                     /db_xref="GeneID:3255008"
     CDS             join(730941..731126,731175..731445,731502..731824,
                     731878..732480)
                     /locus_tag="CNL06240"
                     /codon_start=1
                     /product="glutamate-5-semialdehyde dehydrogenase,
                     putative"
                     /protein_id="XP_568149.1"
                     /db_xref="GeneID:3255008"
                     /translation="MADSIASASNSGAESIAIAARRAFEASQLVNPSERDVALKAIRE
                     TLQASKDEIIAANKKDMEAAEALAATGKLSSSLVSRLDLGRPGKFEAMLQGITDVAAL
                     PAPTGIVTFAKEIGPELELHRVTCPVGVLLVIFEARPEVVVNIAALAIKSGNAAILKG
                     GKESINTATLLSSLISQALAKTSIPPAFVQSVSTRSEISSLLAQDKYIDLVMPRGGNE
                     LVRSIQNNTRIPVMGHADGICAVYLDESAVQEKAVRIAVESKIDYMAACNAAETLLIH
                     SSLLTTVWPAVASALMSNSVCLRCDAATLSALRDANIPKTSEFVTASSPADYSTEFLG
                     PTIAVKAVESVQEAIQHINSHSSHHTDSIVTEDEASMSAWCRGLDSANCFVNASTRFA
                     DGTRYGLGTEVGISTGKTHARGPVGLDGLIIYKYMMRSRKQDGSVIADHEKGGKGYTH
                     KDLVKGEPPF"
     gene            complement(732340..733811)
                     /locus_tag="CNL06250"
                     /db_xref="GeneID:3254936"
     mRNA            complement(join(732340..732556,732611..732739,
                     732794..733147,733204..733385,733434..733516,
                     733574..733811))
                     /locus_tag="CNL06250"
                     /product="expressed protein"
                     /transcript_id="XM_024658221.1"
                     /db_xref="GeneID:3254936"
     CDS             complement(join(732538..732556,732611..732739,
                     732794..733147,733204..733385,733434..733516,
                     733574..733718))
                     /locus_tag="CNL06250"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513886.1"
                     /db_xref="GeneID:3254936"
                     /translation="MSAPGAISKKLKFKGDKPKKKKRSHHHSSGGGGGDGDELEALAA
                     ADPRGWMFPSNPMEINGPAYILLPTEPLTCLAWDATRQKVYAAPIDIPQAPEGANDLS
                     ESEILLTIEPTDVNHVWVISRLSGSEDVVSLRTSTGTFLTASPSGSLTATTPSRGPLE
                     AFIPITSRSSSSSVFPTFALQIQHNSKYFSATTVAGKAELRADADDVGEFEGLRIKCQ
                     REFVYKARQGEDVKGKKRMVDSGPSAASIEDDEMRRNREAQTWGAGRVKLSDKDRRDV
                     KKAKKEGRYAEAMLDRRAALKSDRYAK"
     gene            733900..737916
                     /locus_tag="CNL06270"
                     /db_xref="GeneID:3255017"
     mRNA            join(733900..734251,734299..734637,734706..735251,
                     735318..735773,735838..735922,735970..735994,
                     736047..736147,736197..736316,736368..736530,
                     736581..737043,737101..737469,737538..737916)
                     /locus_tag="CNL06270"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658222.1"
                     /db_xref="GeneID:3255017"
     STS             735016..735519
                     /locus_tag="CNL06270"
                     /standard_name="Hae5"
                     /db_xref="UniSTS:470734"
     CDS             join(735342..735773,735838..735922,735970..735994,
                     736047..736147,736197..736316,736368..736530,
                     736581..737043,737101..737469,737538..737723)
                     /locus_tag="CNL06270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513887.1"
                     /db_xref="GeneID:3255017"
                     /translation="MAVKAAQSDLCDERYETTPSHKAGGSQRRHSSSLQILQHCISSS
                     NMPKGPIYLPVTSNDVPSSEGISKRRWPLIVLGLLAASSIITSWPLSVSQLITYKGDY
                     SAYNGSLRDGLCAQAEPIMPAGYDTSKIWEDKDIIIKRLQEAVRIPTEVFDEMGPVDE
                     DPRWEIFTEFHAFLEKTFPLIYEVAEVTETDWALVYEIQGSNPSLKPLFLTAHQDVVP
                     VLPSTRSQWTHDPYGGEYDGTVIHGRGASDTKSSLIAVMSAIEHLLKTTDFKPKRTII
                     LGFGSDEERGGQVGAPAIARYLLDKYGRNSMALLIDEGSGMINTWGQQFATPAVAEKG
                     HYDLGITVSTLGGHSSVPPPHTAIGLISLLIAELERNPHEATIAESSPVYEFMTCAAA
                     YAKDMPKRLKSMIIKAEDGDPKAWKSLPEEIISVGMGGAPAGPGQGDPIKSMLTTTQA
                     VDIIQGGLKVNALPEAVTAIVNHRINSLSNHFELQGRTLNLLKPVCEDYNLTLIGFEG
                     ETVFEGSPTSKVILDEAFGYYTDPSPHSPVSIEDPAWRVMAGTARGMWASRKEVSEDG
                     KIVELEAGDDLIMAPFMSTGNTDTRRYWDLTPNIYRFRYTPMAGSAGAHTINEYSNAD
                     DLVEFARFYQAMILNLDTAEDVA"
     gene            739377..742040
                     /locus_tag="CNL06290"
                     /db_xref="GeneID:3254977"
     mRNA            join(739377..739747,739805..740198,740250..740397,
                     740447..740536,740597..741125,741216..742040)
                     /locus_tag="CNL06290"
                     /product="riken protein, putative"
                     /transcript_id="XM_568153.1"
                     /db_xref="GeneID:3254977"
     CDS             join(739457..739747,739805..740198,740250..740397,
                     740447..740536,740597..741125,741216..741614)
                     /locus_tag="CNL06290"
                     /codon_start=1
                     /product="riken protein, putative"
                     /protein_id="XP_568153.1"
                     /db_xref="GeneID:3254977"
                     /translation="MLQYRLLAAIALNTAVYASPAPNHFVLTSPEEVLDRSYDSYPYF
                     SHGQKEIEAITIYDGTGYVQEYSIELPHAAVWTEQGWLSRWLALGGEGEVVVHLDDPK
                     GAEKAENITLPHRPAAFPSHPSISLPLSGRLLPFSSFLTPSASHSPSELLACIPSSII
                     PRPPTRPGKSEDVKIALIERGTCDFATKAMAAQDRGAHAVIVGDTKARAGETDAEGRK
                     REGLITMFSPQETDSLYIPAVFVSRASYLGLRDLLANQTGSKSPGQGLYIDISEGSDE
                     GNALSGLLSFAILMPTLFLLAMIGIHRLRVVRQREADRAPAMVVLSLPERVWTPDIVW
                     EKDDDSSEGPGSPSPEGGERSLLTDEQEVHDSQRSILNDPTDADASQTHPPPPVDLSI
                     ISPPLLPPLTETNPSFSPILPAHPPLSSSTDNAGPSRNSRKHKRPTRRYFSKDECAIC
                     MDAFEKGDIVRILPCGHVFHKEECDEWLMKWRKLCPTCRADVTLPQVKIKGSTMTPVI
                     GPPMAVDADRTEQTPSSFDTLAAFPNPDFNSNLGGGTLGSGPGTSSSPSRPWRLPEVW
                     RDVRERLIGWVGPGFGLRRTGVRLGEGEEEGGAGEEEEERERMVAGEESV"
     gene            742290..743469
                     /locus_tag="CNL06295"
                     /db_xref="GeneID:36393137"
     mRNA            join(742290..742491,742588..742730,742907..742997,
                     743100..743153,743280..743469)
                     /locus_tag="CNL06295"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658847.1"
                     /db_xref="GeneID:36393137"
     CDS             join(742435..742491,742588..742730,742907..742997,
                     743100..743153,743280..743312)
                     /locus_tag="CNL06295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514677.1"
                     /db_xref="GeneID:36393137"
                     /translation="MSTLSDDTLRKILLQIQTQAITSQKQLAVVKAQITSKEKERRIL
                     ALQVKELGNVPGDGGMYKGVGKMFIEQPRQEINKENVEQEKQLAEDVQNLSKKAKYLE
                     KQFDEANNQLKDIFHAQKRQEQS"
     gene            complement(743902..744965)
                     /locus_tag="CNL06300"
                     /db_xref="GeneID:3254783"
     mRNA            complement(join(743902..744114,744243..744418,
                     744554..744965))
                     /locus_tag="CNL06300"
                     /product="gal4 DNA-binding enhancer protein 2, putative"
                     /transcript_id="XM_568154.2"
                     /db_xref="GeneID:3254783"
     CDS             complement(join(744098..744114,744243..744418,
                     744554..744936))
                     /locus_tag="CNL06300"
                     /codon_start=1
                     /product="gal4 DNA-binding enhancer protein 2, putative"
                     /protein_id="XP_568154.1"
                     /db_xref="GeneID:3254783"
                     /translation="MSIENLHIADETEIPAGATVELHSRPERKARKALEGLGLKRVQG
                     IQRVTLRRARNVLLVVSSPEVYKSPGSDCYIVFGEAKVEDPNSAAQLQAQAQLAASSQ
                     AAQQAHAHGGFKEGVPKSLEELMQDAPSTDSSAPAPSGEATDASASGDFKVSDEEIQL
                     IVAQTGVDEAKAREAYISEKGDLINAIMKLQ"
     gene            745209..747113
                     /locus_tag="CNL06310"
                     /db_xref="GeneID:3254808"
     mRNA            join(745209..745377,745439..745456,745512..745732,
                     745822..745929,745997..746054,746161..746276,
                     746356..747113)
                     /locus_tag="CNL06310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568155.2"
                     /db_xref="GeneID:3254808"
     CDS             join(745225..745377,745439..745456,745512..745732,
                     745822..745929,745997..746054,746161..746276,
                     746356..746947)
                     /locus_tag="CNL06310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568155.2"
                     /db_xref="GeneID:3254808"
                     /translation="MSFFKSRSASASTASLKPESLGPKTSEVFTVPPQESSVKKRWEY
                     DDHQLGLIAQLKEYTKTIALPESDEYYPWEQRFLSDPATHARYMRAAKWKLHDGKHRI
                     RGTMEWRREYKPELIQPDDVGVEAETGKIILTGFDMDARPILYMRPGRENTETSPRQI
                     RHLIYHLERAIDLMPPGQEQVAIIVDYKSATSQSNPSIGTARKVLHILQNHYVERLGR
                     GLVVNMPWWINAFFSGISPFMDPITRDKIRFNPRLLDLVPAAHLDSEFGGDYNFTYDY
                     SVYWKTITEFCHIAPNGRRVPPPGKEEEGKGREGWIPPAGNGIKAAVEGYVPKEGTVK
                     SGEIVKAGEKNEKSEKTGKGAAATSANGVAGAAPTASSTTAPAPPEKEMESLAIQTAP
                     GEPIGGSVFDHPPSEGEVHEAKKSLNVSA"
     gene            complement(747594..748914)
                     /locus_tag="CNL06320"
                     /db_xref="GeneID:3254821"
     mRNA            complement(join(747594..748141,748229..748260,
                     748319..748365,748417..748461,748519..748620,
                     748679..748914))
                     /locus_tag="CNL06320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658223.1"
                     /db_xref="GeneID:3254821"
     CDS             complement(join(747867..748141,748229..748260,
                     748319..748365,748417..748461,748519..748620,
                     748679..748852))
                     /locus_tag="CNL06320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513888.1"
                     /db_xref="GeneID:3254821"
                     /translation="MFIQAILGASVTAMAGLYALKSGANPTHSDNVPYEVDLHWMRKS
                     IEVMPPCHFNAYGSVIVNASNNELLCSGYNSQLEIGDPTEHGEVNAIRNCVKKYTELG
                     WTPAQITEIWPQSWIYTTAEPCPMCGSTILQSGFKRVVYGTSSPDLVSMGWTEYLVSV
                     RNKWLRKAAVVQPGFGGGRPVTQVVGHVGNNETDPRLAWQFNLDYPCPEGCHRHGEEQ
                     ICKPVA"
     gene            749477..751789
                     /locus_tag="CNL06330"
                     /db_xref="GeneID:3254883"
     mRNA            join(749477..749685,749743..749804,749859..750030,
                     750088..750190,750252..750420,750474..750596,
                     750661..750836,750898..751009,751073..751789)
                     /locus_tag="CNL06330"
                     /product="purine-cytosine permease, putative"
                     /transcript_id="XM_024658224.1"
                     /db_xref="GeneID:3254883"
     CDS             join(749506..749685,749743..749804,749859..750030,
                     750088..750190,750252..750420,750474..750596,
                     750661..750836,750898..751009,751073..751487)
                     /locus_tag="CNL06330"
                     /codon_start=1
                     /product="purine-cytosine permease, putative"
                     /protein_id="XP_024513889.1"
                     /db_xref="GeneID:3254883"
                     /translation="MSIAPPEYDEKDIEAQSFVSPTGRQHNHASAGGILQAEDGVPRG
                     KGISAPLWKAMAWFDRFGVEARGIERVPEDDRPHTSWWDNGTLWFSVNSCVGTFSVGY
                     LGHLYYGMGLRDAALTIVFFNLLSCAPVAYMCIFGKELGLRQMVLSRFALGYWTGIIP
                     VIFNLIACCGWATMNTIGGISCWRAISTTHQIPVIAAAVILAFLGLIVSFCGYKFIHL
                     YEKFAGYPVLIAFLVSMGTSAKYMDLPGAWGPSGPVGAAGVLTFGCAIAGYAIGWVGF
                     AADFTVSMPKETSTKKLFWVTFWGLAIPLIFIELMGALAVTTFNARPDWEEMFNDGAV
                     GGLLAGLLQPCGGFGKFLLVILGLSTVAVNTPNVYIFTNTFHALSPYCQAIPRPFIAL
                     IVSIIYAVLAAAGANSFSAVLEHLLLFLAYWLTMYFGIVATEHLVFRKNSFDNYVPDD
                     YRNWRMLPLGVAGFFALGLGWTGAALGKSSLRNFFPFFWNARSTHGWLIEERA"
     gene            complement(752020..754811)
                     /locus_tag="CNL06340"
                     /db_xref="GeneID:3255022"
     mRNA            complement(join(752020..752549,752612..752986,
                     753042..753458,753512..753958,754009..754040,
                     754095..754236,754283..754416,754470..754628,
                     754677..754811))
                     /locus_tag="CNL06340"
                     /product="Catalase A, putative"
                     /transcript_id="XM_568158.1"
                     /db_xref="GeneID:3255022"
     CDS             complement(join(752133..752549,752612..752986,
                     753042..753458,753512..753958,754009..754040,
                     754095..754236,754283..754416,754470..754628,
                     754677..754698))
                     /locus_tag="CNL06340"
                     /codon_start=1
                     /product="Catalase A, putative"
                     /protein_id="XP_568158.1"
                     /db_xref="GeneID:3255022"
                     /translation="MAQMLNQAVTAVTGDAKYRQMAENTIEQTSKTPLTTYFGVKVPE
                     TDVALRAGARGPTLLEDFHNREKIQHFDHERIPERVVHARGSAAHGEFKLHTPLTGIT
                     TAKVLTDTSKVVPAYVRFSTVVGSRGSADTVRDVRGFATRFYTDEGNWDLVGNNIPVF
                     FIQDAIKFPDVIHALKPEPHNEMPQAQTAHDNAWDFISLHQQATHMQQWVTSDRAIPR
                     SYRMMQGFGVHTFRLINEEGKSTFVKYHWIPHLGIHSLVWDEALKIAGQDPDFHRRDL
                     WDAIEAKAYPKWELGVQLIKEEDEHKFDFDILDSTKIIPEELVPVQKIGTLTLTRNPV
                     DFFAEVEQVAFCTQHIVPGMDFTDDPLLAGRNFSYADTQISRLGTNWHDLPINRPICP
                     VMTNFRDGQMSMFSKTNRTPYHPNRHDSLPLTSSNNGGFQSYREKISGVKERLNGPKF
                     QEFYSQATLFWNSMSETEREHIIAAYNFELSHCAEDIVIQNVINSLNEIDHGLATSVH
                     ATFPHLTLPEAKPTHNKKSEYLSQINGKHQVFTASGRRIGIYLVPGYTYSQVVPLLAA
                     FEADGCMVKFIGPTLGPIKASNGQSFTAEFTFEGCRTTFFDAIVFVGGPDDSFIAKLK
                     IGRLIHAAREAYMHLKPIGVLGNATQWMVNTCLPGDFSEKTKTESSVVVENGVVFAPG
                     DPTLHSIKFAKQFLEGVAHHRVWDRQVAHIAA"
     gene            757031..758087
                     /locus_tag="CNL06350"
                     /db_xref="GeneID:3254857"
     mRNA            join(757031..757229,757331..757399,757523..757638,
                     757695..757772,757840..757974,758023..758087)
                     /locus_tag="CNL06350"
                     /product="RNA cap binding protein, putative"
                     /transcript_id="XM_568159.2"
                     /db_xref="GeneID:3254857"
     CDS             join(757175..757229,757331..757399,757523..757638,
                     757695..757772,757840..757929)
                     /locus_tag="CNL06350"
                     /codon_start=1
                     /product="RNA cap binding protein, putative"
                     /protein_id="XP_568159.1"
                     /db_xref="GeneID:3254857"
                     /translation="MDALIPFTTSGSLVDLVDKKVLVILRDGRKLIGLFRSYDQFANF
                     LLESCVERLHYKLEYADKDIGVLLVRGENVVALGEIDLIAEDMVPLQQVNVQEIEEKI
                     SAENKQRERDHAVKESVLSKMGFVNEGKEGDAY"
     gene            758089..760438
                     /locus_tag="CNL06360"
                     /db_xref="GeneID:3254974"
     mRNA            join(758089..758394,758451..758542,758592..758656,
                     758704..758817,758868..758930,758981..759024,
                     759076..759402,759468..759725,759798..759994,
                     760061..760438)
                     /locus_tag="CNL06360"
                     /product="expressed protein"
                     /transcript_id="XM_024658225.1"
                     /db_xref="GeneID:3254974"
     CDS             join(758249..758394,758451..758542,758592..758656,
                     758704..758817,758868..758930,758981..759024,
                     759076..759402,759468..759725,759798..759994,
                     760061..760272)
                     /locus_tag="CNL06360"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513915.1"
                     /db_xref="GeneID:3254974"
                     /translation="MSSRLPPSSAHSIKFGHAQSTPPSKSSTFGQGRNDGVLEWLDYA
                     ECSLCRDPLLNGAAKGKHYWMTSCGHILCSSDEHQHQEGICTACNKQMELFLIQEGSL
                     PPGHEIWFQNGASLLTGAMEEMKTAMKKNTSALRVMGFQYREMKRSIQHYRDAMKEKD
                     ARITSVQREQEALMSENHELHERVAELQSQLRNFQRSQPAIVPQITPQSQYSLNSNIR
                     QAEPTHYDQPQPNTQKEYIPPPPALPTVHEEEQQPTVGFGYRMGNGDVEGSNKRRRID
                     ILEQQPRRFIPPTPASGAFEGSQHLRHPQPSHNFQTNRPMSRAFSSIAPMAIPRMGAP
                     TQVPLQGPGGRPKSTIGHMGGERRADDGDDIKSRLETYRYDPANPSPNRRAPQERSGT
                     TLPNQHERRFNTQSLQTQRLQMSVPQRPQSSFVQRLKMSNSSFVNRPGSARPTPLQQH
                     MSAPSMNSSQSMVIGTGMGGVQDSASVRMREGVLQGGARMTLTHGVGQRGSGNRF"
     gene            complement(760679..761893)
                     /locus_tag="CNL06370"
                     /db_xref="GeneID:3254965"
     mRNA            complement(join(760679..761049,761128..761427,
                     761494..761893))
                     /locus_tag="CNL06370"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658226.1"
                     /db_xref="GeneID:3254965"
     CDS             complement(join(760814..761049,761128..761427,
                     761494..761839))
                     /locus_tag="CNL06370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513916.1"
                     /db_xref="GeneID:3254965"
                     /translation="MSRFNPDELSSFREHYHTYGYVIVPSLIPDDLFPLLRESADHVV
                     DLSRSGKWDNVRVVGKPFPPWDAKDKEDIWGVQSVMHPDLGQKVFAEWYGSEGMLEVS
                     RALMGCEQEDMQFELFNLLVNPTNAAYALVWHRDDVKPTATPQEEIAALQKDYHGIQW
                     NAALYDDECLSVVPKSHLRVSAPDEKKALLGDGEMPGGIKVKLKAGETVFYNNNILHI
                     GSYDPATKRRTLHGCYGCPPPGDTSRARNILQHDLTYTLDPKFRESVPEKLKGMVDKL
                     NGMQKLLEGQVLEYSQN"
     gene            complement(762253..763071)
                     /locus_tag="CNL06380"
                     /db_xref="GeneID:3254865"
     mRNA            complement(join(762253..762517,762587..762780,
                     762830..762841,762893..763071))
                     /locus_tag="CNL06380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568160.2"
                     /db_xref="GeneID:3254865"
     CDS             complement(join(762402..762517,762587..762780,
                     762830..762841,762893..762933))
                     /locus_tag="CNL06380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568160.1"
                     /db_xref="GeneID:3254865"
                     /translation="MQRPNDSLAQRALFVKNLNFNITGADLYDLFGKYGPIRQIRLGT
                     DANLKTKGTAYVVFESPDDAKEAVNQLNGFHLMERYIVVLYHHPSKQQASALAKAELR
                     AREEALAEEKRRLGMKDE"
     gene            763210..765015
                     /locus_tag="CNL06390"
                     /db_xref="GeneID:3254869"
     mRNA            join(763210..763612,763663..763758,763806..764455,
                     764503..765015)
                     /locus_tag="CNL06390"
                     /product="zuotin, putative"
                     /transcript_id="XM_568161.2"
                     /db_xref="GeneID:3254869"
     CDS             join(763228..763612,763663..763758,763806..764455,
                     764503..764751)
                     /locus_tag="CNL06390"
                     /codon_start=1
                     /product="zuotin, putative"
                     /protein_id="XP_568161.1"
                     /db_xref="GeneID:3254869"
                     /translation="MASVVTLPITLTATPAGYSKPSPSKASAPKQLPIYPAGPSFISA
                     ARRQILQRSFADDDKAILEAREREAEEKANASGDGTQYPGLGEEEESQTVLSSDPKEW
                     KKQDHYAILGLGHLRYTATDDQIKVAHRRKVLRHHPDKKASQTGHGTNDDSFFKCIQK
                     AHETLTNPERRRQFDSIDWNINDEVPDFKKLSPEEFCAQANALFAREGRFSKVQPVPE
                     FGDLNSSKKDVEGFYDFFYNFDSWRSFEWHDKEVNEGSDSRDDKRFTEKKNKSERTRR
                     KKEDNTRLRELVDSVLALDPRIKRIKAEEKAAREAKKKGGAVGAPKQLSAAEKKKLEE
                     QKKKEEEEKKVAEKKANEASKADREAAKKAKEAARKNLKKWKKAISTVVASSNYFQAE
                     GTAASAQVIEKQLGELDALVELLEPEQVKDLKEKIEKAGNGAPAKAALQEKVAALGEK
                     GAGKFTEFA"
     gene            767128..769148
                     /locus_tag="CNL06400"
                     /db_xref="GeneID:3254786"
     mRNA            join(767128..767811,767865..769148)
                     /locus_tag="CNL06400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568162.2"
                     /db_xref="GeneID:3254786"
     CDS             join(767334..767811,767865..769063)
                     /locus_tag="CNL06400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568162.1"
                     /db_xref="GeneID:3254786"
                     /translation="MISTAAVNTPGASMNHSPAVLPTDIPRRPSPWHDIAHSLSTTSL
                     PPTSRCDSTTSLPTPPSSDPSTPPSQTPVLSASQAFKEWEERLSQPDSDATRHQLVHP
                     KRSPTPKLAAERDKMGFIEYKLKLINPTTERFERLVTQMMWRLKQGKNEAIYELGLAD
                     DGTVVGLTRAEMDASLRTLELMASEVGATVIVLKEIVLNGLASQQPTASIETITALPP
                     SDVLSHSKLLTNGWTAKRPDLDEDGQPRRGNGIPDSHGKGRRSKREKKKKKETRSQME
                     LKQKSEGDGEIVDSTRDCSMSSAASLSTDTDSSFQFDNDESPPNDLHQHQSILSPALF
                     PRKIINPVSPKSDKKRRKSAAKQEQRRLDLLRGDGTNPMWAEITSQSSKFPVESPKVN
                     LPHQPARPSSLRLATPAECPDNSFVDDLLHVPLDSLSLSFADVRTVSGTSPRQSHYPR
                     FHPHSTQLSIPSPIRPLSPVSDHSVAATTKTGTETEIVLPLDDAALTTNKILPPPPGE
                     ELICVEALVVRKVQHDHDREDEDDEAEEEEMNDWGYGGEEDVWGFGAEED"
     gene            complement(770182..772570)
                     /locus_tag="CNL06410"
                     /db_xref="GeneID:3255028"
     mRNA            complement(join(770182..770351,770410..770676,
                     770726..770961,771014..771073,771134..771256,
                     771315..771674,771730..771796,771865..771919,
                     771979..772075,772138..772570))
                     /locus_tag="CNL06410"
                     /product="expressed protein"
                     /transcript_id="XM_568163.2"
                     /db_xref="GeneID:3255028"
     CDS             complement(join(770322..770351,770410..770676,
                     770726..770961,771014..771073,771134..771256,
                     771315..771674,771730..771796,771865..771919,
                     771979..772075,772138..772483))
                     /locus_tag="CNL06410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568163.1"
                     /db_xref="GeneID:3255028"
                     /translation="MVTNHHSPEVIEHVAEKAPSSSSNSDAIEGKEDLAASQYDTISG
                     QLPELAAVGSNMDRKNEENGPRAGEELETVIPLAYRLIAFSMILFFATGSSYMQSVAS
                     PLKSTFKEKLNINNAQYGTISSASSLVNTILPIIGGIGMDYWGATYAAIISSIFVLVG
                     AIIAAAASNAENYGMLIGGLILMGFGSTVIESTQNKLYSHWFRGTSLGLVFAVDIAWN
                     RITSVIAKNTAVPMSTINGWWGWALWIPAIVCAVNMAVVMLYWWYERAVPKKYRPLLG
                     KDARVKEGWDKRKFQFGTLRRLPKFFWIFCGSQLFQNAAVSVYTSNLADIQTVTRGTS
                     TLAAGYNSSLQSVIPIFLTPLTGFFFDKIGWRMPFVSFTGALYIIVFALIGLTTVHPL
                     CPILISSFALSTNAITFIASIPILVGDDSLLGTALGIWKAFANGNSIVLDVAAGAIQD
                     RSSNGSYNNVIYFIIAIKGVQVLLGPTYYYLDRRWLAGSLRMTEENRLAKLKEVKENN
                     LDYEGWRVSKMTAAIVGFELIGLIITAWVVYIIYSLGT"
     gene            770370..771686
                     /locus_tag="CNL06415"
                     /db_xref="GeneID:36393138"
     mRNA            join(770370..770586,770654..770687,770737..770909,
                     770984..771686)
                     /locus_tag="CNL06415"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658848.1"
                     /db_xref="GeneID:36393138"
     CDS             join(770386..770586,770654..770687,770737..770909,
                     770984..771082)
                     /locus_tag="CNL06415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514678.1"
                     /db_xref="GeneID:36393138"
                     /translation="MGKISKTHNPGSDNQADQFETNDGSRHLADSPTFVIQVVLLDFL
                     QLRETILFGHTERPCKPPAIKIIEPLLDRSCFKGTATSRTIELPFANAFQIPRAVPNN
                     ESSPTKMGIEAIKVMALVDRANEEMRIGQRGWTVDVYHKVKRTYRKAFSIQFYQKRNR
                     SMGSKRLK"
     gene            complement(773892..778251)
                     /locus_tag="CNL06420"
                     /db_xref="GeneID:3254988"
     mRNA            complement(join(773892..774092,774153..774241,
                     774293..774362,774427..774554,774608..774637,
                     774685..774964,775024..775240,775291..775349,
                     775404..775687,775754..775971,776024..776186,
                     776257..776411,776476..776582,776638..776736,
                     776787..777152,777200..777421,777469..777690,
                     777738..777809,777864..777950,778001..778062,
                     778109..778251))
                     /locus_tag="CNL06420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658227.1"
                     /db_xref="GeneID:3254988"
     CDS             complement(join(773973..774092,774153..774241,
                     774293..774362,774427..774554,774608..774637,
                     774685..774964,775024..775240,775291..775349,
                     775404..775687,775754..775971,776024..776186,
                     776257..776411,776476..776582,776638..776736,
                     776787..777152,777200..777421,777469..777690,
                     777738..777809,777864..777950,778001..778062,
                     778109..778211))
                     /locus_tag="CNL06420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513890.1"
                     /db_xref="GeneID:3254988"
                     /translation="MDQQVLQCLQSTLSPEENVRKHAEEQLKQLFAVPEGGLSLARLL
                     NAQDVPLFQRQSAGVLLQQYVNQHWTPASAQFQHPITPIEVKAQIRPLVFSGLSDPER
                     KIRLASAFSLSAIARYDWPDDYPDLLPQLVNLLTSGSSDSVHGGMRVISDFVRNELSE
                     DQLLPVVQDLLPAVLNILANPEAHSPSTRASTVHVFRQVVRMLETVREEQPRAVKSAL
                     ESLGAVWLDAFSQLLSQDAGAEVQQNWESLSIRIEIFRTLSLFQSAFPRIIAPNVPSF
                     IRLAILNLQSLLPLFTAFYLSTTDDTPEPPSPTSDSGTGMTDPKIDITDLASAIFDYL
                     TPTVRTKSAVGVLMEGQDESARATEVLENLVRVVQEFTQITKENAEEWMEDTNAFVID
                     EDEETEEYSARTSGYDLIGSVMDKWTRPVAAILQNLTNTRVQESASAKQSGSPDWWKP
                     LESVLAMLGGISDDIRNALEEDLEKKRSPTIDVSYLFDQVIPSLLGQSEAPFLQGRAF
                     VFASQFSSFLPQTLVTQYLNAAVSVLESPEVSVPVKISAVKTIKNFCRHVDTAILQPQ
                     TGKLLSLLLPLLPQAERETLYLLLETIRAITSIDDSILNAQNTGPVVEQMFDVWLRCA
                     DDPVTTSIIEENIESLTLFPDPGVLSALVHTLAPKLAAAISTPVTDEIVHIPGEAVQL
                     ANSMIRMRGGPLETELVATVTRAVMEILRTTDDMDVIQHGMIHLTLVVRKDCQKLTHW
                     HDLEGNNGIASIFGLLGRFLAPTFSESGGIFVGELIMHLFRKAGEAIGPVLPDLLRAV
                     VARLATATMPSFIQTLVLPFAYLFSTEHTANTIDLLSQFSVPVPSGGEKRALDLVLSA
                     WCDTSDTITGSWNIRVSDMGMSKLFVLSDQRLREVIVKGDLIISEANRNTIMTRSRTR
                     HTPNQYTQIPFPLKALKLILKDVQSEPTSAKKATTGLDIEDDDGDEEWDDDDLLGGGS
                     NVGEFDYLSSWLDNNGAESDAQDDDEDLKSDPLAQIDLGQHLTDVLRHAYASNSNGMH
                     EMVEGLSDEEKGILRGVLTL"
     gene            778352..781587
                     /locus_tag="CNL06430"
                     /db_xref="GeneID:3254947"
     mRNA            join(778352..778452,778569..778694,778785..778934,
                     779004..779093,779142..779275,779331..779603,
                     779654..779955,780008..780167,780220..780311,
                     780362..780518,780567..780671,780719..781007,
                     781064..781587)
                     /locus_tag="CNL06430"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658228.1"
                     /db_xref="GeneID:3254947"
     CDS             join(778425..778452,778569..778694,778785..778934,
                     779004..779093,779142..779275,779331..779603,
                     779654..779955,780008..780167,780220..780311,
                     780362..780518,780567..780671,780719..781007,
                     781064..781440)
                     /locus_tag="CNL06430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513891.1"
                     /db_xref="GeneID:3254947"
                     /translation="MPLKDLLKARFTSAIQSIPAGTWKILITDEHSHALLTTVYKQFD
                     ILQQHVTSIEPLHSTRQPMTVDAIYLLTPTLQNVDRIIADFANGTRTYKSAHVYFIDG
                     IDDQLAQRLTDGMPQGILQAFVELYCNIWALEDRVFSLKAPWSFYTMFGSLGGAASAD
                     LAMEAFQDDLKVTGRSILNFLATINENPYIRYYQPHHHPPLGPLAHTAQSSSHSPQPQ
                     SNASLRWKSAMGGLSSKAPEVVGEHLSKKIAEQLQTDLDEYLTNNPEFPPASGRPRSV
                     LFVVDRSMDPAAPFLHEFWYQAMVNDLLNVEEGVRYKYKYTNTLGGLEDKVAELTEQD
                     PVWVSVRHLHMKDAIDTLMTDFGKFAQEHAGFRGGGNVNVNDLKDMLASLPQFQTQRE
                     QFSLHLDMAQECMNIFEKKRLAQVGNVEQCCATGYTAEGKTPKSIVEEMVPLLDDRLN
                     ITSLDKVRIMALYILFRDGVADEDRRRLYQHARLSLSEQDMVNNLVHLGVKVIKDHSK
                     SSKSRIKQKPTMAEGEYELSRYKPVIQMMLEDQNSNKLDPANFPYIKDMPPEANPSLR
                     GSSAQLATTSNPSGSLRSARPTWHKAPSARINNTEGKQRFIIFIAGGMTYSEMRCAYT
                     VGQALGKDVYIGSTHVLTPETYCSQLRALGRGGVGSNPPTPIPLHPQGPSRINRQPGQ
                     PVSYQEILNFRHWRPPVGPPSLAPTPQAQPQLQQKQSSHSLLTNGMSSLSLTSTAGSK
                     DKKEKQEGEKKKKKLFGLKL"
     gene            complement(780513..783083)
                     /locus_tag="CNL06440"
                     /db_xref="GeneID:3255030"
     mRNA            complement(join(780513..781788,781840..782514,
                     782591..782724,782848..782888,782953..783083))
                     /locus_tag="CNL06440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568245.2"
                     /db_xref="GeneID:3255030"
     CDS             complement(join(781765..781788,781840..782514,
                     782591..782724,782848..782888,782953..783035))
                     /locus_tag="CNL06440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568245.1"
                     /db_xref="GeneID:3255030"
                     /translation="MPPTSATASVSPTKRAPSPAPTITELDLEIAMLRCLGEIRPLGR
                     YKHFLIIQLQTEIHRRTGSWLPIELLWQRLDKLYNLEGLDEMASSSSVSIPSTPHTLS
                     PRFPLSPRSSSSPLSDLSPQRAKSRKTRNPSNKTPSNANNKKGESLDISKSARIINSE
                     HFHRTFDLPYFKSRYHLTEDEEEQSQKDSEEESDLDEPIELDGEEERIWQDMIYPRAL
                     APEGTDASWQGGSLTVEEDESEDEDMKFDDERKGKKTSVVSTVSRRESAGSGAGVEND
                     GRKRGRQTRAQEESEEDSPNVMKRKGARDVSAADSRKSKRRR"
     gene            complement(790688..790780)
                     /locus_tag="CNL06450"
                     /db_xref="GeneID:3254942"
     tRNA            complement(790688..790780)
                     /locus_tag="CNL06450"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:3254942"
     gene            795053..797763
                     /locus_tag="CNL06460"
                     /db_xref="GeneID:3255012"
     mRNA            join(795053..795235,795410..795427,795485..795506,
                     795581..795592,795753..795920,795970..796041,
                     796092..796184,796231..796298,796347..796675,
                     796726..796833,796886..797000,797052..797163,
                     797214..797239,797296..797406,797460..797763)
                     /locus_tag="CNL06460"
                     /product="UDP-glucose 6-dehydrogenase"
                     /transcript_id="XM_568166.2"
                     /db_xref="GeneID:3255012"
     CDS             join(795202..795235,795410..795427,795485..795506,
                     795581..795592,795753..795920,795970..796041,
                     796092..796184,796231..796298,796347..796675,
                     796726..796833,796886..797000,797052..797163,
                     797214..797239,797296..797406,797460..797578)
                     /locus_tag="CNL06460"
                     /codon_start=1
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="XP_568166.1"
                     /db_xref="GeneID:3255012"
                     /translation="MAPITVKKICCIGAGYVGGPTCAVIALKCPQIQVTIVDLNQQRI
                     DAWNSDNLPIYEPGLDEVVKATRGKNLFFSTDVDKGIEDADLIFVSVNTPTKKSGVGA
                     GYAADLKFLQLATRRIAEVATSSKIVVEKSTVPCRTAESMRTILEANCRPGCHFDILS
                     NPEFLAEGTAISDLFNPDRVLIGSLQTEQGIDACQALSGVYANWVPKERILTVGLWSS
                     ELSKLAANAMLAQRISSVNALSAICEATGANIDEVSYAVGKDTRMGSKFLKASVGFGG
                     SCFQKDILNLVYLSESLHLPEVAKYWRAVVEMNEYQKSRFARKVVDTLFNTITGKKIA
                     ILGWAFKKDTGDTRESPSIGIANHFLSEKARIAVYDPQVTESQIWLDMTDYGEIPAEP
                     IQPHLTICKSVEEACANAEAIVICTEWDEFKTLDWKKIYDNCPRPAFVFDGRLILNRQ
                     ELTNIGFKVVTIGTGDRI"
     gene            797873..799812
                     /locus_tag="CNL06470"
                     /db_xref="GeneID:3254723"
     mRNA            join(797873..798145,798211..798341,798412..798549,
                     798611..798688,798753..798809,798863..798930,
                     798985..799098,799154..799194,799251..799313,
                     799375..799496,799549..799812)
                     /locus_tag="CNL06470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568167.2"
                     /db_xref="GeneID:3254723"
     CDS             join(797903..798145,798211..798341,798412..798549,
                     798611..798688,798753..798809,798863..798930,
                     798985..799098,799154..799194,799251..799313,
                     799375..799496,799549..799582)
                     /locus_tag="CNL06470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568167.1"
                     /db_xref="GeneID:3254723"
                     /translation="MTAEIATVSLDVFLADPSSKAAQLEARNAAESLIRTGALIVRDS
                     RAPKEANDRFLDLFEDYFAQSQEALKEDERPELGFQVGVTLENTEKPKCSSDGDCKAI
                     IASLEASERPQDLEGFGADPKCRFFHRMSEVPPYQSNFPVLEAPNVTPRAFERTWEER
                     VNEWGMFMRQSVEGVARMVALGLDMEERAFLDAGRYGSHLLAPTATDLEKYGELNTIC
                     AGFHTDLNFLTIHGQSRYPGLHIWARNTGKKIQVKIPPGCLLVQAGKQIEWLTGGLIK
                     AGYHEVVCTEATLQTLKRRKSEFPDRPSIRISSTFFWHLSPDYELSPIPSLQREAEKR
                     FGKQEDYGTMLVGDQVRRELGLIALMPA"
     gene            799891..802369
                     /locus_tag="CNL06480"
                     /db_xref="GeneID:3254794"
     mRNA            join(799891..800173,800234..800674,800724..800843,
                     800892..801139,801192..801683,801736..801798,
                     801855..802369)
                     /locus_tag="CNL06480"
                     /product="hypothetical protein"
                     /transcript_id="XM_568168.2"
                     /db_xref="GeneID:3254794"
     CDS             join(800472..800674,800724..800843,800892..801139,
                     801192..801683,801736..801798,801855..802264)
                     /locus_tag="CNL06480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568168.1"
                     /db_xref="GeneID:3254794"
                     /translation="MPPTSRPLPPTPHSNTSDRMLPTNTLFSVLLSLAVASAAVVPRD
                     ASASFDLNSGSGTAVKDPAPVAVSIEFFTFPGYVQDLDTTSQCLNNLDRAAGAATRVR
                     IGGTTQDRATYDPTSSSAVNYYVADPADAPANLTYGPSFFDLASKLNGPTTIGLNRRL
                     NNINNTIAAAEQAVKTMNNLYAIELGNEPDLYSSSDPIADGQSWTPALDAQIQVDWQK
                     QVATSLNKKDIIQGGVFLQPPKFSIQELGPLEQSSGSIDYVKSWADHAYPQSACGDST
                     TNLEGLQNHTTIVNFVKGFEAEVTAAKSLGERPLFFGETNSATCGGGGISPTYGAALW
                     IVDYVFQSVKLGYERLYFHQGTIGNSPYSWWGKSNVFAPYYGAYFAASALKDVTSISQ
                     IDDGSSHVAVYALHSHDCISKAVVLNTFYYPNTTTTARSSEDITLTGLPNGVKKAKAK
                     RLTAEYSTSQVELGQVPTFGGQTFDNESCHVQGKEQYETVEVNKGRATISVAASEALL
                     IYF"
     gene            803224..808982
                     /locus_tag="CNL06490"
                     /db_xref="GeneID:3254779"
     mRNA            join(803224..803603,803663..804392,804448..804785,
                     804839..805075,805125..805174,805214..805268,
                     805307..805379,805427..805767,805823..806358,
                     806406..806745,806797..806939,806986..807176,
                     807230..807555,807603..807664,807713..807768,
                     807819..808145,808200..808256,808308..808316,
                     808367..808655,808709..808750,808799..808982)
                     /locus_tag="CNL06490"
                     /product="ABC transporter, putative"
                     /transcript_id="XM_568169.2"
                     /db_xref="GeneID:3254779"
     CDS             join(803451..803603,803663..804392,804448..804785,
                     804839..805075,805125..805174,805214..805268,
                     805307..805379,805427..805767,805823..806358,
                     806406..806745,806797..806939,806986..807176,
                     807230..807555,807603..807664,807713..807768,
                     807819..808145,808200..808256,808308..808316,
                     808367..808655,808709..808750,808799..808835)
                     /locus_tag="CNL06490"
                     /codon_start=1
                     /product="ABC transporter, putative"
                     /protein_id="XP_568169.1"
                     /db_xref="GeneID:3254779"
                     /translation="MTGVIGDDYSTPPHNNGNTDQLLGSTVTISEKRPQAPSPDDSEW
                     NLASQLRADQELLKSRGLTPCKSLPLAWEHLSVRGVGGLDNIEYGSSMSTILAPWLRR
                     KYRKKAALLAATRSDLPEAEKGDGDVMAWRPGMPTPKKGEPGLRKGERYLLRDFSGVV
                     KSGEMMLVVGRPGSGCSTFLKILAGHRDGYAGVEGIVKYGTLQPDKDFQPYKSEVIFN
                     SEEDLHDPNLLVGHTMDFALQMCTPSRDSRLPEEPAGNGMSRKKYQDRTKWELLKMFG
                     LTHTHDTKVGDQYVRGVSGGEKKRVSIAEVLATKASVQMWDNATRGLDADTALRYAKT
                     LRTLADIQRNTTVVSLYQAGNGIYDLFDKVTVIAEGRVIYYGPRAEARGYFEDLGFVH
                     PDGGNTADFLTAVTATNERKIREGFTGPIPTTPAEFSTLYEKSDIARRMREELEAHLA
                     DPAVDEQTKKFKESVEKQKDRWASKSRPEKADFMTQVRAALIRDYQQRWGDKWTFWMR
                     PATLLFQALIAGSMFYNMPVSTAGLFLRGGTLFLSLFFPSMISLGETTAVFSGRSVLS
                     KHKGFSMYRPSALLLAQTIGDMPLYFVMIVMFTLIIYFMTGLKVDAGLYFIYLLFIYF
                     TTLCTTALFRSIGYAFSTFNNASKASGFALLMLSMYAGYIIYTPQMHPWFSWIRWLNP
                     FYYSLEAIMASEVYGLELECVSPQLAPYGGDYAQYNQGCAITGAEPNSITLDGTLWME
                     SALNFYKSHVWRNFGILIAFWVFFLGFCALMIEMIPAAGSTKSVLLYKPGGGGKYIRN
                     AQKNGASPRDEEDGPNDSQLNEKSQGTSDGTAAEVQAVNSVLTWKNLCYTVNANGQPR
                     QLLNNIFGYCKAGTLTALMGSSGAGKTTLMDVLAARKTDGDIRGEILMNGKQLPISFQ
                     RTTGYCEQVDVHLPQATVREALEFSALLRQPRTLSDKEKLAYVDVIIDLLELHDIEDA
                     LIGTPEAGLGVEQRKRLTIGVELVSKPTLLFLDEPTSGLDGQSSYLIVSFLRKLAAAG
                     QAVLCTIHQPSAALFARFDQLLLLKGGGNTVYFGPVSELTSYFEKQGVTIPKNVNPAE
                     RMIDIVSGDLSKGRDWAQIWLESDECKERARELEELKKAGADNTASVEGDEHEFASTN
                     ITQLKLVTKRASVQLWRDTEYVMNKVALHVLAALFNGFSFWKIGDAYADIQNRIFTIF
                     LFVFVAPGVIAQTQPKFLHNRDIFEAREKKAKLYSWHAFCFAEIVAEIPYLLVCALLY
                     FAPWYPTAGFSFKPGIAGAIYLQMTLYEFLYTGIGQFVAAYAPHEVFAALVNPLLIGI
                     LVIFCGVLVPYDQITAFWRYWMYYLDPFQYLLGGLVSRALWDVEVKCKSDEYAVFNPP
                     EGMTCENYMSAFLSEAPGYLNNPNATSDCEYCVISKGSDYLKALNLEKKVDGWRDIAL
                     TFLFVLTSYGMVFLLLKLRSKRSKMAQ"
     gene            complement(809493..811404)
                     /locus_tag="CNL06500"
                     /db_xref="GeneID:3254854"
     mRNA            complement(join(809493..809699,809753..810521,
                     810571..811001,811053..811404))
                     /locus_tag="CNL06500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658229.1"
                     /db_xref="GeneID:3254854"
     CDS             complement(join(809553..809699,809753..810521,
                     810571..811001,811053..811232))
                     /locus_tag="CNL06500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513892.1"
                     /db_xref="GeneID:3254854"
                     /translation="MSKTTLLRKASLVGYPDNTTYSVLVKDGKVAAIRETGAGDIEKA
                     DETIDMRELDSHWVSPSLIDWHTHTKLNALHNHRLDLQTAKTAQEVLDRVVVAIKDPK
                     YEPKYDTNFCGINLRNAEWPDPEKLTRLSLDNISTERPIFLFFNGYHSICANSLGLKL
                     GGYVPEGHNGYLYEGEAFELSRVIGNVDVEAIDKWIMDEAKYAATLGVTEIVDLEWEL
                     NIPNWQRRYKKGFRTLRVHVGMYTEHLPYSIERGWKSGDDVPETNGLIKVGPFKIVTD
                     GSLGSQTAFCHEPYPGSTDNYGMLAYKPEALSELIRRGTDNGFKLAIHAIGDHANQLT
                     LQTLAKAEKKVLPGSTIEHAQLLSFEDLPLFRSLNVIASIQPCHLVDDRDLCHKFWPG
                     REHRAYPFRWLVDAGVPIKLGSDCPVAPLQPWEAIAVAMTRAAEGDEHNPFCKEQIID
                     LEVAWQASTSNGKPKLEVGDRADLCILSANPLNCDAAGIRAMKVKGTMLGGDWTHKAF
                     "
     gene            811938..813104
                     /locus_tag="CNL06510"
                     /db_xref="GeneID:3254868"
     mRNA            join(811938..811959,812017..812844,812899..813104)
                     /locus_tag="CNL06510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658230.1"
                     /db_xref="GeneID:3254868"
     CDS             812088..812831
                     /locus_tag="CNL06510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513893.1"
                     /db_xref="GeneID:3254868"
                     /translation="MHIPAVHAELNLPVLHAFIRQYPLGLFTTSIPHPKNDTLQMSHI
                     PFVLDVDPDQADDKGRLRGHMARVNPQSKSIIDSLSAKGDSTQLVEEDILIVFNASVH
                     SYVTPKFYLETKPTSGKVVPTWDYAAVQVYGRAKIHYANNDATGSFLQKQIQDLSEQE
                     EKTMLKRTGNEGGSTWKVSDAPEKYVEILKKAIIGVEIDIKKIEGRFKLSQEKNGGDW
                     QGVVSGFRSLGTDEGNSMAEMVEENGKKS"
     gene            complement(813315..815769)
                     /locus_tag="CNL06520"
                     /db_xref="GeneID:3254934"
     mRNA            complement(join(813315..813595,813646..814066,
                     814120..814317,814365..814584,814643..815203,
                     815706..815769))
                     /locus_tag="CNL06520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658231.1"
                     /db_xref="GeneID:3254934"
     mRNA            complement(join(813315..813595,813646..814066,
                     814120..814317,814365..814584,814643..815639,
                     815706..815769))
                     /locus_tag="CNL06520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568172.2"
                     /db_xref="GeneID:3254934"
     CDS             complement(join(813550..813595,813646..814066,
                     814120..814317,814365..814584,814643..815089))
                     /locus_tag="CNL06520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513894.1"
                     /db_xref="GeneID:3254934"
                     /translation="MQIGPLVPLLALLAAPALARSSLHPNAAAHRRQDVGQERINSAV
                     ERREALAQSQPRALSEKPNKRKITRRGGRSCRARNSTATASDSATASATASALSEDSS
                     AVYSDAESASSTQAPVENTSSSSENVAATTSSIENIAALQQPSSSSSTEDSSTAASLT
                     SVASAAATSSAAATSSAAATSSSAATSSSSNSTGSYTPNGIKAGVTGDDPLSFLQGHI
                     GWYYDWNATPTGSASGASPANMLWGAGTVDSTDASRLAAFQALTTAPQYIIGFEEPDC
                     STSGSSNIGVSDAASLWDSTIAPWKDQGSILISPSMCHQAAEEYTKWLSTFSTQISTS
                     WDITNLHINKNSMDGVKEDIDYYYNTYGKPIWVTEFACVDDSTDFVPCTDQSEINTFI
                     NDIVALFESDDRVQAYAYSTGEGLSSEWDMVSNGALTESGQTYLTAISQYH"
     CDS             complement(join(813550..813595,813646..814066,
                     814120..814317,814365..814584,814643..815089))
                     /locus_tag="CNL06520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568172.1"
                     /db_xref="GeneID:3254934"
                     /translation="MQIGPLVPLLALLAAPALARSSLHPNAAAHRRQDVGQERINSAV
                     ERREALAQSQPRALSEKPNKRKITRRGGRSCRARNSTATASDSATASATASALSEDSS
                     AVYSDAESASSTQAPVENTSSSSENVAATTSSIENIAALQQPSSSSSTEDSSTAASLT
                     SVASAAATSSAAATSSAAATSSSAATSSSSNSTGSYTPNGIKAGVTGDDPLSFLQGHI
                     GWYYDWNATPTGSASGASPANMLWGAGTVDSTDASRLAAFQALTTAPQYIIGFEEPDC
                     STSGSSNIGVSDAASLWDSTIAPWKDQGSILISPSMCHQAAEEYTKWLSTFSTQISTS
                     WDITNLHINKNSMDGVKEDIDYYYNTYGKPIWVTEFACVDDSTDFVPCTDQSEINTFI
                     NDIVALFESDDRVQAYAYSTGEGLSSEWDMVSNGALTESGQTYLTAISQYH"
     gene            818112..822314
                     /locus_tag="CNL06530"
                     /db_xref="GeneID:3255001"
     mRNA            join(818112..818607,818673..819558,819621..819699,
                     819747..819841,819892..820300,820358..820462,
                     820524..820853,820910..820993,821051..821452,
                     821515..821739,821792..821898,821981..822056,
                     822113..822314)
                     /locus_tag="CNL06530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658232.1"
                     /db_xref="GeneID:3255001"
     CDS             join(818172..818607,818673..819558,819621..819699,
                     819747..819841,819892..820300,820358..820462,
                     820524..820853,820910..820993,821051..821452,
                     821515..821739,821792..821898,821981..822056,
                     822113..822133)
                     /locus_tag="CNL06530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513895.1"
                     /db_xref="GeneID:3255001"
                     /translation="MADGLTREDIILQNLGDDRSESGNVEEDERDRALGEEDDGQRGH
                     EGSSEPGENDNQGVGEEVEKEEVKDAQQEHGADGEAAEKSAETSVEEVTPEDNGDAAA
                     DAVPQVKGGDDEEPVEMAKEVDLEDKKETTTGVRKVLKSGVFGDAPKPTPLPKAAAGV
                     ASSARLSRPSLAPVRPGAAATKTTAPSTSKPASGSAATTSAAARKTGASRASAPAISG
                     ANGTIARPTTTTATSSTRPRTTTAASDRTTSSGTARPATTSTTSTIAARARAGMTKPS
                     VPTAASARTAARPTSSTTARPTHPTTTSTLARKPETKPASSTATATRTTRPSVTSTTS
                     TATRAPLASQRTSASAAGTTAARTGVTRPLAGRASMAPTASSSRAATGVPPKVRAGSG
                     PSTLASGGKEVTVLKAKVEELEKNIADEKTKYEEKIAALAQEKVDLEECHGKALEELR
                     AELANATDKAGSDAEGKIAELTALHETQLKEAEEERNRLMMEMVSKLQKMGAEYSSIQ
                     TQLQSARSELTSSENELCSLKSSLQTAQDELSRLRTTASDRDTAFAELESSKASLQTR
                     LDELETIRNSLETKLAEGEGEADKSLADVAGLGDKVKELEDQIVELENKLGSEKGVWK
                     QEEVKWQEIKAALEKEIEDLKNAAEGHAEGLSRASSSAEASKEELGALRIAHEQLTTT
                     YAGLVEASSRHPEDVENLQRQLKEATDKHGALLLEASSSTNDQSAELKAQIEELKKEK
                     EEKEKEVEELKGTLEEVEQEVELLKNARREGEERERQLNKIIAGLEAEIVELKAEFED
                     RYTAGYEDAKRAAGEEHHKELASIRSEISVTHSRLQDAHTAELESLKASQSTTLATLN
                     ADHSSQTSALGLSLQAANAQVEQDQAKLESVSEERDALAEQVERLKAELEGASARGDE
                     VDPEVEAELKKVKAELQHVSDELAGALEMSEMNKAHFEQTLSTMQEQQADEVRAAVEG
                     REKQYAQEKAQYTSEAGELRAEMEKLKIELNDEKAEKESVLARLAEKLGAPSTPPRAE
                     IVSSPSFARLHEAHNAKVTELESEIARLKAELAGKPVIASEPVEEYEDDETLTF"
     gene            complement(822281..>823912)
                     /locus_tag="CNL06540"
                     /db_xref="GeneID:3254995"
     mRNA            complement(join(822281..822774,822826..823216,
                     823297..823375,823444..823529,823568..823626,
                     823683..823798,823865..>823912))
                     /locus_tag="CNL06540"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024658233.1"
                     /db_xref="GeneID:3254995"
     STS             822384..822635
                     /standard_name="Pvu10"
                     /db_xref="UniSTS:470737"
     CDS             complement(join(822393..822774,822826..823216,
                     823297..823375,823444..823529,823568..823626,
                     823683..823798,823865..823912))
                     /locus_tag="CNL06540"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513896.1"
                     /db_xref="GeneID:3254995"
                     /translation="MPPLQTYSERPVVLLTNDDGPPCDSSPNIFSFAKTLQARLGWDV
                     RVVIPDSQKSWVGKAYAISDIVSASYFYPQEPQGLTGDVSPVRRPLKHGESMEWVLLS
                     GTPSSCANIALHNLYPGEIDLVISGPNHGRNSSTAFALSSGTIGAALAATLSVPLPGP
                     APLASLHTEHVPCIALSYAVVSRPVPPRLLALAAETSVDVCKRLFDNWGHDSVPGKGG
                     KVQIYSVNVPLVEEYLEKGNRKAVYTELWKNAYGRLFKPTALDTTHFDPGDDPDQGKK
                     DITENQPNRPQALPVPAHTETSKGTPGPAALPTPSPTPTPVNAADPAHNPQQQQQLKF
                     RFAPNLQPVLFPREDTLPEGTDAWALASGYVSVTPLRAEYNCIPVGQFGSEL"
     gene            complement(824022..825154)
                     /locus_tag="CNL06550"
                     /db_xref="GeneID:3254993"
     mRNA            complement(join(824022..824601,824677..824788,
                     824902..825154))
                     /locus_tag="CNL06550"
                     /product="orotidine-5'-phosphate decarboxylase, putative"
                     /transcript_id="XM_568176.2"
                     /db_xref="GeneID:3254993"
     CDS             complement(join(824093..824601,824677..824788,
                     824902..825090))
                     /locus_tag="CNL06550"
                     /codon_start=1
                     /product="orotidine-5'-phosphate decarboxylase, putative"
                     /protein_id="XP_568176.1"
                     /db_xref="GeneID:3254993"
                     /translation="MPHPTTLKTYASRIPLHTNPTARRILSIMDRKRTNLCVSVDVTK
                     AAEVLEVVRRVGASVCMVKTHCDIIEDFTLEFADELVKLSKQLDFVIFEDRKFADIGN
                     TVSLQYSSGTHKIASWSDLTNAHSVPGPGIITGLASIGLPLGRALLLLANMSSKGALA
                     TGEYTKQTMRMAREAGREFVVGFIAQERVDAGEDGDWLIMSPGVGLAAKGDKLGQQYR
                     TPKEVVRDAGADVIIVGRGIYGVQGGEEAVKAEAERYREEGWKAYEERLSR"
     gene            complement(825210..828737)
                     /locus_tag="CNL06555"
                     /db_xref="GeneID:36393139"
     mRNA            complement(join(825210..825684,825748..826823,
                     826876..826964,827011..827147,827203..827289,
                     827341..827742,827815..827950,828083..828121,
                     828302..828737))
                     /locus_tag="CNL06555"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658849.1"
                     /db_xref="GeneID:36393139"
     CDS             complement(join(825684,825748..826823,826876..826964,
                     827011..827147,827203..827289,827341..827742,
                     827815..827950,828083..828121,828302..828590))
                     /locus_tag="CNL06555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514679.1"
                     /db_xref="GeneID:36393139"
                     /translation="MAPSTRSTSKSPDSVVHDTFPVRESRVAPTISTGNYNSNYPSTP
                     GLGISRTDASVDNNEGPEVVINTIFNSDSEVETHSEPSTPKYEVRLFGLSQAVTSDHL
                     INFFAAHTKVLGILMHATSNSSANLQWAQVWVPSEADVARCLGLKACLAPSGITLVRA
                     PSTNFAQAQGISTVTTPELKTANASFELKTPTTPLLAPPAPFSSAYNTDCASSNPLFA
                     LDSSSIQSMGSAPISTSTTGFNIASLSDSFSSLNLGMNLRDSSGLGYRHVDPQGPLPR
                     NLYVMGLPLDMTQIQFKTLFTPFGMVEHSTLLSQLDGMGRRRGFVLMSTHQEAVETMR
                     AMNGTWHGGFKMDVSWALVQREAKHFGSSNIMPNRVVHPPTVSIRRESVEECTVVVEN
                     LDSAYFPDSASIRDIFNHFGPVSRVNIISSNPFKILIQFDHAVSATALVAANGLNLGG
                     RPLVARRYVGAINTLVPTLNSATAGLPQLASMTMPIARTAFDPFGQQQPSQYQTQSHA
                     QHSLSFPLQDRTSPLSRMTVRKGNEPLGFGHCFSYLQSLPQFEVHQSNPPQSLARSTL
                     SFQARPQSQPISNQQFQQLRQSDVMQTQNWQQFSPFTTFMEPTRGMDTNHRFGLDAKP
                     TGNSLIANNNSNGKGNDKLASLESKPFGTNTLKSDLFVPLPWHPVGDNKRHINEALKE
                     TNDSTTLQNVPLGLNKTAAKTGLGTRDENKPPMTNAIGSMAPVGSTADLEFGGLGVRG
                     MRDRWQVSPDW"
     STS             826583..827176
                     /standard_name="Pvu9"
                     /db_xref="UniSTS:470738"
     gene            complement(829041..830727)
                     /locus_tag="CNL06560"
                     /db_xref="GeneID:3254981"
     mRNA            complement(join(829041..829465,829520..829758,
                     829812..829918,829994..830153,830207..830310,
                     830374..830727))
                     /locus_tag="CNL06560"
                     /product="t-SNARE, putative"
                     /transcript_id="XM_568177.2"
                     /db_xref="GeneID:3254981"
     CDS             complement(join(829132..829465,829520..829758,
                     829812..829918,829994..830153,830207..830310,
                     830374..830659))
                     /locus_tag="CNL06560"
                     /codon_start=1
                     /product="t-SNARE, putative"
                     /protein_id="XP_568177.1"
                     /db_xref="GeneID:3254981"
                     /translation="MSNYNPLSPADEPITRSRTLFFLSIRDSNPFSRARPSREYGHQI
                     SLDDDGDGEGEGERLIGGREGWKEVGMKGLPPKWVDLSEEVEEILGRTRNKIAVLDKL
                     HAKHVLPGFTDRSGEEREIEKQTIDITRDFRRCTSLISSITPERGAPRVQVLTTKNVQ
                     RGLAQKVQEMSGQFRKKQKVYMSKLQGHQIKNKDLMVASGAITLKGTEVLDELQEDEQ
                     ASQNQLSQTQQAQSAVNIDIQRRSREITQIASSISELAELFRDLGQMVVEQGTVLDSV
                     EWNVMEAAKEVKGGEEELVVARRYQANTARRKCIFFLLLCIFALILILIYKPRSHSSP
                     SSPASSSSLLSSNSTATSSSWGKSTARVRPSHAKGSGKGGIVLPSSTGSTGKGKGRPS
                     LPRPPPLASTTGRHGSS"
     gene            830899..832773
                     /locus_tag="CNL06570"
                     /db_xref="GeneID:3254967"
     mRNA            join(830899..830997,831043..831154,831200..831282,
                     831337..831369,831416..831543,831589..831719,
                     831772..832206,832253..832773)
                     /locus_tag="CNL06570"
                     /product="ubiquitin fusion-degradation 1-like protein,
                     putative"
                     /transcript_id="XM_568178.2"
                     /db_xref="GeneID:3254967"
     CDS             join(830973..830997,831043..831154,831200..831282,
                     831337..831369,831416..831543,831589..831719,
                     831772..832206,832253..832751)
                     /locus_tag="CNL06570"
                     /codon_start=1
                     /product="ubiquitin fusion-degradation 1-like protein,
                     putative"
                     /protein_id="XP_568178.2"
                     /db_xref="GeneID:3254967"
                     /translation="MNHGYDSEDEFDHYAAPPPLPGGPAGILSHLMGGGFGGFHSAPP
                     PSAYDDYFKAYSTAVMGGRERPEVMYGGKIIMPPSALARLSALDIPSPWTFQLRNPRS
                     PTQHITHAGVLEFIAEEGIVHLPAWMMKRLNLEEGDPIRLTGAKLPKGKMVKIQAQNT
                     DFLQVSDPKSVLESALRFYSTLSPDDIIEITYNSLTFEFLIMSVVPEGPGISVIDTDL
                     EVDFATPKGYVEPPRPEPKPIPTMADKLNIDLSSNEPTGSGAGSVSGGSRPGTSMGTQ
                     TPVESFTGVGQSLSGKKVKGKGLAKKIEEVDPSSKINRADGPRIINSSSLSSTNTQVP
                     SALILPEGKFFFGFKYIPYDPSKAPKPSLADQQKVELQPFGGEGNTLKGGKRIGGEEG
                     KGKEKAAEDEKEDPWAKLGSGNTLKRTTTTAASSSSTPAPVSAPLEEFKARKATEQEI
                     IDATMLDEDDFMFEDEEDDEDDVIEIDSDYD"
     gene            832997..835677
                     /locus_tag="CNL06580"
                     /db_xref="GeneID:3254953"
     mRNA            join(832997..833338,833392..833559,833614..834106,
                     834256..835677)
                     /locus_tag="CNL06580"
                     /product="hypothetical protein"
                     /transcript_id="XM_568179.2"
                     /db_xref="GeneID:3254953"
     CDS             join(833037..833338,833392..833559,833614..834106,
                     834256..834267)
                     /locus_tag="CNL06580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568179.1"
                     /db_xref="GeneID:3254953"
                     /translation="MSNDWWSQTPSRYTSTPIHPTLSRSQSISQSTRTRFAGDELDPE
                     DSRAADAVKFLPSFASSQAGRVALGTSPTGGMSMSVGSPQGERRSPQGRLSGSVHESN
                     SPRHTTRARSLAQSAALSSSTANGPAPMDEDMPPTASLRDSVTESRVTTVVASNELPT
                     PPSLLPTKSTTTLYIFGPPPNILSTLQPYLSQFGPIASYRPGPEGSNWYTVEYTTPLG
                     AAYALRRHGEILGGQWMIGFKVGIGGAMEGIGSIPGEGDVQGSSSQVPPPTVGTPIRV
                     QHKEILRPKVVQPVVAKAAVKSGNEYAWDEPEGSGGWTGWVSERLFGR"
     gene            complement(834437..836848)
                     /locus_tag="CNL06590"
                     /db_xref="GeneID:3254952"
     mRNA            complement(join(834437..834763,834824..835198,
                     835260..835537,835606..835655,835709..835791,
                     835858..836130,836215..836848))
                     /locus_tag="CNL06590"
                     /product="hypothetical protein"
                     /transcript_id="XM_568180.2"
                     /db_xref="GeneID:3254952"
     CDS             complement(join(834504..834763,834824..835198,
                     835260..835537,835606..835655,835709..835791,
                     835858..836130,836215..836380))
                     /locus_tag="CNL06590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568180.1"
                     /db_xref="GeneID:3254952"
                     /translation="MSYKEDKDLEEEGGDAPQAITTLIEEVYINKYTFTEEESRSLVR
                     KLDWHILPYIWWCYIFNSLDRSNVSNAKSDGMPTDLNFPDEGYAIMLSVFYVPFCLLV
                     VPSVMLTRKIGPKWTIPGYMIGWGGMAMVNAGCKNFAGVLAVRLLLGAFEAGFAASLI
                     FYLTTFYTRSELGKRIAVFYSCNALSGAFSGLIAYGVFQMDSKLWGWQILFLIEGAFT
                     VAFAILTAFMLPWSLDEARFLDEREREVGRLRVLKDGSSKTGTKFNVREFFKPLKDPR
                     FYAFASIAICYGCAASMAGNFLTQIIGRFNYSTVKTNLFTVAPYVVGTICLLLTSWSS
                     DRFRERGFHLASSFVLVLIGCIILIAIPVSQVGAGYFATFLITAGAFTPPVLFHTWHQ
                     CNDASEDGRAFRVGSYTFLANTGGIVSANIFLDKWAPAYREPLAITVGIEALALGLVI
                     ALRMWMYLDNKKRNKAQGVNWQSKDVPTEALADGLKNPVFRHFY"
     gene            837090..838782
                     /locus_tag="CNL06600"
                     /db_xref="GeneID:3255038"
     mRNA            join(837090..837487,837548..837640,837727..837859,
                     837934..838068,838151..838210,838307..838782)
                     /locus_tag="CNL06600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568183.2"
                     /db_xref="GeneID:3255038"
     CDS             join(837320..837487,837548..837640,837727..837859,
                     837934..838068,838151..838210,838307..838551)
                     /locus_tag="CNL06600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568183.2"
                     /db_xref="GeneID:3255038"
                     /translation="MKAYVDGRKAASGKADSKAVRLATASGTHVLSIPNYAVAMAIAL
                     LHQLPRQIVGARTEQRWLSEEECDMDGQAYYARKTFHRTAGLLGYGSLGRETARLLKA
                     HGMRIIAANTSGKATLQDGYVIPGTGDKDGSIPEAFYSTKDPKSVKEFLNQCDVLVAS
                     LPNTPATQYFLNKEKLEMLPKGAVLVNVGRGSLIPSDDLLAVLNTPHLFGAALDVTDP
                     EPLPAQHPLWSHPKCIITPHLSGNTQGEMEIAADVLLFNVQRMKDGKEVVNEVRWDRG
                     Y"
     gene            complement(838650..842977)
                     /locus_tag="CNL06610"
                     /db_xref="GeneID:3255020"
     mRNA            complement(join(838650..838971,839043..839138,
                     839212..839730,839790..840116,840176..841665,
                     841712..841893,841944..842396,842448..842977))
                     /locus_tag="CNL06610"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658234.1"
                     /db_xref="GeneID:3255020"
     CDS             complement(join(838804..838971,839043..839138,
                     839212..839730,839790..840116,840176..841665,
                     841712..841893,841944..842396,842448..842953))
                     /locus_tag="CNL06610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513897.1"
                     /db_xref="GeneID:3255020"
                     /translation="MDHQTRLFQMLNAATSPPPNKSAATASSPREPEPTPPPPSLQSV
                     SLNDLFKGIQLQTSSPSVSANGSAAGVALEKASNASVAGPTIGLGHIGQHTPGTRSAS
                     QASVGSAPVSSPPPPSGPAQDQRAKLLGMLSFGGSGAGTPVNVTTSGFPTPLSGHVQP
                     ESQASAPFGGIKSPVIDHSNPPQPNITPAQDPAIASPPIVESNATQTPEPAQPQGQGE
                     QPRPKSAVPNFSFVSPFDAFDDPTPVAVSPAKEKKPEPEVVKHEEKIQATAPAPKEVK
                     GKKDKVKSPAPSKAPELPVAAQEASLKEEPVADNALPQNQQGSGPKTTQSHITIDLSE
                     PNLDSLISTPDLLYIQPTTLLKVDVGYKKGRKVGLTRQFVAYTMSKGKIRLIDSRSGA
                     RLMLQTTTSTPGPIIDIAVCPVYVAALAADRSLWIWRVPAGWREDNPPVDLTLISHTT
                     GSAIGKAFKVGWLKKNGADWVIVAGDEGVTMFDPTREGRGVKKAEETFAGKTIFRTMG
                     NVVDFCVNNTQSAMGILSSDSTFSLYSTQSLNRVWQRSIPSSSPHSPPSSAHFIESNV
                     LIGREQNTHFDLVQITVSLAVLSSIHFVAPPGLDASSHYAHAMYDPFSGLLFITPFAR
                     SSLYAFRYALKDTEPVRDAGSPNSPQVVAFDRMAEFPLTQQGSSGTGVVTIGMIAHLG
                     RDPGPGREEGDLEWFYGTAEGFASASMGKQATGLVKGGVVASAVASSAAAATSVEPKK
                     EKEAEKEIQQPEKKERKKSAQSTPTSKTLPLPQNLPVPQPLPSIGSRTNSTSGSLVEE
                     AGGAAAAAASTGMNSRKLKKEKRKEERALARAQAAAEAESKIEAAWGAETLSAVPEAK
                     SERAEAKSERGAAANEEALKQMEGRLSTQFQDLLTASISPLSAQLATIASPSFSSNIA
                     ARVERSLQPQIMSSISIELQKNLKGLMPQMVGEISNEVQREVKSCLDKVPKDLEKGLG
                     PVVSRTVAGVVQTSVEKMIQQAIRSHLLPTLTQSTSSLTDTLLTELKSEMLQIRKELT
                     PLPPPVVPETKRNVGEDELLNKLQEMSQQMEALQTAVKDIQGRNLNGINHAQSVSNLS
                     TTQGPLPPPIQNTRLPTPAQLEDTFLAALTAQTVPSTLQLVDDHLGLTDYCLPVSGKS
                     PLSQAVLLTLLHRTSIAIADIPAQHPVFPHLVTWIRRTINLLDPSDPNIKEYIVRLYP
                     VVQTHLSNVIASVQASGNPHVQAQFLPVLKEIGDVLAAKVNV"
     gene            complement(843165..844803)
                     /locus_tag="CNL06620"
                     /db_xref="GeneID:3255023"
     mRNA            complement(join(843165..843581,843644..844016,
                     844084..844237,844546..844803))
                     /locus_tag="CNL06620"
                     /product="expressed protein"
                     /transcript_id="XM_568185.2"
                     /db_xref="GeneID:3255023"
     CDS             complement(join(843576..843581,843644..844016,
                     844084..844237,844546..844609))
                     /locus_tag="CNL06620"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568185.1"
                     /db_xref="GeneID:3255023"
                     /translation="MVSPAFPGLFFAFAAAVLLLFASISPPAWDQVGFLTTTAGTTKT
                     VFGVFGECVKGGSCSSKSVGYDLVINGATDVNINQTVLHNLTYAMILHPIAGFLALLA
                     LVFGLLGACAASRVATIFMALCSALGLIITLVVFVIDMVLWNVVKNHARDGGVQATLG
                     NANWFTVAALASLFLSMCTSVCGACGRFANGRMAGEKY"
     gene            complement(845945..847767)
                     /locus_tag="CNL06630"
                     /db_xref="GeneID:3255024"
     mRNA            complement(join(845945..846672,846737..846812,
                     846973..847171,847232..847335,847404..847469,
                     847543..847767))
                     /locus_tag="CNL06630"
                     /product="put. CPS1 protein, putative"
                     /transcript_id="XM_568186.2"
                     /db_xref="GeneID:3255024"
     CDS             complement(join(846597..846672,846737..846812,
                     846973..847171,847232..847335,847404..847469,
                     847543..847570))
                     /locus_tag="CNL06630"
                     /codon_start=1
                     /product="put. CPS1 protein, putative"
                     /protein_id="XP_568186.1"
                     /db_xref="GeneID:3255024"
                     /translation="MGGQLSKALGKLFGNKEMRILMLGLDAAGKTTILYKLKLNQSVT
                     TIPTVGFNVETVTYRNVRFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSGDRDRIDE
                     ARLELERILADREMRECLLMVFANKQDLPGAMSPAEVTEKLGLHRMKDRSWYVHPSCA
                     TTGEGLFEGLQWLSSNVKNLKV"
     gene            848237..849886
                     /locus_tag="CNL06640"
                     /db_xref="GeneID:3255027"
     mRNA            join(848237..848317,848372..848424,848472..848708,
                     848763..848908,848964..849319,849378..849886)
                     /locus_tag="CNL06640"
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
                     putative"
                     /transcript_id="XM_568187.2"
                     /db_xref="GeneID:3255027"
     CDS             join(848285..848317,848372..848424,848472..848708,
                     848763..848908,848964..849319,849378..849683)
                     /locus_tag="CNL06640"
                     /codon_start=1
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
                     putative"
                     /protein_id="XP_568187.1"
                     /db_xref="GeneID:3255027"
                     /translation="MPSPTRVSIRDAMELLDDRRVKIVRPLIPPQILHEELPLSLRGA
                     QTVLDGRRQVEAVIKGDDDRLLVVVGPCSVHDPEQAITYAKALKEYADKAAEDLVIVM
                     RVYFEKPRTTVGWKGLINDPDMNGSYQINRGLKIARKLLLDITEIGLPAAGEFLDVIS
                     PQYLADLFAWGAIGARTTESQVHRELASALSMSVGFKNGTDGSIGIAIDAIKAAGSGH
                     TFLSVTKQGLSAIVETEGNSSTHVILRGSSKGPNYGADDVAACAEKLNKSGLPAKLMI
                     DCSHGNSSKQHLNQIKVGADIASQLSSGPTSNAIVGVMIESNIFEGRQNVPAEGPSGL
                     KYGISVTDACISMEQTIPLLDELRKGVQARREAVKAKREGQQ"
     gene            complement(849997..851140)
                     /locus_tag="CNL06650"
                     /db_xref="GeneID:3255031"
     mRNA            complement(join(849997..850384,850449..850522,
                     850601..850651,850711..850749,850851..851140))
                     /locus_tag="CNL06650"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_568188.2"
                     /db_xref="GeneID:3255031"
     CDS             complement(join(850102..850384,850449..850522,
                     850601..850651,850711..850749,850851..850895))
                     /locus_tag="CNL06650"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_568188.1"
                     /db_xref="GeneID:3255031"
                     /translation="MEYIGKATEVVKHFRETKLSTLKPPQEFFDHRQLSRPKNMNEAT
                     SRVTYNTRHYSGNYLIVIAILAVYALITNPLLLIALAFLAGGFAAINKFAPEPMQVGD
                     HIITQKSLYTALFVIGLPLLWIASPVSTFFWLVGSSAILILGHAVLMEPGVESEYAGI
                     EQV"
     gene            851232..853543
                     /locus_tag="CNL06660"
                     /db_xref="GeneID:3255011"
     mRNA            join(851232..852383,852443..852872,852925..853016,
                     853095..853299,853359..853543)
                     /locus_tag="CNL06660"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658235.1"
                     /db_xref="GeneID:3255011"
     CDS             join(851662..852383,852443..852872,852925..853016,
                     853095..853299,853359..853373)
                     /locus_tag="CNL06660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513919.1"
                     /db_xref="GeneID:3255011"
                     /translation="MANYQPLATSPTVADVVESQQHKHPVRRRWHLRTRPLLLFGLLG
                     TCSLLGILYALFFRPSSYETIIIKAADNPYFQTGEVWTHNDQVAARLERCATLGLLRN
                     TSLPLTSHERLSDEEESELVAQGCGTNETTVIILSSIYFAEAFSGASVTGETVYAQSV
                     ISTLNAYNYSYMFSSLGWWNPDMRKTVELWHKHRWNVRMVLADPEQVDVCWKLTDQKC
                     LKTENNLEGIEAWRLLAFWYWDDPGTPLGPQFTLSPSPRNSNHFLSYSIEPTCHRLPY
                     LPPSQRSDPPQAYLLAKQMHYLDDTPAFSWTLPALMGLQEEFGIQVVAGLRDDDPVTA
                     KAVEDIGLKNLGKLGVIEFYAQLSKSFVLLGVGRPRISPSPWDALCMGVPFINPILTW
                     DETDPLNRTKWHAQQWHMTDLDPPYVYSVPTHNLTALRLAVQAALLNPIESFIPPYMK
                     WEFVLEKMVEMVEGDWREKAKRLLEERVRNGGQTFVL"
     gene            complement(853637..856069)
                     /locus_tag="CNL06670"
                     /db_xref="GeneID:3255025"
     mRNA            complement(join(853637..853866,853944..854008,
                     854078..854159,854223..854316,854375..854398,
                     854451..854482,854532..854661,854712..854785,
                     854835..854881,854932..854944,854993..855095,
                     855148..855344,855393..855665,855711..855755,
                     855812..855827,855880..855923,855976..855984,
                     856036..856069))
                     /locus_tag="CNL06670"
                     /product="Tubulin beta chain, putative"
                     /transcript_id="XM_568244.2"
                     /db_xref="GeneID:3255025"
     CDS             complement(join(853784..853866,853944..854008,
                     854078..854159,854223..854316,854375..854398,
                     854451..854482,854532..854661,854712..854785,
                     854835..854881,854932..854944,854993..855095,
                     855148..855344,855393..855665,855711..855755,
                     855812..855827,855880..855923,855976..855984,
                     856036..856063))
                     /locus_tag="CNL06670"
                     /codon_start=1
                     /product="Tubulin beta chain, putative"
                     /protein_id="XP_568244.1"
                     /db_xref="GeneID:3255025"
                     /translation="MGREIINVSVGQAGNQIGTAFWENILQEHGLDRSGKATTDDPHI
                     LDKVDVYFTEASNKKYVPRSIQVDLEPGVVDLVRSGPLANLFRPDTFVHGESGAGNNW
                     AKGYYTEGAELVDPVLDVLRQQAENSDSLQGFQLLHSLGGGTGSGLGALLLGKIREEY
                     PDRMLATFSIFPSPKVSETVVEPYNAVLSTHNLVENSDITCCIDNEALYNICVSDLKI
                     QSPEYKDLNSLIAKVMTGFTTTLRFPGVLNSDLRKLAVNMVPFPRLHFFTAGYAPLVA
                     NASKSYTASNVHELTAAIFQKRSLLAAIDPLFGKYLTVSVAYRGKLSMRDIENAVWDF
                     HNKNSEHFVPWIPNSSLTTLCTVPPLGQTAAATLVANTTAISEVFKRSHTQFRSLFRR
                     RAFTHWYTGEGMDEQEFTEAEANLSDLCIEYDQYASADLEEEEYELEGEEHVEEGENY
                     EE"
     STS             855667..856487
                     /standard_name="Hind14"
                     /db_xref="UniSTS:470739"
     gene            complement(856271..858936)
                     /locus_tag="CNL06680"
                     /db_xref="GeneID:3255021"
     mRNA            complement(join(856271..856714,856765..856797,
                     856854..857228,857295..857622,857680..857762,
                     857812..858084,858151..858936))
                     /locus_tag="CNL06680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568243.2"
                     /db_xref="GeneID:3255021"
     CDS             complement(join(856488..856714,856765..856797,
                     856854..857228,857295..857622,857680..857762,
                     857812..858084,858151..858379))
                     /locus_tag="CNL06680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568243.1"
                     /db_xref="GeneID:3255021"
                     /translation="MQSITVVLSLWSSIIFTTMSKLESRPSLEKVIDDEAARDSFTKV
                     EEVAEVSDYSFTKEENRSIVRKFDWHILPFVWACYLFNSLDRNNVSNAKSDGMTTDLN
                     FPDEGYSIMLTVFTVPFACLVVPGVMLTRKIGPRFTIPGYMLGWGAMAMINAGCKNFA
                     GVLIVRLILGAFEAGFAASLIFYLTTFYTRGELGKRIAAFYSCQALSGAFSGLIAYGV
                     FQMDSKLWGWQILFLIEGAFTVAFAILTGLMLPWSPSTASFLTDREKEVARLRILRDG
                     STAIDTKFNRKAFFKPLKDWKFYVFASIALCYGVAASVAGSFLTQIIGRFHYSTVKTN
                     LFTVAPYAVGTIALCATAWSSDRFRERGFHLASSLILVFIGCILLVALPVTSVGPAYF
                     ATFLITAGAFTPSVIFHTWHQCNDPTEDGRAFRVGTYTFLANLGGIVSAQIFLDKWSP
                     AYIIPLSVTAGIEGLAAILVIGLRMWMYLDNRKRNQAQGVNWQSKDVPTEILVEGPKN
                     PLFRHFY"
     gene            859082..861370
                     /locus_tag="CNL06690"
                     /db_xref="GeneID:3255033"
     mRNA            join(859082..859312,859369..859525,859584..859824,
                     859886..860213,860284..860396,860456..860570,
                     860639..860687,860755..861019,861092..861370)
                     /locus_tag="CNL06690"
                     /product="expressed protein"
                     /transcript_id="XM_568189.2"
                     /db_xref="GeneID:3255033"
     CDS             join(859273..859312,859369..859525,859584..859824,
                     859886..860213,860284..860396,860456..860570,
                     860639..860687,860755..861019,861092..861298)
                     /locus_tag="CNL06690"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568189.1"
                     /db_xref="GeneID:3255033"
                     /translation="MTTIDSKIAIVGAGVFGLSTSLHLKKNGYKDVTVYDYQPYDVNA
                     YDPSKGCDGASADVNKVYRCSYGDETEYQDLAFSGRAIWLEWNKQISETPADQLPPGL
                     TPDDQPFVPCGFLRISNEEKLSEYDQMCLDELEKAGLRHHQHVIKDTGDMDRLVEKEA
                     ADPSTNYATKAASLKNLEGGRLTGFFDTSAGFTVADKACAWARYLAEKDGVKFLLGPE
                     TGKFDELLVRSEGEDQKVVGLKTVDGLEHEADVVIVACGGWTPSVVPEVEGLLETTAG
                     SVCTIQLPTDRHDLWEKFSPERFPVWAYGLTGHSSPEYGGFYGFPRTKDGKIKVGYRG
                     RKWTNYQKHPKTGKELSMPKTKYTADKAENLPKKAIENVKKAVGEIFPELKSIGITDT
                     RMCWYTDSIDNSFVIDYVPGYSDSLFVASGGSGHGFKFLPVLGKHVVNALEKKPDQFT
                     PLWHWRSAAPGEHANGLEEGKGSGRDLASLEIADKVDWKWEDGLGEIAEKIEKL"
     gene            complement(861483..863010)
                     /locus_tag="CNL06700"
                     /db_xref="GeneID:3255037"
     mRNA            complement(join(861483..861725,861778..861889,
                     861940..862089,862152..863010))
                     /locus_tag="CNL06700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568190.2"
                     /db_xref="GeneID:3255037"
     CDS             complement(join(861514..861725,861778..861889,
                     861940..862089,862152..862403))
                     /locus_tag="CNL06700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568190.1"
                     /db_xref="GeneID:3255037"
                     /translation="MTTTRTPKLGVLQLKTTFPRPPGDVGHPASWGDIPVVIRVVEEA
                     VSTLVVGGTWGKDLVDAFVREGTKMIEEDGCVAFVTSCGFLATMHPCLANRLPFMGTT
                     SLLQVAWLQQSFFPGLNSKDSVGVVTFKKSALTVKHLTSVGAHPETPVYGLPEDPKTA
                     IFRGVLDERIPYDYEGMEKEVVDAALVLVKNHPKVKAIVLECTNMPPFTHAVEKATGL
                     RVWDVLTLGKWLYAGAVPKDYRV"
     gene            complement(863067..863174)
                     /locus_tag="CNL06710"
                     /db_xref="GeneID:3254937"
     tRNA            complement(863067..863174)
                     /locus_tag="CNL06710"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:3254937"
     gene            865655..868042
                     /locus_tag="CNL06720"
                     /db_xref="GeneID:3254944"
     mRNA            join(865655..866023,866074..866425,866489..866570,
                     866618..866910,866960..867048,867100..867437,
                     867491..868042)
                     /locus_tag="CNL06720"
                     /product="expressed protein"
                     /transcript_id="XM_568191.2"
                     /db_xref="GeneID:3254944"
     CDS             join(865902..866023,866074..866425,866489..866570,
                     866618..866910,866960..867048,867100..867430)
                     /locus_tag="CNL06720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568191.1"
                     /db_xref="GeneID:3254944"
                     /translation="MRSPGPSLILLAALPLASATHLSSKLQDKVYDVMENISTHSWEI
                     GTKAQAILESKYPSYSVFASTSPIPLPDDFDDDDIEDVVAVAEYTMNNRPPSNTSASA
                     HGGSTLLDDEAAGDPASLGVTILLANASTDNAQVNGVSYGDAAREELNYLLYDVPRTS
                     SGAISHRADQAQLWADSVYMVPPFLAYYGALNNNQTLLQQAYQQCKLYRDALRQSNGL
                     WIHITGGNGTSDPNLWATGNGWAAAGMLRVWATINWSTFSDQLDSQLSDLESWVREIL
                     DASKPYITGNGIFYNYINDTSSFEDASSAALMSHVGLRLSTLGITNDYVDMALGLLSA
                     ASSYVNSTGYLTQVVNPLDFSEQGEESPEGQSFLVMAYAAHTDWDDAGRAGHTKDDGL
                     GSKSGASPQIGGLGSAMVVAIGLLAMLVTL"
     gene            869636..873075
                     /locus_tag="CNL06730"
                     /db_xref="GeneID:3254939"
     mRNA            join(869636..870296,870349..870441,870496..870627,
                     870676..871202,871261..871933,871985..873075)
                     /locus_tag="CNL06730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568192.2"
                     /db_xref="GeneID:3254939"
     CDS             join(869746..870296,870349..870441,870496..870627,
                     870676..871202,871261..871933,871985..872912)
                     /locus_tag="CNL06730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568192.1"
                     /db_xref="GeneID:3254939"
                     /translation="MAEDNHNEPPPPNIPTPTFPQSKTINTAFARSPTTDSEIEPADE
                     EEGDHRPFNPRTSTTDEHQTLFYQDASHFNVEHHVGRVCRSFAPLALLAIIALAFIPV
                     ASATDLDPYTSCPALPQKNTPILSTTGYVFNHVVRFIGLDDSFVGQHLANVKRNLDNT
                     SIIEACMVPVLVLLSGMFAGLTLGYFSVDQTQLQVLAISGTPKHQEYARLIMPVRKNS
                     HLLLTTLILGNMIVNEALPVVMDGLLSGVVSVVVSTAMVVIFAEIIPQSICSRYGLLI
                     GARMAWPVRIMIWIAYPIAWPIAKLLEWVLGAHHGIIYRRGELRELIKMHAAGGEGGG
                     DLDFDTVQITQGALDLARKTVKDSMTAIEQVFMLPIEAKLDYETLGHVVRSGHSRIPV
                     YQMVEVPDIDLSAPTLGPTKTKMVKKVLGSLLVKSCVLLDPEDATPLASIPINAIPSI
                     PFDEPLTNMLNVFQEGRSHMAIVSRRVRRVGPVDPEDAQSAMTAAAGGLRQRFFRRVA
                     GISGNRSFSDGDSSASGEEDLEKGEGGKKKKRRRKNAEKHDRAGSCSSDNHTIVRPIS
                     SDDDGFTEADEIKRMAKEQQEAEMKQQRGKDSKKGSLVQAAKLTQLEQSVPADAQLSN
                     DAVENFFDGLEGAPLGIITLEDVLEELIGEEIYDEYDEHGVPRSAASAFVPLEAMLAA
                     RKAALARQELAIAQSTPIPPVSDADVEQVVAAPTPGAGRRVKAKIQIPKFSLKKPVSQ
                     PGRPRTERLAANETPAATPPADPPCYTNKPDEKSTYSAQIITIPGELDEPPLACAQSD
                     SRLVNRRLSTPLDSGATATPSPQPQYSLSVPGPASAVPTRLLPAGGTVSTPAVIPTSH
                     QPSLLNEAIFIGRERKRMAASHPGQVRSQSSGPTVSSKQPTPPISVYDFGIQAAGVNG
                     ERVEGQEIVSPRPIAAQQKKIPKFKSVPTPVATPSFGFDPSAESKSSSREEKE"
     gene            complement(873071..876213)
                     /locus_tag="CNL06740"
                     /db_xref="GeneID:3254886"
     mRNA            complement(join(873071..875205,875566..875721,
                     875773..875833,875880..875898,875944..876016,
                     876071..876213))
                     /locus_tag="CNL06740"
                     /product="uroporphyrin-III C-methyltransferase, putative"
                     /transcript_id="XM_024658236.1"
                     /db_xref="GeneID:3254886"
     CDS             complement(join(873203..875205,875566..875721,
                     875773..875833,875880..875898,875944..876016,
                     876071..876146))
                     /locus_tag="CNL06740"
                     /codon_start=1
                     /product="uroporphyrin-III C-methyltransferase, putative"
                     /protein_id="XP_024513898.1"
                     /db_xref="GeneID:3254886"
                     /translation="MSPPASQPPLWISLWMLFTTLIVSWDAGYCLMRPRSLPGGDLSW
                     IWKPYNDFPYGEIDYLYGWKAFNEEDGFTAAQALLNVVEIFLAIGYLYLQHISPRDKP
                     LHAVAPLIGFVGTVMTASKTILYFLQEYFCGWCNVGHNDRRTFWMVWVIPNGTWIILP
                     TIVSIVLGRYIAVALKRDAVYSPVSTSLLRAEFLAEKLASTLTEEPTQLPAALPLTFH
                     PRTLSVLIVGSNRLAASRALTFLEADAKVFLLTSSEEVAKEVKELEEGGRVSLLQNTA
                     SDSVAWSELLTKHDISLACVTDTLISTPSRRSLASATIIYQTCLSLHIPVNISDQPHF
                     STYTFPSVHRFAGADGPSHLQVAVSTNGQGCRMSGRIKREIVSRLPADVGKAVDNVGK
                     LRARAKARAKISEEDDGPLNTPVPQLPTPSISRRNSEEVTQQLSDEEQQLRRMRWVYQ
                     MSEYYSFEHLAKISNEEMDKALDIWGQRDEGYLPHHDVKTVNASEKKGRILLIGSGPG
                     HPGLLTMAAHTALRTATLILSDKLVPAEILALIPDSTKLHIAKKFPGNAEGAQNEMME
                     LALEGAQRGETVVRLKQGDPFVYGRGGEEVLYFRQHGFESTVIPGISSALAAPLMMGI
                     PVTQRGVAESLVLCTGVGRQGKAVQLPGYVKSRTLVMLMGVARISQIIEVLTSTTATT
                     ATGRDGAAYPPHLPIAVIERASSPDQRVILSTLEKIQPALKQVDERPPGMMLVGWAAL
                     ALEGKGRVDVLDRSEDDEFEMVESWLAEGQEGEIKGWKVREGLNDEWRGILNGII"
     gene            complement(876860..878064)
                     /locus_tag="CNL06750"
                     /db_xref="GeneID:3254905"
     mRNA            complement(join(876860..877148,877239..877289,
                     877348..877464,877548..878064))
                     /locus_tag="CNL06750"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658237.1"
                     /db_xref="GeneID:3254905"
     CDS             complement(join(877089..877148,877239..877289,
                     877348..877464,877548..877697))
                     /locus_tag="CNL06750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513899.1"
                     /db_xref="GeneID:3254905"
                     /translation="MNTMNLSHKSFRSLSSSSDNSAISTTSTSSRSSTHSRAWEDMID
                     RLASHKINARFDLWSGGNIRLNGLDLTLTTRDAEGLFKAMKTDDRFQIIHHVFFDEEK
                     EDWKVSFIRAQPSPCSAFPSDSE"
     gene            complement(878741..883670)
                     /locus_tag="CNL06760"
                     /db_xref="GeneID:3254890"
     mRNA            complement(join(878741..878889,878961..879093,
                     879147..879427,879485..879683,879747..880251,
                     880309..880491,880567..881908,881957..882788,
                     882844..883670))
                     /locus_tag="CNL06760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568195.2"
                     /db_xref="GeneID:3254890"
     CDS             complement(join(878870..878889,878961..879093,
                     879147..879427,879485..879683,879747..880251,
                     880309..880491,880567..881908,881957..882788,
                     882844..883623))
                     /locus_tag="CNL06760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568195.1"
                     /db_xref="GeneID:3254890"
                     /translation="MSTPTPSRKTSTPSRKLSAPSRQSSTPSRTPQPRPPPSLLIPSA
                     KPSSSTAFVFAQGQSEPTTQPQTPTVETEGGKNGGGSVTGTIPKRQGSASEEALSRQL
                     DGDLGGRLMGLRSRRSSAATTNTLNTLATAGTARHCSGGNGVGRDSPRTADELGTATD
                     TGSVPFVGDDERGRGRSMLASPLSTVAEPGVSNEGGADASNGSLALPTPSLKREGDPL
                     SSQGKRLGNKTSTSWLRWTSPTPTFPKQGEGKGKGKAEETVEGQSPESINEPQREPPT
                     EPAASTATNSDSPSVSQTPQPSQQATTRSEPPKSAGQILSLPPEQNPSRNSTGQSQTL
                     PLSEKEGKQGWFSSFSRNSRPSALTSLHPSQGQAIVESVKHGFKQGDEVKDAAEPSEI
                     EGPGGFGTPVQIADEIKTKEDTRKQEETDKSSPNPPLAEGEVRPDMSSLSNSNIPSHT
                     AELSAPTSISAESTDPLATVTHAQGQSQQKKTVRPQQSMASLRGFRDYLGWSGSSAEG
                     KEASSQKGEHKGSASNSGVDKQEEVRPENATQTSEETLTPPQPTETTAPTPRGQATPW
                     SSYFYSFVVPEPKQGQAQSSKTVSIAPESESNSAAAVPPAQPTDTPKSSTEPQPALLT
                     PLTTPSNTKITSRNVSPARISTTSVPAPDSTSSQPSAPSAPSAPSAPSAPSAPSAPSA
                     PSAPSAPSAPSSSTSPSTSRRPSAAGWLNYLAFRANQKKITAGSVDTGGTGEGEVMDF
                     SNDPNFPSESSIVNATVEDTSSKTSGGASGDKNRPLTAPTKSTPSAITHKPSRNLDVH
                     KHAKRLSNASSLAGNVGSLAFSASPKNKSLEDHQSPGKSSTRSLTNPKESALPHPQPP
                     AVQPNLVIPTFSNTFDRPPRSFPPLPPSPPSSPRSFDSKQPPHKGLTAATTGVAWKVL
                     GAVGSYVYGGGGVGDEVSKGGWVDTEAEQRGRKEGRKVGRELPRRIGLEHGGAEDGWK
                     DVKRVVVVGVHGWFPAKMLNSVIGEPTGTSVKFANMMGQAVKQFFAEKGIDESELRLT
                     LMPLEGEGTIELRVDKLYKAYLSNPAWINDLRRADAIFFAAHSQGCIVTTHLISRMIA
                     QGHIRTPLNAEAVARCEWAFGPIGVIPSYPRSRKFPDDFSIPGAEGGYQKVAMLAMCG
                     VHLGPMYSISTSTMIQPYLQWFENAAARELFGFQDTSSAVSVEYQRALGMVLENEVRV
                     VLLASLNDQVVPIYGSSFSTATHPLLLRALYVDGASYTQSDFMTNLLCFAFMLRNAGI
                     NDQRLVEHLSEATAGSLTGIGHSTPYEELSCYTLAVHYLFYAGRARQPMPPLQVEPFS
                     ARDARNDYELPWIMRALVDSAEVQDLFPGELRDLKEGILHWKPVTKPLKEIKRRLEPM
                     AGRQSRLRPLPNSPSSASLASTGANVETSTSPAPSKNLSAGLRKDW"
     gene            complement(884044..886854)
                     /locus_tag="CNL06770"
                     /db_xref="GeneID:3255018"
     mRNA            complement(join(884044..885782,885839..886038,
                     886089..886288,886337..886460,886515..886854))
                     /locus_tag="CNL06770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568242.1"
                     /db_xref="GeneID:3255018"
     CDS             complement(join(884183..885782,885839..886038,
                     886089..886288,886337..886460,886515..886808))
                     /locus_tag="CNL06770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568242.1"
                     /db_xref="GeneID:3255018"
                     /translation="MRASHKKSHSTSTLSLLAGSPVSASPLSLEQNTPRQQLDRSKRR
                     QSVLPRVNEQSSNASINILNGLQGTVDDRQKDKYPGDGLKKGRGEGDVKELLSDLKSL
                     RSSGRRRMAALKGVEKVVVEACAGQQFDVLEEFLSFNPYNTLVNLLTRHTSTLSHRSS
                     HASLPAGDELALSLIPELKLVVGILQGLCLLSRGCKGLVGEGWVMEVFIDLLLLLRSQ
                     PPPHESDKPISYNILELLFCVLVDSPENARKFEKLSGLEAVVRVLKGSNVGKDVRMKC
                     IEFLYFYLLPEQQNSDVNKRNISNSSVSSTTSSELYPTSPPTLPRTKPPIAVTTSEEK
                     LGDIDVPFIPQTPVKRPRPNLGYLTPATRHLSDASANTSSSTPGLPTVPASPASPAIS
                     STIIPPSPQESNGRLRPSASTTGLSRMLDEDAPLSSHVPDARTPAMLKHRDDGGAGKV
                     GLGIGLSNLGMTTSTFKTKGGTSDDPFDLTASSKRSHSGSSGSSTVVPSTASRAISRS
                     STQPSLADLSYGGNSNKARLDAGLGRSASLRRGVSSSPSPLARSSFPIAHSSNFEKEG
                     EGEGRAQRQRGGSSGSALVSRTPRSSTSSRSRHSRAQSYASGLSLPPPTGPSESASVP
                     SIEIPPVPRLPSSVVASIHTDAHHTPNSSGITSMSNMKENKEMEKIRGVRARSKGFPA
                     KLTKGMVPSASSSGLTAMTATSSSLASSGAQIGKDGREVPLGATKRVLSRNYRDVQGR
                     ERNESDAETATGAKAGLTGRAKAETRTMEEKKEMLGMWLGNVEQLVQGVEKVSFWGSI
                     GETHKGR"
     gene            887046..889125
                     /locus_tag="CNL06780"
                     /db_xref="GeneID:3254895"
     mRNA            join(887046..887671,887739..887843,887903..888040,
                     888104..888478,888537..888717,888796..889125)
                     /locus_tag="CNL06780"
                     /product="expressed protein"
                     /transcript_id="XM_568196.2"
                     /db_xref="GeneID:3254895"
     CDS             join(887476..887671,887739..887843,887903..888040,
                     888104..888478,888537..888717,888796..888961)
                     /locus_tag="CNL06780"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568196.1"
                     /db_xref="GeneID:3254895"
                     /translation="MDKLDALLGPFNPNKMAAKSASDPLKVLVLDATGDEGFSVCKSM
                     LKDGGFNIWGLVPNADTPVARELNRLQVQIVEGELDRPDTFQSQLAGMDGIFIPSDIF
                     STPESVTCGKSLIDMCKVAGVGHIVFTALDLVPNGEGSDHPGGQILSYIKQTYTGHAE
                     HEDRPHGAHHHLHWTILYPGWKFSKLITLDLFSKVPISKLPTGSREPDAAKELEKNVS
                     RKEGEPAARLTDDDGEEWLLRVPLPDETKIPGYAVEQLGLWVKAAFLNHKKFRESIIQ
                     VCSTMVTPLEMADVLSKMAGRPVRTLGLTLEEFFSGDFKTDMGETKWERYRAAAEGHF
                     ERDPEASRKIVPEQWNFGQWARQSKELAVLFEEDRDRREEKEQHGRQNDKEK"
     gene            complement(889152..891009)
                     /locus_tag="CNL06790"
                     /db_xref="GeneID:3255014"
     mRNA            complement(join(889152..890309,890414..890691,
                     890758..891009))
                     /locus_tag="CNL06790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568241.2"
                     /db_xref="GeneID:3255014"
     CDS             complement(join(889491..890309,890414..890691,
                     890758..890989))
                     /locus_tag="CNL06790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568241.1"
                     /db_xref="GeneID:3255014"
                     /translation="MAQPVFPERPVPDVNAPSLFDLLAQEQLRDLFHPVFRYILSYLA
                     QRYPRYFLRLLNHHEEAFALLLLILEKHHLEHHNASLSEHFYGLRLVPSRAFSLSRLG
                     SLSQSQLNISPTTTNLTRKQRWGILVFIVGLPYVRARAQDYFERLSGIGNDEIQRDED
                     GEVRIQSLSKSQHIFKLLYPYFNLLLDISFLGYDIAYLFSKTTYWRPWYLLLNLHISR
                     ARFPSPPSPLDTTTFSSRSALSSFSLPPLLPPLLLALKLSQWWYSPSSPRALSPLSRS
                     GSGLQGGRGISVAEVHKGILPPRAVNILSSVSIFPFSRKQSSSHADNEDEEHKRNGER
                     TEIHIPPAKFGICPLCNKAWANPAILPSGWVICWKCGWNAVEGEKECHDEQSEDKPRE
                     EEEVSEREKEGSSYETGKSTDDREKKTERKGRCPITGIYVPPGGLRRILV"
     gene            891161..894508
                     /locus_tag="CNL06800"
                     /db_xref="GeneID:3254852"
     mRNA            join(891161..891524,891580..891787,891845..891915,
                     891966..892248,892321..892896,893015..893446,
                     893524..894230,894294..894508)
                     /locus_tag="CNL06800"
                     /product="mitotic chromosome condensation-related protein,
                     putative"
                     /transcript_id="XM_024658238.1"
                     /db_xref="GeneID:3254852"
     CDS             join(891189..891524,891580..891787,891845..891915,
                     891966..892248,892321..892896,893015..893446,
                     893524..894230,894294..894320)
                     /locus_tag="CNL06800"
                     /codon_start=1
                     /product="mitotic chromosome condensation-related protein,
                     putative"
                     /protein_id="XP_024513900.1"
                     /db_xref="GeneID:3254852"
                     /translation="MAVLHSKRPRMPANSQGIHQQTCINDDAAEKAKRRKSAHFHTVP
                     DHTSISNENENPKNQAGKRVISGLAIQQQGLIQKRGKRLSAVEPNMPEVRIEVKENKY
                     EEWMKLATDNKITANNTWSFALIDYFADLTLLRNGPDDQSINFQKASCTLDGCVKIWT
                     SRVDSVATETGKLLSGLAGGSAETGEDDGSEGEEDEAGEPKTTRKTVRSEATLAKSFA
                     QLQIKKFDLEFTVDPLFKKTSADFDEGGAMGLLMNHLSVDNKLREVFDAGDAVADEQD
                     LDEEKEEGGGGMIDEVVQLEKLRNYIPITKFLADYSINPSLASFHFSSDSSTGNDNDP
                     AIILGLKDSFPVDEYDHYDIPMATADDYNPMDPASNRRSGEGYDFFGSEDYDAVPAYG
                     DGGFDEDGASMMGDPEDGLSAPFHNPANSNGGSLALLGPGSSHLGPFDPHRQGQGHEI
                     VLTLGEGGDIGSGGMFEYFDKGFGKSWAGAEHWRLRKVSRKDMATAGTITTTNSKTKV
                     DKTPFAIDFHTPMVTSLTSSTQALFTPASNKSSITLPSTFAPIRTKNGKAVSGQRQLR
                     EERLLPDDMHFSSHQLLRLFLKPQFSLKMRPGGRNMGGMGGMIGADGEIDENFWAAAA
                     KEREGGECAGDEFGSAPAPFESQFFQDDDDYGDMDNDVDFGPIQPNVPVLCGPGEEED
                     DLWAGTQMELKKARPENVNFTKKAKRVDVKRLKDDIWTGLKDLVPYSDKAGDTDTDDE
                     DSTPSTPPEPSDSEPVKTFSSIIQSLRSTYPPQKMSEISTSFCFICLLHLANEEGLRI
                     ESARGDGKEGEDVGCVGIAPVGEDGEVVLGEGLNALLGMLGAGRGGSEGMESTSEGVK
                     KDRVIGELEALKVYKDHAAGRAA"
     gene            complement(894477..896194)
                     /locus_tag="CNL06810"
                     /db_xref="GeneID:3254861"
     mRNA            complement(join(894477..895531,895598..895694,
                     895752..895783,895875..895927,896052..896194))
                     /locus_tag="CNL06810"
                     /product="hypothetical protein"
                     /transcript_id="XM_568198.1"
                     /db_xref="GeneID:3254861"
     CDS             complement(join(894710..895531,895598..895694,
                     895752..895783,895875..895927,896052..896130))
                     /locus_tag="CNL06810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568198.1"
                     /db_xref="GeneID:3254861"
                     /translation="MDLSNLNASLDPDVADAERDIGDKFRAAAASITSLYRSSLAVTK
                     QGYNAGYSTALKDMLSMVQSSIGEGQDSAQTLSRLMDWADARQAAISVFAADEAEDTP
                     PPRPRSNPISRQSHLAPNRPSSAPAFDHSGANSNANSMSVFIGNSVEGSDGQSESSTP
                     HRLMDTTTYQPTPNMLSSPLNYSSGQPNPSTMASTAGSLSQSSLLVPTTKPSRGQPIR
                     YANPAPSHSSQSINPSSSSLTSSTFNPSLPSLPIISTSAPLAFSSSGPAQNYPIGSKR
                     PIVENMDVEIPSDGSNAFGPSFNSNPGLGLVRAQSQRSVKRRSMGLRDGGKEGKDEEE
                     KGGGGGGGKKGGRRHGHGHGGASAGV"
     STS             897101..897703
                     /standard_name="Sal3"
                     /db_xref="UniSTS:470740"
     gene            899241..901117
                     /locus_tag="CNL06820"
                     /db_xref="GeneID:3254859"
     mRNA            join(899241..899552,899613..899710,899766..899880,
                     899942..900053,900114..900541,900599..900657,
                     900719..900798,900848..901117)
                     /locus_tag="CNL06820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568199.2"
                     /db_xref="GeneID:3254859"
     CDS             join(899466..899552,899613..899710,899766..899880,
                     899942..900053,900114..900541,900599..900657,
                     900719..900798,900848..900969)
                     /locus_tag="CNL06820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568199.1"
                     /db_xref="GeneID:3254859"
                     /translation="MTVEIPSSNRKARIGVMGVGRMGKRHARNIAEFAPRAELVAVSD
                     PYPEALEWAKANLPSTVKTYSSSEELINDPDVEGILIATETAFHAEYAIKVIEAGKHA
                     LIEKPISVDIELTKPVVAAAKKRPDLKVMVAFSRRFDASYQEAAKRIEDGQLGSAYLI
                     KSCTNDLYDPTGYFLNYAKKSGGIFMDCGIHDIDIGRYLLNVGNTDGLKNPAKQVSKV
                     FATGLNTVYPELAEMEDCDNALGIIEFENGSKLNIHLSRTSILGHDVVCEVFGTKGKF
                     VINAVPNISRVEIRDEHGVRTESHPSYYERFFEAFKTEVQTFSSCILDDTPVPTPPHD
                     ALEAAQIATALTHSFRTGNPVYFDDNGEPILK"
     gene            901827..903893
                     /locus_tag="CNL06830"
                     /db_xref="GeneID:3254884"
     mRNA            join(901827..902392,902451..902548,902610..902724,
                     902778..902889,902948..903375,903440..903498,
                     903557..903636,903690..903893)
                     /locus_tag="CNL06830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568200.2"
                     /db_xref="GeneID:3254884"
     mRNA            join(901827..901949,902004..902392,902451..902548,
                     902610..902724,902778..902889,902948..903375,
                     903440..903498,903557..903636,903690..903866)
                     /locus_tag="CNL06830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658851.1"
                     /db_xref="GeneID:3254884"
     CDS             join(902306..902392,902451..902548,902610..902724,
                     902778..902889,902948..903375,903440..903498,
                     903557..903636,903690..903811)
                     /locus_tag="CNL06830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514680.1"
                     /db_xref="GeneID:3254884"
                     /translation="MAISQGNSSGKLRIGVLGVGRMGRRHASNVAYSAPRAELVAVAD
                     PSQEALAWAKANLPSTVQYYSDSADVIQSPNVDAVLISTETSEHARLALEAAAAGKHV
                     LLEKPISVDVDLSRPVVEAAGKHPELKIMIGFSRRFDASYREAKRRIDEGSVGKPYLI
                     KSCTNDQYDSTGFFIAYSKASGGIFIDCGIHDIDISRWLLDVENPANLKYPKKQVTSV
                     WATGLNAQHPELASYGDCDNAICVVEYENGTKCTFHLSRTAIHGHDCFCEVFGTDSKL
                     IINGNPNMNRVEIRDIHGVRMESTPTYYDRFRDAFISEVQSFCDVVLDDKPVPTTPQS
                     ALEAAKIAMALTHSFRAGKPVYFDNEGEAIIN"
     CDS             join(902306..902392,902451..902548,902610..902724,
                     902778..902889,902948..903375,903440..903498,
                     903557..903636,903690..903811)
                     /locus_tag="CNL06830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568200.1"
                     /db_xref="GeneID:3254884"
                     /translation="MAISQGNSSGKLRIGVLGVGRMGRRHASNVAYSAPRAELVAVAD
                     PSQEALAWAKANLPSTVQYYSDSADVIQSPNVDAVLISTETSEHARLALEAAAAGKHV
                     LLEKPISVDVDLSRPVVEAAGKHPELKIMIGFSRRFDASYREAKRRIDEGSVGKPYLI
                     KSCTNDQYDSTGFFIAYSKASGGIFIDCGIHDIDISRWLLDVENPANLKYPKKQVTSV
                     WATGLNAQHPELASYGDCDNAICVVEYENGTKCTFHLSRTAIHGHDCFCEVFGTDSKL
                     IINGNPNMNRVEIRDIHGVRMESTPTYYDRFRDAFISEVQSFCDVVLDDKPVPTTPQS
                     ALEAAKIAMALTHSFRAGKPVYFDNEGEAIIN"
     gene            complement(904323..906062)
                     /locus_tag="CNL06840"
                     /pseudo
                     /db_xref="GeneID:3254826"
CONTIG      join(AE017352.1:1..906719)
//
DBGET integrated database retrieval system