GenomeNet

Database: RefSeq
Entry: NC_006682
LinkDB: NC_006682
Original site: NC_006682 
LOCUS       NC_006682             787999 bp    DNA     linear   PLN 14-AUG-2010
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 13,
            complete sequence.
ACCESSION   NC_006682
VERSION     NC_006682.1  GI:58271750
DBLINK      Project: 10698
            BioProject: PRJNA10698
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella;
            Filobasidiella/Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 787999)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 787999)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 787999)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AE017353.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..787999
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /variety="neoformans"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="13"
                     /note="MAT-alpha"
     gene            complement(213..>2368)
                     /locus_tag="CNM00010"
                     /db_xref="GeneID:3255178"
     mRNA            complement(join(213..298,539..635,692..772,826..858,
                     927..1134,1175..1245,1301..1402,1456..1510,1567..1704,
                     1769..2031,2081..2134,2216..>2368))
                     /locus_tag="CNM00010"
                     /product="transporter, putative"
                     /transcript_id="XM_568395.1"
                     /db_xref="GI:58261969"
                     /db_xref="GeneID:3255178"
     CDS             complement(join(279..298,539..635,692..772,826..858,
                     927..1134,1175..1245,1301..1402,1456..1510,1567..1704,
                     1769..2031,2081..2134,2216..2368))
                     /locus_tag="CNM00010"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_568395.1"
                     /db_xref="GI:58261970"
                     /db_xref="GeneID:3255178"
                     /translation="MKQLSETPGVESTSFDLDYEDLSYTRQRERKFLWKLDVCLISWA
                     WLAYLIKQIDSSNYKTAYVSGMKEDMKLDANELNYLNTYFKIGYAIFLLPSQIILTRV
                     RPSLWLPPLELLWGVMTGLMAAAHNVKGMYALRFLIGAFEASSYPGIVSVLCNWYTPS
                     ELATRIALFGTSYPAASMFVSFMQVAIQSTLNGTRGISGWRWLFIFNAIMTILVAVAG
                     FFLVPDSPGTTKAYWMSEEDNRISAARMARVHKQPPTRLTKAILKKTFTGWPLYIFFG
                     AYAFAAWAADANSWFMLWLKALTHPDGSKRFTIQEINAIPIGGFALMLVLMLLFAWLS
                     SRTGWRATWVSVQNILFLIGCIILSVWPEGVPIKMAGFFLTYTANAISPILVAWMADM
                     CPIPEERAIIIGVTVSLVYAMDSWMNHIEEEK"
     gene            complement(2815..4183)
                     /locus_tag="CNM00020"
                     /db_xref="GeneID:3255289"
     mRNA            complement(join(2815..3155,3202..3350,3633..3683,
                     3738..3993,4045..4183))
                     /locus_tag="CNM00020"
                     /product="expressed protein"
                     /transcript_id="XM_568392.1"
                     /db_xref="GI:58261963"
                     /db_xref="GeneID:3255289"
     CDS             complement(join(2953..3155,3202..3350,3633..3683,
                     3738..3940))
                     /locus_tag="CNM00020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568392.1"
                     /db_xref="GI:58261964"
                     /db_xref="GeneID:3255289"
                     /translation="MSSFSYLRSGGVEVMMPDQRLVEQERKRREVRSEGPPLNIREPM
                     SDEEKAMSGPNYQAIAGQYMGSKTLIAIYYLCLANCSSRIIRLDMFSKRLTSAHPFRH
                     YPSRFHIKGQPLSTFLLSYLDLKHSPMVVSTTRETMNQFCERHNMTSAIINHASIKTL
                     CLLGSADVRRAAFRLMDDLLKHIIDNSSLVASVGMSSKWAG"
     STS             4145..4987
                     /standard_name="Hae2"
                     /db_xref="UniSTS:470742"
     gene            <5545..7531
                     /locus_tag="CNM00030"
                     /db_xref="GeneID:3255272"
     mRNA            join(<5545..5574,5682..5745,5796..5863,5926..6066,
                     6110..6494,6537..6591,6643..6935,6977..7066,7116..7179,
                     7222..7273,7330..7531)
                     /locus_tag="CNM00030"
                     /product="multidrug transporter, putative"
                     /transcript_id="XM_568393.1"
                     /db_xref="GI:58261965"
                     /db_xref="GeneID:3255272"
     CDS             join(5545..5574,5682..5745,5796..5863,5926..6066,
                     6110..6494,6537..6591,6643..6935,6977..7066,7116..7179,
                     7222..7273,7330..7494)
                     /locus_tag="CNM00030"
                     /codon_start=1
                     /product="multidrug transporter"
                     /protein_id="XP_568393.1"
                     /db_xref="GI:58261966"
                     /db_xref="GeneID:3255272"
                     /translation="MVDYYHNMLHDFGINQDNFPWLTWATASWNVGAAVFPLLFVPLT
                     ENSGRMPGYFISYIIFLIFLVPSGVGTNFATMVTTRFFGGGASSVSINIVGGTIADIW
                     KGPAERSVPMSIFGMTSVVGIALGPFIGGAIQTNETTINWHWIYWIQLIFDGALLPVF
                     WFILRETRGDVILAKRAKRIRKETGRQAYAKAELESEKVSTMVLISFKRPTKMLFTEF
                     AVFSFTLWVSFAWGLLFLFQSSIPQTFSANYGFNTFQSSLVQLALSVGAIIGTIINPY
                     QDKLYLRSAHHNKETEGKPIPEARLYFSIPGSLLFAGALFWYGWTSYPNIHWIVPTIA
                     IGFIGLGIYAIYMATVMYLTDAYEKYASSALSAASLGRNSFGAFLPLASQDLFNNLGF
                     QWAGSLLGFLALALSGVPILLFFKGRYLRSRSPFIAEATFEEGDSEERRETTKQEGSK
                     GLGGPAGQARPTAPTIGR"
     gene            complement(8086..10450)
                     /locus_tag="CNM00040"
                     /db_xref="GeneID:3255227"
     mRNA            complement(join(8086..8988,9064..9151,9207..9287,
                     9341..9456,9518..9600,9667..9729,9781..10032,10097..10130,
                     10185..10195,10264..10299,10377..10450))
                     /locus_tag="CNM00040"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544686|gb|CF690527.1,gi|41575289|gb|CF721130.1"
                     /transcript_id="XM_568390.1"
                     /db_xref="GI:58261959"
                     /db_xref="GeneID:3255227"
     CDS             complement(join(8243..8988,9064..9151,9207..9287,
                     9341..9456,9518..9600,9667..9729,9781..10032,10097..10130,
                     10185..10195,10264..10299,10377..10429))
                     /locus_tag="CNM00040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568390.1"
                     /db_xref="GI:58261960"
                     /db_xref="GeneID:3255227"
                     /translation="MSPSKRARDLAPLSWEAPSEEEYKSLRRYKSFLMPPNISYYLGD
                     FVWLAHEHSRPPIPESPPRKKSRASHAAESAVEKEEEYDDEEEEEEVDETEEEKQRRE
                     ADAMWKAGYWIGRIVEIRARDKTYVWMKVRWMCRTVKELRESDVKTGLPKGKVGGREI
                     FMLGREFDAVQPVGTVESHAPVTLYDESNPMQEPFDNNTIFYRSEARTPSLEESAVIQ
                     AKLNPAKASSKRARQSDISRSRHLFQYQPPTCYCTEPYLPITDRPEPMALCPNPGCLK
                     WFHLGCLDWRGGDYRRPLTPFSISYIRSSGLQLLPLADYTSSPEVQSDVIRPLTPGKP
                     FWEVVNGTPTPKEIEKLREEGLAECQNEYAKRDDQESDKVRQEKEGVLSFAELQAWAG
                     QVDEQIPEVIQQAAIAPILRGEKAGVVGNARKVLGARQIICNAINLSLYSSSANSVIN
                     IKVESDSERNGGGDTKEKAVDVTAKVAGADESHPSILQMVEEWLLTHGDDLDESEART
                     VIWRCPSCSRFL"
     misc_feature    9860..9938
                     /note="CT-rich"
     gene            12166..15364
                     /locus_tag="CNM00050"
                     /db_xref="GeneID:3255110"
     mRNA            join(12166..12330,12387..13150,13211..13335,13395..13502,
                     13580..13723,13790..14102,14198..14272,14344..14457,
                     14550..14972,15041..15364)
                     /locus_tag="CNM00050"
                     /product="amino acid transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545435|gb|CF691276.1,gi|41545441|gb|CF691282.1,
                     gi|41569264|gb|CF715105.1,gi|41569276|gb|CF715117.1"
                     /transcript_id="XM_568372.1"
                     /db_xref="GI:58261923"
                     /db_xref="GeneID:3255110"
     CDS             join(12222..12330,12387..13150,13211..13335,13395..13502,
                     13580..13723,13790..14102,14198..14272,14344..14457,
                     14550..14972,15041..15271)
                     /locus_tag="CNM00050"
                     /codon_start=1
                     /product="amino acid transporter"
                     /protein_id="XP_568372.1"
                     /db_xref="GI:58261924"
                     /db_xref="GeneID:3255110"
                     /translation="MSPPQGKGVPVPNLGLKHESKKKGHVMQSSLELVFSYSRSQQMH
                     YGSRSAPSFLDDSSFRGDQFDVDDYDEDQNYNDIYDGIERTGEEQFEGRDLSGRLEDL
                     KVAGAISEANEDGSTQEELGQDSHITRRSSDEPAFFHSDSVPISPISQLQPSVNQGAK
                     VNTLLPDGIGPIQGLFLAAMPSPRLAPVLPHPGSLDTSYCTEAGPSSNPRTSKRWNSH
                     SRGDSNPMEIRESAALVSSSPQYHGKGKSAENRPLLDGRPTEGYASIQSQKEIRRKSN
                     RRKRSEDGQSTEGQTLFNATAVLVGIGLLSLPLAFAYAGWIGGTIMLLGFGWLTCYTA
                     KLLARLIRADGRMMGYTDIGLRAFGSWAGAGINLLVHFIVSSCNDGILTTGSSVALVL
                     LFGDTLNVLYPSIPSNVWKLVGFFIIVPTVLLPLRLLSLPSLLSSISSFFLIIVLLVD
                     GFLPSPEPSSASTGSLLHPSPTSLSPEWSRGNWLGGIGLILAGFGGHAVMPSLARDMK
                     RPEKFDGIVNWAFAIATGISFTAGAAGYLMFGETVSDEVTKDLMREKYHYPRILNIVA
                     LWMIVINPLTKFGLSSRPLNLTIEGILRISPSPPPSLFSPFDGGLESALGSGAPETSQ
                     VNFPKRRDRSSFSTRNDPRTSRRPSALTSPSNSRPFPQSQSQIVAFEQYVSKERKKRW
                     LRMVSRVVITALCVGVAVVLPGFGRVMAFLGSFSAFMICIILPLLFYIRLSPTLLPTC
                     PPSPHSLTFPPTARSQPTSKWASEKFTNAIHWVLVIASTALMIAGTIWAFLPGSGHDE
                     LET"
     gene            complement(15414..16757)
                     /locus_tag="CNM00060"
                     /db_xref="GeneID:3255207"
     mRNA            complement(join(15414..15638,15692..16364,16606..16757))
                     /locus_tag="CNM00060"
                     /product="expressed protein"
                     /transcript_id="XM_568445.1"
                     /db_xref="GI:58262069"
                     /db_xref="GeneID:3255207"
     CDS             complement(15785..16099)
                     /locus_tag="CNM00060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568445.1"
                     /db_xref="GI:58262070"
                     /db_xref="GeneID:3255207"
                     /translation="MVPRVCIQIRQRRAKITTNCVWIIWRVLDKLMRCAIGSARCWEM
                     WQLRLGLKTNVRVRIERDSEMIGNKTWSKRDVLETVGFSPLKFESRREKMLENLTLAD
                     FL"
     STS             16839..17882
                     /standard_name="Bam17"
                     /db_xref="UniSTS:470741"
     STS             17160..17500
                     /standard_name="Mbo1"
                     /db_xref="UniSTS:470743"
     gene            17330..18820
                     /locus_tag="CNM00070"
                     /db_xref="GeneID:3255108"
     mRNA            join(17330..17380,17429..17460,17526..17671,17844..17934,
                     18067..18069,18132..18325,18396..18820)
                     /locus_tag="CNM00070"
                     /product="Rho GTPase, putative"
                     /transcript_id="XM_568391.1"
                     /db_xref="GI:58261961"
                     /db_xref="GeneID:3255108"
     CDS             join(17359..17380,17429..17460,17526..17671,17844..17934,
                     18067..18069,18132..18325,18396..18507)
                     /locus_tag="CNM00070"
                     /codon_start=1
                     /product="Rho GTPase"
                     /protein_id="XP_568391.1"
                     /db_xref="GI:58261962"
                     /db_xref="GeneID:3255108"
                     /translation="MAMQSIKCVVVGDGAVGKTCLLISYTTNSFPGEYVPTVFDNYSA
                     SVLVDGRPVSLGLWDTAGQEDYDRLRPLSYPQTDVFLVCFSIVSPPSFENVKTKWIPE
                     IRHHAPTTPILLIGTKLDLRDDPVTLSRLKERRFQPIGFEMGVRCAREIGAVRYLEAS
                     SRTQKGLKNVFDEAIRAVLSPSARDAREKKKKKQQCLIL"
     gene            complement(<19042..>19928)
                     /locus_tag="CNM00080"
                     /db_xref="GeneID:3255146"
     mRNA            complement(join(<19042..19062,19209..>19928))
                     /locus_tag="CNM00080"
                     /product="peptide alpha-N-acetyltransferase, putative"
                     /transcript_id="XM_568389.1"
                     /db_xref="GI:58261957"
                     /db_xref="GeneID:3255146"
     CDS             complement(join(19042..19062,19209..19928))
                     /locus_tag="CNM00080"
                     /codon_start=1
                     /product="peptide alpha-N-acetyltransferase"
                     /protein_id="XP_568389.1"
                     /db_xref="GI:58261958"
                     /db_xref="GeneID:3255146"
                     /translation="MPVPLARIRPVSLARVRGTTAIHPALLRPTAIHLSRSFILPLTA
                     TLSSRSFLSTPHIFNANLQASSQRNTTSSGSDQKRQESESGPEHEPEHEPGAEPKSAY
                     ARFKALTRKYGSWAVGMYFFLSTIDFSLCFLLVHSLGAERIAPLMDSAKAFYRSKRYG
                     VEEAERMRVEDEREREEEMAAEKKEGKQAKSGWFGKTFWAEAVLAYTIHKTALLPIRA
                     GLTVAWTPKFVGWLTKRGWVGKVKVKRP"
     misc_feature    19167..19203
                     /note="A-rich"
     repeat_region   19630..19682
                     /rpt_type=tandem
                     /rpt_unit_seq="ttcggg"
                     /satellite="microsatellite"
     misc_feature    19995..20016
                     /note="GC_rich"
     gene            20341..22384
                     /locus_tag="CNM00090"
                     /db_xref="GeneID:3255233"
     mRNA            join(20341..20743,20799..20835,20898..20923,20989..21114,
                     21175..21293,21366..21554,21622..21665,21740..22384)
                     /locus_tag="CNM00090"
                     /product="glycoprotein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530449|gb|CF676290.1,gi|41530455|gb|CF676296.1,
                     gi|41532542|gb|CF678383.1,gi|41532549|gb|CF678390.1,
                     gi|41536852|gb|CF682693.1,gi|41536856|gb|CF682697.1,
                     gi|41537491|gb|CF683332.1,gi|41537505|gb|CF683346.1,
                     gi|41548500|gb|CF694341.1,gi|41548508|gb|CF694349.1,
                     gi|41549237|gb|CF695078.1,gi|41549248|gb|CF695089.1,
                     gi|41555070|gb|CF700911.1,gi|41555076|gb|CF700917.1,
                     gi|41555244|gb|CF701085.1,gi|41555255|gb|CF701096.1,
                     gi|41556729|gb|CF702570.1,gi|41556732|gb|CF702573.1,
                     gi|41556842|gb|CF702683.1,gi|41557260|gb|CF703101.1,
                     gi|41558299|gb|CF704140.1,gi|41561158|gb|CF706999.1,
                     gi|41561166|gb|CF707007.1,gi|41567190|gb|CF713031.1,
                     gi|41567205|gb|CF713046.1,gi|41571171|gb|CF717012.1,
                     gi|41571172|gb|CF717013.1,gi|41573909|gb|CF719750.1,
                     gi|41573915|gb|CF719756.1,gi|41573927|gb|CF719768.1,
                     gi|41573933|gb|CF719774.1,gi|41574434|gb|CF720275.1,
                     gi|41574438|gb|CF720279.1,gi|41574577|gb|CF720418.1,
                     gi|41575657|gb|CF721498.1,gi|41575666|gb|CF721507.1"
                     /transcript_id="XM_568387.1"
                     /db_xref="GI:58261953"
                     /db_xref="GeneID:3255233"
     misc_feature    20345..20470
                     /locus_tag="CNM00090"
                     /note="C-rich"
     CDS             join(20423..20743,20799..20835,20898..20923,20989..21114,
                     21175..21293,21366..21554,21622..21665,21740..22083)
                     /locus_tag="CNM00090"
                     /codon_start=1
                     /product="glycoprotein"
                     /protein_id="XP_568387.1"
                     /db_xref="GI:58261954"
                     /db_xref="GeneID:3255233"
                     /translation="MLPLSFLPALLALAPLARAQVTATYPNGATNPDTPEFAPIGSYV
                     NQSSESRLISLNGVDDFCLWGPRNISAVSTNLIGNIEPEVVAYCSKPRNNARIIPDGV
                     VTAAHFVKTALYVQIWGFWDATRIGIPDGDSGGELDPHGAENLGNPIGGNATSNVDGT
                     DVFYEEWMSFISYDQFCLRICTAETSNVTAALQCEHELDIMGCAFVMAIDDFYNTNNS
                     FTSCDGEPAAPPGLYPQANGSTSTFRQRYTGTWSNAETTDMFTVGQTVTPSSVAFYPA
                     TSNCYTYSTISNGIDTANWQVTATPSTLSGGSTVAVASVGTTSQSPPPGISTSSPTSS
                     SSSSGSSGSSAGSSSSSNTGSASTGATAVDSSGSSSAATKASTVHGQGIVVMGVAAVG
                     MLFGAAVLL"
     gene            22713..24782
                     /locus_tag="CNM00100"
                     /db_xref="GeneID:3255209"
     mRNA            join(22713..23348,23419..24105,24184..24385,24496..24782)
                     /locus_tag="CNM00100"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538509|gb|CF684350.1,gi|41538516|gb|CF684357.1,
                     gi|41553914|gb|CF699755.1,gi|41553922|gb|CF699763.1,
                     gi|41554215|gb|CF700056.1,gi|41554221|gb|CF700062.1,
                     gi|41559710|gb|CF705551.1,gi|41559717|gb|CF705558.1,
                     gi|41571830|gb|CF717671.1,gi|41572628|gb|CF718469.1"
                     /transcript_id="XM_568385.1"
                     /db_xref="GI:58261949"
                     /db_xref="GeneID:3255209"
     CDS             join(22752..23348,23419..24105,24184..24385,24496..24692)
                     /locus_tag="CNM00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568385.1"
                     /db_xref="GI:58261950"
                     /db_xref="GeneID:3255209"
                     /translation="MTTGTTTVVSSPGKVLIAGGYLVLDTHYSGLVIGTSSRFYSCVS
                     SRATSSRATSSTPSIDADTNTGIDTDTCQNKATISVRAGQFPPDASTWVYCISKPSAS
                     ASASAGEDGEEGEEGGDGTLYLKLEQTNEEQAGKNKFIFITLCKVLEYVYESILAHVG
                     DEETALDELMKRIKGGGGGEDGLDVVVFADNDFYSQREQLTSLSLPTRISSLPHLPPF
                     TPLPRPIPATNKTGLGSSAALVTSLVGSLLSHLHITHSSPEGSIADDDKAVIHSVAQL
                     AHCQAQGKVGSGFDVSSAVYGSHLYTRFSPSILTPLMSLAPFSRPRPSPGSTSLLLDA
                     LHPSKWDNKSIPFRLPKHLRLLLADVSCGTDTPSFVSSVLKWRNNDREKADEVWARLD
                     NANRALGKVLSDMVAAENEIDYEKTMMAASELTSDELLNLPTTPSPSRTLHLLHRLAL
                     SLSSIRALLREMSDLSGVPIEPKEQTRLLDACGQVKGVVGGGVPGAGGYDALYLLTID
                     HPTPIAGVDKLWAEWTEMDVCPLSAKQSDGGIRQEQVAEVKGLKEALERARR"
     gene            complement(24854..26967)
                     /locus_tag="CNM00110"
                     /db_xref="GeneID:3255234"
     mRNA            complement(join(24854..25107,25191..25361,25462..25651,
                     25755..25893,25954..26149,26202..26521,26575..26636,
                     26693..26967))
                     /locus_tag="CNM00110"
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538623|gb|CF684464.1,gi|41567558|gb|CF713399.1"
                     /transcript_id="XM_568380.1"
                     /db_xref="GI:58261939"
                     /db_xref="GeneID:3255234"
     CDS             complement(join(24963..25107,25191..25361,25462..25651,
                     25755..25893,25954..26149,26202..26521,26575..26636,
                     26693..26906))
                     /locus_tag="CNM00110"
                     /codon_start=1
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /protein_id="XP_568380.1"
                     /db_xref="GI:58261940"
                     /db_xref="GeneID:3255234"
                     /translation="MWFACLRPLPTTSKFRCSNVFGSKSRQCLPRAVNVKLKPLVRMR
                     SSHSLAERELRSLLPTMEELGLREGDHVTVGMSGGVDSATTLRILREFPIHLDVVFMR
                     NWDPLLSESPPESSLPPSPISLAYSSGSTSNREQNLSPCQWERDWNDVLKVATQVGIP
                     KDSIKLVDLSKEYWSRVFEPAVGVWERGGTPNPDVDCNREIKFGALLDVLPKKDRHFL
                     ATGHYGRVAHVPLLSHPGPSKLLRAVDKSKDQTYYLSQMTEQQLSRAILPLGSLLKTD
                     VRRLAEHWGLPNAKKEESMGVCFIGERGKFGDFISQYTSPPESGYLVNLSGERLAEHK
                     GLWYYTIGQRARVANQLKPMFVAKKGVGEKGTDILVVPGSDHPMLLCKSVHTSDFHWI
                     HDTFPRELLVKEPEKVGIQVRHRMNPVGGRIVVGGNVKDVTVEFNDPIVGVSPGQVVA
                     IWHDGWCLGSGVIDGTKCEGENMRGGTG"
     gene            <27665..>28685
                     /locus_tag="CNM00120"
                     /db_xref="GeneID:3255104"
     mRNA            join(<27665..27722,27788..28123,28295..28450,
                     28672..>28685)
                     /locus_tag="CNM00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_568383.1"
                     /db_xref="GI:58261945"
                     /db_xref="GeneID:3255104"
     CDS             join(27665..27722,27788..28123,28295..28450,28672..28685)
                     /locus_tag="CNM00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568383.1"
                     /db_xref="GI:58261946"
                     /db_xref="GeneID:3255104"
                     /translation="MEPEDPLLALIDEARGTWDDSVIENGQPGITVTANAPVGDLFPY
                     TEETYYMGPASSTFQSTTPTSGLFFPMNEPERVLSTATNYFPRGRQITTSHFPSAEIE
                     RNDGGITHTLRTPPFQSHPPTNNLSDLTTLHYPPFVSTPSTNEAEWINYFNVRGVTTR
                     DGRSEIGLDEAVDTEVEPTDEGHRFPL"
     gene            complement(28831..>30494)
                     /locus_tag="CNM00130"
                     /db_xref="GeneID:3255057"
     mRNA            complement(join(28831..29119,29208..29346,29453..29597,
                     29650..29722,29858..29973,30035..>30494))
                     /locus_tag="CNM00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_568381.1"
                     /db_xref="GI:58261941"
                     /db_xref="GeneID:3255057"
     CDS             complement(join(29030..29119,29208..29346,29453..29597,
                     29650..29722,29858..29973,30035..30494))
                     /locus_tag="CNM00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568381.1"
                     /db_xref="GI:58261942"
                     /db_xref="GeneID:3255057"
                     /translation="MPAPPSTLILVLDTHPLSWHLLAHLPPAPPLPDNKILDNATSSP
                     TSLDQFITILTVFLNAHLASKWGNEVVVYTASAGKAELIYPPSNEKIRQRGEGAKPSA
                     NMYRPFQILDQGIEEGLKEVVREEEGKLNTEGAGFINQPPAMVSALTKALCFINRRIS
                     PSVPADPTALPLSSDPNSGTSDTSGGLLPSKERRQQRMRGGYVGLMNCVFAAQKAAKS
                     PDRYPVPSSIDDRFFPSRLLATSRPSDGWSVLAMEWKRRFAPVSSRTVYTSHHLLSDI
                     TRSSPRHKTLSTFVQYVSVITGRWTWDSYVACVSPSSANQNPSVQCVKHGFLSSPFPD
                     SGRWPG"
     STS             29456..30235
                     /standard_name="Pst21"
                     /db_xref="UniSTS:470745"
     misc_feature    30399..30487
                     /note="G-rich"
     gene            <30656..33816
                     /locus_tag="CNM00140"
                     /db_xref="GeneID:3255100"
     mRNA            join(<30656..30883,30926..31569,31629..31895,31941..32910,
                     32969..33816)
                     /locus_tag="CNM00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_568379.1"
                     /db_xref="GI:58261937"
                     /db_xref="GeneID:3255100"
     CDS             join(30656..30883,30926..31569,31629..31895,31941..32910,
                     32969..33718)
                     /locus_tag="CNM00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568379.1"
                     /db_xref="GI:58261938"
                     /db_xref="GeneID:3255100"
                     /translation="MSVPLHRIRFYDHTPSPITAIQYTPLPLPAPSSTPSQTPPAHPG
                     DCIIARENGHVEIWKHVSDKQVDSYGNWVLYKTLPPTLTHPTISQLALVIRDPLNCST
                     PALNDLRLFTSSSDSGDLVERCLFTGKILQTYSIPSAPIWSLAVAPTHDLLCLSTTSP
                     NLHFLSIPPPTMFDPSPSLEPPPPHLLRTDALPSRTRTTSIAFGPPTLTQLPDGTAEW
                     RNTTLVTGNSDSSWRKWEIPAPADGSRQGPNRVVLKGRAVVEKVQKAGRGGRKATGAA
                     GGQKQTIVWSIGILPDGTVATTDSLGSLIFWDPLSLAQRQHFRAHKADAMCLAIGPGG
                     STVFTSGPDQRVCQFVRARAPGGEWVLVSAKRLHAHDVRALAVWPPTVGAGLAPVLAS
                     GGWDMSPTFTPASHPSSPPLPSPLARPSQSQTLPTFESTHPRRMGYLSSGLLSSSSPI
                     TFSPSARLVVGKRARGVGIWRVHPNENGWEKLLEMELRLRTTIIATTISEHGKYLAVS
                     DLYETKLFKLVPTSSGLKPTRLPLLPALLSSPLLHHLNTQLTTQGCGSTSMVFTPDGG
                     RVVLGLVTGQVLIIELAEDEENVEVEVVKCFERKERVVRGRVIKGKNVNGTGVNGNNT
                     APDIDVSMTEKAEEQESNSGSESESESESDSPSTFHSNGAHKQTQNEWISTLAVSEDG
                     QWLGVADLEGRVEVFNLDSLQLHSTLPTLPHPPTTLSFPSLPSPSPYLAILSPTNTLS
                     LYNLDQRRFIPLPSLGKGELEKFGNVLSKMQTPVMGMVWRPSRFSLPVGPRGDGEGKA
                     LLWGTDYLVTLRVSRDMLHPTPNAHVNGEVASMPNHSASTTTISSINGKGGESKSSRK
                     KRAREARQAKASHGQGEEGGAGVGRDLEEKKEEYYKIIGDRFKSILSVGWLVGSHQSQ
                     GEERGEEGELEVGVVERPWGDFVAELPGVFWSGSYGSS"
     misc_feature    31993..32068
                     /locus_tag="CNM00140"
                     /note="C-rich"
     misc_feature    32969..33067
                     /locus_tag="CNM00140"
                     /note="C-rich"
     gene            complement(33993..35629)
                     /locus_tag="CNM00150"
                     /db_xref="GeneID:3255045"
     mRNA            complement(join(33993..35165,35227..35462,35522..35629))
                     /locus_tag="CNM00150"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41529936|gb|CF675777.1,gi|41529943|gb|CF675784.1,
                     gi|41559657|gb|CF705498.1,gi|41559666|gb|CF705507.1,
                     gi|41564645|gb|CF710486.1,gi|41564650|gb|CF710491.1,
                     gi|41571737|gb|CF717578.1,gi|41571745|gb|CF717586.1"
                     /transcript_id="XM_568388.1"
                     /db_xref="GI:58261955"
                     /db_xref="GeneID:3255045"
     CDS             complement(join(34034..35165,35227..35462,35522..35575))
                     /locus_tag="CNM00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568388.1"
                     /db_xref="GI:58261956"
                     /db_xref="GeneID:3255045"
                     /translation="MTPNQQQSVEQDDWEIDTQEVILPKKLVRQPKVASPVGHGPNVS
                     STAISSSQNAGASYGSATGLAQANKGTGDVNEDEDDWFRGDRPTTNRQIWDSANARTP
                     STTIIAPQALPTPTVQLLRRTPNSASSGSNSPGNGANGEKKGKSMEERAEEYRLARER
                     IFGAGVAPAASDTSSASAQGSAGRNATTSSSPAPSPSEFANLSLNSSDKDRRQDRRST
                     SGNGRQRGLNATGTNAGNNNNSNNSSNNRFGGNGGAAGSMGERNGFYSGYTQRNESYN
                     RFPADTPRDLSSAYTYTPTSSSSPSPSSAARTTDRPFAGLVPSQVRTGCSPNPTNPTN
                     LTNSMYPTNPTNPMGRPTTTGDNGSPGLRSGEYSSTDMIPGSAAGPGLGSGAQGGVLR
                     QPLGPGVGQAGGFGIGFGGAGAGAGREGGQGYGNGYGYGGSGGFSAGAGGNRGYGGNG
                     GNGSGNRGVGSKYSPSGFRNPRQ"
     repeat_region   34718..34750
                     /rpt_type=tandem
                     /rpt_unit_seq="ttg"
                     /satellite="microsatellite"
     gene            <35860..>36899
                     /locus_tag="CNM00160"
                     /db_xref="GeneID:3255103"
     mRNA            join(<35860..35947,35998..36087,36152..36295,
                     36346..>36899)
                     /locus_tag="CNM00160"
                     /product="conserved hypotetical protein"
                     /transcript_id="XM_568377.1"
                     /db_xref="GI:58261933"
                     /db_xref="GeneID:3255103"
     CDS             join(35860..35947,35998..36087,36152..36295,36346..36899)
                     /locus_tag="CNM00160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568377.1"
                     /db_xref="GI:58261934"
                     /db_xref="GeneID:3255103"
                     /translation="MRQKRAKTYKRVMTLYTQTFGFRQPFQILVSQDLLLEGAKSELN
                     MPKQFVTVIQGECKPMITQCCMEALYKLGKPVQRTTDLAKTFERRKCNHRTALEPDEC
                     LKDVIDAGATNKHRYILGTQSTTLLTAMDRIPGLPVIHFNPRGVLVLSPPSTATIREK
                     NKVEEERRLEGVKVLEGVVDGGNVVGADLAPVSGGPAEKRSRKVKGPNPLSVKKKKTP
                     GQDKEGESKKRRRVEEEEVKEDENEVNAEGKRKRKRKKKKTAVGEAIEELNATNADRT
                     EKAVVSDDSDGSEEE"
     misc_feature    36682..36798
                     /locus_tag="CNM00160"
                     /note="GA-rich"
     gene            37127..38875
                     /locus_tag="CNM00170"
                     /db_xref="GeneID:3255195"
     mRNA            join(37127..37317,37374..37691,37740..37936,37996..38411,
                     38460..38592,38658..38875)
                     /locus_tag="CNM00170"
                     /product="asparaginase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542865|gb|CF688706.1,gi|41542874|gb|CF688715.1,
                     gi|41546845|gb|CF692686.1,gi|41546856|gb|CF692697.1,
                     gi|41552163|gb|CF698004.1"
                     /transcript_id="XM_568375.1"
                     /db_xref="GI:58261929"
                     /db_xref="GeneID:3255195"
     CDS             join(37222..37317,37374..37691,37740..37936,37996..38411,
                     38460..38592,38658..38682)
                     /locus_tag="CNM00170"
                     /codon_start=1
                     /product="asparaginase"
                     /protein_id="XP_568375.1"
                     /db_xref="GI:58261930"
                     /db_xref="GeneID:3255195"
                     /translation="MTGQQTAKRRSVLMIGTGGTIASETTASGLAPLRQDTFFRRIRQ
                     HPSLTSPLQFSSTSVSFSSPVITTVIDKNIKYPKLVTPELDDEGRDVEYEILDLNRHM
                     DSSEMTPAEWNKIAALVYQNWDGYDGFVILSGTDTLAYTAAILSFLFKDAGKPIIVTG
                     AQIPLSRPRSDGWTNILDSLFVAGVLPYAGVGIVFNHQVMHGTRATKTSPNLFAAFTT
                     PCIPPLINLNVKITLDSTLSLAPRSITPPAPLIALNADPTVLSVHIYPGLTGSLLSAQ
                     IAAVPTCKAVILSAYGSGNLPLDMENGVLEALKKMVEREVLVVVISQCAIPNIYPLYT
                     QGRTLLDIGVLPGYDLTHEAAFAKLIWLVSRPDLTFEQRQELFETPLVGEMSVTSRLR
                     KT"
     gene            39092..41755
                     /locus_tag="CNM00180"
                     /db_xref="GeneID:3255111"
     mRNA            join(39092..39190,39249..39606,39965..40018,40081..40247,
                     40303..40398,40469..41320,41404..41476,41554..41755)
                     /locus_tag="CNM00180"
                     /product="cyclohydrolase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41541779|gb|CF687620.1,gi|41541786|gb|CF687627.1,
                     gi|41570714|gb|CF716555.1,gi|41571530|gb|CF717371.1,
                     gi|41575712|gb|CF721553.1,gi|41575726|gb|CF721567.1"
                     /transcript_id="XM_568373.1"
                     /db_xref="GI:58261925"
                     /db_xref="GeneID:3255111"
     CDS             join(39119..39190,39249..39606,39965..40018,40081..40247,
                     40303..40398,40469..41320,41404..41476,41554..41570)
                     /locus_tag="CNM00180"
                     /codon_start=1
                     /product="cyclohydrolase"
                     /protein_id="XP_568373.1"
                     /db_xref="GI:58261926"
                     /db_xref="GeneID:3255111"
                     /translation="MTDLDKVLELLNNLTVKQEQLAQELKNHTCSCGAQYHYDPTAHH
                     SPPTSPTAGGVDTFRASRGSISSLSALLGSSPTSTSGFSPAPNGVANNSGASNGSSTP
                     YGNLSLDAAARGSGAPGGLVPPEKDAKKKHKGLYPSRVILTTYPSQAGINPIPINWGA
                     GPTARERGPVVCSRIKSNLPIRNAIGAHAGSYSIYRALSIAMGQLRPDWRPDLTNTHP
                     PFVLPPTDGWFGNKIVSFDPWGAMSQEVWAKEYAAGLDVRPTISQTKAHIKIQELDEL
                     FRKGEFPCDGEIVIKSPDLPAFPGADQGIEVNTYKAAIDPVWYLPGVADRLGIEEGVL
                     RRALFEDTGGMYPELLTRPDIKTFLPPIGGMTVYIMGDPAKLQDPDTEVTCRPHDSCS
                     GSDVFGSDICTCRPYLIFGISEAIKCAQRGGVGVIVYFQKEGRALGEVVKYMVYNRRK
                     RGGDTAAEYFNNTERVAGVKDARHQALMPDVLHFLGIKHIHNLISMSNMKYDAIIGSG
                     ITVGKRYEIPEELIPADGRVEIDAKIQSGYFSKKEVTEELVKETKGRNWEDIIH"
     gene            complement(42058..43884)
                     /locus_tag="CNM00190"
                     /db_xref="GeneID:3255084"
     mRNA            complement(join(42058..42349,42399..42850,42941..43884))
                     /locus_tag="CNM00190"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537633|gb|CF683474.1,gi|41553355|gb|CF699196.1"
                     /transcript_id="XM_568371.1"
                     /db_xref="GI:58261921"
                     /db_xref="GeneID:3255084"
     CDS             complement(join(42079..42349,42399..42850,42941..43378))
                     /locus_tag="CNM00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568371.1"
                     /db_xref="GI:58261922"
                     /db_xref="GeneID:3255084"
                     /translation="MSFLGNFLLIVDKTFDSLPILAKRDDWPQYSRQLRLSLLTLGLP
                     RLLDVGLAIPLSPAPTVPSPDTSPSTVSAGAAPPPPSPMPYDPILESKDSVIAGAILL
                     RLDPSIHETFVPIAMDGLGNYTHRLYPALSRSFGHYDPQHVYAKEMKMDWEDLHVNAL
                     FHGLPSRFHHLRNEQFGGSARKTAADIELTIANIDAAASYFASSSPAALAVSVCRSDE
                     TLTAFYTRLSCKWRQPSAAHPCARCGSPDHWVVSCPSPPVSSHPAHPGAPDSQRSRRT
                     QATSCPMGALRGRQVLRQTFRDKLKLAKQGPNGSKKGRWEVYVAARESASLKDIRNKQ
                     KRQTTIKLDPAAVLWNRWRDRAPKDWSELVKLLKNVCLLVLTLKLSYPTRFE"
     gene            complement(43899..45234)
                     /locus_tag="CNM00200"
                     /db_xref="GeneID:3255177"
     mRNA            complement(join(43899..44998,45071..45234))
                     /locus_tag="CNM00200"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544143|gb|CF689984.1,gi|41544152|gb|CF689993.1,
                     gi|41557590|gb|CF703431.1,gi|41557598|gb|CF703439.1"
                     /transcript_id="XM_568443.1"
                     /db_xref="GI:58262065"
                     /db_xref="GeneID:3255177"
     CDS             complement(join(44027..44998,45071..45184))
                     /locus_tag="CNM00200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568443.1"
                     /db_xref="GI:58262066"
                     /db_xref="GeneID:3255177"
                     /translation="MSTPPQSLRPAFLTTATKEDLRSASTEAGLTVHGSTYKITGDLL
                     SSDTAELGNTSSDPPFPSTPTVDHSTSQTTLPSHTPSDPTPPPPSATDQALATLTRLV
                     EDLTIEVLEQRNYVDQRLANELLPITSSVLPESPSYPGLVSSLPPSSSAPPVLSNRAP
                     SATTRNAVPLPKMDAQAEWAYIPPTVFDSVVDGTFEIRDLWKLDPTRRLEIEKMAEDV
                     ISDRALNGLSELLQITSAFTEQSRSLTKYRSLDDIILPWIVYCRIRDVVQPGSGHYLS
                     AHVIQLYLAFHALNKRFPAVLRYHLDVCQKRMSLGDSVDWSSWITLDLLVLNTSLVQS
                     LPSSSRGSTPSSGAPTTQHSCRRRGRK"
     gene            <48300..>49806
                     /locus_tag="CNM00210"
                     /pseudo
                     /db_xref="GeneID:3255213"
     gene            complement(48468..50981)
                     /locus_tag="CNM00220"
                     /db_xref="GeneID:3255072"
     mRNA            complement(join(48468..48809,48860..48881,48943..49092,
                     49148..49238,49295..49574,49623..49689,49764..49866,
                     49923..50002,50051..50258,50315..50329,50387..50424,
                     50468..50573,50632..50802,50872..50981))
                     /locus_tag="CNM00220"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541467|gb|CF687308.1,gi|41541476|gb|CF687317.1,
                     gi|41556278|gb|CF702119.1,gi|41556284|gb|CF702125.1,
                     gi|41557363|gb|CF703204.1,gi|41557380|gb|CF703221.1,
                     gi|41560929|gb|CF706770.1,gi|41560934|gb|CF706775.1,
                     gi|41561615|gb|CF707456.1,gi|41561618|gb|CF707459.1,
                     gi|41575990|gb|CF721831.1,gi|41575995|gb|CF721836.1"
                     /transcript_id="XM_568386.1"
                     /db_xref="GI:58261951"
                     /db_xref="GeneID:3255072"
     CDS             complement(join(48587..48809,48860..48881,48943..49092,
                     49148..49238,49295..49574,49623..49689,49764..49866,
                     49923..50002,50051..50258,50315..50329,50387..50424,
                     50468..50573,50632..50802,50872..50925))
                     /locus_tag="CNM00220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568386.1"
                     /db_xref="GI:58261952"
                     /db_xref="GeneID:3255072"
                     /translation="MDMYFPEHTPTPLPQIEQIYDTVNKRFDSGVTCSLAYRLFNLKQ
                     LAYLIKDNEALIQAAVENDQGKGPFDVTIGELWPALNEIDLAVKNVENWMKDESRTAD
                     AILSMKAMPSRVKKQPKGVALIISTWNYPWQLSLCPLVGAISAGCPAILKLSEHSPTS
                     SALLADLLPKYLDPEGYVAVLGEVEQSQALLVKPWGHILYTGSSGVGKIVAGAAAKTL
                     TPTTLELGGKSPVIVASDANFKIAARRLFSIKQMTGGQICVAPDYVLCVKDKVDEFIS
                     VCKSTLDELFPPLPSSKSLLSSPSGSSFLRSPADFSRQLSYIEKAEMEGKLVYKGEMD
                     EKTRRMGISLIRLNENGEREEGGVMVDEIFGPVLAIIPVEDIDGAIAYVNARPKPLAL
                     YVCAGKRSIFEKVISQTTSGSATWNDFAMATFARNLPFGGVGASGWGSYHGKDGFNAF
                     THHKAVLEIPYLFEPLISLRYPPISSLAKKILPFLMFAGIKFSRPKSIEHEEESLRRR
                     KWRWRVIVLGFLMGALVGGKRLLGNGQ"
     gene            <52163..>54041
                     /locus_tag="CNM00230"
                     /db_xref="GeneID:3255102"
     mRNA            join(<52163..52165,52219..52307,52388..53474,
                     53589..>54041)
                     /locus_tag="CNM00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_568370.1"
                     /db_xref="GI:58261919"
                     /db_xref="GeneID:3255102"
     CDS             join(52163..52165,52219..52307,52388..53474,53589..54041)
                     /locus_tag="CNM00230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568370.1"
                     /db_xref="GI:58261920"
                     /db_xref="GeneID:3255102"
                     /translation="MAACTYCQWKNASILTEDDWSSGCSSYTSTGLGFAEAVEQIPIW
                     AFRPSSNDSGAWDPSVSSVTAAANTGSWTTTLSRSFADASKTTAGNPAVTTARVNVSG
                     SGVSENSIWVQNTGTETASSTSTSNSNSTSSSDKDGDSNDSSTSHSIPLGPVIGGAAG
                     GLIGLIILFLLWRWYVNSRHRLSNPYSPSSTSPGFGGRIKKEKQKKKKRMSYPYPANT
                     RDSLVASPPVFALGGGVGGDEERGQSRGRSFLDMLVGGKGDESGNWKGQQRDTALYSD
                     PTTFADPRKAPEPYSASPMKWRTTSERLTLETDLSDSESAWSVSDDGGEDDGRRKKKG
                     RWKEAFIPSIAMAAEAKKKADRNNRKLSTYTTTSQQRLTRRTLTPSEMEEDEGAPFPL
                     CTSQSNRQLLTLPPKQPPPAHLPPPAPDEAQSLSLLSPLGGRVDFSQPPSIRRERISE
                     NPTLPSLYEPPTGARTYRASRGSEMFSPGSRYMGTIYGDGGDEDGARGGGEGRRFSES
                     TIGTALGSARSFKTRDGRGRWSGESAPALPTPKPR"
     gene            complement(54172..55701)
                     /locus_tag="CNM00240"
                     /db_xref="GeneID:3255044"
     mRNA            complement(join(54172..54421,54507..54670,54746..54804,
                     54859..55004,55054..55148,55203..55359,55420..55504,
                     55584..55701))
                     /locus_tag="CNM00240"
                     /product="NADH-cytochrome b5 reductase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41571109|gb|CF716950.1,gi|41571118|gb|CF716959.1"
                     /transcript_id="XM_568369.1"
                     /db_xref="GI:58261917"
                     /db_xref="GeneID:3255044"
     CDS             complement(join(54346..54421,54507..54670,54746..54804,
                     54859..55004,55054..55148,55203..55359,55420..55504,
                     55584..55686))
                     /locus_tag="CNM00240"
                     /codon_start=1
                     /product="NADH-cytochrome b5 reductase"
                     /protein_id="XP_568369.1"
                     /db_xref="GI:58261918"
                     /db_xref="GeneID:3255044"
                     /translation="MFTIEVLAQKLAPHASFLGGLVVAAILGLFIFFQEKDRKVLDPV
                     EWRSFKLVDKDHLSHNTALYRFALPRASDSLGLPIGQHISVAAEINGKQVVRSYTPTT
                     LDDDKGHFDLVVKTYEKGNISRYLSLLTIGQEIKVKGPKGKFVYTPNMAPHLVMIAGG
                     TGITPMYQIIKSSIKTPGDKTRLSLIYANIQEDDILLKKEIDELQAKSNGRFDVKYVL
                     NNPPEGWTGGVGFVTKEMIEEAMPSSGVGSANHGEGHKVLMCGPPPMITAMKGHLAQI
                     GYPAPRSVSKLEDQVFLF"
     gene            55852..58015
                     /locus_tag="CNM00250"
                     /db_xref="GeneID:3255184"
     mRNA            join(55852..56430,56483..57374,57483..57654,57736..57788,
                     57849..58015)
                     /locus_tag="CNM00250"
                     /product="vacuole protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41560051|gb|CF705892.1,gi|41560060|gb|CF705901.1"
                     /transcript_id="XM_568436.1"
                     /db_xref="GI:58262051"
                     /db_xref="GeneID:3255184"
     CDS             join(55913..56430,56483..57374,57483..57654,57736..57788,
                     57849..57947)
                     /locus_tag="CNM00250"
                     /codon_start=1
                     /product="vacuole protein"
                     /protein_id="XP_568436.1"
                     /db_xref="GI:58262052"
                     /db_xref="GeneID:3255184"
                     /translation="MIPRSLVELYGRANHVIQRILGPEQPLSEAEEPILPRSSSSSSM
                     ASTQQSTPSYRSSINQNLLRNSFPKALYPFLCVWVVIFIWLIRQQYYYFTPPHDLISC
                     TASPWDDWPPDNCGINGERCADDLTSLSDRTFRCMSGCKVTRLGNERWVGNERVNGVP
                     LVIGGGDMNHTYRADSWICAAAIHSNLISSSLGGCVTVHPLPYPAGHSNFISSAAHGL
                     TSTAFSQYFPGAFTLSHVIPSGCWDLHFIVMGVNAVCLLILTLFLRPPSSLLFTILLV
                     LGYFQITLFSDVPHFPPDWQSLFGGLIPVLITGYWIWKQAFVITLLHFRDAPFTLALW
                     QGAGYWVGVESSTVFARFPISRLGYDTLTPSGLLALVIIVVLIHVVVGYQALAMRKQG
                     LLRYYLVRYLPFIPILLILSNIPSYTLRLHHYLLALLAIPVLSLPNRLSLVLQAFMLG
                     LWLDGVGRWGWASFLEKTSSLLGDAPSGSWTPTFFANLSSPHTLSWSPITPEQAAEDV
                     TGYSILVNDMQAFAGWVNSTIDLKGVLRDGVNYFRIAYEKNGMSMDFSDPIVRWKNGT
                     WGGMEEPVDLF"
     gene            complement(62225..64610)
                     /locus_tag="CNM00260"
                     /db_xref="GeneID:3255113"
     mRNA            complement(join(62225..62568,62634..62697,62756..63099,
                     63162..63576,63636..63738,63793..64610))
                     /locus_tag="CNM00260"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535379|gb|CF681220.1,gi|41535394|gb|CF681235.1,
                     gi|41551679|gb|CF697520.1,gi|41551692|gb|CF697533.1,
                     gi|41564395|gb|CF710236.1,gi|41564411|gb|CF710252.1"
                     /transcript_id="XM_568384.1"
                     /db_xref="GI:58261947"
                     /db_xref="GeneID:3255113"
     CDS             complement(join(62497..62568,62634..62697,62756..63099,
                     63162..63576,63636..63738,63793..64522))
                     /locus_tag="CNM00260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568384.1"
                     /db_xref="GI:58261948"
                     /db_xref="GeneID:3255113"
                     /translation="MPPDIPKRKESLPQYISSQRAPHIRTPLSSSSFFNTNFKARGRN
                     MSNSRLRIALSKPIVRVLLVGSLLIGLVLLSRLGNGEDDGAWDASSWSDRHGNGRTVS
                     PGSRKGWSLWSNTPKLRTDQRVPRPILTRQNATLPPPTHPGRSRRLKPGSDPENPEYI
                     EGPLPTLDEAWEFLHPLLREIKSRTPSVPREHELTEPIFPPFLKDDLKERYRHLRDVF
                     DENTGQWVRGPERRWFLVTVCRQVAGMLADWFHAWTVLADFLGPESLVFSLFEGDSAD
                     GSGEILAYAMRTHLLNIGVPPSNIHIQTQLPAVDWDNHHRIELLAQMRNSGMQPFYDT
                     AATGLSPDGHPWAGIVFYNDVYLSATHFLELMHQHFKQDADMTCGWDHAGKWFYDGWV
                     ARDMSGDLFTPFPVKEEDKDLPQKLFPSSPETLKRYNRLLPFQVFAAWNGITVMSPEP
                     FLPPYNVRFRRGTPRTNDFWECQASESSFISWDFWKYGFGRIAVVPGVHATYGKGDAM
                     LRGWVEWPSEEDSYGETIWWNPNPPQRIRCHDWPDGLGKGYWAWDTVRWVKPPKLEIP
                     SASETTAQP"
     gene            complement(65651..67450)
                     /locus_tag="CNM00270"
                     /db_xref="GeneID:3255218"
     mRNA            complement(join(65651..65941,65991..66633,66694..66709,
                     66766..66918,67007..67450))
                     /locus_tag="CNM00270"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532458|gb|CF678299.1,gi|41532463|gb|CF678304.1,
                     gi|41535227|gb|CF681068.1,gi|41535242|gb|CF681083.1"
                     /transcript_id="XM_568378.1"
                     /db_xref="GI:58261935"
                     /db_xref="GeneID:3255218"
     CDS             complement(join(66272..66633,66694..66709,66766..66918,
                     67007..67315))
                     /locus_tag="CNM00270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568378.1"
                     /db_xref="GI:58261936"
                     /db_xref="GeneID:3255218"
                     /translation="MSTLSGSSAQSALWSTLSSIVSIPYKIYNSTRVFYQEYKLWYDT
                     NQPLFIFDTEMSLEWARIKTNGELRTDNPCIEYYYFAGDPDPERTDYHFMRFTLEDGT
                     TLERKEYCKAWAVTKQAVIFFEGLQESLKAWENPAEPKYGDQMLRVGAILKKWEAYLD
                     ELTFSMRTLKVWEREHCVPEKWAAIPPYDYDNPRIFPFATINSAGKRETRHLTPLFIP
                     LSKHVIKLHEEGFDEEWFDLWDRLKPDPEKFAPYHLPLDRPWPYKDIALRRKKVTGEN
                     RER"
     gene            67850..69601
                     /locus_tag="CNM00280"
                     /db_xref="GeneID:3255240"
     mRNA            join(67850..68132,68195..68249,68327..68339,68399..68571,
                     68632..68652,68711..68811,68873..68948,69007..69127,
                     69195..69601)
                     /locus_tag="CNM00280"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543654|gb|CF689495.1,gi|41543665|gb|CF689506.1"
                     /transcript_id="XM_568452.1"
                     /db_xref="GI:58262083"
                     /db_xref="GeneID:3255240"
     CDS             69203..69541
                     /locus_tag="CNM00280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568452.1"
                     /db_xref="GI:58262084"
                     /db_xref="GeneID:3255240"
                     /translation="MAACRDVLDFLNTQGMDAIIGTMICSLRDKRQVIDHSSFRGQHS
                     TVLRLPSLPSLSSLLPLYCYHHHHRPSLAHRLLLSYYDYRPDFPASKLRSRRFHNRFP
                     QLLYTYIGGC"
     repeat_region   69859..69891
                     /rpt_type=tandem
                     /rpt_unit_seq="tc"
                     /satellite="microsatellite"
     gene            70504..73052
                     /locus_tag="CNM00290"
                     /db_xref="GeneID:3255180"
     mRNA            join(70504..70617,70702..70872,70936..71041,71097..71134,
                     71190..71204,71275..71482,71541..71620,71680..71782,
                     71844..71910,71969..72248,72312..72402,72468..72617,
                     72692..72713,72785..73052)
                     /locus_tag="CNM00290"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531650|gb|CF677491.1,gi|41531658|gb|CF677499.1,
                     gi|41539999|gb|CF685840.1,gi|41540010|gb|CF685851.1,
                     gi|41546027|gb|CF691868.1,gi|41546037|gb|CF691878.1,
                     gi|41548919|gb|CF694760.1,gi|41552415|gb|CF698256.1,
                     gi|41552427|gb|CF698268.1,gi|41553647|gb|CF699488.1,
                     gi|41553656|gb|CF699497.1,gi|41562550|gb|CF708391.1,
                     gi|41565323|gb|CF711164.1,gi|41565334|gb|CF711175.1"
                     /transcript_id="XM_568438.1"
                     /db_xref="GI:58262055"
                     /db_xref="GeneID:3255180"
     CDS             join(70570..70617,70702..70872,70936..71041,71097..71134,
                     71190..71204,71275..71482,71541..71620,71680..71782,
                     71844..71910,71969..72248,72312..72402,72468..72617,
                     72692..72713,72785..73010)
                     /locus_tag="CNM00290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568438.1"
                     /db_xref="GI:58262056"
                     /db_xref="GeneID:3255180"
                     /translation="MSLPKHISTSLSQIDQLYDTVNKRFNSGVTLPLAYRLYNLKQLA
                     YLIKDNETLIQAAIEKDNGKGPFDATLGDIWPTLNEIDLAVKNVKKWMKDESRTGDAI
                     LAMKSMPSRVKKQPKGVALILATWNYPWQLALCPLVGAISAGCTAVIKGSEHAPTSSA
                     LLADLLPKYLDPEGYAVVLGEVEQAQALLAKPWGHILYTGSAVVGKIVAEAAAKTLTP
                     TTLELGGKSPVIVASDADLKIAARRMFSIKQMTGGQICVAPDYVLCVKDKVDEFISIC
                     KTTLDEFFPPSPSPQSLLNNQSASSFLRSPADFSRQLSYIQTAEKAGKLVYKGEMDEQ
                     TKRMGISLIRLNENGEGEEGGVMVDEIFGPVLTIIPVDSIEAAIAYVNARPKPLSLYV
                     CSSKRSVFEDIITKTTSGSATWNDFGIATLSRNIPFGGVGESGWGSYHGKDGFNTFTH
                     HKAVLEIPYLFEPLMSLRYPPMSILAKRIMPFLMFSGIHFSRPKSVEHEQRALRRRKW
                     GSRLVWFGVILVGALVGGKLIVGKGY"
     gene            <73459..79246
                     /locus_tag="CNM00300"
                     /db_xref="GeneID:3255277"
     mRNA            join(<73459..74665,74724..75673,75720..75780,75835..76178,
                     76215..76610,76660..77412,77464..77924,78086..78796,
                     78847..78921,78985..79246)
                     /locus_tag="CNM00300"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41547012|gb|CF692853.1,gi|41547028|gb|CF692869.1"
                     /transcript_id="XM_568368.1"
                     /db_xref="GI:58261915"
                     /db_xref="GeneID:3255277"
     CDS             join(73459..74665,74724..75673,75720..75780,75835..76178,
                     76215..76610,76660..77412,77464..77924,78086..78796,
                     78847..78921,78985..79132)
                     /locus_tag="CNM00300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568368.1"
                     /db_xref="GI:58261916"
                     /db_xref="GeneID:3255277"
                     /translation="MESRMSQEGGQPGAMGSTSVPRSVSVSDAITLFEQKSRSSSTSM
                     SRSSSRSVIYMNTTSSPSGSGNAVKSESRIKHPPRSPSNTAVSISGDAQPQLAEVSVS
                     SKSRSMDVASDTGEANEIGVRGVPTIRPQRSASRPMVPKRVASNTSATTSASRTPPAS
                     PRNHPGRSISNVSSSSSRASLANGSASNKAIGIGIGVPSTVRSRDARRASDTASIRPR
                     SPRTSYIAPNRQPFPHSISAPRSLSSQSYGVEHDDFSPRSERSQSPFHLQPAISVSQA
                     TPEKLLPPLYMQSSRSDLPRRTNGIPIPLSRHTSISSTPSAYYTPPSSKSPMSSELEQ
                     KGEDVTKSSILDGYFRNSFGRDSSFGPEPITLATTLEQTRSDLSIAPDMDRRSSAMEL
                     YRRKDSSGSITSFVASQRSSKPLPSLDVPLGDPITIASPQQIPAAPALHHASLTSSLN
                     VGTMASNPELTQPLRSTTPTESQSQPPPRKSPRKPPPPNLGITPPNPASLLSTPNPSG
                     SATPAATPPVPLKSPLRSISGGSSVTSYNSYSSVEIPGEISVETGIGLGFEGKLGLEV
                     EGKVEKVRRVKKLASMDSIIANAGTPLTSQTRMTRLVSATADDHTSQSPSQKDVNALK
                     KPDDARFTMLTAPSIYSQDSAPSSATSSAGLTDSPTESTSTAGKAGSGNASESTKGSG
                     RRRPMSGVFTQMAVGWGKMKEEREKRKSVDLGNSGHRRSSSLPRPKLVLPDEGFLTSV
                     ASNFSTRPTLGHTPLSSVPPSSLGARPTDRSHGKSPSLPILRRYPTSPTSTDPTSKGN
                     SIPPPSPRRAETSTALSSFLSPSSTTSPATSGVSKRSHLLREIATSERAYARDLKLFR
                     EGSLSSMSSSASVSTSDSDKSKRRSMYMSHTQSLSVSQTSSTQREALPKSPSEGMNLT
                     LQAAPPVGAMSPPVGKPLSPADVKAVFLNLDQLAAVAEELATKFEEAVGEDEEEGREC
                     EGGSDRMGEVFVSMVPKLQPLYSYFCARQSSASRHLMTLQSNPSHFTYLSQRWSSIST
                     QTRAWNLDSMLIKPVQRITKYPLLFEDLLKMTTPVHADYFKIREAKEMARGMAVEIDE
                     GKRRKEAVENAIGKKNMMAQPTVKDTKNLVSKTQGSKLLGLKRFRKDKPRAPSSSTPD
                     LVSPQQIAQSSLNQLSELSARLTALDEGVRKIGQEIMLWTAAAKETFVAQDDLVKTWL
                     HVVQLEPTDPTDQRMLEMRRVIDGIVSEAWGGLNMEVEDLIIPILSNLLNSTSNPRRV
                     LSKRSAKHPDYTRYHAFRVSKRTPDRDIVQGALEFVALHEQLIEELPTFLEGCLRILD
                     IAVVGFARAQAKYFRTTRDRLRAFAEGWIQSPLGASLATGGSSGESNVVAGADIVKAW
                     QESWEPYAEAMDNAFSPPSSRPESPAFSVPTRVRSSSLRDSFTTAPTIITPHTSSSTF
                     ASYGSQALSKDSQSAGRFNLLRRSSSKNNTNAPSRPPSRPTHSRRGSGLRPASLASDS
                     SRLSWGLPQIPAEGAGKIFDSLGFSPTDSFSLMSATSPTSASSRIEEMAERSPHLGAS
                     APEFSSLRMSPYSPNGAFVGQVPMPKHPFAVSPASETCSRSGSRADARRMKGGEIDVA
                     EGWRNEKVIYQCACVADFEPIELGNKKYRGLWFLPMMVGDLIDVFHEVGRIEELPSFP
                     YPEVGVENDGILVGRAENGEIGLVICSFLEPLR"
     gene            complement(<79669..>81297)
                     /locus_tag="CNM00310"
                     /db_xref="GeneID:3255099"
     mRNA            complement(join(<79669..79791,79875..79974,80138..80237,
                     80302..80530,80601..81027,81128..>81297))
                     /locus_tag="CNM00310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568376.1"
                     /db_xref="GI:58261931"
                     /db_xref="GeneID:3255099"
     CDS             complement(join(79669..79791,79875..79974,80138..80237,
                     80302..80530,80601..81027,81128..81297))
                     /locus_tag="CNM00310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568376.1"
                     /db_xref="GI:58261932"
                     /db_xref="GeneID:3255099"
                     /translation="MSARQSRSPERTHTNEHHHNHSALEKSKGHDLDTQKVNDPNYKP
                     RGWIARSEFWTWNCFTVNMGTGAVAILVGGVQFPFNGQREIGTVFFMIDLVVFFINVI
                     GVACRAVFHWANFKDSFFDHSDGTYIPCILLAVATLFVGIMDYAVPHCGFWLTRAMYV
                     VYWMYIGCSLAIALILECTLRGHQRKLDTITPADCLLFFPLMLSGTIGSALANKLPLQ
                     EAGYVIIISYWLQGMGMMLSLLKCSVWMARNMLRVNPPPSSLPGYLIAVGPPGFTAFA
                     FLNLGNLAVDAFPASNILASSNGGQIFQVVSVCRMVDGVVEFYFSPDWLLHGYCPIRR
                     STTIRDVQGHPSSRMSGRHSSLVHQLLHDLVQHLHLTIPRNAHIVEKG"
     gene            <81460..84727
                     /locus_tag="CNM00320"
                     /db_xref="GeneID:3255168"
     mRNA            join(<81460..81497,81620..81943,81987..82163,82211..83384,
                     83435..83591,83670..83741,83799..83890,83954..84292,
                     84365..84727)
                     /locus_tag="CNM00320"
                     /product="Rab GTPase activator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533993|gb|CF679834.1,gi|41558452|gb|CF704293.1,
                     gi|41558453|gb|CF704294.1,gi|41575313|gb|CF721154.1,
                     gi|41575322|gb|CF721163.1"
                     /transcript_id="XM_568367.1"
                     /db_xref="GI:58261913"
                     /db_xref="GeneID:3255168"
     CDS             join(81460..81497,81620..81943,81987..82163,82211..83384,
                     83435..83591,83670..83741,83799..83890,83954..84292,
                     84365..84685)
                     /locus_tag="CNM00320"
                     /codon_start=1
                     /product="Rab GTPase activator"
                     /protein_id="XP_568367.1"
                     /db_xref="GI:58261914"
                     /db_xref="GeneID:3255168"
                     /translation="MGKNDINLGIKTGCSYSPPPPRHPPRHVPPPPPTRQGPPALLQS
                     PRGHTPHRVQGRQRPRLPRPRRAGRCGERRRAEARRRGRGRTCHLGAGPGAGADGRAG
                     QGGVQARRRACRGRQGGGRVCVRVCPPAKGRKVCILRPSDRYLQHPRLSGASLALHWG
                     DGSPQTQPSLSHWYGSATINLTGGVSLPTLYFHDDESPLLASPNPSLENATPTPRARW
                     GFPPFLSLLTHRAVLVRSKLVHSRQGAELWLVNPSRADREVHEAGVDNDEPEPDVVPS
                     LKNKKPSPPTNYPPKPDYPAAYPQFDRLDTTNPKQALLTSLSNLTNLSRRKASQILSH
                     PLAQPVVPHLPPAVRSLVNVPGEWERNGQSNSKSLLQKGNDVASEFESARLYLAKWAR
                     VVAEEGERARRSELAAQARIRGSRSGLTPIPRDDDDVEDLGSSLGVFSLLPSKAYSKR
                     PVPSPTRTPQDPITFPEWEKWAKEGKDELFVRQQIFRRGFSDMEGDKLARREGWEVLL
                     GVVPWSVGGFGPGEQAVEKRKREREEMRQGRRRVYEGLKSKWRAEFGDGSGNETWKEE
                     WHRIDVDCRRTDRNQPIYAVPTTPTVPRALGEEENGRKSEKGEWEDDEEEGGMASLNP
                     HIAALRTILMTYHTFSPELGYVQGMSDLLSPIYVVFDANEGDAFWGLVGVMKMMESNF
                     LRDQSGMKKQLSTLQQLISILDPVLYTHLERTDSLNLFFTFRWILIAFKREFPFDAVI
                     HLWEVLWTGYYSEKFVLFVAMAVLESHREVIIRYLGEFDEVLKYANDLSGTIDLDTTL
                     AQAEVLFLSYRALVEDLDKENNEMVGSDDGLRRRTTTTTTIDLAADGQGKGKDKVPAK
                     SEDGLDEGLGEGDGGERKEKMETRAISEELRELLVSWKPEH"
     misc_feature    81633..81683
                     /locus_tag="CNM00320"
                     /note="C-rich"
     gene            complement(84712..>86474)
                     /locus_tag="CNM00330"
                     /db_xref="GeneID:3255076"
     mRNA            complement(join(84712..85401,85522..85607,85701..86005,
                     86053..86129,86340..>86474))
                     /locus_tag="CNM00330"
                     /product="trans-aconitate 3-methyltransferase, putative"
                     /transcript_id="XM_568382.1"
                     /db_xref="GI:58261943"
                     /db_xref="GeneID:3255076"
     CDS             complement(join(84787..85401,85522..85607,85701..86005,
                     86053..86129,86340..86474))
                     /locus_tag="CNM00330"
                     /codon_start=1
                     /product="trans-aconitate 3-methyltransferase"
                     /protein_id="XP_568382.1"
                     /db_xref="GI:58261944"
                     /db_xref="GeneID:3255076"
                     /translation="MSLDVVAPTLAFFVSFSSVLPARQSKALSNVHLWLESMDYRDRM
                     DIPHSTSRDISAVDRSSHFSSSLFSPQSYPQEAYDIILAYHFHFPPNRSGLKGGNTRL
                     LDLGCGPGFIASTLAPHFEHTLGLDPSQKMVQVGLQPVRGGKVEYRVGNAEDLDNAGV
                     GVGDHGVDLVVAGQAAHWFDHSKVWPQLTKHVRPGGTVAYLGYAELLFPSHPHLTHLF
                     TRFSSSPPPHGIGPYWSQPGRGIVEGLLDRVPFPVKPGPGPRRAEVEEVERVVGRRPV
                     MMIDEPALDPKPFSDTLEWYEAEWAPETAVRIRHTPSSPFLMRQHWTLAQLEAYLRTF
                     SATHEYWRANPQDEAKGKVELKVKTGEGDVVDRFMAVIKEAFEKEGVVDRDGKGSFDV
                     AWPLVLMMIKKNV"
     gene            <86541..>87227
                     /locus_tag="CNM00340"
                     /db_xref="GeneID:3255264"
     mRNA            join(<86541..86880,86941..>87227)
                     /locus_tag="CNM00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_568489.1"
                     /db_xref="GI:58262157"
                     /db_xref="GeneID:3255264"
     CDS             join(86541..86880,86941..87227)
                     /locus_tag="CNM00340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568489.1"
                     /db_xref="GI:58262158"
                     /db_xref="GeneID:3255264"
                     /translation="MAPRERGLTKHQYSAGLTYVAQKPSFLQNFGKPQAPPPSSASSR
                     GGREPLPERPDKGQWATGSGDEAGEREDDDDDDEWGDVFGGGGEEGPQVVVLKEGRHL
                     TAEEIKRERRKAAGQDSPPPEDQNKEKKDKNEEQVTSNANAQQKETSKTRIIPKPNPN
                     KRRLVGNGGAEDDKQGQEKETAATGGEKKKKKKAKKGLLSFDEAEGEA"
     gene            complement(87261..>88683)
                     /locus_tag="CNM00350"
                     /db_xref="GeneID:3255112"
     mRNA            complement(join(87261..87735,87807..88091,88183..88236,
                     88324..>88683))
                     /locus_tag="CNM00350"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533789|gb|CF679630.1,gi|41533795|gb|CF679636.1"
                     /transcript_id="XM_568374.1"
                     /db_xref="GI:58261927"
                     /db_xref="GeneID:3255112"
     CDS             complement(join(87370..87735,87807..88091,88183..88236,
                     88324..88683))
                     /locus_tag="CNM00350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568374.1"
                     /db_xref="GI:58261928"
                     /db_xref="GeneID:3255112"
                     /translation="MPDPTSPDRVQLIQNAILFLNDPKTQNSSLTSRVQFLESKGLTE
                     KEIEQAIREAGSGYGSSAGSGKQGAVGEGEAEGERTGPSSVYERPPERPRVPAPNYGY
                     GYTYAPPEPPKRDWRDLFIMAMVSGGVVYGLTALARKYLLPHLRPPSTTAFQSTSSEL
                     TSKYDEATRLLNELTEETTKVQVSIEEDREKVNQVVEEVEGAVKGLKAGEERWRDEMR
                     DMRGEVESLKELVPRMIEKHMQSQSSALADLQSEIRSLKTLLASRSQLPPTGSAAGSG
                     SGSRSDVGSPAPTPTAAAANALLGPRAGGKAGIPAWQMAPPAPPPTNTAHTSSDSTST
                     SGSGSGEDTSETGKGNDKEV"
     gene            89595..91849
                     /locus_tag="CNM00360"
                     /db_xref="GeneID:3255181"
     mRNA            join(89595..89668,89777..89810,89870..89889,89960..90016,
                     90215..90222,90279..90377,90435..90509,90562..90783,
                     90838..90858,90911..91129,91179..91360,91408..91523,
                     91587..91849)
                     /locus_tag="CNM00360"
                     /product="aspartate transaminase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530236|gb|CF676077.1,gi|41530251|gb|CF676092.1,
                     gi|41532123|gb|CF677964.1,gi|41535601|gb|CF681442.1,
                     gi|41535609|gb|CF681450.1,gi|41537253|gb|CF683094.1,
                     gi|41538552|gb|CF684393.1,gi|41538557|gb|CF684398.1,
                     gi|41538716|gb|CF684557.1,gi|41538721|gb|CF684562.1,
                     gi|41539287|gb|CF685128.1,gi|41539294|gb|CF685135.1,
                     gi|41539500|gb|CF685341.1,gi|41539507|gb|CF685348.1,
                     gi|41540450|gb|CF686291.1,gi|41540455|gb|CF686296.1,
                     gi|41541739|gb|CF687580.1,gi|41541747|gb|CF687588.1,
                     gi|41542498|gb|CF688339.1,gi|41542501|gb|CF688342.1,
                     gi|41542503|gb|CF688344.1,gi|41544381|gb|CF690222.1,
                     gi|41544389|gb|CF690230.1,gi|41548804|gb|CF694645.1,
                     gi|41548808|gb|CF694649.1,gi|41549951|gb|CF695792.1,
                     gi|41549959|gb|CF695800.1,gi|41550236|gb|CF696077.1,
                     gi|41550245|gb|CF696086.1,gi|41553084|gb|CF698925.1,
                     gi|41553090|gb|CF698931.1,gi|41554288|gb|CF700129.1,
                     gi|41554305|gb|CF700146.1,gi|41555262|gb|CF701103.1,
                     gi|41555268|gb|CF701109.1,gi|41560576|gb|CF706417.1,
                     gi|41560586|gb|CF706427.1,gi|41562311|gb|CF708152.1,
                     gi|415"
                     /transcript_id="XM_568366.1"
                     /db_xref="GI:58261911"
                     /db_xref="GeneID:3255181"
     CDS             join(89665..89668,89777..89810,89870..89889,89960..90016,
                     90215..90222,90279..90377,90435..90509,90562..90783,
                     90838..90858,90911..91129,91179..91360,91408..91523,
                     91587..91771)
                     /locus_tag="CNM00360"
                     /codon_start=1
                     /product="aspartate transaminase"
                     /protein_id="XP_568366.1"
                     /db_xref="GI:58261912"
                     /db_xref="GeneID:3255181"
                     /translation="MSFTNFWAGVPEGPPDPILGVTDAFKKDTSPKKVNLGVGAYRDE
                     DGKPYVLDSVLKAEDILHKKRLDKEYLPITGAADFIKLASELAYGKDSKPLREGRVAV
                     SQSISGTGALRIATGFLSSFYSGPKVIYLPNPTWGNHVPLAESVGIKVERYRYFDKKT
                     VGLDFEGMKEDIKNAESGSIILLHACAQNPTGIDPTQEQWKELSDLLKAKKHLPLFDM
                     AYQGFASGDIIRDAFAVRYFVEQGHQIILCQSFAKNLGLYAERAGTFSMVCASPEEKE
                     RVMSQIKRVVRPLYSSPPIHGAQLVATILGTPELYDEWLTEVKKMADRIIAMREKLYN
                     LLIELKTPGEWGHIKSQIGMFSFTGISKEQVDDLAEYAHVYMTKDGRISMAGLNEHNI
                     QYFAESLSKAVKGELRTKSAL"
     STS             90050..90849
                     /locus_tag="CNM00360"
                     /standard_name="Hind9"
                     /db_xref="UniSTS:470749"
     gene            complement(91630..93739)
                     /locus_tag="CNM00370"
                     /db_xref="GeneID:3255163"
     mRNA            complement(join(91630..91986,92042..92185,92248..92336,
                     92394..92558,92627..92770,92841..92997,93051..93147,
                     93212..93440,93498..93578,93635..93739))
                     /locus_tag="CNM00370"
                     /product="Aryl-alcohol dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530657|gb|CF676498.1,gi|41530667|gb|CF676508.1,
                     gi|41531694|gb|CF677535.1,gi|41531705|gb|CF677546.1,
                     gi|41532908|gb|CF678749.1,gi|41532911|gb|CF678752.1,
                     gi|41533073|gb|CF678914.1,gi|41535933|gb|CF681774.1,
                     gi|41535938|gb|CF681779.1,gi|41537061|gb|CF682902.1,
                     gi|41537073|gb|CF682914.1,gi|41537636|gb|CF683477.1,
                     gi|41537639|gb|CF683480.1,gi|41538208|gb|CF684049.1,
                     gi|41538217|gb|CF684058.1,gi|41540035|gb|CF685876.1,
                     gi|41540046|gb|CF685887.1,gi|41540264|gb|CF686105.1,
                     gi|41540270|gb|CF686111.1,gi|41541700|gb|CF687541.1,
                     gi|41541704|gb|CF687545.1,gi|41543230|gb|CF689071.1,
                     gi|41543239|gb|CF689080.1,gi|41546106|gb|CF691947.1,
                     gi|41546374|gb|CF692215.1,gi|41546378|gb|CF692219.1,
                     gi|41548257|gb|CF694098.1,gi|41548262|gb|CF694103.1,
                     gi|41551294|gb|CF697135.1,gi|41552193|gb|CF698034.1,
                     gi|41552198|gb|CF698039.1,gi|41553774|gb|CF699615.1,
                     gi|41553782|gb|CF699623.1,gi|41557199|gb|CF703040.1,
                     gi|41557205|gb|CF703046.1,gi|41557718|gb|CF703559.1,
                     gi|41557725|gb|CF703566.1,gi|41558786|gb|CF704627.1,
                     gi|415"
                     /transcript_id="XM_568365.1"
                     /db_xref="GI:58261909"
                     /db_xref="GeneID:3255163"
     CDS             complement(join(91954..91986,92042..92185,92248..92336,
                     92394..92558,92627..92770,92841..92997,93051..93147,
                     93212..93440,93498..93578,93635..93698))
                     /locus_tag="CNM00370"
                     /codon_start=1
                     /product="Aryl-alcohol dehydrogenase"
                     /protein_id="XP_568365.1"
                     /db_xref="GI:58261910"
                     /db_xref="GeneID:3255163"
                     /translation="MPRPALTSSTDFTPADPNAKFSMADLFAPVPEPRTELERYRLLS
                     PTAAVRVSPLCLGAMSIGDQWTPFMGGALNFEEACKLLDTFYEAGGNFIDTANNYQHE
                     QSEMIIGEWMEKRGIRDEIVLATKYTTFCLDRKEGKFQGIGANFVGNHRKSLRHSVED
                     SLKKLRTDYIDLLYVHWWDYSTSIPELMQSLNDLVKSGKVLYLGISDTPAWIVSQANE
                     YARHHGLAQFVVYQGLWNLGVRDLERDIIPMARANGMSIAPWGVLGQGKFKSPEELQN
                     KDKWRANAPPTEQDIKISEALSEVAKEIGDDVKPASIAMAWARQTVTDCYPIVGGTNP
                     EHLKANIEALKITLTDKQMDRLNNAYKFDYGFPYNRFGRDPHYLPEGKPDNGLLTTAA
                     HLKYTQLP"
     gene            complement(<95075..>96502)
                     /locus_tag="CNM00380"
                     /db_xref="GeneID:3255164"
     mRNA            complement(<95075..>96502)
                     /locus_tag="CNM00380"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41560676|gb|CF706517.1,gi|41560691|gb|CF706532.1"
                     /transcript_id="XM_568364.1"
                     /db_xref="GI:58261907"
                     /db_xref="GeneID:3255164"
     CDS             complement(95075..96502)
                     /locus_tag="CNM00380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568364.1"
                     /db_xref="GI:58261908"
                     /db_xref="GeneID:3255164"
                     /translation="MTLNCYSGFAGRLLVPVTYVMWSWPGSWLHPSVRVQKKNGGPSP
                     IASSTYKLNITSSDLHTPMSVPELSPAVIQELLPHLLPPSPLPQPLLSKSLLQRLTYL
                     PPSPSDLDAHLSPFPSSEEQPISSRLRELSRGHRWSEKQYAREGEDVFARMIVEREEG
                     GEGVEVWFEWEGGSEGSEGRGWVYHSARIPSTSEHIWFSSPALLPPPVHHMPEPSHDE
                     ADDPYAAPAGYWSAFDDEPLFDTKEPDYESDHVGAEDAYWAQYSRPATAPITPGTHTP
                     GLYHAHSESNPHNVPHPHAHNGLASYFQKTRPDVSQEQLKSIDETAVKLHESLTQLGL
                     HPQNGGLALASLSLEPKGIWRETGDDVRAKIAGKIGSGLNNIWRQFVGQSEGEEKEEK
                     AMAWLRLAQPVVDPLACPIAINRSLNSERVVAKLEVLKDMYELLNEAEEEQGFWRMVE
                     GVIRKSSGEEEGMEDEVTRQQMYYE"
     gene            96605..>97377
                     /locus_tag="CNM00390"
                     /db_xref="GeneID:3255148"
     mRNA            join(96605..96921,96976..97077,97129..>97377)
                     /locus_tag="CNM00390"
                     /product="expressed protein"
                     /transcript_id="XM_568363.1"
                     /db_xref="GI:58261905"
                     /db_xref="GeneID:3255148"
     CDS             join(96706..96921,96976..97077,97129..97377)
                     /locus_tag="CNM00390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568363.1"
                     /db_xref="GI:58261906"
                     /db_xref="GeneID:3255148"
                     /translation="MRSIRRLLSRRLLSTTACLAAKPPVKLLHIPKLGSESEHLLARQ
                     WVDAFTPEDIPKEGWVATRSRSSGPGGQHVNKTESKVTIRCDLDQAVGRWLPKFIMSA
                     LTKSTHYHHSPPSLLITSQTTRSASQNQANALSLLHQTIVSSANSLIINPTSPEQKER
                     VKELEKKEKERRMEMKKRRSMKKASRRE"
     gene            complement(97443..99405)
                     /locus_tag="CNM00400"
                     /db_xref="GeneID:3255196"
     mRNA            complement(join(97443..97908,97964..98211,98261..98288,
                     98336..98412,98512..98740,98801..99405))
                     /locus_tag="CNM00400"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539531|gb|CF685372.1,gi|41560055|gb|CF705896.1,
                     gi|41560063|gb|CF705904.1,gi|41565363|gb|CF711204.1,
                     gi|41565366|gb|CF711207.1"
                     /transcript_id="XM_568441.1"
                     /db_xref="GI:58262061"
                     /db_xref="GeneID:3255196"
     CDS             complement(join(97538..97908,97964..98211,98261..98288,
                     98336..98412,98512..98740,98801..99344))
                     /locus_tag="CNM00400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568441.1"
                     /db_xref="GI:58262062"
                     /db_xref="GeneID:3255196"
                     /translation="MSTPSNRQVQQPRFFFPPTSVASSPATLNLGTSLALSRQTSRSS
                     RHGHGQSEGSEHRRRVAYGREHLHSRSRSGILFGGETNSTGSLSSDGTELQIQEALST
                     SIILDKDQQVVAFQPRFQGRARTPSPNPTEMDIMDALADIHRGLYLGEEPLDQEGGNK
                     SWEQKVGSLRKVIEQYFEGDCVYDTPLVRLTSRSSLLSHFSLLHLLSTLTLPSLTPSA
                     VIRHARSLTSAFMLRLVNVTPREADPIPRFRKRDTFGERRDGEDGWWKVWEVRAECSE
                     IGEMECYDGYRLAMIDHIISLHLLPSLTRPLPSEPTTPSFSSPSPLSTPSPSSAHLPG
                     ALHSLPAPTFVRRLVGTLASELDLVLKWKLPMTTVVEMNEVGKATYIRDIVDLRDAVE
                     TFVPFAKRFGWLTRSLTGIVSSVLGDIVVRSILPKREEMIETAINVETVETAYRASEY
                     VVESPSREGSKTRISTQGGQKENSLGLQNLGRGSHMAPDVDDEALVTE"
     STS             99179..99977
                     /standard_name="Xba27"
                     /db_xref="UniSTS:470748"
     gene            <100707..103660
                     /locus_tag="CNM00410"
                     /db_xref="GeneID:3255210"
     mRNA            join(<100707..100776,101008..101665,101719..101985,
                     102038..102650,102784..102901,102959..103070,
                     103370..103660)
                     /locus_tag="CNM00410"
                     /product="beta-glucan synthesis-associated protein,
                     putative"
                     /transcript_id="XM_568362.1"
                     /db_xref="GI:58261903"
                     /db_xref="GeneID:3255210"
     CDS             join(100707..100776,101008..101665,101719..101985,
                     102038..102650,102784..102901,102959..103070,
                     103370..103400)
                     /locus_tag="CNM00410"
                     /codon_start=1
                     /product="beta-glucan synthesis-associated protein"
                     /protein_id="XP_568362.1"
                     /db_xref="GI:58261904"
                     /db_xref="GeneID:3255210"
                     /translation="MGALHWSVLIIRRLITEGRLQQHISSHSSLDYIPLLMSHRLTSS
                     TSANWGPRGSISSFASVSTANRYGPSATPTSTLSTVPLNVHSPHQAALPTDDDDDLDD
                     SLHTFTPKEYREHYISSRFNLKSWRGWTNALTLVVLAGGAVMLFAGYPIISFYYGDSN
                     SSGGNTSGFNLGGINASGQYPEIPGLPSLIDPDTPSWAYSRKGSDDEDWELVFSDEFE
                     KEDRTFFEGDDPFWTGMDIHYWVTGDYEWLDPSAVTTKDGHLVITMTQEPIHDLNFRS
                     GMIQSWNKLCFNKNAIFEVSASFPGTSEIGGFWPGIWTMGNLGRPGYAGTTDGTWPYS
                     YDSCDVGTLPNQTWVNGTGPIAALTTGSNGGALSYLPGQRLSACTCPGEDHPGPDITV
                     GRAAPEIDMVEAQIAIAEGEGQVSASLQLAPFDDYYQFDNSTRYATIYDNDLTYFNTY
                     LGGTTQQSASGLTTVPSKIYYDQDGESKQFVMFAMEYQAFPDDRDNAYITWWADNKTS
                     WTLRSGAIGPNERTEVSRRLIPEEPMAMSNGFQAVDFNHLTWPNYLRIDYVRIYQKAD
                     HISLTCDPEDYPTADYIEDHIEVYSNPNITTWKEGGYSFPKNRLKDEVSRASRQSA"
     gene            104373..>106098
                     /locus_tag="CNM00420"
                     /db_xref="GeneID:3255284"
     mRNA            join(104373..104841,104915..105387,105434..105745,
                     105829..>106098)
                     /locus_tag="CNM00420"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550171|gb|CF696012.1,gi|41550178|gb|CF696019.1"
                     /transcript_id="XM_568361.1"
                     /db_xref="GI:58261901"
                     /db_xref="GeneID:3255284"
     CDS             join(104418..104841,104915..105387,105434..105745,
                     105829..106098)
                     /locus_tag="CNM00420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568361.1"
                     /db_xref="GI:58261902"
                     /db_xref="GeneID:3255284"
                     /translation="MPHLSKKQEALHEIDNRISSLLPYVSNSLIRHQTGLLLSLRKIH
                     ENSRYYQRIPHSSHYENHDYLFLRSSLLPSTDDKIIKTLRMNRAEFTSLVALFGGHEI
                     FKSQGRKPQAPPEVQLATCIYRMAGGERMSTVENHFNLSHGSVSLYTDRSLIAIVSSL
                     KQYVFWPSEAERGVLARELYAQYGIPSCIGFIDGTDIVLHQAPSIGREKAHTMHSYKE
                     RYGYKMIAVVDHLKRFRYAWFGFSAATNDQMAQDLSDLHRNPHRFFSPKEYVLGDAGM
                     KSSDTVIPLFKRERRMQVTVGPKAYFNHKCAKARVMIEQAFGILKNRWQILQDCRLTC
                     RTVTDEARLYLVIQACMVLHNLLVETWKDSLTTCEVEGVMNINESVINIGDEAGNRRR
                     DEIVAEMIREEISFVFAEGPTSSKHGKRFLQGDLHLRCDPCSGFHFLNLNFSLIILFL
                     RLAKVFLFFKIPSHPFPAIILLLRSRNFPHFFIYAALRCLAT"
     gene            complement(<106173..>107282)
                     /locus_tag="CNM00430"
                     /db_xref="GeneID:3255270"
     mRNA            complement(join(<106173..106594,106660..106789,
                     106869..>107282))
                     /locus_tag="CNM00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_568490.1"
                     /db_xref="GI:58262159"
                     /db_xref="GeneID:3255270"
     CDS             complement(join(106173..106594,106660..106789,
                     106869..107282))
                     /locus_tag="CNM00430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568490.1"
                     /db_xref="GI:58262160"
                     /db_xref="GeneID:3255270"
                     /translation="MQPSQPAQSSPSKRRHSSAQLSQTQTGASATVPLQPTTNASKRS
                     KKNPAVSTGHGTDGTPPAEENWWADRKIDWENDCGGEDQQSSFAYFKDWIPTGISYMS
                     GAVGGYTLKRGAKEFQRFLYEKKGPTKRSVKSIENKYISVRKGWKTAYNLTQQTGAGD
                     GGIITIHTPTGDVGIPYDKLGDHRENYCPDYNFWNEIFQSRQGARPEFRTSTENDSSF
                     SLNCMREHVPCPHKETTSDNAPLEGPRPVDEGTSEDLELQRQSRRIHGDNDNDDLQEE
                     GNSCHKEGGGDLSSQHPLLEKSIRSRLSHRKCVLFTFFLCLLTFL"
     gene            <107599..>108448
                     /locus_tag="CNM00440"
                     /db_xref="GeneID:3255273"
     mRNA            join(<107599..107670,107747..107835,107926..108109,
                     108159..108239,108287..>108448)
                     /locus_tag="CNM00440"
                     /product="ADP-ribosylation-like factor, putative"
                     /transcript_id="XM_568360.1"
                     /db_xref="GI:58261899"
                     /db_xref="GeneID:3255273"
     CDS             join(107599..107670,107747..107835,107926..108109,
                     108159..108239,108287..108448)
                     /locus_tag="CNM00440"
                     /codon_start=1
                     /product="ADP-ribosylation-like factor"
                     /protein_id="XP_568360.1"
                     /db_xref="GI:58261900"
                     /db_xref="GeneID:3255273"
                     /translation="MIRRPFDNCSQKQSQVQGDEGAIPTTILKKLNNENISDISPTLG
                     FNIKTLIRDGLADNGPTYFLELGDVGGQRTLRPYWRNYFESTDAVVWVVDSSDRMRME
                     DCRDELKELLHEERLAGATLLIFANKQDLGGSMTLEEIRDALELRSIISHRWIVYPCS
                     AFTGKNLDDGMNWLVKEVAGRLYWSGLNAKEADLF"
     gene            complement(108534..111417)
                     /locus_tag="CNM00450"
                     /db_xref="GeneID:3255256"
     mRNA            complement(join(108534..108877,108927..108989,
                     109044..109300,109350..109601,109651..110137,
                     110199..110575,110636..111417))
                     /locus_tag="CNM00450"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536496|gb|CF682337.1,gi|41539056|gb|CF684897.1,
                     gi|41549650|gb|CF695491.1,gi|41549661|gb|CF695502.1,
                     gi|41556258|gb|CF702099.1,gi|41556261|gb|CF702102.1,
                     gi|41558847|gb|CF704688.1,gi|41562840|gb|CF708681.1,
                     gi|41562841|gb|CF708682.1,gi|41562971|gb|CF708812.1,
                     gi|41564779|gb|CF710620.1,gi|41569225|gb|CF715066.1,
                     gi|41569233|gb|CF715074.1,gi|41570486|gb|CF716327.1,
                     gi|41570487|gb|CF716328.1"
                     /transcript_id="XM_568456.1"
                     /db_xref="GI:58262091"
                     /db_xref="GeneID:3255256"
     mRNA            complement(join(108534..108877,108927..108989,
                     109044..109300,109350..109601,109651..110137,
                     110199..110296,110361..110572,110636..111304))
                     /locus_tag="CNM00450"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536496|gb|CF682337.1,gi|41539056|gb|CF684897.1,
                     gi|41549650|gb|CF695491.1,gi|41549661|gb|CF695502.1,
                     gi|41556258|gb|CF702099.1,gi|41558847|gb|CF704688.1,
                     gi|41558855|gb|CF704696.1,gi|41562840|gb|CF708681.1,
                     gi|41562841|gb|CF708682.1,gi|41562971|gb|CF708812.1,
                     gi|41564779|gb|CF710620.1,gi|41564786|gb|CF710627.1,
                     gi|41569225|gb|CF715066.1,gi|41570486|gb|CF716327.1"
                     /transcript_id="XM_568457.1"
                     /db_xref="GI:58262093"
                     /db_xref="GeneID:3255256"
     CDS             complement(join(108717..108877,108927..108989,
                     109044..109300,109350..109601,109651..110137,
                     110199..110289))
                     /locus_tag="CNM00450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568456.1"
                     /db_xref="GI:58262092"
                     /db_xref="GeneID:3255256"
                     /translation="MSPYIHPSEARAPGESVRCTTRLPPILASIGTVLIDAFDSLPRP
                     IVDDSQASSRPASPVIDERAPQPQGHLQHLVIPARRLRLSPPLSSPATSGTSGPSTPQ
                     MTLDDIPVPNAEEVYEMLGGGALYAIVGARFWLPPCQLRTLVDRAPAENDDCPKDVEQ
                     KLAKLGNEIWVWNRGEGTRMTRARIRYEGDVRYFQPVVKAPYRTIQELSTSPLLYAEY
                     LHISPPYSPENVAVIVSDLKALPKDSWRPKIVFEPTPPSCHPGQKDWLEHILPDIEVL
                     SPNHEELFSFYSIPTMATSSISLRPTVERLVTHILHDVGIGANGQGIVVVRCGRLGAC
                     VGTKKGGLKWCPAYWEGDDVKNVKDVTGAGNSFLGGYVAGLSLTNDPYEALLYATISS
                     SFVVEQFGLPRLMDCTDPLTGEEIWNADTPSRRLKELKRRLGLL"
     gene            113368..116986
                     /locus_tag="CNM00460"
                     /db_xref="GeneID:3255101"
     mRNA            join(113368..113603,113767..114007,114650..114813,
                     114863..114973,115023..115184,115232..115374,
                     115429..115664,115712..115828,115875..116130,
                     116189..116238,116294..116498,116550..116986)
                     /locus_tag="CNM00460"
                     /product="allantoin permease, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531659|gb|CF677500.1,gi|41533510|gb|CF679351.1,
                     gi|41535420|gb|CF681261.1,gi|41536360|gb|CF682201.1,
                     gi|41538180|gb|CF684021.1,gi|41538262|gb|CF684103.1,
                     gi|41538528|gb|CF684369.1,gi|41538863|gb|CF684704.1,
                     gi|41539194|gb|CF685035.1,gi|41539199|gb|CF685040.1,
                     gi|41539405|gb|CF685246.1,gi|41540031|gb|CF685872.1,
                     gi|41540040|gb|CF685881.1,gi|41540272|gb|CF686113.1,
                     gi|41543458|gb|CF689299.1,gi|41543465|gb|CF689306.1,
                     gi|41545602|gb|CF691443.1,gi|41545613|gb|CF691454.1,
                     gi|41547645|gb|CF693486.1,gi|41548759|gb|CF694600.1,
                     gi|41548770|gb|CF694611.1,gi|41550322|gb|CF696163.1,
                     gi|41550328|gb|CF696169.1,gi|41553302|gb|CF699143.1,
                     gi|41553701|gb|CF699542.1,gi|41554113|gb|CF699954.1,
                     gi|41554188|gb|CF700029.1,gi|41554627|gb|CF700468.1,
                     gi|41554632|gb|CF700473.1,gi|41558821|gb|CF704662.1,
                     gi|41559659|gb|CF705500.1,gi|41561091|gb|CF706932.1,
                     gi|41561259|gb|CF707100.1,gi|41564930|gb|CF710771.1,
                     gi|41565295|gb|CF711136.1,gi|41565306|gb|CF711147.1,
                     gi|41567835|gb|CF713676.1,gi|41569714|gb|CF715555.1,
                     gi|415"
                     /transcript_id="XM_568359.1"
                     /db_xref="GI:58261897"
                     /db_xref="GeneID:3255101"
     mRNA            join(114549..114813,114863..114973,115023..115184,
                     115232..115374,115429..115664,115712..115828,
                     115875..116130,116189..116238,116294..116498,
                     116550..116986)
                     /locus_tag="CNM00460"
                     /product="allantoin permease, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533510|gb|CF679351.1,gi|41535420|gb|CF681261.1,
                     gi|41536360|gb|CF682201.1,gi|41538180|gb|CF684021.1,
                     gi|41538262|gb|CF684103.1,gi|41538528|gb|CF684369.1,
                     gi|41538863|gb|CF684704.1,gi|41539194|gb|CF685035.1,
                     gi|41539405|gb|CF685246.1,gi|41540031|gb|CF685872.1,
                     gi|41540040|gb|CF685881.1,gi|41540272|gb|CF686113.1,
                     gi|41543458|gb|CF689299.1,gi|41545602|gb|CF691443.1,
                     gi|41545774|gb|CF691615.1,gi|41547645|gb|CF693486.1,
                     gi|41548759|gb|CF694600.1,gi|41548770|gb|CF694611.1,
                     gi|41550322|gb|CF696163.1,gi|41553302|gb|CF699143.1,
                     gi|41553701|gb|CF699542.1,gi|41554188|gb|CF700029.1,
                     gi|41554627|gb|CF700468.1,gi|41558821|gb|CF704662.1,
                     gi|41559659|gb|CF705500.1,gi|41561091|gb|CF706932.1,
                     gi|41561259|gb|CF707100.1,gi|41564930|gb|CF710771.1,
                     gi|41565295|gb|CF711136.1,gi|41565670|gb|CF711511.1,
                     gi|41567835|gb|CF713676.1,gi|41569714|gb|CF715555.1,
                     gi|41571283|gb|CF717124.1,gi|41573317|gb|CF719158.1"
                     /transcript_id="XM_568358.1"
                     /db_xref="GI:58261895"
                     /db_xref="GeneID:3255101"
     CDS             join(114662..114813,114863..114973,115023..115184,
                     115232..115374,115429..115664,115712..115828,
                     115875..116130,116189..116238,116294..116498,
                     116550..116758)
                     /locus_tag="CNM00460"
                     /codon_start=1
                     /product="allantoin permease"
                     /protein_id="XP_568358.1"
                     /db_xref="GI:58261896"
                     /db_xref="GeneID:3255101"
                     /translation="MPIKFSKPDTKKWFTLDYWRLDTPPASYATHDGWSNADVDVVPV
                     EQRNWRAINYLFLWLADGANVGTMQQAGSIVSLGLSWREASVAIAIGNIIIAVAVTLN
                     GVIGSRHHVPFSIASRASLGFYFSYFAVISRLVLGLIYFGINTFIGASCTLICLEAIW
                     PQLKTYNNTIPTSQGVTSNKMIAYFVFWAIQFPLVMIPPRKMRWLFFVKSLFAIVAAF
                     ATLGWAVKQAGGGGPIFQQHTALTGSAKSWAWLAGINVAISGKTTLAINIPDLTRYAR
                     KTSDAYWQIIFIPIVYWVFSFIGIVIASAGQAIYGTLYWDPTSIVALWTSRAGAFFVA
                     FAFGFATLGTNISTNSIATSNDFAFLIPKWLNIKRGAFITSLVGGWATCPWKIQASAT
                     SLTTFLSGYIIVLAPLAAIMIVDYWVLRKTHLHVPMLYQNEGIYKYTWGINWRAFVTL
                     VVVIPVNLPGLIHAINPKVPIGNFSYFYKASWLTSFFIATGVYLILSSIFPPTSTFVE
                     ATVESMDEDISDPMTDSKGWEKENGRESDRNYPIINSV"
     STS             116303..117066
                     /standard_name="Stu5"
                     /db_xref="UniSTS:470746"
     gene            complement(117222..119107)
                     /locus_tag="CNM00470"
                     /db_xref="GeneID:3255246"
     mRNA            complement(join(117222..117493,117540..117719,
                     117780..117865,117918..118098,118159..118252,
                     118303..118314,118370..118483,118544..118607,
                     118657..118807,118859..119107))
                     /locus_tag="CNM00470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568357.1"
                     /db_xref="GI:58261893"
                     /db_xref="GeneID:3255246"
     CDS             complement(join(117455..117493,117540..117719,
                     117780..117865,117918..118098,118159..118252,
                     118303..118314,118370..118483,118544..118607,
                     118657..118807,118859..118978))
                     /locus_tag="CNM00470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568357.1"
                     /db_xref="GI:58261894"
                     /db_xref="GeneID:3255246"
                     /translation="MKAAQIVGFEAPYKVTDIPKPVPQGNQILLRVKAAGFCHTDEAV
                     KMGYTGSPLPLTGGHEGAGLVEATGGDVTNFTVGDRVAALLFREPCGGCGECKNNSAV
                     FCDNIKMNGFNVDGAFAEYMIVDQRFTLHVPENIDFAQAAAFMCSGATVYNGLKAAKL
                     PPKSVVGIYGIGALGSLGVQFAKAMGHQVIAIDNRPQPLEHIRALGSLSPDLTLSSDH
                     TVEEGLKAIEEMFPEKLLRGVDAMLVTGPQAHEFDYAFKMTAKHGVVVALSCCNQPMI
                     EIDWKDIVLRDIRVVGGFCATIEVTKELLELASMKNVKSKIRTFSLDEVNDLLTVYHQ
                     PDMHGKLVVTFD"
     gene            119293..122411
                     /locus_tag="CNM00480"
                     /db_xref="GeneID:3255263"
     mRNA            join(119293..119407,119480..119574,119624..119706,
                     119758..120308,120360..120623,120672..120924,
                     120975..121107,121158..121319,121379..121500,
                     121549..121795,121848..121903,121954..122213,
                     122264..122411)
                     /locus_tag="CNM00480"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533504|gb|CF679345.1,gi|41533507|gb|CF679348.1,
                     gi|41555660|gb|CF701501.1,gi|41556891|gb|CF702732.1,
                     gi|41559588|gb|CF705429.1,gi|41568057|gb|CF713898.1,
                     gi|41568070|gb|CF713911.1,gi|41570944|gb|CF716785.1"
                     /transcript_id="XM_568355.1"
                     /db_xref="GI:58261889"
                     /db_xref="GeneID:3255263"
     mRNA            join(119293..119407,119480..119574,119624..119706,
                     119758..120308,120360..120623,120672..120924,
                     120975..121107,121158..121319,121379..121500,
                     121549..121795,121848..121903,121954..121990,
                     122046..122195)
                     /locus_tag="CNM00480"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41555649|gb|CF701490.1,gi|41556885|gb|CF702726.1"
                     /transcript_id="XM_568356.1"
                     /db_xref="GI:58261891"
                     /db_xref="GeneID:3255263"
     CDS             join(119359..119407,119480..119574,119624..119706,
                     119758..120308,120360..120623,120672..120924,
                     120975..121107,121158..121319,121379..121500,
                     121549..121795,121848..121903,121954..121990,
                     122046..122048)
                     /locus_tag="CNM00480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568356.1"
                     /db_xref="GI:58261892"
                     /db_xref="GeneID:3255263"
                     /translation="MTDHVSSVQQDEQQYDFFLYGTLCVPAVLAKVLGHKCKNITFQD
                     ALLPGYTRHKVKNEMYPAVIDKARTDQLLKDNPPNANEVNTRGTYVKGLSYADVHALD
                     MFEGEEYSRLRLPLQTLSQPANIQELPTELVNPTAREGPAFKSSSVEDEPVDAEKKDM
                     VEGWVYVWAGSLERLVPQIWQFEAFIRAKASEWNDLPEEWFISLPPDGELQPPAIERE
                     GLQGEEEEIEDGDQSKLKGRTAEGFEEFGKGMLKHWAFRPGYVNLNHGSYGSPPRHVL
                     NYMRDLSEEIESCPDLFLRRTYLPLLNETRQKVADIIGAEQGEVVLVPNTTHGVFNVL
                     QNIKWDEGDIIVIYSTTYGAVAQMAKHFADVLPISLHIVSLTFPCTHAEILTATEDVL
                     AQYNKVAIPNYTGQSRAEGKDGNHQRVRAVLCDVLASMPGVLYPWEKVVTLCKKYGAL
                     SIIDGAHAIGQIPLDVKKADCDFFVSNCHKWLMAHRGAALLYVPTHNQYLMRTSIPTS
                     AGYESSKYPTPGGVRCWDWASQYEWTGTQNWTPLFSVLSAIEFRKSIGGEQRIMDYCQ
                     SLATEGGKRLKKKWGPLTSIMDTKPPSLSVAMVNLSLPHIPAPNDAADQVKQLCYFEE
                     GMYEANCFAACYVHGGKWWVRFSAQVWNDLSDFEYVGKVLEKLCLEIKNGKYLEQKSV
                     KP"
     CDS             join(119359..119407,119480..119574,119624..119706,
                     119758..120308,120360..120623,120672..120924,
                     120975..121107,121158..121319,121379..121500,
                     121549..121795,121848..121903,121954..122020)
                     /locus_tag="CNM00480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568355.1"
                     /db_xref="GI:58261890"
                     /db_xref="GeneID:3255263"
                     /translation="MTDHVSSVQQDEQQYDFFLYGTLCVPAVLAKVLGHKCKNITFQD
                     ALLPGYTRHKVKNEMYPAVIDKARTDQLLKDNPPNANEVNTRGTYVKGLSYADVHALD
                     MFEGEEYSRLRLPLQTLSQPANIQELPTELVNPTAREGPAFKSSSVEDEPVDAEKKDM
                     VEGWVYVWAGSLERLVPQIWQFEAFIRAKASEWNDLPEEWFISLPPDGELQPPAIERE
                     GLQGEEEEIEDGDQSKLKGRTAEGFEEFGKGMLKHWAFRPGYVNLNHGSYGSPPRHVL
                     NYMRDLSEEIESCPDLFLRRTYLPLLNETRQKVADIIGAEQGEVVLVPNTTHGVFNVL
                     QNIKWDEGDIIVIYSTTYGAVAQMAKHFADVLPISLHIVSLTFPCTHAEILTATEDVL
                     AQYNKVAIPNYTGQSRAEGKDGNHQRVRAVLCDVLASMPGVLYPWEKVVTLCKKYGAL
                     SIIDGAHAIGQIPLDVKKADCDFFVSNCHKWLMAHRGAALLYVPTHNQYLMRTSIPTS
                     AGYESSKYPTPGGVRCWDWASQYEWTGTQNWTPLFSVLSAIEFRKSIGGEQRIMDYCQ
                     SLATEGGKRLKKKWGPLTSIMDTKPPSLSVAMVNLSLPHIPAPNDAADQVKQLCYFEE
                     GMYEANCFAACYVHGGKWWVRFSAQVWNDLSDFEYVGKVLEKLCLEIKNGKYLEQKSV
                     KPVSDVPKQDK"
     gene            complement(<128864..>129597)
                     /locus_tag="CNM00490"
                     /db_xref="GeneID:3255118"
     mRNA            complement(join(<128864..128884,128942..129252,
                     129295..129466,129550..>129597))
                     /locus_tag="CNM00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_568354.1"
                     /db_xref="GI:58261887"
                     /db_xref="GeneID:3255118"
     CDS             complement(join(128864..128884,128942..129252,
                     129295..129466,129550..129597))
                     /locus_tag="CNM00490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568354.1"
                     /db_xref="GI:58261888"
                     /db_xref="GeneID:3255118"
                     /translation="MTKTQMIRTTRMNSSGKLQEVMEEFCDLHKISLTALERRLAETK
                     QTRAMSTWILWQRSNIAKRLLEALENDQSLTSDKAASVASINEDNFTSTFQRISKKKD
                     FSSKEDEKTQALVTRVKRNSALYKAQKERLGDVELRRRLEEDVYGEQQLAARDTALSV
                     SEREKKIKAMKNETWKWMHVMEA"
     gene            <130508..>134872
                     /locus_tag="CNM00500"
                     /pseudo
                     /db_xref="GeneID:3255292"
     gene            complement(<134929..>138054)
                     /locus_tag="CNM00510"
                     /pseudo
                     /db_xref="GeneID:3255051"
     repeat_region   137786..137830
                     /rpt_type=tandem
                     /rpt_unit_seq="tatg"
                     /satellite="microsatellite"
     gene            complement(<138096..>138629)
                     /locus_tag="CNM00520"
                     /pseudo
                     /db_xref="GeneID:3255050"
     gene            <138627..>143360
                     /locus_tag="CNM00530"
                     /pseudo
                     /db_xref="GeneID:3255062"
     repeat_region   138956..139000
                     /rpt_type=tandem
                     /rpt_unit_seq="cata"
                     /satellite="microsatellite"
     repeat_region   146936..147044
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     misc_feature    147420..147535
                     /note="A-rich"
     gene            complement(<147714..>158351)
                     /locus_tag="CNM00540"
                     /pseudo
                     /db_xref="GeneID:3255135"
     repeat_region   152839..152957
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     misc_feature    157455..157547
                     /note="G-rich"
     gene            <159328..>161070
                     /locus_tag="CNM00550"
                     /pseudo
                     /db_xref="GeneID:3255058"
     gene            complement(<161121..>170552)
                     /locus_tag="CNM00560"
                     /pseudo
                     /db_xref="GeneID:3255137"
     misc_feature    170894..170986
                     /note="G-rich"
     gene            <174116..>174700
                     /locus_tag="CNM00570"
                     /pseudo
                     /db_xref="GeneID:3255055"
     misc_feature    177225..177268
                     /note="T-rich"
     gene            complement(<182012..>183433)
                     /locus_tag="CNM00580"
                     /db_xref="GeneID:3255282"
     mRNA            complement(join(<182012..182105,182383..182517,
                     182608..182969,182987..183112,183163..183200,
                     183299..183338,183392..>183433))
                     /locus_tag="CNM00580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568491.1"
                     /db_xref="GI:58262161"
                     /db_xref="GeneID:3255282"
     CDS             complement(join(182012..182105,182383..182517,
                     182608..182969,182987..183112,183163..183200,
                     183299..183338,183392..183433))
                     /locus_tag="CNM00580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568491.1"
                     /db_xref="GI:58262162"
                     /db_xref="GeneID:3255282"
                     /translation="MAQQGYAIVEVDEDQPGPSHGSDLEFQNVPFSPFNLTYYQTYFD
                     VDTNTVLKRVGMAMIPRPGFIIEVCEGQIDMYGKWKRVLIPSVKGSFWTLTTLILTLY
                     TTSTLTTSIAQYMSSSHASSNLPLLSTATSAIYIYGLLVPSLLWSATKWLGVGEWGIA
                     EALGIYGYAMSIFIPLSLLCLIPVGILRWVLIGLGGITSGFFLRPMINVGELMLPSKQ
                     SDNKFARLLIIAVAVMHAVMAFMIKILFFGFTLPDPVTSLHEVEEIIGSYRTEEGKTC
                     FR"
     gene            183649..184920
                     /locus_tag="CNM00590"
                     /db_xref="GeneID:3255128"
     mRNA            join(183649..183882,183921..183960,183998..184066,
                     184134..184141,184226..184298,184354..184465,
                     184519..184676,184714..184920)
                     /locus_tag="CNM00590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568353.1"
                     /db_xref="GI:58261885"
                     /db_xref="GeneID:3255128"
     CDS             join(183760..183882,183921..183960,183998..184066,
                     184134..184141,184226..184298,184354..184465,
                     184519..184676,184714..184772)
                     /locus_tag="CNM00590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568353.1"
                     /db_xref="GI:58261886"
                     /db_xref="GeneID:3255128"
                     /translation="MSNPQTPSSADFSSASTPLKKFKLVFLGEQSVGKTSLITRFMYD
                     TFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTALFERFRSLIPSYIRDSSVAVIVYD
                     ITNRTSFQNTSKWVDDVRNERGQDVIIVLVGNKTDLNDKRQVTPEDLDKRAKELGVMS
                     IETSAKAGHNVKTLFKKIAMALPGGSEAKDNGTTKIDVSSSPQEVPQASGCSC"
     gene            complement(186282..187890)
                     /locus_tag="CNM00600"
                     /db_xref="GeneID:3255290"
     mRNA            complement(join(186282..186472,186526..186780,
                     186835..186975,187032..187255,187306..187507,
                     187562..187719,187766..187890))
                     /locus_tag="CNM00600"
                     /product="galactose metabolism-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534323|gb|CF680164.1,gi|41534333|gb|CF680174.1,
                     gi|41557073|gb|CF702914.1,gi|41557081|gb|CF702922.1,
                     gi|41572990|gb|CF718831.1"
                     /transcript_id="XM_568352.1"
                     /db_xref="GI:58261883"
                     /db_xref="GeneID:3255290"
     CDS             complement(join(186331..186472,186526..186780,
                     186835..186975,187032..187255,187306..187507,
                     187562..187719,187766..187816))
                     /locus_tag="CNM00600"
                     /codon_start=1
                     /product="galactose metabolism-related protein"
                     /protein_id="XP_568352.1"
                     /db_xref="GI:58261884"
                     /db_xref="GeneID:3255290"
                     /translation="MTQTSSSSVSVPGEPLKNVLVTGGLGYIGSHVVLSLLMSGRYLP
                     IVIDNAHNAYPQALERCNQIAQSEVGPHAPKPLYHQCDIRNAEEINKVFKQYQSKGGI
                     WAVIHLAALKAVGESSEIPLDYYEVNVGGSISLLKIMQQSQTNNLVFSSSATVYGTPA
                     VIPIPETSEIIPESVYGRTKAITEEVIRDVCRAGAATADNQGLKAISVRYFNPAGAHP
                     SGKLGEEPKGRPGNLLPILAQIAVGRLSSDLKVFGNDYPTRDGTCLRDYLHIMDLAEG
                     HLLALDALAKSEIKTQSSGIFQSIDTKKEGYFRAFNLGRGKGITVLEMINEMKIATGY
                     EYQFEIVERRSGDVPDLTADPRLAQEELGFIARRGLQEMCQDLWRFQSSNVNGYSS"
     gene            188362..190561
                     /locus_tag="CNM00610"
                     /db_xref="GeneID:3255281"
     mRNA            join(188362..188600,188662..188782,188839..189150,
                     189200..189340,189397..189865,189922..190188,
                     190245..190403,190469..190561)
                     /locus_tag="CNM00610"
                     /product="galactokinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530512|gb|CF676353.1,gi|41537333|gb|CF683174.1,
                     gi|41537712|gb|CF683553.1,gi|41538328|gb|CF684169.1,
                     gi|41545492|gb|CF691333.1,gi|41554355|gb|CF700196.1,
                     gi|41554361|gb|CF700202.1,gi|41561696|gb|CF707537.1,
                     gi|41571924|gb|CF717765.1,gi|41574636|gb|CF720477.1,
                     gi|41574640|gb|CF720481.1"
                     /transcript_id="XM_568351.1"
                     /db_xref="GI:58261881"
                     /db_xref="GeneID:3255281"
     CDS             join(188506..188600,188662..188782,188839..189150,
                     189200..189340,189397..189865,189922..190188,
                     190245..190403,190469..190503)
                     /locus_tag="CNM00610"
                     /codon_start=1
                     /product="galactokinase"
                     /protein_id="XP_568351.1"
                     /db_xref="GI:58261882"
                     /db_xref="GeneID:3255281"
                     /translation="MLKMGSEELRPIPAFHNLSEIYNTEETLERERQRWSALVQSFVE
                     EFGGQPNYIIRAPGRVNVLGEHIDYSLFPVLPAAIEQDIIVGIRPTATFPNKISVDLA
                     NAVKSYPNAELQLARDQELWSLKVPLPSKAKGWERYVVAVLLECLERFAEQLQDGAAG
                     MEVMVSGTVPEGAGLSSSAAFVVGIIVAFLVANGLQEGVSRVQVVDIAMAAEHRLGLK
                     SGGMDQAASILSVPNSLLHLSFYPSLKPAILPLPSSLTLVITNSMAPHSLADSAPDRY
                     NLRVVENLCATRILLHTFGADAGVLSTTQRGSTGRLWLREALEHWAEDAHMDEETVYR
                     NLLARIVGVLGKEGRDKNGWTKNQMIEESGMTAEDFEATFLAFIPIRATRFYLLQRVQ
                     HTLEESLRVCSFKRLCEASVATSDNRVSETGLVKELGALITASHVSMRDLYEATVPEV
                     DDLQALCLQCGSLGSRQTGGGWGGAVISLLPSNRASDFLREVRKMYSLYRGLSVDELD
                     KAAFITVPGSGAGFYPLMEGCKIV"
     gene            191194..192943
                     /locus_tag="CNM00620"
                     /db_xref="GeneID:3255268"
     mRNA            join(191194..191340,191410..191471,191530..191646,
                     191697..191960,192019..192083,192139..192326,
                     192379..192490,192567..192729,192791..192943)
                     /locus_tag="CNM00620"
                     /product="galactose-1-phosphate uridylyltransferase"
                     /transcript_id="XM_568349.1"
                     /db_xref="GI:58261877"
                     /db_xref="GeneID:3255268"
     CDS             join(191262..191340,191410..191471,191530..191646,
                     191697..191960,192019..192083,192139..192326,
                     192379..192490,192567..192729,192791..192886)
                     /locus_tag="CNM00620"
                     /codon_start=1
                     /product="galactose-1-phosphate uridylyltransferase"
                     /protein_id="XP_568349.1"
                     /db_xref="GI:58261878"
                     /db_xref="GeneID:3255268"
                     /translation="MTATHTHSNGSNDFTPVSINDHVHRRFNPLLGKHVLVSPHRSLR
                     PWNGQKETPAIPVETPHDSKCYLCPGNKRTTGQHNPDYKGIYVFENDFPALLPDPLAV
                     GTNKISDDPLFQSEPVRGRCKVICFHPRHDLTMAAMRISEINHVLDGWKDVYAEEGKI
                     MQEESSDGCVQIFENRGAMMGCSAPHPHGQVWTTSFVPDEPATEIENFVRYASGRSGS
                     HMLLDYALREVKARERVVTLHESGWVAVVPYWAAWPFEILLMPYKRHIPSILQLTAEE
                     QTGLATILKDVLSRYDNLFSCPFPYSMGLHQSPLPPTDPTSNSAQVHFHFYPPLLRSA
                     TVRKFMVGFELLGEAQRDIVPEQAAVRLRESLPHKRATLSNDKPYNP"
     gene            complement(<194567..>196533)
                     /locus_tag="CNM00630"
                     /db_xref="GeneID:3255127"
     mRNA            complement(join(<194567..194679,194735..195258,
                     195312..195376,195433..195638,195698..195919,
                     195972..196266,196318..>196533))
                     /locus_tag="CNM00630"
                     /product="trehalose transport-related protein, putative"
                     /transcript_id="XM_568347.1"
                     /db_xref="GI:58261873"
                     /db_xref="GeneID:3255127"
     CDS             complement(join(194567..194679,194735..195258,
                     195312..195376,195433..195638,195698..195919,
                     195972..196266,196318..196533))
                     /locus_tag="CNM00630"
                     /codon_start=1
                     /product="trehalose transport-related protein"
                     /protein_id="XP_568347.1"
                     /db_xref="GI:58261874"
                     /db_xref="GeneID:3255127"
                     /translation="MLSHSDKTTRIAGKHAEQLFYADPTLVQSALSAAAAEKELGFKK
                     TFRLYYKAALWSMALSLALVMEGYDVGIINSFWGQASFLNKFGSTAADGTKYIPANWQ
                     AALNNATSIGQMIGLAINGWAQPKFGSKKVYLTAMAVMVGTIFLPVFSTSLPMLFGGE
                     ILCGIPWGIFQTLSTAYAAEICPLAMRGYLTAFVNMCWGFGLLLSAGVVRASLELDSQ
                     WGWRIPFMIQWVWPVPLFVIACFAPESPWYLVKVGREDDARATTKRLAPSEYLTDQLV
                     DQQIALMKHTIEMEKAETQGASFLDCFKGSNLRRTEIVMLVWIIQYWSGQNIINYATQ
                     YLQTGGMTEDGAFNMFLGITCCYIVGTAACWYTMHHFGRRSIYIAGVALMVVWHVIIG
                     SLGTVNSTKATLAIGIVMVIINFSTNATFFPVTYTIAAEVPATRVRAKTMVLGRGVYL
                     ISSIICNQITPRMFSVSEWNWGAKSSFFWMGCCLISLVYLWFRLPETKGRMFSELDVL
                     FANEVPARQFKHTIVDELSAVTEEKYTEKGEIEYQENA"
     gene            197049..199874
                     /locus_tag="CNM00640"
                     /db_xref="GeneID:3255083"
     mRNA            join(197049..197478,197527..197927,197970..198285,
                     198337..198777,198839..199557,199612..199874)
                     /locus_tag="CNM00640"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41564634|gb|CF710475.1,gi|41564642|gb|CF710483.1,
                     gi|41574246|gb|CF720087.1,gi|41574247|gb|CF720088.1,
                     gi|41576609|gb|CF722450.1,gi|41576614|gb|CF722455.1"
                     /transcript_id="XM_568345.1"
                     /db_xref="GI:58261869"
                     /db_xref="GeneID:3255083"
     CDS             join(197354..197478,197527..197927,197970..198285,
                     198337..198777,198839..199557,199612..199838)
                     /locus_tag="CNM00640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568345.1"
                     /db_xref="GI:58261870"
                     /db_xref="GeneID:3255083"
                     /translation="MISVRLNEYNLPEGKDEDKVSFDLAELDNLSDWSGWAFYRIAPT
                     WIEARPLDNVSLLSNQLTTHLLLVKRKSQPDHIACVYPISSSSALSNIVNDNGDIKVQ
                     LRRAKGNSDAKAAVVIGTASDASQLNCLIGDVVRTARGWLLDVPAKEVVDFKSFPSGG
                     PLDGVGFCTWSSLGEDIRPDRENMSGLFNALTDHNLPIQSFILDDGWLNQKTYEKGDS
                     SPFVSTTGPEEERGTWQLRGLYDFDAWSGLGHDGIKMIVDEATTRLSKIDGVKDTIQV
                     GVWMSLVGGYWDGISPDSPLIAKYKCRPYPASRARLPGISNEPFTVGFLPGGKGTYWL
                     PPPSESLRFWRDWFNYLKSQGVDFLKVDNQGSMSLVDGTEGVECQHAIWENMVKASDE
                     VFGKGKVIHCMSHHESIWGGIQGLGIVTEGEKFVWRNSDDFGLGHKKANAHQQHIFTN
                     LSNSLLTSHLAMILDADMFMSAEQDPVPHAFLRALYPGPLLLSDRPGIHDSRLLGRMI
                     SKDKTGIARVIKTQHPAVPLSHRALDIDVIGKGEGSGLYAAAPTEAGVILGVWNVRED
                     NDNGRVVDKLTFTDVKYALNGKDMSSPWLIVESDLEKGGISRTGLLSSSDAVITDIVL
                     ERMKAASFWLTPLRPVNKVGVAVLGLTKHFAGLMAVTDVQSNDTRVTAQVNGEGTFGF
                     VVVSSQRPMYTIHVDDQVQDATLALTPSFHGVDKVWLIETEIRANGTRGDGWTVAIDI
                     LG"
     STS             199934..200769
                     /standard_name="Xho22"
                     /db_xref="UniSTS:470747"
     gene            complement(<201284..>202360)
                     /locus_tag="CNM00650"
                     /db_xref="GeneID:3255249"
     mRNA            complement(join(<201284..201749,201899..201984,
                     202034..>202360))
                     /locus_tag="CNM00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_568343.1"
                     /db_xref="GI:58261865"
                     /db_xref="GeneID:3255249"
     CDS             complement(join(201284..201749,201899..201984,
                     202034..202360))
                     /locus_tag="CNM00650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568343.1"
                     /db_xref="GI:58261866"
                     /db_xref="GeneID:3255249"
                     /translation="MYPSSQAYKVAAASVKLSPSLKSVLNLSSALPSGIPAPSPAITS
                     KLFDTIRSKAPSNLSRHAWLTLGTAALLTVNSPDAICQLWDYAGRSKENAEVMREVGL
                     KCISFNGIPRTINGLGALRAHLPDDVKHALTTQAYRSLTSASFSQPDASNIAEITSRS
                     RSLWDAIYTPHHEKLLAKLAASHPDLPVHILNSHYGALLADPPSLPSPRIGRILTSII
                     AITCLRAQRGVGPQLTSHVFGLKKAGLEEGVPDELEGGEWLCSDEGATWVLESTDKVS
                     EAVTGGKVTFAGPPGQ"
     gene            202580..205790
                     /locus_tag="CNM00660"
                     /db_xref="GeneID:3255254"
     mRNA            join(202580..203436,203489..203538,203614..204149,
                     204192..204272,205077..205309,205354..205515,
                     205588..205790)
                     /locus_tag="CNM00660"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530237|gb|CF676078.1,gi|41530244|gb|CF676085.1,
                     gi|41538266|gb|CF684107.1"
                     /transcript_id="XM_568341.1"
                     /db_xref="GI:58261861"
                     /db_xref="GeneID:3255254"
     CDS             join(202659..203436,203489..203538,203614..204149,
                     204192..204272,205077..205309,205354..205515,
                     205588..205757)
                     /locus_tag="CNM00660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568341.1"
                     /db_xref="GI:58261862"
                     /db_xref="GeneID:3255254"
                     /translation="MYGKSFKHLLFPSSSAFSLTTSVHPSMANRDSLLSTSSSTTYPS
                     TFSSLSMSALGLTDSPLPSRSKGPSPAGSMPPSPSRRPAIRASASKSSLRQEVTTNAA
                     ARVAQQHSAEFARMPRQRVSQVNLRENVASGQTPKPPIPAKSPSTRPPAVKPASAPQT
                     AQHPNQRKSIQATARANLVTRKAVPSPAHNEVTMADEWEAELVKDAQKLNLGPSSRKP
                     EIARELVEQRHNDGEWERFGEEKSTAREEEDRRRREPGREVAFPPSMPRTPIRAVTAG
                     PDVNVPNPLFSPAISNPELFGEESRPSSTANHTPDLLKKAQKEYEDWLARKAEREGDM
                     ESSGMRNWEPRERAIARPFGFSPQSANSVHTASSLESSPTEVASWASGYPAGQSQTAM
                     SEQTAPPQSEDQQAAIDVAQRQAMVPYGYEAYYAHPAYWDPSYWWGMYEDPNVMAVHA
                     ANPSTQDPKTMNQVDMPKEGEMTSEEQQAYGLSNMMMYNPYQWGGGMGGQGAGYPGMQ
                     NPYMMGRDPSVMGSMPALSQSSGTEDKNLRPFDSTKMKQGRLGHYGYLEGRELAGPPV
                     GHLPAGMQSQYSQAGHGTTTAGPSSASYQGNGSWGDLASIPRARYDGAASATGHVQAD
                     LDSPYPRAPNGSVTTAWTRYGADGSVMEGMNGNGAGRRRLREGRV"
     gene            complement(205854..>207998)
                     /locus_tag="CNM00670"
                     /db_xref="GeneID:3255216"
     mRNA            complement(join(205854..206380,206428..206695,
                     206745..>207998))
                     /locus_tag="CNM00670"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543122|gb|CF688963.1"
                     /transcript_id="XM_568448.1"
                     /db_xref="GI:58262075"
                     /db_xref="GeneID:3255216"
     CDS             complement(join(205869..206380,206428..206695,
                     206745..207998))
                     /locus_tag="CNM00670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568448.1"
                     /db_xref="GI:58262076"
                     /db_xref="GeneID:3255216"
                     /translation="MPADRLFGADAHALLPRDAAPRIAHGPRPGARSLYHQHVLDEDA
                     YTAALSHIIARDFFPHLPHLHATNQYLAALHANDPQRLAASIRALAALARDRDGAAHS
                     IDDSDGERLRRRTEYSMARTPYIAMPGSGGRPLRTPVGTRGWDTPLGSTSRRDTDDFD
                     IDTHARRSPDAPSSGQPRKRQRRLPPVRDDLSLDAFQRHFTSEDNASFVHILDEENRR
                     RREEKYGWAFEAERKAEARRIEGETRRRMILDRAKGGGWRVDGDGRRLIGALAEGGRD
                     RPEGEAWRDKMIQGGEAVEAVETVDTTETTATHPSSTALTQPSSPPPQPLSEIPLPPK
                     HPLAEALADAGLPPTALISSTDGMIVPHRETASGALTVSAPQGDRGRGEDERKERERR
                     ERDVLGEDKGETLSAAGSGVDMWKYKARNSLMFLPDANTNPYPDASSLSASAPSIPIS
                     NARPSVKHSNTRLHEDDPTWTAGVGGMTGENGRGKSKSVRGSSPSRSLIDAAVRGTPY
                     RDTDQLPSVNNYPLVRPDASPSPHDLPSLLTWGTLLATPRALEDSKGDDDPLEERPAF
                     RLPETKRRDELGRRLAEKASRAMSDRARGFTSRSAKSSSSALGKAPGSMGPPATPRRH
                     ADSLTPAAKRLLEKTVGRTPVSASRTASGSGSGSSRPQKNIGWTPTPRYPRPS"
     misc_feature    206791..206863
                     /note="C-rich"
     misc_feature    207903..207954
                     /note="GC_rich"
     gene            <207931..209644
                     /locus_tag="CNM00680"
                     /db_xref="GeneID:3255197"
     mRNA            join(<207931..208040,208110..208276,208314..208499,
                     208538..208815,208871..209644)
                     /locus_tag="CNM00680"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_568339.1"
                     /db_xref="GI:58261857"
                     /db_xref="GeneID:3255197"
     CDS             join(207931..208040,208110..208276,208314..208499,
                     208538..208815,208871..209203)
                     /locus_tag="CNM00680"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_568339.1"
                     /db_xref="GI:58261858"
                     /db_xref="GeneID:3255197"
                     /translation="MRGAASRGRSACASAPKSLSAGIGGGGGVTTGGRGSDRLPLITL
                     SLQHNGTHGESRPPPLRHPRESPPRVPPPRLHPAHTAQNDDVVRESGNYHAIYSKWLT
                     DSLATYPDPAVARSTRLIVDPYDVVHKKAYPPPERLQHAAPDAYDCVMLTGSKHTAYD
                     TSNPFIPPLVHFIRSLASSPAYQHLKLIGICFGHQILSIALGGECVPGHNGWEIGVYG
                     CQLTDQGRYWWTGDVEGQGGGDKVYIEQMHKDHVPSLPPGCTLLLSTPRYPIHSFLKP
                     HPLSTPSRPLAHILTVQGHPEFTPSIVHHIINARAAAGVFDDQTAQEARRRAGGKDGT
                     GGEGFGRIGWAVWRVLLQDLPPA"
     gene            complement(209209..>213282)
                     /locus_tag="CNM00690"
                     /db_xref="GeneID:3255145"
     mRNA            complement(join(209209..210030,210090..210442,
                     210502..210622,210677..210783,210851..210982,
                     211087..211402,211460..211558,211618..212259,
                     212309..212377,212427..212449,212516..212536,
                     212586..212798,212849..212990,213112..>213282))
                     /locus_tag="CNM00690"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530631|gb|CF676472.1"
                     /transcript_id="XM_568337.1"
                     /db_xref="GI:58261853"
                     /db_xref="GeneID:3255145"
     CDS             complement(join(209350..210030,210090..210442,
                     210502..210622,210677..210783,210851..210982,
                     211087..211402,211460..211558,211618..212259,
                     212309..212377,212427..212449,212516..212536,
                     212586..212798,212849..212990,213112..213282))
                     /locus_tag="CNM00690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568337.1"
                     /db_xref="GI:58261854"
                     /db_xref="GeneID:3255145"
                     /translation="MSSTTDPGAAVSSFVASYESTLTQVSVRAVGSQFALMAAISMAT
                     LLAFSFFRPREKKIKYQLPKPVDPIEDPDYEPPPPPISNGFFAWLSPMIHLKEEEIIA
                     NIGLDAATFLRFLRMLRNIFTITSIIVVALLVIDIVYNLKYVNSSDRNALSLLTIQNV
                     SGNWMWPALAASYVINIVAMYFIWFNWKAMVRLRKGWFRSPAYQTKIYSRTLMVTHVR
                     KDFRSDAGLLSLMGLLKVDGIKIGPSIDCTCIGRRLEDFPKMVDDHNEAVQELEKHLV
                     KYLKGGEMAKKRPMIRKGGFLGLFGGVKKDAIDYHAKEIKFLRDRIDAKRQAIDSLLR
                     KERHARKKGNKVVNRVEGENYGFVTFKTIAEAHRIARTHRGKLKELFGAELQLAPMPH
                     DIVWENISKEPAELGSKNTFGFIIIGIVCFFNTLPLLVVSLLANLSSLTVYVTFLADW
                     KDAGSWGQWTFSMVSGILPSVVSALFGYLLPIIIRKISKYQGAPTRSRLDRAVTARYF
                     FFMIISNLVIFSLLGVVYTAIARIVVQVGGHQSVGTILKGFEDIPDQIQGTYVQQSTC
                     FLVIFELIQLIKLAMVSIRRFMFSHTPRDIREMTKPPYFEYAIVIVNLLFITAVGLIY
                     APLAPLVAMGACCVFWFSSVVYKYQLLYVYISRAESGGRMWNVYVNRLLACCVLMQLL
                     MVLTTGLIRDRWIDCVAAAPPLLLIIAFKIYISRTAERQFRYYEASPEELEQEKMYSM
                     SEKPTKQSEVENRFLHPALQHNKLFTVMVHKSQESLAREVLSAYPWFAGKHEGDGVKI
                     KAVREENLEYDPSRDGPADEAHQADWDAKSIASTDILSKSEYASSTAPNYEEAYRHYP
                     LLPLTDSPSLAPASLPLLPLDNPSTDRLLSTNDRSEQFIARQPSARGNASARGYRQPH
                     LPMPAGARHAAQMSDVDLSASSPLLAQDPWLNEDDNAYGGGGGDVPYPPSAYTQPPLG
                     YVPPTMRRTASDLSESDVGVAGAGAGAGAGGTRWDTGDREERGYMSRQGSQGYYGGY"
     misc_feature    211415..211454
                     /note="AT_rich"
     gene            214306..215974
                     /locus_tag="CNM00700"
                     /db_xref="GeneID:3255149"
     mRNA            join(214306..214372,214410..214507,214547..214787,
                     214844..215671,215727..215974)
                     /locus_tag="CNM00700"
                     /product="Eukaryotic translation initiation factor 3
                     subunit 6, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530171|gb|CF676012.1,gi|41530440|gb|CF676281.1,
                     gi|41530445|gb|CF676286.1,gi|41535562|gb|CF681403.1,
                     gi|41535570|gb|CF681411.1,gi|41536551|gb|CF682392.1,
                     gi|41536554|gb|CF682395.1,gi|41537028|gb|CF682869.1,
                     gi|41537042|gb|CF682883.1,gi|41548361|gb|CF694202.1,
                     gi|41548367|gb|CF694208.1,gi|41549490|gb|CF695331.1,
                     gi|41553604|gb|CF699445.1,gi|41553613|gb|CF699454.1,
                     gi|41555062|gb|CF700903.1,gi|41558266|gb|CF704107.1,
                     gi|41558277|gb|CF704118.1,gi|41559010|gb|CF704851.1,
                     gi|41559021|gb|CF704862.1,gi|41562892|gb|CF708733.1,
                     gi|41562902|gb|CF708743.1,gi|41576158|gb|CF721999.1,
                     gi|41576164|gb|CF722005.1"
                     /transcript_id="XM_568335.1"
                     /db_xref="GI:58261849"
                     /db_xref="GeneID:3255149"
     CDS             join(214349..214372,214410..214507,214547..214787,
                     214844..215671,215727..215927)
                     /locus_tag="CNM00700"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit 6"
                     /protein_id="XP_568335.1"
                     /db_xref="GI:58261850"
                     /db_xref="GeneID:3255149"
                     /translation="MADYDLTQKLIPHLDRHLAIPLLNHLSDIAIYPAEQLARAQYDL
                     AKGTNMVNYVEQFHAQIENAEPTDFARLRDEATAKYQELQEKAQPVTKVIEDPDAVAK
                     LRSGGDKDRNLDLLRSEYQIDIDQINALYHFGQYQYSLGDYGSAGNLLYHFLILSPSY
                     ELNISAQWGKLASNILNGEWDAALMQVRDLRETIDNPHGTSLAKPLAQLQARTWLLHW
                     SLFVFFNLGENQGCQGLLDMFLSPAYLNTIQTSCPHLLRYLVAAAIISRRAPKPANVR
                     SRDHVKELTRIVETEEYQYTDPITSFLKDVFADFDLTQAQQRLSVAESVVRSDFFLSG
                     FADEFVENARWLISEVICRLHRRIDIGQLSKTLNLSNEEGEKWIVNLIRDSRMGVEAK
                     IDLKENMLHITRPHATPTATLIETTRGLAFRSQAIQFAMQSSVGEPRERGERGERGNK
                     GGRGRPRTQEVAA"
     gene            <216024..>216938
                     /locus_tag="CNM00710"
                     /db_xref="GeneID:3255141"
     mRNA            join(<216024..216178,216273..216330,216384..>216938)
                     /locus_tag="CNM00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_568333.1"
                     /db_xref="GI:58261845"
                     /db_xref="GeneID:3255141"
     CDS             join(216024..216178,216273..216330,216384..216938)
                     /locus_tag="CNM00710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568333.1"
                     /db_xref="GI:58261846"
                     /db_xref="GeneID:3255141"
                     /translation="MAACSIVHTTAFIQLNSSLTVSSWAWFSQSCKIKEITLTSRAGS
                     SDRGRFFSRNTLAQIPEHMQDTCIISSVHPSSSAGTDLDATIVSAAIWLVILCVSICI
                     STSLILSLWPLSSFCILINLPFSLSNVNLASKRAAKLAGKSIGIPPLYCPSPADPLCC
                     PFLDPDIPERKFASPIPAAAPARTLSCDSVSFGRGSIRPKVLADQLESAAERLAAVVV
                     ALAAAASALAKVDLGTEKISGGRGGKEGGGIEGGVAY"
     gene            complement(217269..218811)
                     /locus_tag="CNM00720"
                     /db_xref="GeneID:3255073"
     mRNA            complement(join(217269..217605,217660..218215,
                     218253..218811))
                     /locus_tag="CNM00720"
                     /product="cytochrome c oxidase biogenesis-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534065|gb|CF679906.1,gi|41534076|gb|CF679917.1,
                     gi|41542946|gb|CF688787.1,gi|41543623|gb|CF689464.1"
                     /transcript_id="XM_568331.1"
                     /db_xref="GI:58261841"
                     /db_xref="GeneID:3255073"
     CDS             complement(join(217339..217605,217660..218215,
                     218253..218788))
                     /locus_tag="CNM00720"
                     /codon_start=1
                     /product="cytochrome c oxidase biogenesis-related protein"
                     /protein_id="XP_568331.1"
                     /db_xref="GI:58261842"
                     /db_xref="GeneID:3255073"
                     /translation="MLTTSLRRALQTGIKAELSNAPIAPRAFSTTSLVFTRPTPRPIV
                     LPYFTPCTRSSFFFPSHTFKFPRSLSTAAPKNKVYSDIPNSLPYWLYGCSAVVFGIIV
                     IGGLTRLTESGLSIVEWNPITGILPPITKEDWDAEWEKYKVSPEGIIMNANISRDEFK
                     KIFYMEWGHRLAGRALGIGFLLPTVYYLARYKLPRPLPTKLLLIGLGIGFQGVLGWWM
                     VKSGLDEQIITDNSVPRVSQYRLAAHYSAAVALYLGMLSTAIGIQRDMKLAKNPAIVS
                     ALNIPAVKKFRGLVHLSGMMVALTAVTGAFVAGLDAGLVYNEFPMMGDGLVPPKDELF
                     DQRYARSGSDKIWRNMLENPVTAQFDHRVLATTTFTILCTLPFAARRLPFPAARRLAA
                     LTTAAAVTQVTLGISTLLYLVPISLASMHQTGSVVLLTCIMALGGALRKPSRMIRYMR
                     RV"
     gene            complement(<218952..>219967)
                     /locus_tag="CNM00730"
                     /db_xref="GeneID:3255223"
     mRNA            complement(join(<218952..219041,219073..219175,
                     219231..219473,219513..219652,219710..>219967))
                     /locus_tag="CNM00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_568329.1"
                     /db_xref="GI:58261837"
                     /db_xref="GeneID:3255223"
     CDS             complement(join(218952..219041,219073..219175,
                     219231..219473,219513..219652,219710..219967))
                     /locus_tag="CNM00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568329.1"
                     /db_xref="GI:58261838"
                     /db_xref="GeneID:3255223"
                     /translation="MASMANIERAYRVLADREVTRLEYSLLRKPSTEQAFYSVHNSLK
                     HKRNNRYSNVLAYDRTAVTVDGEYLNANVVTDGKGGRWIAAQAPPPQAFNTFFKALYS
                     GAAIGRLPNNVILVQLTGWEESGIPKADPYMEHKMPDMGVHLSRREIIDRISSTLTEV
                     ALQGDRRVNLFHYQFDAWPDHGVPTGAAVQALRELVKEVDEKRRELDCEVWVHCSAGV
                     GRTGTFIALSSLLSPDEPNVSSPIGPLPRETPFANAEGCLCRLSVNLSFCTKCNNNKS
                     P"
     gene            220161..223572
                     /locus_tag="CNM00740"
                     /db_xref="GeneID:3255241"
     mRNA            join(220161..220417,220454..221421,221458..221634,
                     221684..221931,221983..222211,222261..222447,
                     222504..222628,222678..222827,222868..223172,
                     223228..223572)
                     /locus_tag="CNM00740"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532199|gb|CF678040.1,gi|41532204|gb|CF678045.1,
                     gi|41538099|gb|CF683940.1,gi|41538102|gb|CF683943.1,
                     gi|41538319|gb|CF684160.1,gi|41538325|gb|CF684166.1,
                     gi|41541276|gb|CF687117.1,gi|41541281|gb|CF687122.1,
                     gi|41566550|gb|CF712391.1,gi|41566557|gb|CF712398.1,
                     gi|41570144|gb|CF715985.1"
                     /transcript_id="XM_568327.1"
                     /db_xref="GI:58261833"
                     /db_xref="GeneID:3255241"
     CDS             join(220186..220417,220454..221421,221458..221634,
                     221684..221931,221983..222211,222261..222447,
                     222504..222628,222678..222827,222868..223172,
                     223228..223303)
                     /locus_tag="CNM00740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568327.1"
                     /db_xref="GI:58261834"
                     /db_xref="GeneID:3255241"
                     /translation="MAQTTSLPPRFTVPPLPPHIYRRLTLIVHDDGVVLSPDNGQSIL
                     IHWGVKGKIEPVDGDEQGELIIGGVLGVARLWDAAYLFVFLPRTGTPLFPPHDDDEPP
                     HEHEVFSLGDVHAVPLTQEGATSSINRMLAIQVSRQPKTKTKWSLALPITGAGATASE
                     EDHLSNSDTSSEETPEADETPIPPKSRQWRKFMPKLRKKQDASTTPEPPKRQELEHKI
                     VRQIVREFGAGFFFSYDFDLTRTLQHKRQVVSQRTATGAAFSDLIQKDNTLFPPSQSS
                     TFQTPINPALDEDFIEPDIQVPLWRRVDKRFFWNEWLMKDFIDLGLHSYVLPVMQGWV
                     QSATFSIPIPPNPLQPDVSLGAIPVDLVVVSRRSKDRAGLRYQRRGIDDNGHVANMVE
                     TEMIVRAKVEGKSSLFSFTQVRGSIPLRWSQSPYSMKPPPILNEPVDKTYAVANLHFN
                     DLTSRYGPITIINLSEQDGKEAVVTNGYQELVNSLERDDLKYVGFDFHAKCHGMKWEN
                     IVELVDSLDFESMGYLWTLQGDAIREQKGAFRTNCIDCLDRTNVVQSAIARRVLNTML
                     MQLGLQISAPTVENIFNDIWANNGDIISRCYAHTSALKGDFVRTGKRDLSGMLHDGVS
                     SLSRMFYGAISDFFAQAVISFLLGHRNLAVFSEFLETLTSEDASSVVRLDRIRSVAIE
                     TCSARVLSDGEEKIGGWILLSPDPRSVKISSDLEEKILLLTRSAIYVVTFNYSLEKVV
                     QFTRIPLPSITSIQKGAYILSTLQEASRDPKENAGFLINFSPTDESTRYSTYSLRNKT
                     APATPTKRPTAATPSTPTPSVEHATINPDVTEYYAFKALPGQSGDATCAETVSQIVEQ
                     IAEACKRNDLVVEKDVVSLTEAESSTSLLAKMDYAFKRALWL"
     gene            complement(<222830..>223550)
                     /locus_tag="CNM00750"
                     /pseudo
                     /db_xref="GeneID:3255139"
     gene            complement(<223557..>224597)
                     /locus_tag="CNM00760"
                     /db_xref="GeneID:3255132"
     mRNA            complement(join(<223557..223667,223716..224067,
                     224122..224480,224535..>224597))
                     /locus_tag="CNM00760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568494.1"
                     /db_xref="GI:58262167"
                     /db_xref="GeneID:3255132"
     CDS             complement(join(223557..223667,223716..224067,
                     224122..224480,224535..224597))
                     /locus_tag="CNM00760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568494.1"
                     /db_xref="GI:58262168"
                     /db_xref="GeneID:3255132"
                     /translation="MSFKTIIVFGSTGKQGSATVKALNAIGGYNIIAATRDTESDRAK
                     ALAQTPNVRVVKGEVGDHAHLFKDSVHGIFFFLVGFDIEASIERGKCTLSNIPGASEP
                     IEFVAKGMLDTAVSKGVQHVIFSGVDFCGHREKGIRHPFLDAKKPIEDYLMTLPLQWT
                     IIRPTAIMENLYMPIYKDIITTTWVETIHYKWIASEDIGKITAEIFEHPEKFSGKALN
                     IAGDSMTPGEHVRMWKEVTGETLNATEPPNFPPGLDSAMKFFDVNESDADIEENRKNF
                     PWLMDLETWLKQSSFASQ"
     gene            complement(225252..226658)
                     /locus_tag="CNM00770"
                     /db_xref="GeneID:3255089"
     mRNA            complement(join(225252..225353,225403..225637,
                     225689..225788,225839..225912,225958..226292,
                     226331..226658))
                     /locus_tag="CNM00770"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536534|gb|CF682375.1,gi|41536543|gb|CF682384.1,
                     gi|41558253|gb|CF704094.1,gi|41558260|gb|CF704101.1"
                     /transcript_id="XM_568426.1"
                     /db_xref="GI:58262031"
                     /db_xref="GeneID:3255089"
     CDS             complement(join(225297..225353,225403..225637,
                     225689..225788,225839..225912,225958..226292,
                     226331..226543))
                     /locus_tag="CNM00770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568426.1"
                     /db_xref="GI:58262032"
                     /db_xref="GeneID:3255089"
                     /translation="MPRIALAQTSPASAPSGPPALEKAHSTSPFPTLDQNLVDVVDFV
                     ERAAAEKAEVVVFPEYFLQGIVNEARQYLTFPSKYLLSFLCHLAKAHRVCLVGTIVHG
                     SRNNGPAFPASDPFSHIPLKSGPRPSKVTLQQLEWAKYLEQHPLSSEENSTPIVKNTA
                     FFIDEEGVLQGEYVKQNLWHPEREYIVAGIEPRQVFETKWGKAGLLICWDMSHPSAAQ
                     ELADLGVDIIFAPTYWMATDSEPLIHNHPHPTDYETSVVSALCLTRAFETETVWIMCN
                     AGGDAIEGFMGGSGVWAPLRGRVGGCGVEASLQIVDVETDVLKDARQTYKIREDWSKK
                     QAT"
     gene            complement(229515..232266)
                     /locus_tag="CNM00780"
                     /db_xref="GeneID:3255079"
     mRNA            complement(join(229515..229905,229953..230409,
                     230458..230534,230571..230739,230775..230908,
                     230945..231356,231394..231463,231521..232190,
                     232230..232266))
                     /locus_tag="CNM00780"
                     /product="chromatin remodeling-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41554736|gb|CF700577.1,gi|41554741|gb|CF700582.1,
                     gi|41571585|gb|CF717426.1,gi|41571593|gb|CF717434.1"
                     /transcript_id="XM_568325.1"
                     /db_xref="GI:58261829"
                     /db_xref="GeneID:3255079"
     CDS             complement(join(229598..229905,229953..230409,
                     230458..230534,230571..230739,230775..230908,
                     230945..231356,231394..231463,231521..231753))
                     /locus_tag="CNM00780"
                     /codon_start=1
                     /product="chromatin remodeling-related protein"
                     /protein_id="XP_568325.1"
                     /db_xref="GI:58261830"
                     /db_xref="GeneID:3255079"
                     /translation="MAPRDADQAIIAARDATLPKWEGPKEVLPGNPAPGGIPGSGWFG
                     EGTADYERNIGGPEQWPHKIREVLRAVEGYRDHSGQRLAEVLDILPEVVDIPFLSFNH
                     PLSFARINAIADASRYLSLRDFDMDMARLFEKARRWFHDGSEEYGRVLVLQRLYNALT
                     SIYPLQLPPSGIPEPSSIAFASIPAGPGNARSMHEATQELRAGAAEEQVGYGITTFRV
                     GTKDRVFTEEARHKGVAYRLGDYVHVMNPDDPTRPIIGQIFKTFVPTKGKQTHHASIC
                     WYYRPEQTVHTPDQMFYEHEVFKTGQFCDHPVEDIMERISVQFYVKYIRGRPREGEFY
                     PGWPVYVCNSRFNHRDYNIVRIKNWNSCIPEELRQTDFMSIIPFERVIEARMVPSPLS
                     QGVQGPGFFGEPKKVLGGSAAQDDDDDDDEDKGRRRGRPSVHSAAHTPAPQTQPRAQP
                     AAAVYRASPAVVPPPQPQAAPGVVPAPQIPVTQPVVAQQPIRTFAALMGGQQALDQVA
                     HRETLPAETARLFPTDARGQVLWFSGPPLAPGAIHIPQQPVHSVEYLQYLTKRKRGEK
                     WTPRKTNRRSVVGLSGTQNVEKPDEDLSNLWWAEGKSSEEVFDSLRELVEDKS"
     misc_feature    232965..232988
                     /note="AT_rich"
     gene            233217..236926
                     /locus_tag="CNM00790"
                     /db_xref="GeneID:3255205"
     mRNA            join(233217..233716,233779..234255,234304..234598,
                     234803..235043,235173..235234,235283..235447,
                     235506..235584,235632..235796,235910..236034,
                     236094..236926)
                     /locus_tag="CNM00790"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41564485|gb|CF710326.1,gi|41564502|gb|CF710343.1,
                     gi|41566595|gb|CF712436.1"
                     /transcript_id="XM_568323.1"
                     /db_xref="GI:58261825"
                     /db_xref="GeneID:3255205"
     CDS             join(233329..233716,233779..234255,234304..234598,
                     234803..235043,235173..235234,235283..235447,
                     235506..235584,235632..235796,235910..236034,
                     236094..236637)
                     /locus_tag="CNM00790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568323.1"
                     /db_xref="GI:58261826"
                     /db_xref="GeneID:3255205"
                     /translation="MSFNSKNAAGPSRPQKLPRKVNRSQPQLKRNAACLPCRRRRIKC
                     DATRPHCSSCVRSYHFLARTYPDTGRDARGVQCTYAEDAPDVGHNEQQSHGLRSQPAQ
                     PTKRKLSEEDGEDGDPKGMIKRLEGKVAELQKALEKSHCTTPSITDPGLQIPSSNVSD
                     GEARGQPAQFENSFYLWTGTSQAAVVDTFPPQNPHKNKHSDPMNGFPSALENFVPHHS
                     AEMYNMGDAGFPPLQQSSMQLKYNAKKCDSHLDNFRTSVEVPPIDAEAGKMGNDILDI
                     LWPGWPPTLPSPSMLEHLVETFFTMTPSVPRVLHRQSFLARLALPPSHPEFPQRALLH
                     AICAAASRYSAAVSVRSVADGMIKVNDDARQARGKGLDQDVASETCFSERNAIWMEGW
                     VMIGAETRLAICLGLLQNQSQHDRGIPSIKQSVLDRPKDDADREERRATMYYALCYDV
                     TSSASSGWVGTMPTEELEAKGKIPENPQNFHSPDIFYNHPVADSFVMMIKGKILLGRA
                     CRFVRKCKAMEPEDRLLAKDTPEFRQIDGDIAMFSMSFPKSLRDPVQYMSGHAKGIDA
                     DLVSAHLVPHVVAIQLHEPFADLNDPSCSSAIRLLTEARACLNIVYLLIGSSADISYV
                     QLIQSSYIFTASRALILFYQKALESGDQVTAMTMHAEIEVFKMAFTSLSARFSMGSRH
                     LTMVEKLMQHVEKDTLGHQVFNEDFSFLPPAHLSSESVPGFVSDLGQMGLPDTHPDSM
                     MIFELEKAAALGRHRPGFSSHVMMDQKRGYAGGLNSRSNSTAGSTGPSPNDPSRWLDI
                     SKSQQEASLTLLSSENVGGNGGSAADSPSVRGQRIGTLGVMSKAEVGN"
     gene            238486..241064
                     /locus_tag="CNM00800"
                     /db_xref="GeneID:3255280"
     mRNA            join(238486..238847,238941..239030,239084..239168,
                     239227..239485,239541..239645,239692..239927,
                     239981..240397,240446..240584,240638..240704,
                     240754..241064)
                     /locus_tag="CNM00800"
                     /product="amino acid transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530768|gb|CF676609.1,gi|41530780|gb|CF676621.1,
                     gi|41533983|gb|CF679824.1,gi|41533997|gb|CF679838.1,
                     gi|41536439|gb|CF682280.1,gi|41536451|gb|CF682292.1,
                     gi|41537424|gb|CF683265.1,gi|41538741|gb|CF684582.1,
                     gi|41542983|gb|CF688824.1,gi|41542995|gb|CF688836.1,
                     gi|41544791|gb|CF690632.1,gi|41544799|gb|CF690640.1,
                     gi|41548515|gb|CF694356.1,gi|41548843|gb|CF694684.1,
                     gi|41548849|gb|CF694690.1,gi|41555127|gb|CF700968.1,
                     gi|41555143|gb|CF700984.1,gi|41555379|gb|CF701220.1,
                     gi|41555617|gb|CF701458.1,gi|41555620|gb|CF701461.1,
                     gi|41556240|gb|CF702081.1,gi|41556247|gb|CF702088.1,
                     gi|41561232|gb|CF707073.1,gi|41566791|gb|CF712632.1,
                     gi|41566800|gb|CF712641.1,gi|41567859|gb|CF713700.1,
                     gi|41572959|gb|CF718800.1,gi|41572969|gb|CF718810.1,
                     gi|41573129|gb|CF718970.1,gi|41573135|gb|CF718976.1"
                     /transcript_id="XM_568394.1"
                     /db_xref="GI:58261967"
                     /db_xref="GeneID:3255280"
     CDS             join(238700..238847,238941..239030,239084..239168,
                     239227..239485,239541..239645,239692..239927,
                     239981..240397,240446..240584,240638..240704,
                     240754..240935)
                     /locus_tag="CNM00800"
                     /codon_start=1
                     /product="amino acid transporter"
                     /protein_id="XP_568394.1"
                     /db_xref="GI:58261968"
                     /db_xref="GeneID:3255280"
                     /translation="MSSAIEKEGSIRGRTSQEVVSAGYDPKKGGDGVDTVVTPAHAEK
                     GSYEGEGIHVGEGTVHRQLKQRHMAMIALGGAIGTGLFVGSGSALASGGPVGVWLGYI
                     FMASMVYAMMVALGEMAALYPVSGAFTHYASRFVDPSLGFALGFNYWYSYAITIPTEV
                     VAASIVISYWDTTTNVAVYITVCLVLIWFINFWGARAYGEAEFWFSSIKVITIVGLII
                     LGIVLMCGGGPNHDAIGFRYWRNPGPFAQITINNGDGVIPGRWGQFLAFWNVFVQAAF
                     SFIGTEIIATTLGEAENPRKTVPRAIKRVFFRLLFFYVFGIFIISVLVPYTEPNLLNG
                     TGTAAASPFVIAIENAGIKALPSIVNAVLLISAWSAGNSDLYASSRTLYALALERQMP
                     RFFRRCTKRGLPIWCVVITGLFGFLSYMNTGGETAEKAFDWLYNLSAITGIITWWAIL
                     LSYLRFYYGLKKQGLSRDDFPYRAPFQPWLSWYGFIFFTLIILFNGFTVFLKGNWDAS
                     SFVAAYITLPIFAVCWIGWKLVKKTRVVPLAEIDFHSGRRELDELEALDAERFKAETK
                     YQKIISILF"
     gene            241677..242682
                     /locus_tag="CNM00810"
                     /db_xref="GeneID:3255243"
     mRNA            join(241677..242045,242114..242413,242462..242682)
                     /locus_tag="CNM00810"
                     /product="expressed protein"
                     /transcript_id="XM_568454.1"
                     /db_xref="GI:58262087"
                     /db_xref="GeneID:3255243"
     CDS             join(241704..242045,242114..242413,242462..242551)
                     /locus_tag="CNM00810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568454.1"
                     /db_xref="GI:58262088"
                     /db_xref="GeneID:3255243"
                     /translation="MPVTPRPNYPYPVPNSELIATHSLGKHFEGGFFAQNVALESDSP
                     KSPAPQNAHISQPDALGGRVQYASGPGAELLYGPPGDERVGEDKRLDATLIYYLLTPD
                     SYRSAMHMNLHSTFHLHHAGRALYTLIQPPQKNGDEPTVRRVIMGPNSSLGEVTQLFV
                     PGGCWKASEIPEEDMLLLGGREDNDLKERIGCLISEVVVPGWNPDQHQFIDEDKLRAM
                     WGTKSGWEQYTKYIHPPQGVEHPDK"
     gene            complement(242488..>243857)
                     /locus_tag="CNM00820"
                     /db_xref="GeneID:3255042"
     mRNA            complement(join(242488..242764,242815..243110,
                     243164..243435,243486..243507,243567..243692,
                     243761..>243857))
                     /locus_tag="CNM00820"
                     /product="chorismate mutase, putative"
                     /transcript_id="XM_568424.1"
                     /db_xref="GI:58262027"
                     /db_xref="GeneID:3255042"
     CDS             complement(join(242687..242764,242815..243110,
                     243164..243435,243486..243507,243567..243692,
                     243761..243857))
                     /locus_tag="CNM00820"
                     /codon_start=1
                     /product="chorismate mutase"
                     /protein_id="XP_568424.1"
                     /db_xref="GI:58262028"
                     /db_xref="GeneID:3255042"
                     /translation="MMNFTTGANASELLSLDRIRSQLIRLEDTIIFLLIERAQFAYNK
                     KIYEAGAFKDEIDFEGSWLEWFLYETETFHAKARRFTSPDEHPFTPLDRLPQPILKPQ
                     KFPTLLYEPAATHPSVNVNSRILRFYVEHIVPGITGAGKGKTESEDDGNYGSSATRDV
                     EVLQALSRRIHFGMFVSESKFLTAPHDFIPHILASPPNTEALAGLITKPAVEAKLLVR
                     LANKARVYGCEMDVDGRLIEVPDEEMGARGKIDLASVVGMYKDWVIPLTKDVEVDYLI
                     HRLDGVPQSQIDVWMKGKSQ"
     gene            complement(245188..246481)
                     /locus_tag="CNM00830"
                     /db_xref="GeneID:3255124"
     mRNA            complement(join(245188..245354,245402..245536,
                     245594..245612,245673..245868,245930..246012,
                     246073..246330,246417..246481))
                     /locus_tag="CNM00830"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_568422.1"
                     /db_xref="GI:58262023"
                     /db_xref="GeneID:3255124"
     CDS             complement(join(245269..245354,245402..245536,
                     245594..245612,245673..245868,245930..246012,
                     246073..246330,246417..246422))
                     /locus_tag="CNM00830"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_568422.1"
                     /db_xref="GI:58262024"
                     /db_xref="GeneID:3255124"
                     /translation="MSPQSVLVVGASRGLGLALVKHYSSVINPCNVFATVRGSAPSDT
                     FPKGVRVIESVDCSKEDCGQKVVDGLQGASVDLVAYVAGVLKPESIENLSWKDEILMY
                     SVCSIAPVFVVKSLLFASSLSPSAKILFLTSEAGSVTLRTESEGGGAFGHHGSKAAAN
                     MVGHLLSYDLKERGIPIAMIHPGFLKTDMTKNAGMEEFYDKMGAITPEEAAKPLADFV
                     DKLDLSMSGKFWAPLGAKGIGNAEEVLGKEVLDKPGPLEIPW"
     gene            complement(246956..247871)
                     /locus_tag="CNM00840"
                     /db_xref="GeneID:3255222"
     mRNA            complement(join(246956..247234,247293..247402,
                     247503..247568,247651..247696,247765..247871))
                     /locus_tag="CNM00840"
                     /product="expressed protein"
                     /transcript_id="XM_568420.1"
                     /db_xref="GI:58262019"
                     /db_xref="GeneID:3255222"
     CDS             complement(join(247087..247234,247293..247402,
                     247503..247568,247651..247696,247765..247802))
                     /locus_tag="CNM00840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568420.1"
                     /db_xref="GI:58262020"
                     /db_xref="GeneID:3255222"
                     /translation="MSSVAVAVVYKPNEYADEYMVFVDDVADYERWKDGAKDIALSRF
                     IGQFSIYKSATSGHTGSLGEISKQEIENVFFGDEKNVKDKSVEAAIMIILQNGKMHKS
                     DFRHSYKLNLNPSRGAGDTRATGASGAAMGFPR"
     gene            complement(249446..251366)
                     /locus_tag="CNM00850"
                     /db_xref="GeneID:3255257"
     mRNA            complement(join(249446..249778,249832..249914,
                     249967..250078,250135..250241,250298..250877,
                     250929..251039,251096..251366))
                     /locus_tag="CNM00850"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41557203|gb|CF703044.1,gi|41557208|gb|CF703049.1"
                     /transcript_id="XM_568418.1"
                     /db_xref="GI:58262015"
                     /db_xref="GeneID:3255257"
     CDS             complement(join(249626..249778,249832..249914,
                     249967..250078,250135..250241,250298..250877,
                     250929..251039,251096..251350))
                     /locus_tag="CNM00850"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_568418.1"
                     /db_xref="GI:58262016"
                     /db_xref="GeneID:3255257"
                     /translation="MASLTELFQFLDSPNPSARHLALQNLVGHTPKNSTNRNIFIPSS
                     FAGTTTSGNGLVPNKRKDGSDEDEIKIKALKDLTYLCMDQAPIAHDALSALINLSDNP
                     VVARHISDKEFLVWLVSYTANTTSPLSPLTSMLLSNITSHPSLISNLANLTIPIIPLP
                     KSKHYPPYFLPASGSASSTIHPDFRDPTIGLVNAEAGQEPEREIEAIRALVQAFEDGA
                     SDGVKEGTGKRKGDCNFLASVFANISMAPATRQLLLIPRPPFPQPADATPSEGDEPLL
                     SKIVVYTGHPDTIRRGGALGCIKNCAMDRASMGWLLASEEDRVRLPSDPTRMIKGVDV
                     LPWVLAPLMGPEEYDIDEMDKLPPTLQFLPPEKERERDPVLRMMCVEILLLLATTFTG
                     REALRNRGAYYVVREHHKVETDQQIKDSIERFVGLLQRDESRDTKEDHIEELVRGAVK
                     QEGEEEEMGELDVVEV"
     gene            251513..253465
                     /locus_tag="CNM00860"
                     /db_xref="GeneID:3255267"
     mRNA            join(251513..251781,251839..251931,251986..252162,
                     252213..252365,252420..252520,252575..252595,
                     252645..252841,252903..253011,253065..253465)
                     /locus_tag="CNM00860"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533260|gb|CF679101.1,gi|41533275|gb|CF679116.1,
                     gi|41537986|gb|CF683827.1,gi|41542966|gb|CF688807.1,
                     gi|41546834|gb|CF692675.1,gi|41553137|gb|CF698978.1,
                     gi|41553687|gb|CF699528.1,gi|41553694|gb|CF699535.1,
                     gi|41555249|gb|CF701090.1,gi|41558442|gb|CF704283.1,
                     gi|41558446|gb|CF704287.1,gi|41563508|gb|CF709349.1,
                     gi|41564089|gb|CF709930.1,gi|41571725|gb|CF717566.1,
                     gi|41571732|gb|CF717573.1,gi|41572394|gb|CF718235.1"
                     /transcript_id="XM_568397.1"
                     /db_xref="GI:58261973"
                     /db_xref="GeneID:3255267"
     mRNA            join(251513..251781,251839..251931,251986..252162,
                     252213..252365,252420..252520,252575..252595,
                     252645..252841,252903..253011,253065..253264,
                     253316..253465)
                     /locus_tag="CNM00860"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533275|gb|CF679116.1,gi|41537975|gb|CF683816.1,
                     gi|41537986|gb|CF683827.1,gi|41542963|gb|CF688804.1,
                     gi|41542966|gb|CF688807.1,gi|41546834|gb|CF692675.1,
                     gi|41553129|gb|CF698970.1,gi|41553137|gb|CF698978.1,
                     gi|41553694|gb|CF699535.1,gi|41555241|gb|CF701082.1,
                     gi|41555249|gb|CF701090.1,gi|41558442|gb|CF704283.1,
                     gi|41558446|gb|CF704287.1,gi|41563508|gb|CF709349.1,
                     gi|41564089|gb|CF709930.1,gi|41571732|gb|CF717573.1,
                     gi|41572394|gb|CF718235.1"
                     /transcript_id="XM_568396.1"
                     /db_xref="GI:58261971"
                     /db_xref="GeneID:3255267"
     CDS             join(251656..251781,251839..251931,251986..252162,
                     252213..252365,252420..252520,252575..252595,
                     252645..252841,252903..253011,253065..253188)
                     /locus_tag="CNM00860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568396.1"
                     /db_xref="GI:58261972"
                     /db_xref="GeneID:3255267"
                     /translation="MLSTFRTGVKDIELANPPTDSISRIEFSPTADILAVASWDNNVR
                     LYDVNSQGQNQGKAMYSHQAPVLDLTWSADGQYVFSSGCDNAAQMYNVQTQQAQQVAQ
                     HDAPIKCVEFAEVPGSGQVLITAGWDKKLKYWDLRSPNPIATIDLSDRAYSMSVAQQL
                     LVCATGDRQLHVINLSSPTTIFKSIESPLKWQTRVVSCFPTGDAFAVGSIEGRVAIQY
                     PGEDDKRNFSFKCHRYDIPTGSMPRTPAVSGSQNVFAINSLTFHKVQGTFCSGGSDGS
                     LTFWDGISRTKLKTFSCKDLNNGDTDVRPPRFGTPIVSTSFNRTQEIIAYAMSYDWSK
                     GHSGVPPAGQNINKVMLHPVKPEEVNKKPKRN"
     gene            complement(<254754..>255779)
                     /locus_tag="CNM00870"
                     /db_xref="GeneID:3255160"
     mRNA            complement(join(<254754..254882,254935..255366,
                     255397..255591,255699..>255779))
                     /locus_tag="CNM00870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568493.1"
                     /db_xref="GI:58262165"
                     /db_xref="GeneID:3255160"
     CDS             complement(join(254754..254882,254935..255366,
                     255397..255591,255699..255779))
                     /locus_tag="CNM00870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568493.1"
                     /db_xref="GI:58262166"
                     /db_xref="GeneID:3255160"
                     /translation="MDPEAWLCSYFWPRREKAWWLAWRAFNPALASIRFQFWRDALKG
                     IFAANPQNQIVPQHPVAVLLADMKKHRPVQKYYLNQLIDVRVSLQIITAKALSLPPAA
                     VSLESHLSINSPLSTSLLLGPLPILLPPTHASSAHISHTLSHVSTLLAVVSLLRNLPI
                     LISQKKQISIPADICEKYGIVEEELFRRGAEAKGFRDACWEIGTRGMDELITARRDLK
                     ETGGKVVPSSVMPIFLSAVAPENYLKRLEKYDFDVFHPDIQKHDWQLAPKIWYRYQTG
                     KL"
     misc_feature    256245..256267
                     /note="AT_rich"
     gene            complement(256724..258338)
                     /locus_tag="CNM00880"
                     /db_xref="GeneID:3255116"
     mRNA            complement(join(256724..256816,256863..257081,
                     257129..257208,257258..257656,257711..257816,
                     257872..257979,258054..258106,258233..258338))
                     /locus_tag="CNM00880"
                     /product="DNA polymerase processivity factor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41552975|gb|CF698816.1,gi|41552981|gb|CF698822.1"
                     /transcript_id="XM_568321.1"
                     /db_xref="GI:58261821"
                     /db_xref="GeneID:3255116"
     CDS             complement(join(256802..256816,256863..257081,
                     257129..257208,257258..257656,257711..257816,
                     257872..257979,258054..258106,258233..258284))
                     /locus_tag="CNM00880"
                     /codon_start=1
                     /product="DNA polymerase processivity factor"
                     /protein_id="XP_568321.1"
                     /db_xref="GI:58261822"
                     /db_xref="GeneID:3255116"
                     /translation="MLEARVKQAVVLKKLLDAIKELVSDGNLDCTEEGISLQAMDNSH
                     IALVALKLEASEFDEYRCDRNMPLGVNLASLTKILKCAKDTDVVTLKASDDADALNLI
                     FESPKEDRVGEYEMKLMDIDQEHLGIPDTQYDATVSMSSAEFARICRDLAVLGESVKI
                     ECSKEGVTFSADGEVGKGSVLLRQNAGQDRSRVKDENEMDEDGKLDIKPKTKREARRD
                     PDEDDEDGQRSDVDVKPDIEGEDELQDEEEQEGEEQPKKRKAAGKKDKANKRAKKEDV
                     EDPGVSIILERQVSLTFSLKYLTNFAKSAPLAREVTLHMSNDVPLLVQFEFEQGTLQF
                     FLAPKIADE"
     gene            258565..261321
                     /locus_tag="CNM00890"
                     /db_xref="GeneID:3255261"
     mRNA            join(258565..258708,258756..258921,258983..259060,
                     259121..259842,259891..260407,260457..260623,
                     260673..260762,260804..260944,261002..261321)
                     /locus_tag="CNM00890"
                     /product="inositol/phosphatidylinositol phosphatase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537555|gb|CF683396.1,gi|41543438|gb|CF689279.1,
                     gi|41543444|gb|CF689285.1,gi|41547924|gb|CF693765.1,
                     gi|41547932|gb|CF693773.1,gi|41547973|gb|CF693814.1,
                     gi|41547978|gb|CF693819.1,gi|41548839|gb|CF694680.1,
                     gi|41548850|gb|CF694691.1,gi|41550695|gb|CF696536.1,
                     gi|41553132|gb|CF698973.1,gi|41553140|gb|CF698981.1,
                     gi|41555259|gb|CF701100.1,gi|41555270|gb|CF701111.1,
                     gi|41563658|gb|CF709499.1,gi|41563664|gb|CF709505.1,
                     gi|41570876|gb|CF716717.1,gi|41570892|gb|CF716733.1,
                     gi|41573387|gb|CF719228.1,gi|41574306|gb|CF720147.1"
                     /transcript_id="XM_568319.1"
                     /db_xref="GI:58261817"
                     /db_xref="GeneID:3255261"
     CDS             join(258688..258708,258756..258921,258983..259060,
                     259121..259842,259891..260407,260457..260623,
                     260673..260762,260804..260944,261002..261268)
                     /locus_tag="CNM00890"
                     /codon_start=1
                     /product="inositol/phosphatidylinositol phosphatase"
                     /protein_id="XP_568319.1"
                     /db_xref="GI:58261818"
                     /db_xref="GeneID:3255261"
                     /translation="MTFNALPLHETLNLYVSPTAYIFEPASSSAGHAGIDGTIFVDEK
                     NVRESMVVDRQTGQISLSTASHIPFGKEKVITCYGIIGILSLATTDFLLIVTSRTPSC
                     RLLSHPIYLANDYRLLPVSPLSTSSAILEHPVEKELISLVEQGLKSSKLWFSYGWDLT
                     NSLQRQQEIDLKLSQSGEQWPVWKRADERFFWNRFLMDKMIDVTESGEADLSRFILPI
                     MYGSIELRSSTLNSRDLLFLLISRRSRYRAGTRYFTRGINPSGHVANFNETEQIVLYD
                     PIPEDGEAYRRGKVEGRERLSFVQTRGSVPLFWAEVNNLRYKPDLQIMDYTETPQALK
                     AHLDSMIKTYGHTYLVNLVNQKGHEQPVKEAFERYMSLVASSDPSIQEKAHYLYFDFH
                     HECKGLRFDRISLLVEKLATALEDMGWYHSVNPDSSTYALFRPNSADTQVLAKQMGVV
                     RTNCMDCLDRTNVAQAALARWVLNRQLRKVGILSVKEGVEDHEEFMIMFRNVWADHGD
                     TVSRAYAGTGALKSDFTRTGKRSKEGLLEDGYKSVVRYIRNNFFDGDRQDGFDILTGA
                     WIAKRGGVPPLTDTRPLIMRSMPYILAFALTMITAALTLPRTSEMSIYSFLILWFFLA
                     FLSGSYIWGNGTSYVSWPRLNPPLEILSYSGPGHRSAVRGRGMSFAAVVPLFDRRRRN
                     GPGAGLLGATGGIGGRNDGRPAMYKMEESELGRRKGALID"
     gene            262479..266217
                     /locus_tag="CNM00900"
                     /db_xref="GeneID:3255288"
     mRNA            join(262479..263067,263127..263309,263360..263421,
                     263481..263923,263972..264124,264246..264364,
                     264415..265419,265472..266217)
                     /locus_tag="CNM00900"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530754|gb|CF676595.1,gi|41530759|gb|CF676600.1,
                     gi|41531879|gb|CF677720.1,gi|41531889|gb|CF677730.1,
                     gi|41533942|gb|CF679783.1,gi|41533961|gb|CF679802.1,
                     gi|41535924|gb|CF681765.1,gi|41536580|gb|CF682421.1,
                     gi|41536586|gb|CF682427.1,gi|41538609|gb|CF684450.1,
                     gi|41538621|gb|CF684462.1,gi|41539594|gb|CF685435.1,
                     gi|41539600|gb|CF685441.1,gi|41539738|gb|CF685579.1,
                     gi|41539744|gb|CF685585.1,gi|41540746|gb|CF686587.1,
                     gi|41540757|gb|CF686598.1,gi|41542097|gb|CF687938.1,
                     gi|41542107|gb|CF687948.1,gi|41542846|gb|CF688687.1,
                     gi|41543292|gb|CF689133.1,gi|41543298|gb|CF689139.1,
                     gi|41545000|gb|CF690841.1,gi|41546728|gb|CF692569.1,
                     gi|41546824|gb|CF692665.1,gi|41546831|gb|CF692672.1,
                     gi|41547202|gb|CF693043.1,gi|41547381|gb|CF693222.1,
                     gi|41547388|gb|CF693229.1,gi|41548204|gb|CF694045.1,
                     gi|41548213|gb|CF694054.1,gi|41548463|gb|CF694304.1,
                     gi|41548479|gb|CF694320.1,gi|41548562|gb|CF694403.1,
                     gi|41548575|gb|CF694416.1,gi|41549235|gb|CF695076.1,
                     gi|41549386|gb|CF695227.1,gi|41549394|gb|CF695235.1,
                     gi|415"
                     /transcript_id="XM_568317.1"
                     /db_xref="GI:58261813"
                     /db_xref="GeneID:3255288"
     CDS             join(262767..263067,263127..263309,263360..263421,
                     263481..263923,263972..264124,264246..264364,
                     264415..265419,265472..265809)
                     /locus_tag="CNM00900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568317.1"
                     /db_xref="GI:58261814"
                     /db_xref="GeneID:3255288"
                     /translation="MLAPLALLPLLSLMLPQASADTRPGSLPHNLHHPYRRSLKRSIT
                     SDASSINGESFDFVIAGGGVAGLTLAARLSEWSNVTVLCIEAGGDGSNYEDQIDIPGY
                     SYLNSLTGTAYDWAYNTVPQTDALDLTKYWPRGKGLGGSGAINGLFWGRASSIEYDAW
                     ATLNPNGNETWNWEEVNKYIKKSENLTAPPTDIQEKFGIVVNASAHGDDGPIQIGFSE
                     YIFDEVAKWIPTWETLGLSGKDLAGGSTHGAMISTSTINMRNQTRSDSKAGYIDPLPP
                     RSNLVILTEQQVTGVIFNGSTDASGNIVASGVTFQANSNSANYSVQANKEVLLAGGTV
                     GSPQILQLSGIGPKDLLSSLGIDTKIDLPVGYNLQDHVSYSMYWSTPQGTLTWSNLSA
                     SSTLQSEQLAQYKSNFTGMWTYVNEAVGYPSMSDIMQSSSSASTYASTVSSAIDGMVT
                     NVTSWLDLPDTVATGLTSQYQIQQQWLTEDIGQLEIVLTLLGNGGNELGIQVALQHPF
                     SRGTIFINSTDPFTQPNINPDYFGVGYDIDIMAYGSEFARRLAAASPLSDVMITETAP
                     GSSVTGDSLATYTKQNCGTEYHPLGTCSMLPKNSGGVVDTTLTVYGTSNLRVIDTSIA
                     PLQLSAHLMATTYGIAEKGADIIKKKYWYVDPVTSSSATVAAATTSTEATTAAVGDAT
                     DTAVTNINQNNAESGSTLSSGAKIGIGVGVGVGAAAVLAGLLLFFVMRKRNQKEDEKG
                     WYGDRQEGWNPDAGDAYKEPGSAYPMADFDSHNSYASPTPAFIGNHSRNQSINTIATA
                     DLASRTPMRNSSSFSYAAGGPGVGRTASPYRDDMSDDGNGQGHVYQAPEAPAGQQATR
                     GEQRYQPVNIR"
     gene            272831..274411
                     /locus_tag="CNM00910"
                     /db_xref="GeneID:3255262"
     mRNA            join(272831..273123,273182..273346,273399..273836,
                     273897..273991,274054..274411)
                     /locus_tag="CNM00910"
                     /product="delayed-type hypersensitivity antigen - related"
                     /transcript_id="XM_568398.1"
                     /db_xref="GI:58261975"
                     /db_xref="GeneID:3255262"
     CDS             join(272968..273123,273182..273346,273399..273836,
                     273897..273991,274054..274186)
                     /locus_tag="CNM00910"
                     /codon_start=1
                     /product="delayed-type hypersensitivity antigen - related"
                     /protein_id="XP_568398.1"
                     /db_xref="GI:58261976"
                     /db_xref="GeneID:3255262"
                     /translation="MYSSAIMTFLFGALLSLPGIYANSPWLGCVLTTAATAVGSVSSR
                     QSSSSVCSTYCAGRSYPYAYYVGGILLGNNCYCGSEANIISPVNYAAPSTSLTTSCLP
                     ILQAGVFDTSSTFSYTGCYAPSGLLSGLINTVTGVLGTTVSSPRACFQMCADTPAAYY
                     TPYLLGLSTLTPRYGCVCGDETVVSGVPTLCGLGQFYAYSHSAAAAASSLPRRKRAHE
                     RILAGKRSEVIKERNWDCPTGMQACNIDGVANSWECIDPTTELESCGGCRYGDYSASA
                     NSSEPTGVDCTALPGVLRGSVTCSDSKCEAFACKRGWTLRDGECVKTFTFQL"
     gene            275338..277942
                     /locus_tag="CNM00920"
                     /db_xref="GeneID:3255266"
     mRNA            join(275338..275682,275729..275886,275939..276113,
                     276162..276427,276468..276668,276730..277267,
                     277318..277942)
                     /locus_tag="CNM00920"
                     /product="lysophospholipase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534834|gb|CF680675.1,gi|41534841|gb|CF680682.1,
                     gi|41538006|gb|CF683847.1,gi|41538010|gb|CF683851.1,
                     gi|41554142|gb|CF699983.1,gi|41554148|gb|CF699989.1,
                     gi|41571704|gb|CF717545.1"
                     /transcript_id="XM_568399.1"
                     /db_xref="GI:58261977"
                     /db_xref="GeneID:3255266"
     CDS             join(275509..275682,275729..275886,275939..276113,
                     276162..276427,276468..276668,276730..277267,
                     277318..277719)
                     /locus_tag="CNM00920"
                     /codon_start=1
                     /product="lysophospholipase"
                     /protein_id="XP_568399.1"
                     /db_xref="GI:58261978"
                     /db_xref="GeneID:3255266"
                     /translation="MSIITTAFALSLLATTAFAVPPETPRIELQAERGLGDQSYAPWQ
                     VDCPSNVTWIRNATTGLGTGERAYIEAREKLVQPAIEQMMAARGLETPPRTPVIGVAL
                     AGGGYRAMLTGLGGIMGMMNESTEASQSETGGWLDGVSYWSGLSGGSWATGSFMSNGG
                     QLPTTLLENLWNIDSNLVFPDDGKLSFYTNLYTETNAKSDLGFPVQITDIWGLAIGSH
                     VLPEPYQLSNTPNLTFSSLPSVVAALGNASLPMPIIVAADRKRREAGELVIAENATVW
                     EFTPYEFGSWAFGSQYKSPGAFTPIEYLGTSVDDGSPNGTCWKGFDQLSFVMGTSATL
                     FNGAFLELNGTDSGLLTNLITAFLADLGEDQADISRIPNSFSNYNSGENPIYNLTYIT
                     LVDAGETNQNIPLEPLLVPTRDVDAIVAFDSSYDSDYIWPNGTALRTTYERAKILAEH
                     ENTRVLMPEVPSMNGFVNGGYNSRPTFFGCNDTTTPVIIYIPSYPWSFAANTSTYQLS
                     YENNEANEMLLNGMRSLTLNHSVPTWPTCFACALTDRSFMYTSENRSTTCQECFDTWC
                     WAGDDNTTEPANYEPVINSVPPWLIANNLSIGMADAPGSNESTAGTASSGAAKMGVGM
                     GMVALTAGLGLML"
     gene            complement(277860..279961)
                     /locus_tag="CNM00930"
                     /db_xref="GeneID:3255225"
     mRNA            complement(join(277860..278174,278237..278317,
                     278372..278600,278664..278813,278897..279209,
                     279262..279366,279411..279706,279756..279796,
                     279846..279961))
                     /locus_tag="CNM00930"
                     /product="cyclin-dependent protein kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531063|gb|CF676904.1,gi|41531074|gb|CF676915.1,
                     gi|41531769|gb|CF677610.1,gi|41546776|gb|CF692617.1,
                     gi|41546792|gb|CF692633.1"
                     /transcript_id="XM_568416.1"
                     /db_xref="GI:58262011"
                     /db_xref="GeneID:3255225"
     CDS             complement(join(278069..278174,278237..278317,
                     278372..278600,278664..278813,278897..279209,
                     279262..279366,279411..279706,279756..279796,
                     279846..279925))
                     /locus_tag="CNM00930"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase"
                     /protein_id="XP_568416.1"
                     /db_xref="GI:58262012"
                     /db_xref="GeneID:3255225"
                     /translation="MATIPGGGTIMDPMHLYRARRDKERRGVLKTYKILGFISSGTYG
                     RVYKAVLLPPPKTASAKSALPSSTRAALSLPKDKLPSPSFTEDSDPLNNPEMCMRPGD
                     RPAKRGDVFAIKKFKPDKEGDVLTYAGISQSGAREIMLNRELHHRNLVSLREVILEDK
                     SIYMVFEYAEHDFLQIIHYHSQTARASIPPSTLRRLLHQLLCGVHFLHSNFVLHRDLK
                     PANILVTSQGVVKIGDLGLARLWHKPLAQQGLYGGDKVVVTIWYRAPELILGAKHYTA
                     AVDIWAVGCIYAELLSLRPIFKGDEAKMDGKKSLPFQRDQMGKICEVLGPVKPEQWPG
                     IVHMPEYRTYQATGPYPHSNPLAPWYHARSNSSEGYDILVKMFEWDPARRITARDALR
                     HPWFQEEGGVDTKSVFEGSSITYPTRRVTHEDNGDAKMGSLPQSMAGGRLPSSSNFRP
                     ASGNIVQPAARKKARI"
     misc_feature    280066..280102
                     /note="A-rich"
     gene            <280600..>283922
                     /locus_tag="CNM00940"
                     /db_xref="GeneID:3255171"
     mRNA            join(<280600..280684,280806..282275,282326..282660,
                     282710..282885,282936..283108,283159..283442,
                     283493..283752,283808..>283922)
                     /locus_tag="CNM00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_568492.1"
                     /db_xref="GI:58262163"
                     /db_xref="GeneID:3255171"
     CDS             join(280600..280684,280806..282275,282326..282660,
                     282710..282885,282936..283108,283159..283442,
                     283493..283752,283808..283922)
                     /locus_tag="CNM00940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568492.1"
                     /db_xref="GI:58262164"
                     /db_xref="GeneID:3255171"
                     /translation="MFAPTRPLGIRDKVWEEGGSVSLPMHMFETSTPSLKSNHSRRSS
                     ILNIGSVSKPNIFAPSIFQGEGEAQGEESMEIEDDKELSGFDTSERDEAQQEHGHDGG
                     AEGEESMEMEEEDMDITQHIYGGIVRRSSIAPTVAAPSELDAGADTEEESDNGQEHSH
                     LEDEEKTMDFTIAVGGLLPHEAPATATRNRNSIGYSFPNPDGPALPNLMPGQAEDHEV
                     EYPMDETEAYGAIIGQDISFSSGSEDTMGSRNGDKTMTFTYNHHIALPTQIDGDDSMD
                     MITSAGGIISLPPVSPRLSVPNNTRPINGTPSFARPTVSSAQKTTATKRNVFAPSPSP
                     LKSTTPRKSGIQTAAEVAKRLSFGSVTSSGGKKRVREDSQEAEGSMKKSRIEAAAEEV
                     FGTPHHVSPFNKPEEAEPSTLIVQSTTPPSDPPQGTVMSTRRSSLGTAMRLSLPPQRS
                     LAPPQQEAEEQNKKNVTEPQQRMHEQPQDISLAAFLEIAGVQFMEGLPGLNRKRSSVA
                     KEILGQSYANERDFALHEYTEAQVNSIFLNMYTWASNKLFQDIQTGDEELTAVAARCD
                     IDSPPVIQEYLAASDEDKQLFEMTFKSFKTNTHLKAKEMWYDWMWQLLETIKPDVETV
                     LMGMKEDKKRLTAFEEQAVVLLPQLRARKIEVESKLVEERKAVVEIESCDQAELAAYK
                     EAIAEQSAQITNFSTEVADLKDELATLTGKLEELNAKKHEYETAIAHAKGQCDQFTRS
                     DAIRLQEESISLQHLHMWHPTKILPERMELTYDAEILLSINCSNYIPDISSATLEYLS
                     ERMQSSKRKCSGIRGESPSRCLFEVFKGAVGDMIKHKTWDLPSFVQQTGLLWSNAQRI
                     RAELRYIEFHHPLFITYNSSTFLMSVSASIMIPQAKSKVLVWFDVDKSVVHGFPGSLG
                     GVVVSVKSVYGQADVNLLEQTARQTIEMSRPEACLGTFLQVCVEVGARYSS"
     gene            complement(284106..286314)
                     /locus_tag="CNM00950"
                     /db_xref="GeneID:3255194"
     mRNA            complement(join(284106..284302,284352..284643,
                     284699..284826,284889..284993,285053..285142,
                     285194..285238,285288..285345,285405..285568,
                     285631..285804,285867..285874,285963..286039,
                     286114..286314))
                     /locus_tag="CNM00950"
                     /product="Aspartate aminotransferase, mitochondrial
                     precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530089|gb|CF675930.1,gi|41530105|gb|CF675946.1,
                     gi|41530262|gb|CF676103.1,gi|41530370|gb|CF676211.1,
                     gi|41530376|gb|CF676217.1,gi|41530484|gb|CF676325.1,
                     gi|41530486|gb|CF676327.1,gi|41531210|gb|CF677051.1,
                     gi|41531575|gb|CF677416.1,gi|41531585|gb|CF677426.1,
                     gi|41531586|gb|CF677427.1,gi|41531593|gb|CF677434.1,
                     gi|41532014|gb|CF677855.1,gi|41532018|gb|CF677859.1,
                     gi|41532056|gb|CF677897.1,gi|41532063|gb|CF677904.1,
                     gi|41532513|gb|CF678354.1,gi|41532530|gb|CF678371.1,
                     gi|41532704|gb|CF678545.1,gi|41533210|gb|CF679051.1,
                     gi|41533689|gb|CF679530.1,gi|41533818|gb|CF679659.1,
                     gi|41534024|gb|CF679865.1,gi|41534035|gb|CF679876.1,
                     gi|41534237|gb|CF680078.1,gi|41534245|gb|CF680086.1,
                     gi|41536021|gb|CF681862.1,gi|41536216|gb|CF682057.1,
                     gi|41536229|gb|CF682070.1,gi|41537343|gb|CF683184.1,
                     gi|41538045|gb|CF683886.1,gi|41538536|gb|CF684377.1,
                     gi|41538542|gb|CF684383.1,gi|41538717|gb|CF684558.1,
                     gi|41538722|gb|CF684563.1,gi|41538771|gb|CF684612.1,
                     gi|41538779|gb|CF684620.1,gi|41539438|gb|CF685279.1,
                     gi|415"
                     /transcript_id="XM_568414.1"
                     /db_xref="GI:58262007"
                     /db_xref="GeneID:3255194"
     CDS             complement(join(284258..284302,284352..284643,
                     284699..284826,284889..284993,285053..285142,
                     285194..285238,285288..285345,285405..285568,
                     285631..285804,285867..285874,285963..286039,
                     286114..286289))
                     /locus_tag="CNM00950"
                     /codon_start=1
                     /product="aspartate aminotransferase mitochondrial
                     precursor"
                     /protein_id="XP_568414.1"
                     /db_xref="GI:58262008"
                     /db_xref="GeneID:3255194"
                     /translation="MLPRLGAIQSTTHPFFFTTTKMLVHSSKYLLARSAAISKVLPAV
                     AARRAGSTWTNVPAGPPDPILGVTEKFKADKSPKKINLGVGAYRDGSGKPYVLPTVRK
                     AEKILAEAMQDKEYLPITGLSDFTKLAAELAYGKDSKPLVENRLAITQSISGTGALRI
                     GTAFLARWFPGAKSIYLPTPTWGNHIPIAKDSGLEVKQYKYFDKKTVGLDFEGMKADI
                     KAAPEGSIVLLHACAHNPTGIDPTEAQWKELSDIVKEKKHFPFFDMAYQGFASGDTLK
                     DAFAVRYFVEQGHQLLLCQSFAKNMGLYGERAGAISFVCESPEEKARVDSQLKIIIRP
                     MYSNPPVHGARLVSTILGSPELTKEWLVEVKGMADRIIEMRERLYNKLVELDTPGEWG
                     HIKSQIGMFSFTGLKPEQVDKLAEKASIYLTRDGRISMAGLNSNNVDYFAESVSKAVK
                     GTL"
     gene            <286902..>287091
                     /locus_tag="CNM00960"
                     /db_xref="GeneID:3255115"
     mRNA            join(<286902..286957,287040..>287091)
                     /locus_tag="CNM00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_568315.1"
                     /db_xref="GI:58261809"
                     /db_xref="GeneID:3255115"
     CDS             join(286902..286957,287040..287091)
                     /locus_tag="CNM00960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568315.1"
                     /db_xref="GI:58261810"
                     /db_xref="GeneID:3255115"
                     /translation="MKKSKLPNSGYYTNSLTGGLPPQIILLLDSAPKPP"
     gene            287278..289759
                     /locus_tag="CNM00970"
                     /db_xref="GeneID:3255231"
     mRNA            join(287278..287853,287914..289759)
                     /locus_tag="CNM00970"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546428|gb|CF692269.1,gi|41546439|gb|CF692280.1,
                     gi|41553902|gb|CF699743.1,gi|41553907|gb|CF699748.1"
                     /transcript_id="XM_568401.1"
                     /db_xref="GI:58261981"
                     /db_xref="GeneID:3255231"
     CDS             join(287399..287853,287914..289483)
                     /locus_tag="CNM00970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568401.1"
                     /db_xref="GI:58261982"
                     /db_xref="GeneID:3255231"
                     /translation="MNALRTLPILNRPSRPASPAPPTVQSTTASAQPPSNEKPRSRSL
                     SRQVTDKVSSLQISTNGAAIHPPAVITPSQPLAKRSSSPGSRAATPRSTASPLPAAAP
                     GEQAPSGGYMDVIGLRLNETVNKASAGVDFKAKKGFKKGSGFAIGEAVVKELPSPPSD
                     AYLMRAVLRISVRALSIYVTRLESLLLPSLTDVSFTAPLNIATSTAHPLNSVQYFALS
                     VAHTAWETCEILEQTLETGQWPRFTQEALRPVMDKLDLVVSKVVQPLLLGLKRDLIAS
                     LMRTEGTSPAGGKTVGLASIPAPTTSTNGVPLTKEGSHQPVSRLTKEFSSSGHARQLA
                     IPPCLQHFAARVDGSRKVFELIAKPCADDGEGWVTGIVVAVIWKGMCIISDRDLTPTG
                     IRPPSPNSVARALAGLGKERDSSSNITPSPSLQGVTAKLASSLSIVPTRSQSRASSPP
                     RQASKLDPVTHALLSLEGLIKRLVSGLVQPPSPTDDEDEHLARQALSEAIEALQSFRI
                     ISTAMNNGISSSTRLLASARRLRDDVEDPAEDELDDAMEDLQAVILFSILCRQANSIL
                     SSLPISSEKEPTLKIRHPSEVWGWQMAEYERQVLSGFSAAEEWGRRVAVALKGDIEKL
                     LARLAEIIASQGVPEKTSKEKEAVVEAMEWVKLLGVACDAKCGLKVANAA"
     gene            <290521..290877
                     /locus_tag="CNM00980"
                     /db_xref="GeneID:3255187"
     mRNA            join(<290521..290551,290686..290780,290818..290855,
                     290868..290877)
                     /locus_tag="CNM00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_568313.1"
                     /db_xref="GI:58261805"
                     /db_xref="GeneID:3255187"
     CDS             join(290521..290551,290686..290780,290818..290855,290868)
                     /locus_tag="CNM00980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568313.1"
                     /db_xref="GI:58261806"
                     /db_xref="GeneID:3255187"
                     /translation="MRNTERKWEKPVAKKDLNLRIPKTEAVKPETRKQFENGEVVVRQ
                     EGIRKSRNKK"
     gene            294293..298617
                     /locus_tag="CNM00990"
                     /db_xref="GeneID:3255259"
     mRNA            join(294293..294352,294424..294484,294872..295143,
                     296597..296991,297044..297592,297644..298600)
                     /locus_tag="CNM00990"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532117|gb|CF677958.1,gi|41541460|gb|CF687301.1"
                     /transcript_id="XM_568402.1"
                     /db_xref="GI:58261983"
                     /db_xref="GeneID:3255259"
     mRNA            join(296004..296991,297044..297592,297644..298617)
                     /locus_tag="CNM00990"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531408|gb|CF677249.1,gi|41531420|gb|CF677261.1,
                     gi|41534661|gb|CF680502.1,gi|41534673|gb|CF680514.1,
                     gi|41535088|gb|CF680929.1,gi|41535096|gb|CF680937.1,
                     gi|41538622|gb|CF684463.1,gi|41538637|gb|CF684478.1,
                     gi|41542168|gb|CF688009.1,gi|41550072|gb|CF695913.1,
                     gi|41550079|gb|CF695920.1,gi|41554273|gb|CF700114.1,
                     gi|41554285|gb|CF700126.1,gi|41555420|gb|CF701261.1,
                     gi|41555427|gb|CF701268.1,gi|41555958|gb|CF701799.1,
                     gi|41555967|gb|CF701808.1,gi|41558367|gb|CF704208.1,
                     gi|41558372|gb|CF704213.1,gi|41559166|gb|CF705007.1,
                     gi|41559171|gb|CF705012.1,gi|41562444|gb|CF708285.1,
                     gi|41562649|gb|CF708490.1,gi|41562661|gb|CF708502.1,
                     gi|41563408|gb|CF709249.1,gi|41573434|gb|CF719275.1,
                     gi|41573444|gb|CF719285.1,gi|41573650|gb|CF719491.1,
                     gi|41573653|gb|CF719494.1,gi|41574094|gb|CF719935.1,
                     gi|41574103|gb|CF719944.1,gi|41574120|gb|CF719961.1,
                     gi|41574126|gb|CF719967.1,gi|41576118|gb|CF721959.1,
                     gi|41576130|gb|CF721971.1,gi|41576422|gb|CF722263.1,
                     gi|41576428|gb|CF722269.1"
                     /transcript_id="XM_568403.1"
                     /db_xref="GI:58261985"
                     /db_xref="GeneID:3255259"
     CDS             join(296749..296991,297044..297592,297644..298135)
                     /locus_tag="CNM00990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568402.1"
                     /db_xref="GI:58261984"
                     /db_xref="GeneID:3255259"
                     /translation="MPVAPTVKSARTTSVYDRSCRASASPKSSRRLSSQTKAKIQAVA
                     APVSQARAVPQHRKVEEVMYFEEDYSEEIIAYMNSMDNSTLASAELMDMQPELQWFMR
                     SYLIDFIIEVHQQFRLRPEVLYLAMNIVDRYISKRVVYKKHYQLVGCAALWIAAKFED
                     AKDKVPLVHELSEMCCKAYDESAFIQMEGHVLSTIGWVLGHPSAEAWLRVFTTGIRYE
                     DQKVANMARFLMEITLFHREFIGIQSSIIAAGALMLARFICGKPYKPCFPNVPETVAA
                     RVSIAIDKRFSQELEKVSEIVIRKYAPTYYDRVSTVCREWYLSGRRYTYNPVMPSTPV
                     SGLSTPGLAPSCSSSWAKRGSWVTGSPAGSCASSEAGDDTPVTPITPIYTHVIDPFSV
                     AAKENIAPDAGKPMAKVIPRVHNVTAPRVMRRLSN"
     gene            complement(299740..303224)
                     /locus_tag="CNM01000"
                     /db_xref="GeneID:3255235"
     mRNA            complement(join(299740..299902,299967..300482,
                     300533..300605,300657..301436,301495..301701,
                     301750..302252,302303..302641,302694..303224))
                     /locus_tag="CNM01000"
                     /product="ER to Golgi transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41551990|gb|CF697831.1,gi|41552000|gb|CF697841.1,
                     gi|41573017|gb|CF718858.1,gi|41573022|gb|CF718863.1"
                     /transcript_id="XM_568412.1"
                     /db_xref="GI:58262003"
                     /db_xref="GeneID:3255235"
     CDS             complement(join(299829..299902,299967..300482,
                     300533..300605,300657..301436,301495..301701,
                     301750..302252,302303..302641,302694..303213))
                     /locus_tag="CNM01000"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein"
                     /protein_id="XP_568412.1"
                     /db_xref="GI:58262004"
                     /db_xref="GeneID:3255235"
                     /translation="MAPRTRYAIDPSLTGHPQVPAPQQQQWPQPEYIQAAQPGYQPER
                     YQQQAHLDPNSMPQLHNVPEKDLRPSGPYAPTQSSYHAIHPSQQLQPKQQQQEMQSPR
                     ATPPPNHIPPPPHSSGPTMSGMRVRIDPSQVPNPIEAQELDQNLYEDEDFLSCQTRGL
                     IPLVGTDYRGVDQGNSLPRHLRATLPCVPSNGQLLDTTALPFGILVQPFAPLRYDEAP
                     VPCVSSWVSGQSAFDPPAFKGETWGAEGEGDEQGPPRCDKCRGYINPWIRFVDGGRKW
                     TCNLCGVLNEVPPQYFCHLAPNGQRLDHAERPELQFGTVDFPVPPSYWALQPPSGSLL
                     DSIDSDALASTAHDLLGGLQASLGQSQPHIPTGKEQREKEKEKEKERKKFRKPIALSR
                     VFVLDVSAHAGENGVARQVCERIRKAIYGSKESGNVEEELLGEGQRIGFVSVGETVSF
                     WNLSSHLHAPSQAVVSDLDDMFIPFTAGFLVDPQESRAQIEHLLELLPNLAEQGREGG
                     RVAAGSAIVGALAGLKHTGGQINLFLTSLTTHGLGTLTTRENPDYYNTDKERTLFTPS
                     QWYLTTADQLAEAGVGVNLFLFPSAYTDIASLGALAAGTGGETFFHPRFDVVRDREKI
                     HSELLQVLTRETAYNATVRVRCSNGLRVSDHLGNFYQRSLTDLEYATIDSAKSFTAVL
                     KHEHRLDDRQPAFIQVAILYTSKEGERRVRCLNMSFVVTSMIGNVFKFADQEACVAVL
                     LKAGLSQVTQRSLRDIRKSLTDRANRVLLMYRKHCAPAVQHGQLILPEGFKLLPLYAL
                     CMTKSKPIKGGSVSSDVRMHYTRHVKALPPTRVLMLLYPRLLAIHDLAPAAGFADSNT
                     GRLVLPRFMRNSHSWMVAEGAYLMINGEIAMLWLGQAVSPQIINDLYGVDNLEDLDVR
                     ITRLPNLPTLLSTQIRNILTHLSSPHLVDQELPVIIVRQNMDGAEVEFANQLVEDSNN
                     DALSYTDYLMTAHREITNDLSGGKGDSWRPW"
     misc_feature    301967..302012
                     /note="T-rich"
     gene            <304493..>304950
                     /locus_tag="CNM01010"
                     /db_xref="GeneID:3255296"
     mRNA            join(<304493..304548,304782..>304950)
                     /locus_tag="CNM01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_568311.1"
                     /db_xref="GI:58261801"
                     /db_xref="GeneID:3255296"
     CDS             join(304493..304548,304782..304950)
                     /locus_tag="CNM01010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568311.1"
                     /db_xref="GI:58261802"
                     /db_xref="GeneID:3255296"
                     /translation="MGEGGENEGSTYIIAKPTLREAAEDTVNFHTPGMGNIHVLMVHE
                     TLCVKSSNTEVRHKIMAHKSLRGGSIYELV"
     gene            306468..307441
                     /locus_tag="CNM01020"
                     /db_xref="GeneID:3255287"
     mRNA            join(306468..306545,306657..306792,306861..307066,
                     307119..307441)
                     /locus_tag="CNM01020"
                     /product="ribosomal protein L13, putative"
                     /transcript_id="XM_568309.1"
                     /db_xref="GI:58261797"
                     /db_xref="GeneID:3255287"
     CDS             join(306474..306545,306657..306792,306861..307066,
                     307119..307322)
                     /locus_tag="CNM01020"
                     /codon_start=1
                     /product="ribosomal protein L13"
                     /protein_id="XP_568309.1"
                     /db_xref="GI:58261798"
                     /db_xref="GeneID:3255287"
                     /translation="MVKHNNQLPKNHFHKDWQRRVKTWFDQPGKKKSRRVARSKKALA
                     SGAAPLQRLRPAVRCPSQRYNIRVREGRGFTTSELKLAGIRRKEALSLGISVDPRRRS
                     KSEEGQKLNVERLKEYKSRLVVFPKKAGKPKAGDATGDALTAHITRDSIPLPASYTAE
                     APRAITDEEKETNAFTTLRLARAAQRNEGQRKKRLAEKEAAEKTK"
     gene            308020..309900
                     /locus_tag="CNM01030"
                     /db_xref="GeneID:3255174"
     mRNA            join(308020..308107,308361..308521,308714..308867,
                     308928..309259,309321..309505,309566..309900)
                     /locus_tag="CNM01030"
                     /product="tricarboxylate carrier, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531987|gb|CF677828.1,gi|41554920|gb|CF700761.1,
                     gi|41554929|gb|CF700770.1"
                     /transcript_id="XM_568307.1"
                     /db_xref="GI:58261793"
                     /db_xref="GeneID:3255174"
     CDS             join(308062..308107,308361..308521,308714..308867,
                     308928..309259,309321..309505,309566..309584)
                     /locus_tag="CNM01030"
                     /codon_start=1
                     /product="tricarboxylate carrier"
                     /protein_id="XP_568307.1"
                     /db_xref="GI:58261794"
                     /db_xref="GeneID:3255174"
                     /translation="MAPMEKGFSWSNIAVGATMNMFEVTTLGQPLEVLKTQMAANRSQ
                     TIGQAFSTVWSRGGIKGFYQGLIPWAWIEASTKGGVLIFTSAEIEKAAVKGFNLSPAA
                     AGMLGGIGGGVAQAYATMGFCTCMKTVEITRHKQMSVGAPVESTFKVFLDIYKREGLA
                     GINKGVNAVAVRQATNWGSRFGFARLAEAGLRNMKGIKEGEKLGAMDKILASTLGGAL
                     ATWNQPIEVVRVEMQSALKSQDPARPAKKTVLNTLSYIYKTNGLKGLYRGVTPRIGLG
                     AWQTICMVSFADYVKAFIGTSK"
     misc_feature    310116..310300
                     /note="GA-rich"
     misc_feature    311593..311613
                     /note="AT_rich"
     gene            <311991..>315142
                     /locus_tag="CNM01040"
                     /db_xref="GeneID:3255217"
     mRNA            join(<311991..312360,312415..312834,312888..313249,
                     313307..313606,313661..313716,313775..313840,
                     313900..314004,314058..314318,314373..314485,
                     314547..>315142)
                     /locus_tag="CNM01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_568305.1"
                     /db_xref="GI:58261789"
                     /db_xref="GeneID:3255217"
     CDS             join(311991..312360,312415..312834,312888..313249,
                     313307..313606,313661..313716,313775..313840,
                     313900..314004,314058..314318,314373..314485,
                     314547..315142)
                     /locus_tag="CNM01040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568305.1"
                     /db_xref="GI:58261790"
                     /db_xref="GeneID:3255217"
                     /translation="MNGPTPHDEILADQSLAPLKRNHACRQCKKRKTKCDGAHPVCSP
                     CLRSHAHAARSANRNGTSVPVLVCTWADGEGGENGSPPIQEPMQRLSRPGSASGVKRP
                     AVSQGSRPTRDEENEILRRRIADLEAKLVNLSSATRQSGPEPIGPELSMPENTLSPPR
                     SDSIVDNWITEVGHIIRYDLNHFGTFGNKEAPSSKSSQPSVSSLKAPPGGNGGGIGTT
                     QTRESSGSGTRLNIGTIPKDGFSSSFGLDDLFVIPADWPRGLPSPFLLEHLVETFFNH
                     VPQTPRMLHRPTLLTRIKLSPTSGNFPFPGLLHAICATASSHTAWVNNLSPHQIEAAV
                     QRHVITGMDLTSIEDFGLAQAEMANRSVDLVASACVMGGGDLIFQVTQTCILLSDIYF
                     CKGFPLKGWLLGGQPARLINTLQLSDRNPRKSYKEPLLPRPRNSREREERLATLWMAF
                     INDSGLACNSTWVPSMSLADIKCNLPTTGQEWSKLDDMLENPQSPESGDLFTSHPMED
                     AFVLVIKSTILLSEVAQWLRNWSQRTQVPGDELAGPETESFKTVVRHIEDFISTIPNA
                     LKNVFKLVDSANSGGLNVNLLSLHIFPNVALALMFEPFIEWKPSNQCLKATQQAYEAI
                     LGVLHLIPSNLDVTMVFTPLIACSLYTVGRIIADYVKYTMRSHQYSLAVRYRADLTTI
                     QNLLERYGQRHSLGSAMSHFLENYVQYLGNECMDPAAMCSKLERQLAYPTNNGTYVMG
                     AANDGYAHLNDPGSSCSGPNDPPSTKSFSDSWSASGPSPSVSTPAISKTNEPSPAQVY
                     STAEGKSQDPISNWDWGREAIKMMGVDASRSVSGLAALDGMPMYMGERSSLNMDGRLP
                     VGPFSDVAEIGGFEGLHWKTGNSDTI"
     gene            complement(314875..316724)
                     /locus_tag="CNM01050"
                     /db_xref="GeneID:3255220"
     mRNA            complement(join(314875..315314,315438..315559,
                     315623..315897,315966..316110,316189..316282,
                     316360..316522,316614..316724))
                     /locus_tag="CNM01050"
                     /product="Glucosamine-6-phosphate isomerase, putative"
                     /transcript_id="XM_568410.1"
                     /db_xref="GI:58261999"
                     /db_xref="GeneID:3255220"
     CDS             complement(join(315139..315314,315438..315559,
                     315623..315897,315966..316110,316189..316282,
                     316360..316522,316614..316658))
                     /locus_tag="CNM01050"
                     /EC_number="3.5.99.6"
                     /codon_start=1
                     /product="Glucosamine-6-phosphate isomerase"
                     /protein_id="XP_568410.1"
                     /db_xref="GI:58262000"
                     /db_xref="GeneID:3255220"
                     /translation="MRLTVRDTKEQVGNYVGDYIANRVNSFVPTPEHKNFVLGLPTGS
                     SPLPVYRRLVELYNEKKVSFKDVVTFNMDEYVGIPRDHSESYHTFMFKNFFSLIDINP
                     NNTHILNGEAEDLYKECEDYEASIKAVGGIDLFLGGIGADGHIAFNEPGSSLTSRTRI
                     KTLAYETILDNCRFFNNDLSLVPRMALTVGVQTVMDAREVVLVVTGQNKSLALSQMIE
                     GAVNHMVTASALQTHPWALVVCDEDATLELRVKTVKYFKSIEKVQDEVEAKYGPVASV
                     RLGLRAMEQIVVTTYIINSYTPKCTYIYVQGPLSKDYSKKRGKGKTKTRDIILFYTPQ
                     PKHSF"
     gene            317030..318344
                     /locus_tag="CNM01060"
                     /db_xref="GeneID:3255224"
     mRNA            join(317030..317332,317373..318344)
                     /locus_tag="CNM01060"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542719|gb|CF688560.1,gi|41542726|gb|CF688567.1"
                     /transcript_id="XM_568450.1"
                     /db_xref="GI:58262079"
                     /db_xref="GeneID:3255224"
     CDS             317580..318176
                     /locus_tag="CNM01060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568450.1"
                     /db_xref="GI:58262080"
                     /db_xref="GeneID:3255224"
                     /translation="MSFFQPTPAVNGPTSTHQANRPPSPLPNEQFYFLCNPPDFHNCT
                     HPSQRHHRPHHISHSIHTPQHCQVHIPPALSQTQIYFPCSPSLPAHSPPSYTVPASPP
                     SYKPLPSSSDTTLLLAPPPPFSQATCPHASQRDTLLPIHSHSCTHCFEYQRGSLWPYG
                     SYGCTIDWAVFLLVLLNVLVWGSVIYGYWCEFTAKPIG"
     gene            complement(318373..321381)
                     /locus_tag="CNM01070"
                     /db_xref="GeneID:3255098"
     mRNA            complement(join(318373..318537,318611..320160,
                     320221..320326,320382..320467,320523..320652,
                     320710..320717,320779..321381))
                     /locus_tag="CNM01070"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542620|gb|CF688461.1,gi|41542631|gb|CF688472.1,
                     gi|41542925|gb|CF688766.1,gi|41559817|gb|CF705658.1"
                     /transcript_id="XM_568409.1"
                     /db_xref="GI:58261997"
                     /db_xref="GeneID:3255098"
     CDS             complement(join(318480..318537,318611..320160,
                     320221..320326,320382..320467,320523..320652,
                     320710..320717,320779..321186))
                     /locus_tag="CNM01070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568409.1"
                     /db_xref="GI:58261998"
                     /db_xref="GeneID:3255098"
                     /translation="MTGASSAAQVSVRNNYDEFEFEENFDREELEKAMGEAERRYGAQ
                     SESLVRRTDGMIAGQPAESPFIIRDIEDIVSDQGDDGSLISQRTITPLVYAEHAEQIE
                     SGEADDSLAPFFQFRKRGFFNVTDLAAPVWCETQYDYRLRTLPFLPLAERPDVITATS
                     GKQIVVDKRKRESGERIMNRGRKVHKQLEREIHPNEIVVDTTTREDVWGLRFLNMLSA
                     VEALLTIGKCREMPVVGFVNDILVLGIIDEIVRSPVESPKLKASKSTTPSKSPNNTSR
                     QTSLANFFTSIKHSQVVDQTSPSVDLPSTALSQQSRPRTHKLHISDSKTRAVLSVPRD
                     DDIKAGKIQVMMYKEMLDAILLAPYRSSTPSTDQQLLDDTFSILPSRASKPFAWKKLF
                     DHLSLSPTEPFSEQFFKEGRMVIEGNKLRHGATKALCLQDFVQVWEKYVEDLGLGYSK
                     ETKLKGVREKGEQWENLGKTEDRLELVYRWAGGKKKRKRREAHKRRKRDFNRESPNKQ
                     DDALEVEFQRGEAPLSRGHGHLEAEEEQRLIQLAIAESLNIDPNASSTRPYLTTPILT
                     PTYTRSAPHTTPASTSRKHKKDRDESTVHEDEEYWTSTDDEFYAHVIENGLGEDRAGG
                     DRFVPGSVDVIPEGAATNNLTTTTSEVPSTSTPSNPEFSLSQSSLASSTPSKKPSDVH
                     TSQLSGLISQERIKTKAKRKDDLVAGSIIGRSAFSHSPKFLTDHLESVLQFWMGERPP
                     KGVEIHEAKRCAYCEFEDGCEWRLMKVEEHRRQIQEKKNKL"
     gene            complement(321554..323228)
                     /locus_tag="CNM01080"
                     /db_xref="GeneID:3255179"
     mRNA            complement(join(321554..321796,321846..322168,
                     322219..322450,322499..322727,322780..322927,
                     323182..323228))
                     /locus_tag="CNM01080"
                     /product="ATP:ADP antiporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530560|gb|CF676401.1,gi|41531013|gb|CF676854.1,
                     gi|41531031|gb|CF676872.1,gi|41531545|gb|CF677386.1,
                     gi|41531557|gb|CF677398.1,gi|41532797|gb|CF678638.1,
                     gi|41532807|gb|CF678648.1,gi|41534130|gb|CF679971.1,
                     gi|41534141|gb|CF679982.1,gi|41534283|gb|CF680124.1,
                     gi|41537243|gb|CF683084.1,gi|41538427|gb|CF684268.1,
                     gi|41538435|gb|CF684276.1,gi|41538854|gb|CF684695.1,
                     gi|41538860|gb|CF684701.1,gi|41538974|gb|CF684815.1,
                     gi|41538984|gb|CF684825.1,gi|41539096|gb|CF684937.1,
                     gi|41539250|gb|CF685091.1,gi|41539253|gb|CF685094.1,
                     gi|41539314|gb|CF685155.1,gi|41539322|gb|CF685163.1,
                     gi|41539487|gb|CF685328.1,gi|41539497|gb|CF685338.1,
                     gi|41539786|gb|CF685627.1,gi|41539796|gb|CF685637.1,
                     gi|41539801|gb|CF685642.1,gi|41539812|gb|CF685653.1,
                     gi|41539869|gb|CF685710.1,gi|41539880|gb|CF685721.1,
                     gi|41540175|gb|CF686016.1,gi|41540184|gb|CF686025.1,
                     gi|41540561|gb|CF686402.1,gi|41540563|gb|CF686404.1,
                     gi|41541571|gb|CF687412.1,gi|41541583|gb|CF687424.1,
                     gi|41541690|gb|CF687531.1,gi|41542114|gb|CF687955.1,
                     gi|415"
                     /transcript_id="XM_568302.1"
                     /db_xref="GI:58261783"
                     /db_xref="GeneID:3255179"
     CDS             complement(join(321782..321796,321846..322168,
                     322219..322450,322499..322727,322780..322922))
                     /locus_tag="CNM01080"
                     /codon_start=1
                     /product="ATP:ADP antiporter"
                     /protein_id="XP_568302.1"
                     /db_xref="GI:58261784"
                     /db_xref="GeneID:3255179"
                     /translation="MSEVARKPKDAKAFLTDFLMGGVSAAVSKTAAAPIERIKLLVQN
                     QDEMIKQGRLATPYKGVGDCFARTYKDEGLASLWRGNTANVIRYFPTQALNFAFKDYF
                     KSMFGFKKSEGYWKWFAGNIASGGAAGASSLLFVYSLDYARTRLANDNKSAKKGGSRQ
                     FNGLVDVYKKTLASDGIAGLYRGFVPSVVGIIVYRGLYFGLYDSIKPVILVGPLEGNF
                     LASFLLGWTVTTSAGLASYPLDTIRRRMMMTSGGTVHYKSMFDAGSQIVAKEGMKSLF
                     KGAGANILRGVAGAGVLSLYDKAQELMFGKVYSGGSG"
     gene            complement(323626..325302)
                     /locus_tag="CNM01090"
                     /db_xref="GeneID:3255047"
     mRNA            complement(join(323626..323918,323970..324292,
                     324341..324572,324626..324854,324911..325091,
                     325141..325302))
                     /locus_tag="CNM01090"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41566598|gb|CF712439.1,gi|41566606|gb|CF712447.1"
                     /transcript_id="XM_568408.1"
                     /db_xref="GI:58261995"
                     /db_xref="GeneID:3255047"
     CDS             complement(join(323904..323918,323970..324292,
                     324341..324572,324626..324854,324911..325071))
                     /locus_tag="CNM01090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568408.1"
                     /db_xref="GI:58261996"
                     /db_xref="GeneID:3255047"
                     /translation="MSKVQESTVKKPTDTDVSGFLTNFLMGGVSAAISKTAAAPIERV
                     KLLIQNQDEMIKQGRLSTPYKGVINTFARTYKDEGLVSLWRGNTANVIRYFPTQALNF
                     AFKDYFKTLFGFKRSEGYWKWFAGNIASGAAAGASSLIFVYSLDYARTRLANDNKSAG
                     KGGTRQFNGLLDVYKKTLASDGIIGLYRGFVPSVAGIVVYRGLYFGLYDSVKPVVLVG
                     VLEGNFLASFLLGWTVTTAAGFVSYPLDTIRRRMMMTSGGTVHYKSMFDAASQIVAKE
                     GSRSLFKGAGANILRGVASAGVLSLYDKAQELMFGKVYSSGSG"
     gene            complement(326622..329724)
                     /locus_tag="CNM01100"
                     /db_xref="GeneID:3255094"
     mRNA            complement(join(326622..327058,327116..327220,
                     327292..328697,328744..328860,328909..329344,
                     329393..329404,329627..329724))
                     /locus_tag="CNM01100"
                     /product="RNA binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537844|gb|CF683685.1,gi|41542574|gb|CF688415.1,
                     gi|41543763|gb|CF689604.1,gi|41543775|gb|CF689616.1,
                     gi|41554565|gb|CF700406.1,gi|41563860|gb|CF709701.1,
                     gi|41563867|gb|CF709708.1,gi|41567591|gb|CF713432.1,
                     gi|41567597|gb|CF713438.1"
                     /transcript_id="XM_568300.1"
                     /db_xref="GI:58261779"
                     /db_xref="GeneID:3255094"
     CDS             complement(join(326963..327058,327116..327220,
                     327292..328697,328744..328860,328909..329251))
                     /locus_tag="CNM01100"
                     /codon_start=1
                     /product="RNA binding protein"
                     /protein_id="XP_568300.1"
                     /db_xref="GI:58261780"
                     /db_xref="GeneID:3255094"
                     /translation="MASHTLRPHRSPSPSPEPPVNLANPAKLTRQSLGPPTSGNSKGF
                     GSLGLGPGLASPSSSSQPRHVSSSVAMGMGNRDSLSPRPSGVGSGRAVSATTGPRPSS
                     EFIPTREAKTPEAEQIDQWFKHLANWEATLEEMAAASTDQNFTEELGAIEQWFRVLSE
                     AERTAALYSLLQYSTPVQIRFFISVLHHMSQSDPMSALLSPSLSGNNSFQTQVESKLS
                     NMNLKSPSAGGGAGFTGSSGNGHYLAPDDAATKAAKARQNRISAPGTLQPHDRWQGQL
                     DQVIERGTSPGLESNISGRSRSKSPTPEPRPKSTDFSGKPRESLHRDSTAFPRSPRVS
                     AGSPGIGLGIGHESPMASPFGNNASWASMVNTPLVQNFNDGKLTAPASVADLSQALNM
                     ATLQLNNPGYLPLDDARKYRRPTGGYSSGQTSRNVSGQYNDDGEIVNPHTTQPGTPSG
                     LLPNQFGTAGRSPLVDQFGLGGLGIGADPATLANLGLNYNLAGLGGVNPGLNGLTAAQ
                     AQAAQMLAMQQQLQNSQYSPFNVSASSLQPGLNPSRRGASRDQSSHLNQHHNQHQQQH
                     QLGRRSPNPMKSHSPAPGQQTGGGGAGGGAGVAGPEDVDVRILEDVPNWLRVLRLHKY
                     TPNFEKSNWNDMVLMTDQDLQDNGISAQGARTKFLKVFYNVRTKMDIAHPPGQEEYAP
                     GPKESK"
     gene            complement(330541..>333086)
                     /locus_tag="CNM01110"
                     /db_xref="GeneID:3255081"
     mRNA            complement(join(330541..331594,331652..331736,
                     331787..332236,332286..332497,332562..>333086))
                     /locus_tag="CNM01110"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530114|gb|CF675955.1,gi|41545991|gb|CF691832.1,
                     gi|41546005|gb|CF691846.1,gi|41574292|gb|CF720133.1,
                     gi|41574301|gb|CF720142.1,gi|41576105|gb|CF721946.1"
                     /transcript_id="XM_568407.1"
                     /db_xref="GI:58261993"
                     /db_xref="GeneID:3255081"
     CDS             complement(join(330869..331594,331652..331736,
                     331787..332236,332286..332497,332562..333086))
                     /locus_tag="CNM01110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568407.1"
                     /db_xref="GI:58261994"
                     /db_xref="GeneID:3255081"
                     /translation="MVLLSQIPFSFTLALFSILSIFSHTVLADEVTLYTDTTPTATSS
                     LAASETYTGLAAYDPTRLTPPAPPSPAVTSLSLTIPSDGAGVASEGLSLSIPQKGNFL
                     GFSIELSVATSLLGSSSGNLKVPFLNFMANIQNRAGAGPIIRVGGNSQEGSTIFVDGL
                     EGGVAMEKIKVSSGVTDTPLINYSPELFYIMSNITSLVGAEWYFGLAFNESDVDSPTG
                     NIPIAAHWAQEILGDSLLGLSVGNEPDLYVNHNHRSTGWGVSDFVTEYDDVVKSIVSN
                     GSLLNNNAFLGPSLCCNVPGFEFSDLINAGWLDENVDRLSAVTVQHYPTNNCKVNGKV
                     IEAQDIFSDFLNHTSAQALVGEYLADSVLVQNAGKELVMLETNTASCGGFAGLSDSFG
                     AAMWMTDFALQMAYANFSAALMHVGGQNVYYNPFTPPPSNLSSTRQWTPGSVYYPTLV
                     IAEAFGKSNASQVVDLTPLPEYDANNIYHPIYAIYENDAVARMVLFNFIDDSTGGSDL
                     DVTIDIQNQSPTQVQVRYFRAASVSEQYDIYWANQTLGQSFASDGRLYGDLETITITC
                     DGGACIVPVPAPSVALVYLTDEALEESSVSEDATSTYPTSIIGSGSATVDVGTLSTSN
                     GKEGSGGGSTSKGGAKTSAGKRVEWMGGLLGLGLLLGAINI"
     misc_feature    333648..333672
                     /note="AT_rich"
     misc_feature    334406..334472
                     /note="AT_rich"
     misc_feature    334514..334545
                     /note="AT_rich"
     gene            338877..340500
                     /locus_tag="CNM01120"
                     /db_xref="GeneID:3255191"
     mRNA            join(338877..338980,339029..339073,339135..339251,
                     339304..339449,339502..339900,339953..340136,
                     340186..340500)
                     /locus_tag="CNM01120"
                     /product="chaperone regulator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538198|gb|CF684039.1,gi|41538204|gb|CF684045.1,
                     gi|41548100|gb|CF693941.1,gi|41556613|gb|CF702454.1,
                     gi|41556618|gb|CF702459.1,gi|41561762|gb|CF707603.1"
                     /transcript_id="XM_568298.1"
                     /db_xref="GI:58261775"
                     /db_xref="GeneID:3255191"
     CDS             join(338954..338980,339029..339073,339135..339251,
                     339304..339449,339502..339900,339953..340136,
                     340186..340353)
                     /locus_tag="CNM01120"
                     /codon_start=1
                     /product="chaperone regulator"
                     /protein_id="XP_568298.1"
                     /db_xref="GI:58261776"
                     /db_xref="GeneID:3255191"
                     /translation="MVNNTEYYKTLGLSKDASEADIRKAYRKESLKWHPDKNPGDKHA
                     AAEEKFKKISEAYEVLSDPKKKEIYDQFGEDGLKGGGAAGGGGFGGFPGGGGGGYSSF
                     HATDPNDIFNTFFSSMGGGGGGAENIFTSFGGGGSSRGGPRMRSSRMGGGMGGMGGMG
                     GMPGGFGDEPSSSAPPPPGEIIKPLALTLEELYKGGTKRLKITRHLQSGGQAEKILEV
                     AYKAGWKKGTKIKFAGAGNEDEYGQSQTVAFVVEEKPHNRFERVDDDLVVKLNITLSQ
                     ALLGPDGGGAITKEVEQLDGRRIQVSLPEGQIVQPGQETRIQGEGMPVSKASSVKKSG
                     DLVVKWNVVFPTRLTPEQKKDLRRILG"
     gene            complement(340482..342320)
                     /locus_tag="CNM01130"
                     /db_xref="GeneID:3255131"
     mRNA            complement(join(340482..340669,340724..340799,
                     340853..340998,341049..341170,341229..341306,
                     341359..341506,341569..341681,341732..341765,
                     341817..341887,341946..342019,342109..342320))
                     /locus_tag="CNM01130"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543221|gb|CF689062.1,gi|41543234|gb|CF689075.1"
                     /transcript_id="XM_568406.1"
                     /db_xref="GI:58261991"
                     /db_xref="GeneID:3255131"
     CDS             complement(join(340627..340669,340724..340799,
                     340853..340998,341049..341170,341229..341306,
                     341359..341506,341569..341681,341732..341765,
                     341817..341887,341946..342019,342109..342220))
                     /locus_tag="CNM01130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568406.1"
                     /db_xref="GI:58261992"
                     /db_xref="GeneID:3255131"
                     /translation="MAPAPTQTHAPDSQGYNSDAAAQAQAAEMSVILCTAGYDHTIRF
                     WEAWSGICYRQITLSPQWKQVNRLAISPNKAYVAAAGNGTVRIWDIQSLSNTPIATLE
                     GHTGNVVALAYSALGKWIVTGSEDGTVKVWDTRTAQTQRIYLHDCPVNDVVIHPNQGE
                     LISCDQSGSVKIWDLAENTCTHELVPDEDVPIRSVSISSDGNTLVAANDGGMVYVWRI
                     IPVPNANANLVPVTSFRAHTKYITRCLLSPDTKYLATCSADHTVKIWSTAGIDYTLEK
                     TLTGHQRWVWDAAFSADSAYLVTASSDHAARLWDLSLGETVRQYDGHHRAAVCCALND
                     INLA"
     gene            344591..346314
                     /locus_tag="CNM01150"
                     /db_xref="GeneID:3255291"
     mRNA            join(344591..344741,344803..345081,345133..345297,
                     345352..345981,346037..346314)
                     /locus_tag="CNM01150"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531832|gb|CF677673.1,gi|41532507|gb|CF678348.1,
                     gi|41532522|gb|CF678363.1,gi|41534095|gb|CF679936.1,
                     gi|41534102|gb|CF679943.1,gi|41536767|gb|CF682608.1,
                     gi|41536777|gb|CF682618.1,gi|41545187|gb|CF691028.1,
                     gi|41545193|gb|CF691034.1,gi|41557885|gb|CF703726.1,
                     gi|41557889|gb|CF703730.1,gi|41561625|gb|CF707466.1,
                     gi|41561628|gb|CF707469.1,gi|41570152|gb|CF715993.1,
                     gi|41570161|gb|CF716002.1,gi|41570706|gb|CF716547.1,
                     gi|41570717|gb|CF716558.1,gi|41570753|gb|CF716594.1,
                     gi|41570765|gb|CF716606.1,gi|41571853|gb|CF717694.1,
                     gi|41571862|gb|CF717703.1"
                     /transcript_id="XM_568404.1"
                     /db_xref="GI:58261987"
                     /db_xref="GeneID:3255291"
     gene            complement(<344591..>346192)
                     /locus_tag="CNM01140"
                     /pseudo
                     /db_xref="GeneID:3255147"
     mRNA            join(344605..344741,344857..345081,345133..345297,
                     345352..345981,346037..346314)
                     /locus_tag="CNM01150"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531832|gb|CF677673.1,gi|41532507|gb|CF678348.1,
                     gi|41534095|gb|CF679936.1,gi|41536767|gb|CF682608.1,
                     gi|41545187|gb|CF691028.1,gi|41557885|gb|CF703726.1,
                     gi|41561625|gb|CF707466.1,gi|41567619|gb|CF713460.1,
                     gi|41570152|gb|CF715993.1,gi|41570706|gb|CF716547.1,
                     gi|41570753|gb|CF716594.1,gi|41571853|gb|CF717694.1"
                     /transcript_id="XM_568405.1"
                     /db_xref="GI:58261989"
                     /db_xref="GeneID:3255291"
     CDS             join(344636..344741,344803..345081,345133..345297,
                     345352..345981,346037..346191)
                     /locus_tag="CNM01150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568404.1"
                     /db_xref="GI:58261988"
                     /db_xref="GeneID:3255291"
                     /translation="MVDLGAPIGSHHSSNIPASEQTGFNSGVGGEHASSGIPKGTPIA
                     DQFMGGHPSGATGTTAGVGSKLDNSLDHYSGSGATGATSTGHHSSGLGSGAGVGAGAS
                     TLGSSGKEAVSGQYAGSGTKDALTGQTGHTTGAGVGPYGDNLSSSTGAQHSSTTGSAA
                     RAGQSAVGGAYVGGAAQDGLTGKSKASTVGEGVGPYGENLPHGTSSTTTTGHHGARDA
                     ALASTAGGAFAGDKYAHSKDKSLGTDPTSTGVSGTTSGTGVGPSGGAGGHYGKGAAAA
                     GGAGVGAIGGAGVAAGLAGRDGTSHSAGTTTTAGQHGSALGAGEGGISGTPIGPGAGD
                     GLTGAGISTGVAGVGSGYGSGAGSGAGAGTGGAGAGSELGAGGAGAGKHGRAQPDEDR
                     GAPLSDPSDIDTGGPHSLVYQESTGKYVHRRELEGDVGKAESNVKNTAERRI"
     CDS             join(344636..344741,344857..345081,345133..345297,
                     345352..345981,346037..346191)
                     /locus_tag="CNM01150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568405.1"
                     /db_xref="GI:58261990"
                     /db_xref="GeneID:3255291"
                     /translation="MVDLGAPIGSHHSSNIPASEQTGFNSGVGGEHASSGATGTTAGV
                     GSKLDNSLDHYSGSGATGATSTGHHSSGLGSGAGVGAGASTLGSSGKEAVSGQYAGSG
                     TKDALTGQTGHTTGAGVGPYGDNLSSSTGAQHSSTTGSAARAGQSAVGGAYVGGAAQD
                     GLTGKSKASTVGEGVGPYGENLPHGTSSTTTTGHHGARDAALASTAGGAFAGDKYAHS
                     KDKSLGTDPTSTGVSGTTSGTGVGPSGGAGGHYGKGAAAAGGAGVGAIGGAGVAAGLA
                     GRDGTSHSAGTTTTAGQHGSALGAGEGGISGTPIGPGAGDGLTGAGISTGVAGVGSGY
                     GSGAGSGAGAGTGGAGAGSELGAGGAGAGKHGRAQPDEDRGAPLSDPSDIDTGGPHSL
                     VYQESTGKYVHRRELEGDVGKAESNVKNTAERRI"
     gene            complement(346327..>352037)
                     /locus_tag="CNM01160"
                     /db_xref="GeneID:3255078"
     mRNA            complement(join(346327..346958,347018..347135,
                     347189..347293,347346..347621,347943..348472,
                     348705..349028,349077..349165,349223..349634,
                     349687..349992,350042..350407,350457..>352037))
                     /locus_tag="CNM01160"
                     /product="signal transducer, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41541071|gb|CF686912.1"
                     /transcript_id="XM_568463.1"
                     /db_xref="GI:58262105"
                     /db_xref="GeneID:3255078"
     CDS             complement(join(346485..346958,347018..347135,
                     347189..347293,347346..347621,347943..348472,
                     348705..349028,349077..349165,349223..349634,
                     349687..349992,350042..350407,350457..352037))
                     /locus_tag="CNM01160"
                     /codon_start=1
                     /product="signal transducer"
                     /protein_id="XP_568463.1"
                     /db_xref="GI:58262106"
                     /db_xref="GeneID:3255078"
                     /translation="MTSATYQPSPQYGDSLESPGALKVNGGLGVPSNGWPGYLQPEAR
                     TGRDRSASAVTMKAGDGHDGAVTPRGDERYDKDTLFGSVVEDERLGESQKQYSNTSYA
                     TGNNVPLSTSETVSSADQGSPGPPHRQNSSTSSLHPRSISHNTGRTSFDLSPSWAHQA
                     QTPSHWVERKLQIHQSHRHPSLVDSFEDEQGPSGWEEEEWEEEEDEEIDVDEGQFFQP
                     AFLSEMALQLRDKVERQRHIKAGIAWVGSFTGRDIVTTIHNLLPPHTREKPNDRRFAL
                     LLAQSLQNQLWFVEVDWDIKPLRDSSDDVFRFMGEMEGMASGADALTTELPKGLMTMA
                     TRCYSPSCTGDKRCYSPRCPYKTSPGTFLPTKESIIPLPTPVSIRHDDWKEDIDPLML
                     RDLSPRAITRQDVIRQALSSELAYEADLSIMEDLFITHLRLADPPIIPDPIHREEFIH
                     EVFHNALELRAASKRLIEEFTIRQREQPLIQFVGDLFLQAATEFRNIYPEYTGSLPQA
                     EAALSKELEENTEFRLYTERVVRENDRRRDIRHLVTRPSAQLQRYPALLEGILNVTDP
                     DDPDREFLSQALQSIQFISSLSQLKLFHASKGRGPASKLEWFDLVSEEDRKAIPKKEQ
                     KRQMLIWELIQGEIQYVADLEVLGTVFAEGLRMAEPAVIDRNRLDVFLDEAFHNWRSL
                     YEIHSRFLHNLQIRQLEQHPHIGMISDLVFDAALNWQEAYMEYVPHYPIAKLKVHEEE
                     ASNTKFASFLKACLRDPMTNKQDIDHFMSRPIFRLLRYPLLLDPIRDCLKETAGPDDP
                     DYEQIPQVMEVIASLGKAIQKGVISNESKVELWALQRTLDGSKISPRTVADLDLANPM
                     RELIHRGTVYRQSEGSIGSGWTELNAFLFDNFLVLAKLERPTKPSKSSRKEHRKEKYA
                     INRPPIPLELLSLGSFSEAPRVRNTGRLFGVGGASHYDVSSDRSMNAPKTPGSSKSAD
                     TSKLYPFSISFIGGQGQLGGSYTLWADSYKARQDWREKFEHAKVLRAEINDAGKRRLI
                     AVGCQDGVWIGIRGDSRSLRKVLHVKSVTSIAVLEEFSIFLVLSDKSLVAYQLEALVP
                     SAGQKPVKATTERISMPKEEISSFTVGRLDGRTLVVLMRAETTQTVFKILEPVLNKNT
                     EDTTRQRRPFGFLGKTSEWFRPYKMFYLPAEVYGVHFLKHKLAIVCSKGFEIMDLTEY
                     GEPNRDCRPIEWQGRHDSVAFHPPFLLLISAPFIEIRHIDTGKLLQIYTGSDLRLTWE
                     QVVAIAFREYKLMSLDSGSGGQKNPPVLNPGKHGYGDETKIQEPQIHICQRTTDHKQG
                     RGQPAIGQVVYELSPTLLLNNPLLNPLNTLDPNYLPPLPLTSHANPAIRQARPPSIRT
                     TNSSDQFPHPNLYQTSNPSQGYIPFPNAQGYSAQPPMLQRDSYGTRYSRDSSSYRDSN
                     SVYNMTPIDPSPQSSTGAFPIQPQNQPAGYPPQGTIGGLGYSQYPEPQPPVVHGQSQG
                     QDQGYGGYNDHAIRAWAQNGGYGRNDAYGGYE"
     gene            353125..357111
                     /locus_tag="CNM01170"
                     /db_xref="GeneID:3255144"
     mRNA            join(353125..353449,353690..354515,354563..356245,
                     356290..356812,356868..357111)
                     /locus_tag="CNM01170"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530844|gb|CF676685.1,gi|41550220|gb|CF696061.1"
                     /transcript_id="XM_568429.1"
                     /db_xref="GI:58262037"
                     /db_xref="GeneID:3255144"
     CDS             join(353161..353449,353690..354515,354563..356245,
                     356290..356812,356868..357014)
                     /locus_tag="CNM01170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568429.1"
                     /db_xref="GI:58262038"
                     /db_xref="GeneID:3255144"
                     /translation="MLRSLPRARAALPLRSRPLAPFSRSPLLSRNYAVAAPAVGSYAQ
                     VDGEPTLNSPSELARKISAKVLPKLEKPDVKKVLVVGSGGLSIGQAGEFDYSGSQAIK
                     ALRESNIETILINPNIATIQTSHHLASEIYFLPVTADYVAYVLEKERPDGILLTFGGQ
                     SALNVGIQLDKMGVLERLGVKVLGTPIRTLEVSEDRDLFVQALNEIEIPAAQSTAVST
                     IQAALDAAKEIGYPIILRSAFSLGGLGSGFAHDEEELRNLAAKSLSLSPQVLIEKSLK
                     GWKEVEYEVVRDAADNTIICCNMENFDPLGTHTGDSIVVAPSQTLTDDEYHMLRSAAI
                     KIVRHVGVVGECNVQYALDPVSRDYRVIEMNARLSRSSALASKATGYPLAYTAAKIAL
                     GHTLPELPNAVTKTTTACFEPSLDYIVTKIPKWDLAKFQHVERNVGSAMKSVGEVMAI
                     GRTFEESLQKAIRQVDPNFTGFDAYWKPEDMTAALTHNNDRRLFAIAHAMLNLDYTVD
                     HLHDLTKIDKWFLYKLENIVNVYKTLQSTPFDKIDRELFLTAKKTGFSDLHISQLVGA
                     KEGEVRAARKAAGVTPFVKRIDTLAAEFPAYTNYLYTTYNASTHDLEFNENGTMVLGS
                     GVYRIGSSVEFDWCAVTCSRAIRSMGKKTIMINYNPETVSTDFDEADRLYFEELGWER
                     VMDIYELEGADGVVVSVGGQLPQNIALRLKKTGVNVLGTDPEQIDNAEDRHKFSSILD
                     SIGVDQPAWTEATSLQAAKEFANKVNYPVLIRPSYVLSGAAMNVVWDERQLEEKLTAA
                     ADVSPLHPVVVSQFIDNAQEIDIDAVAHEGKLLVHAVSEHVENAGVHSGDATLVLPPF
                     SLKERDMDRLREIAEKVAKAFNISGPYNMQIIRKPEEEGKEAELKVIECNLRASRSFP
                     FVSKVLGKNFIDVAAAAIMGENIPEPVDLMKEQRDYVAIKVPQFSWTRLPGADPFLGV
                     EMASTGEVASFGKDIHEAYWAALLSVNGFKLPKANSGILLGGDISRVELPEIASNLIS
                     LGFKLYTYDANVEEFINKQPYLAIKKILVPVKDKRKLREVLEENEISCVINVSRSRAA
                     TTADADYASRRAAVDFGIPLINNAKLAVLFTETLQQKFKNSPLPYVEGQQPSEVKSWR
                     EFVGEERAY"
     gene            357474..359195
                     /locus_tag="CNM01180"
                     /db_xref="GeneID:3255151"
     mRNA            join(357474..357521,357625..357716,357806..358264,
                     358318..358595,358648..359195)
                     /locus_tag="CNM01180"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532015|gb|CF677856.1,gi|41532025|gb|CF677866.1,
                     gi|41532261|gb|CF678102.1,gi|41532270|gb|CF678111.1,
                     gi|41532413|gb|CF678254.1,gi|41532418|gb|CF678259.1,
                     gi|41536370|gb|CF682211.1,gi|41536381|gb|CF682222.1,
                     gi|41536444|gb|CF682285.1,gi|41536450|gb|CF682291.1,
                     gi|41538445|gb|CF684286.1,gi|41538448|gb|CF684289.1,
                     gi|41545928|gb|CF691769.1,gi|41545934|gb|CF691775.1,
                     gi|41549910|gb|CF695751.1,gi|41549922|gb|CF695763.1,
                     gi|41549964|gb|CF695805.1,gi|41549970|gb|CF695811.1,
                     gi|41550406|gb|CF696247.1,gi|41550414|gb|CF696255.1,
                     gi|41550833|gb|CF696674.1,gi|41550842|gb|CF696683.1,
                     gi|41553618|gb|CF699459.1,gi|41553622|gb|CF699463.1,
                     gi|41555040|gb|CF700881.1,gi|41555052|gb|CF700893.1,
                     gi|41556232|gb|CF702073.1,gi|41556650|gb|CF702491.1,
                     gi|41556656|gb|CF702497.1,gi|41559286|gb|CF705127.1,
                     gi|41559295|gb|CF705136.1,gi|41560547|gb|CF706388.1,
                     gi|41560558|gb|CF706399.1,gi|41561707|gb|CF707548.1,
                     gi|41561721|gb|CF707562.1,gi|41563740|gb|CF709581.1,
                     gi|41563747|gb|CF709588.1,gi|41565714|gb|CF711555.1,
                     gi|415"
                     /transcript_id="XM_568431.1"
                     /db_xref="GI:58262041"
                     /db_xref="GeneID:3255151"
     CDS             join(357677..357716,357806..358264,358318..358595,
                     358648..358920)
                     /locus_tag="CNM01180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568431.1"
                     /db_xref="GI:58262042"
                     /db_xref="GeneID:3255151"
                     /translation="MSVVSKNLFDLLGDDESPAPAAPKAAPKKSEATPAQRTVPGAAP
                     RGNANRGRGNNNRGAHTVTRDDRVADNEGTETAGGFDGERVPASKKGNHTRDAHTKGP
                     RGSRPAKTSGGHTSAGNGHYRGAKVPAQAGERRQFERRNANGTTDSQKKVEHGWGANS
                     GEAELKDEVEGEKDAKVEENAPQTPAEAVAAETEAPAAEAEAEQEPEEVTKSYEEYLA
                     ERAQQNAAIAALGKKQAREVASEVEGKAFVREAIDDFFSGKSKSTEAKNKPKKEKVYI
                     EVDGQFAQPSRPPRRDREGGERSGERSGERSGRGRGQRGGFGGQRGNNRGGARASRPA
                     PINANDTKAFPALGA"
     gene            359386..361143
                     /locus_tag="CNM01190"
                     /db_xref="GeneID:3255052"
     mRNA            join(359386..359654,359971..360072,360129..360168,
                     360219..360235,360291..360367,360421..360754,
                     360816..361143)
                     /locus_tag="CNM01190"
                     /product="GTPase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531949|gb|CF677790.1,gi|41531957|gb|CF677798.1,
                     gi|41572511|gb|CF718352.1"
                     /transcript_id="XM_568296.1"
                     /db_xref="GI:58261771"
                     /db_xref="GeneID:3255052"
     mRNA            join(359428..360072,360129..360168,360219..360235,
                     360291..360367,360421..360754,360816..361143)
                     /locus_tag="CNM01190"
                     /product="GTPase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531949|gb|CF677790.1,gi|41572511|gb|CF718352.1,
                     gi|41572519|gb|CF718360.1"
                     /transcript_id="XM_568297.1"
                     /db_xref="GI:58261773"
                     /db_xref="GeneID:3255052"
     CDS             join(359603..359654,359971..360072,360129..360168,
                     360219..360235,360291..360367,360421..360754,
                     360816..360952)
                     /locus_tag="CNM01190"
                     /codon_start=1
                     /product="GTPase"
                     /protein_id="XP_568296.1"
                     /db_xref="GI:58261772"
                     /db_xref="GeneID:3255052"
                     /translation="MAEEAPVKAVQVKLVLLGEAAVGKSSLVLRFTSGDFDENTSPTI
                     GAAFLTQKCRLENRIVKFEIWDTAGQERFHSLAPMYYRNAQAAVVVYDVTKSASLEKA
                     KAWVKELQRQANANIVIALVGNKLDLVSAAPSTSASSSSETPAEGEGEADAEAEEESS
                     PAAAADDEDVRQVPTAEAEAYAKEAGLLFFEASAKAGTNVNELFTEIAKTIPFDTIIP
                     KPAGVAQQNRRDAAQDGNRVNLGEGQQVKKGGCC"
     CDS             join(360314..360367,360421..360754,360816..360952)
                     /locus_tag="CNM01190"
                     /codon_start=1
                     /product="GTPase"
                     /protein_id="XP_568297.1"
                     /db_xref="GI:58261774"
                     /db_xref="GeneID:3255052"
                     /translation="MYYRNAQAAVVVYDVTKSASLEKAKAWVKELQRQANANIVIALV
                     GNKLDLVSAAPSTSASSSSETPAEGEGEADAEAEEESSPAAAADDEDVRQVPTAEAEA
                     YAKEAGLLFFEASAKAGTNVNELFTEIAKTIPFDTIIPKPAGVAQQNRRDAAQDGNRV
                     NLGEGQQVKKGGCC"
     gene            <361724..>363931
                     /locus_tag="CNM01200"
                     /db_xref="GeneID:3255299"
     mRNA            join(<361724..361811,361864..361968,362096..362208,
                     362264..362387,362445..362509,362579..362891,
                     362956..363112,363199..363333,363425..363514,
                     363584..363638,363767..>363931)
                     /locus_tag="CNM01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_568295.1"
                     /db_xref="GI:58261769"
                     /db_xref="GeneID:3255299"
     CDS             join(361724..361811,361864..361968,362096..362208,
                     362264..362387,362445..362509,362579..362891,
                     362956..363112,363199..363333,363425..363514,
                     363584..363638,363767..363931)
                     /locus_tag="CNM01200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568295.1"
                     /db_xref="GI:58261770"
                     /db_xref="GeneID:3255299"
                     /translation="MATDLKTLFNLMVFLGVGVGVNALTHYPPANTSNTRLDQVLNGS
                     GAPGIYDSSTTPDSKYGEYNCKLMTWTVQMPHVRKQEYKTPSKEYELEYVEVIQRHHK
                     RTPYASNTFFKEDISVSETCALRRKHILTSILIPQWDCSKEGPYHYAKDANGLNTAPV
                     YWQAQANTRNPFEYTVGPGFLNSTCQFPSITSEGLDDAYIHGKDLRGVYHDKLKFLPN
                     KGEKDKYKFRVTNNVITSQTLSGLVSGLFPGGHEYDALIQSDSWDSLEPSISCALQST
                     VASAITDISSEWGVHLNRSLELRERFYNVSGIEWDNDAGWSTSWDHPYDNLSAKQCHG
                     KPLPCSLNNTAICTPQEDADAIYRLGNYEYAYNALTMGAWFIELQDHINGKIDGSNDV
                     KYFHNFAHDGSISPVLGVLQIDKKTSPSPYFIRVLLSGQPLETSTPLGTLDMVPWDEF
                     EKYLNETIPEDLVGMCAQD"
     repeat_region   363350..363398
                     /rpt_type=tandem
                     /rpt_unit_seq="atggtg"
                     /satellite="microsatellite"
     gene            <364251..365073
                     /locus_tag="CNM01210"
                     /db_xref="GeneID:3255185"
     mRNA            join(<364251..364304,364373..364455,364600..364727,
                     364784..365073)
                     /locus_tag="CNM01210"
                     /product="expressed protein"
                     /transcript_id="XM_568433.1"
                     /db_xref="GI:58262045"
                     /db_xref="GeneID:3255185"
     CDS             join(364251..364304,364373..364455,364600..364727,
                     364784..365010)
                     /locus_tag="CNM01210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568433.1"
                     /db_xref="GI:58262046"
                     /db_xref="GeneID:3255185"
                     /translation="MGEYELPKTTLTKLAKGSIPDNVKMQQDVVLALLRGSTLFISYL
                     SPAHDQAIARSGRTVTAADVIKAIIEMDFGPADALVPIMEQELAAFRNIQQRAKAAKK
                     PPGPGRGRGPRKSAASTRAGEDGDMAETEGEAAVEGEGDEEEEEQEEGEEDGLVAGEQ
                     DEA"
     misc_feature    364885..365005
                     /locus_tag="CNM01210"
                     /note="GA-rich"
     gene            complement(365050..>366365)
                     /locus_tag="CNM01220"
                     /db_xref="GeneID:3255271"
     mRNA            complement(join(365050..365317,365366..365442,
                     365549..365659,365701..365801,365851..366022,
                     366171..>366365))
                     /locus_tag="CNM01220"
                     /product="sterol metabolism-related protein, putative"
                     /transcript_id="XM_568281.1"
                     /db_xref="GI:58261741"
                     /db_xref="GeneID:3255271"
     CDS             complement(join(365062..365317,365366..365442,
                     365549..365659,365701..365801,365851..366022,
                     366171..366365))
                     /locus_tag="CNM01220"
                     /codon_start=1
                     /product="sterol metabolism-related protein"
                     /protein_id="XP_568281.1"
                     /db_xref="GI:58261742"
                     /db_xref="GeneID:3255271"
                     /translation="MSNSWYDTLTSAPALIATALGVSVAALFVSTHNNSNKTAAQVKE
                     QVKEVAHSVHAEGSTGKMAQAEDPITPSELAKHDGSDPSKPIYVAIKGKVFDVSPRSE
                     MYGPGKGYNVFAGKDGSKGLGMSSLDPTDAVADYSSLNESQMNTLNQWEAFFEKIQRG
                     GAGRAVASVMQIIDVPDCSRLQWPCIQGPCRRAFYGGQPQPAYGAPPGQYPPGGEYYT
                     STPGKPPTPARHLLTLPSPACTANTSPATAWTTTPLPRKRATAAPASAQRPRVAASAP
                     VAAAVSNAARLASVSRRWSRTVDRRAK"
     gene            <366788..>370396
                     /locus_tag="CNM01230"
                     /db_xref="GeneID:3255061"
     mRNA            join(<366788..366863,366942..367046,367160..367306,
                     367375..367435,367511..367640,367707..367943,
                     368008..368698,368752..368922,369033..369206,
                     369246..369300,369361..369715,369817..369831,
                     369899..>370396)
                     /locus_tag="CNM01230"
                     /product="expressed protein"
                     /transcript_id="XM_568280.1"
                     /db_xref="GI:58261739"
                     /db_xref="GeneID:3255061"
     CDS             join(366788..366863,366942..367046,367160..367306,
                     367375..367435,367511..367640,367707..367943,
                     368008..368698,368752..368922,369033..369206,
                     369246..369300,369361..369715,369817..369831,
                     369899..370396)
                     /locus_tag="CNM01230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568280.1"
                     /db_xref="GI:58261740"
                     /db_xref="GeneID:3255061"
                     /translation="MLSPIPILRQSAKPPSRNPRSTSRRGGVRFSNEWLQQRTKIDLF
                     LKEHTDESLTMALKIFAKVIDTLDLYAPALKGLTDVHAYACETLESIIFDQRKADQRG
                     QAAAFLYGQAMAMSTLTAEAVTLAIENLGGHTASNLALCIILGVERSSPLLFESHLPE
                     LLRQVQMAAFSSEDKSVPQEALIRALKIYSPSEKASSCQLILHATHALLVASMQLCRC
                     PPTGDVREFTDEEGRGKAEMGVFWTCFLIEHMPMTLRTDLAHRYPSTIRSLPIFTLLL
                     PLSPHLPPPCQAALCSALPLLATWDTAQFVESPLFERTVGFMSGMAMDSSESLGEGEG
                     EIDAMNGLGQLATIVLDRFEPFIQDIGHIALHALSHAKSGAKPKTQRAAQHLLARLLA
                     SQGPTTLHIMVEYLHSPHHVLLDDVELLEMIATLLPNLAKRIVQTLTDIIDALLHDGE
                     EKKKGDDDSGGKGDREYRRESVLEALNVFPLRDIDLATRAQKLVLESLEEDNGKQVVI
                     AALQLATNPIVATPCIMRNLTFKIAQLLLADALSVLSNPTLASMLDERSCSMILLALH
                     QSLEPSVQIIAAKLLAHLTTAHRAIVQPLAWKSVDPIKAVIEACIISNLLPALPPSLH
                     KKYVAPVKDLIMTGLRRPCEPHVLSLIFQGLSNLARFEGYSSLQQSQLVQDLLEMTHE
                     IPKECQHAALNAISSLLSVPKDGLDVYELLVKVHANFGGGRGKGLDNDLKALPVISRD
                     SKAAINREMLNYPSRTTHASRISEIRDRYGALHPTTINTLLAENLLMALSTSLKATDD
                     RSLVLETMSCLGILQPRAIPSLIPDLPDLIMSELKYALKSRDSARDANSTNVSAGLLF
                     LSSTMHTSGVWMERYWGDMEELMGECVKNGEALPVLRGLDLVLAAIND"
     gene            complement(<370561..>373977)
                     /locus_tag="CNM01240"
                     /db_xref="GeneID:3255059"
     mRNA            complement(join(<370561..370775,370829..370890,
                     370949..370981,371036..371093,371146..371250,
                     371301..371551,371607..371787,371842..371916,
                     371959..372084,372144..372327,372443..372482,
                     372561..372656,372723..372792,372839..372948,
                     373004..373101,373153..>373977))
                     /locus_tag="CNM01240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568466.1"
                     /db_xref="GI:58262111"
                     /db_xref="GeneID:3255059"
     CDS             complement(join(370561..370775,370829..370890,
                     370949..370981,371036..371093,371146..371250,
                     371301..371551,371607..371787,371842..371916,
                     371959..372084,372144..372327,372443..372482,
                     372561..372656,372723..372792,372839..372948,
                     373004..373101,373153..373977))
                     /locus_tag="CNM01240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568466.1"
                     /db_xref="GI:58262112"
                     /db_xref="GeneID:3255059"
                     /translation="MMETIDVHSAATPPVRRPIVDLTLENSSPAPARNAGGPKTSHSG
                     SYYYNNSSYASGSQGPVYDVYAGGNSVTLGGGGDRANRAKTGADYDLSSFGSSIPSKS
                     KKPSASAYSSYIKPATPNAFKQEKVPQPKQTFARPTHQPAFGTGGYVNGWPSWVQPGG
                     VNPGVVPDPRPAIAPPKPANQDDDVPREAFNIDSVPITAEDYMRYNGDAEKHMQELLS
                     GAIGDGEDEMGDEGMREGEDTVEGFAKGMKLMPHQVRGVRWMKQRETGRKYGGILADD
                     MGLGKTVQTLARIVEGKPTAAEKKAGYKAGTLIVAPLAVLEQWATECRTKTEPGRLKV
                     TTHHGPSRTKSGKTLEGFDVVITTFQTLASEFGVKKAPKKKATMSALFEVKWLRIVIG
                     ELRMTTIRGWVESKVSMVFDWNNVEELFSLFQFLRAKPLDDWHVFKERISSLVKDGRT
                     KLAMKRLHVVLKAIMLRRTKDAEIDGKKILNLPGRTVQVLPCAFDADERAFYDALEQK
                     TTLTFNKARQFIKSGTANANYTSVLTLLLRLRQACVHPSLVTKSLDTDVDAITDAVSK
                     SSISAAPEKDEADELADLLGGLGVAKGKTCQMCFVKLDDSSSQHCDACEKIAQRVRRQ
                     SGASENALPPTSAKIRMLLKLLSEIDEKSGNKEKTIVFSQFTSFLDLVEPFLKENNIK
                     YVRYDGSMRNDHRQVSLAKIRDDPKTRVILISFKAGSTGLNLTCCNNVILMDLWWNPA
                     LEDQAFDRAHRLGQKLDVNIWKLTIEETVEDRILILQNSKRELANAALSGQTGKGVMK
                     LTMDDIMSMFLMPSCRSDTNIQTVELFKRSSGHDEEDDEESDED"
     gene            complement(<374636..>376560)
                     /locus_tag="CNM01250"
                     /db_xref="GeneID:3255053"
     mRNA            complement(join(<374636..374872,374928..375173,
                     375230..375656,375705..375933,375998..376173,
                     376328..>376560))
                     /locus_tag="CNM01250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568464.1"
                     /db_xref="GI:58262107"
                     /db_xref="GeneID:3255053"
     CDS             complement(join(374636..374872,374928..375173,
                     375230..375656,375705..375933,375998..376173,
                     376328..376560))
                     /locus_tag="CNM01250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568464.1"
                     /db_xref="GI:58262108"
                     /db_xref="GeneID:3255053"
                     /translation="MLEPVEAEFAQPPIYTDAQEEVLRDEDVEESDVITIVASRESRP
                     ATRTNTRTDSAHSHSASTLAGEPSSHGSKEAVLKYATITASILCLVVALGSAMPTGDL
                     PGAAETLHVSDEAIYLSITLFVAGFGIGPLIFAPLSEVIGRRPIYAVSMIFYFLFTLP
                     SCLAKNIATMLAGRMIAGLASSAPFTNVGGTIADVWDTKDRGLPMAMFSSTLFMGPCL
                     GPLFGGWIAEKTHTWRWIYWVLFIFVGAAMVLCIFTPETLAPLLLRKKANKLNKKYQT
                     QLYVSEHDLNRLPFSETLKNAMVRPIILMFCEPIIILFTFYLSFVYALLYATFFAFPI
                     AFEEIRGWSMGMTGVTFISIIIGIAIANCLMPVQERLYRQHSEKYGPAPEARLYPMML
                     GALLLPVALFILAFTSYPGIIWVGPCISGILFGFSMVIIYISGNSYVVDSYANVAASA
                     ISAKNMTRSLIGASVPLWITQLFHNLGFQYGGLLLALVSVVIMPIPFYFYYKGAAVRK
                     RSKRTVQ"
     misc_feature    377190..377215
                     /note="AT_rich"
     gene            <377328..378648
                     /locus_tag="CNM01260"
                     /db_xref="GeneID:3255192"
     mRNA            join(<377328..377615,377663..377863,377920..378046,
                     378096..378181,378232..378461,378513..378648)
                     /locus_tag="CNM01260"
                     /product="cardiolipin synthase, putative"
                     /transcript_id="XM_568435.1"
                     /db_xref="GI:58262049"
                     /db_xref="GeneID:3255192"
     CDS             join(377328..377615,377663..377863,377920..378046,
                     378096..378181,378232..378461,378513..378606)
                     /locus_tag="CNM01260"
                     /codon_start=1
                     /product="cardiolipin synthase"
                     /protein_id="XP_568435.1"
                     /db_xref="GI:58262050"
                     /db_xref="GeneID:3255192"
                     /translation="MLSTTPRAFFIILDVAAHNLPFKLQTQAAHLRTKSRYAARQLST
                     LVEMKPRVLSKQSLRPASPRQLLRMENKMQGCKRYLISGKSKAVDAAAATSTHETSPE
                     TPLTKSDKEKSLTDLYESPYTIPNALTLARLLACPVLGYMIVQGDYAWATSILFASGV
                     TDWLDGWLARRYNSFSVLGSILDPAADKALMTTLVGTLAWAGLLPVPLAILIVGRDVA
                     LSISAFYFRFISLPKPRTLRRYFDFSIPSAQVTPTKISKVGHVHALFRNSRTCYEFAD
                     SVIQINTLLQLMLMGMTTISPLLSISLALPLQALQWTVAGTTIWSGLSYIGRSGVKIL
                     KQPAKGV"
     gene            <379073..380381
                     /locus_tag="CNM01270"
                     /db_xref="GeneID:3255167"
     mRNA            join(<379073..379251,379303..379317,379453..379558,
                     379614..380010,380051..380175,380225..380381)
                     /locus_tag="CNM01270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568459.1"
                     /db_xref="GI:58262097"
                     /db_xref="GeneID:3255167"
     CDS             join(379073..379251,379303..379317,379453..379558,
                     379614..380010,380051..380175,380225..380269)
                     /locus_tag="CNM01270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568459.1"
                     /db_xref="GI:58262098"
                     /db_xref="GeneID:3255167"
                     /translation="MELAASEDKVIRGAIQIIIFACFSPLLFKDTIQVISTINSIPTH
                     KCGNNELRPWRQHYHSTTRFWDEIRTAYKKESLRSHPDRLPQTATPQERRKATERFQV
                     VSDAYYVLSDPGRRAEYDALFRSRPSSAFTEDNASEYEQAQASGNFFQNFAQFFQNAS
                     ASNAAGDDTKESAGTGAGTGRRPNADNVFGDVFEEMLAPEVSHVRPWWSWVGGTSGAA
                     LGYIVANVPGAVAGELDVEVDGFVGFAGNRLGAIRDAKGRAVGEVFKDLGGAQKAEIL
                     RALAFKVLGSMG"
     gene            complement(380360..381351)
                     /locus_tag="CNM01280"
                     /db_xref="GeneID:3255085"
     mRNA            complement(join(380360..380459,380512..380650,
                     380700..381003,381071..381219,381285..381351))
                     /locus_tag="CNM01280"
                     /product="glycerol-1-phosphatase, putative"
                     /transcript_id="XM_568279.1"
                     /db_xref="GI:58261737"
                     /db_xref="GeneID:3255085"
     CDS             complement(join(380402..380459,380512..380650,
                     380700..381003,381071..381219,381285..381348))
                     /locus_tag="CNM01280"
                     /codon_start=1
                     /product="glycerol-1-phosphatase"
                     /protein_id="XP_568279.1"
                     /db_xref="GI:58261738"
                     /db_xref="GeneID:3255085"
                     /translation="MSKTTTTTTRAMLFDMDGTLLDSTPAVLATWEYFAKEYDLDLHQ
                     VLRTSHGVRTIDNMRKWCGIEDPIQLRDATETFESMIVTEAKQLQAAGKEGLIALPNV
                     LPLLNKLNASPIPVWAIVTSATTVYASAALPTAGIPETPKLITGDDVRNGKPDPEPYL
                     AGAKALDVDVKDCVVVEDAPSGIKSGVASGARVLAVCTSHTREQLENIGATWIVTDLS
                     RVTFEIEGGRVKLTIDETP"
     gene            complement(381768..385700)
                     /locus_tag="CNM01290"
                     /db_xref="GeneID:3255093"
     mRNA            complement(join(381768..382047,382102..382840,
                     382891..383508,383564..384033,384084..384628,
                     384680..385022,385084..385413,385463..385700))
                     /locus_tag="CNM01290"
                     /product="leucine-tRNA ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537646|gb|CF683487.1,gi|41537659|gb|CF683500.1,
                     gi|41544435|gb|CF690276.1,gi|41544446|gb|CF690287.1,
                     gi|41552520|gb|CF698361.1,gi|41552525|gb|CF698366.1,
                     gi|41556379|gb|CF702220.1,gi|41556385|gb|CF702226.1,
                     gi|41556445|gb|CF702286.1,gi|41556448|gb|CF702289.1,
                     gi|41561816|gb|CF707657.1"
                     /transcript_id="XM_568277.1"
                     /db_xref="GI:58261733"
                     /db_xref="GeneID:3255093"
     CDS             complement(join(381805..382047,382102..382840,
                     382891..383508,383564..384033,384084..384628,
                     384680..385022,385084..385413,385463..385519))
                     /locus_tag="CNM01290"
                     /codon_start=1
                     /product="leucine-tRNA ligase"
                     /protein_id="XP_568277.1"
                     /db_xref="GI:58261734"
                     /db_xref="GeneID:3255093"
                     /translation="MAASVNHNAPAGAVVVMEKTDKRDYLIDLEKTAQASWAEQHLFE
                     TNPPPLPEGVSSYSEFFASGKSMEEVHEKNPKWFGTFPYAYMNGSLHLGHAFTISKVE
                     FAAGFERMRGKRVLFPVGYHATGMPIKAASDKLIREMEMFGEDFARYKEDEPEEVEPA
                     AATAAPAKSLESTDPSKAKKGKLNAKSTGLTYQFQILELIGVPRDELKKFADPSHWLH
                     YFPPIAKQDLSGLGARVDWRRQFITTDANLYYDSFVRWQMNKLYKQNRVKFGKRYTIY
                     SPKDGQPCMDHDRASGEAVNPQEYTAVKMEVLEWGPTVPEGVKKAVEGRKVWMVAATL
                     RPETMYGQTNCFVGPNLKYGLFEASDNELFLVTERSARNMAFQGIFDRPKGACNKVAD
                     IIGSDLLGTKVNPPFGLVKEVYVLPMEGVLATKGTGVVTSVPSDSPDDYRTLMDLRKK
                     AEMYKIKPEWAAIDPIPVLRTPKYGDMAAEVLCTELKIQSQRDKDKLAEAKDLTYKEG
                     FYNGVMTVGDFAGTPVSEAKPKVREQMIQAGLACPYAEPESEVISRSADVCVVALVDQ
                     WYLDYGEDGWKTQAFKLLNKLNTYQNETRHAFEGVLNWLNQWACARSYGLGSKLPWDP
                     VWLIESLSDSTVYMSYYTVANLLHEDMFGKNPGPLGITPEQMTDEVWEYVLADGQLPA
                     DSPVDAEKAAQLKYHFNYFYPLDVRSSGKDLIPNHLTFWVYCHAALFPEKHWPKAVRA
                     NGHLMLNGKKMSKSTGNFLTMKEATKKYGSDAMRLTLADAGDDITDANFEETVANAAI
                     LRLHTCSSWAEEMKSTKDQLRTGEWNDFDRGFRAEMDALIKEAYGAFEQMEYKRALKA
                     GLYDFENARNWYRMVSDPVNSGSGMHRDLVFAWLRAHVLLITPFTPHYSEHIWKNVLG
                     ETSSIQTALFPEPSGPIDPTVLEQTEYLRGVVDAIRSAEAQAGKKKGKKAAAAVYDPS
                     KPKKVRMYVAKNFPEWQEKAIGVIKNQAWDGEKVDDVKLRKGLEEVGLMKDKKVMPFC
                     QAFKRKLAVTGPSAFDRTLPFDELYSLKMLAPLIKSSLRFEEIDVLSVEEAREIIEKD
                     GEKEGWAKEKIEVAEPAVPGVQFWNV"
     gene            complement(388239..390495)
                     /locus_tag="CNM01300"
                     /db_xref="GeneID:3255123"
     mRNA            complement(join(388239..388631,388683..388958,
                     389025..389227,389280..389739,389792..389922,
                     389975..390008,390387..390495))
                     /locus_tag="CNM01300"
                     /product="translation elongation factor EF1-alpha,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529884|gb|CF675725.1,gi|41529888|gb|CF675729.1,
                     gi|41530202|gb|CF676043.1,gi|41530210|gb|CF676051.1,
                     gi|41530366|gb|CF676207.1,gi|41530377|gb|CF676218.1,
                     gi|41530380|gb|CF676221.1,gi|41530391|gb|CF676232.1,
                     gi|41530399|gb|CF676240.1,gi|41530485|gb|CF676326.1,
                     gi|41530487|gb|CF676328.1,gi|41530561|gb|CF676402.1,
                     gi|41530619|gb|CF676460.1,gi|41530625|gb|CF676466.1,
                     gi|41530666|gb|CF676507.1,gi|41530672|gb|CF676513.1,
                     gi|41530712|gb|CF676553.1,gi|41530818|gb|CF676659.1,
                     gi|41530827|gb|CF676668.1,gi|41530831|gb|CF676672.1,
                     gi|41530839|gb|CF676680.1,gi|41531020|gb|CF676861.1,
                     gi|41531029|gb|CF676870.1,gi|41531279|gb|CF677120.1,
                     gi|41531282|gb|CF677123.1,gi|41531554|gb|CF677395.1,
                     gi|41531565|gb|CF677406.1,gi|41531925|gb|CF677766.1,
                     gi|41531931|gb|CF677772.1,gi|41532071|gb|CF677912.1,
                     gi|41532076|gb|CF677917.1,gi|41532175|gb|CF678016.1,
                     gi|41532185|gb|CF678026.1,gi|41532349|gb|CF678190.1,
                     gi|41532371|gb|CF678212.1,gi|41532382|gb|CF678223.1,
                     gi|41532485|gb|CF678326.1,gi|41532492|gb|CF678333.1,
                     gi|415"
                     /transcript_id="XM_568462.1"
                     /db_xref="GI:58262103"
                     /db_xref="GeneID:3255123"
     CDS             complement(join(388345..388631,388683..388958,
                     389025..389227,389280..389739,389792..389922,
                     389975..389997))
                     /locus_tag="CNM01300"
                     /note="similar to translation elongation factor EF1-alpha
                     GI:2660686 from [Cryptococcus neoformans]"
                     /codon_start=1
                     /product="translation elongation factor EF1-alpha"
                     /protein_id="XP_568462.1"
                     /db_xref="GI:58262104"
                     /db_xref="GeneID:3255123"
                     /translation="MGKDKLHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EAQELGKSSFKYAWVLDKLKAERERGITIDIALWKFETPRYQVTVIDAPGHRDFIKNM
                     ITGTSQADCAILIIATGIGEFEAGISKDGQTREHALLAFTLGVRQLIVACNKMDTCKW
                     SEDRFNEIVKETNGFIKKVGYNPKAVPFVPISGWHGDNMLEETTNMPWYKGWTKETKS
                     GVSKGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKAGMVV
                     KFAPTNVTTEVKSVEMHHEQIPEGLPGDNVGFNVKNVSIKDIRRGNVCGDSKNDPPME
                     AASFNAQVIVLNHPGQIGAGYTPVLDCHTAHIACKFAELIEKIDRRTGKVMEAAPKFV
                     KSGDAAIVKLVAQKPLCVETYADYPPLGRFAVRDMRQTVAVGVIKSVDKTEKGGKVTK
                     AAEKAAKKK"
     gene            complement(391234..392689)
                     /locus_tag="CNM01310"
                     /db_xref="GeneID:3255230"
     mRNA            complement(join(391234..392145,392194..392548,
                     392609..392689))
                     /locus_tag="CNM01310"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541588|gb|CF687429.1,gi|41541594|gb|CF687435.1,
                     gi|41549283|gb|CF695124.1,gi|41549291|gb|CF695132.1,
                     gi|41560509|gb|CF706350.1,gi|41560519|gb|CF706360.1,
                     gi|41569262|gb|CF715103.1,gi|41569272|gb|CF715113.1"
                     /transcript_id="XM_568460.1"
                     /db_xref="GI:58262099"
                     /db_xref="GeneID:3255230"
     CDS             complement(join(391305..392145,392194..392548,
                     392609..392636))
                     /locus_tag="CNM01310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568460.1"
                     /db_xref="GI:58262100"
                     /db_xref="GeneID:3255230"
                     /translation="MGLSERKVKQRIGLDPRNLSWSDDKTRFSYKHMQALGWKENTGL
                     GSSFEGNPNHIAVVRKADNGGIGMGRARKEGDDLAAGAGQAGQGLEEVLRRLAAASAS
                     PSPSLVNTPVNEEKPKEPVVVRNKIASRQRHLAAKRAAVQSPQALAEILGVPVSSLPS
                     SAVATPSPLASSSSTPQPEIKPEIKPDVKPTLADPESASALKSERTSEDVVTTSKLSV
                     SDYFRQKMREKMLIRQAAAGGSRVKVEDLPAHSLENMVEEEEKKPVGSEWEGTKMTFK
                     EQLQEFEPSDSTTAIPKEEDEKTKKRARKEAKRLAKLDKETGKSKGHDPIHEAHQTLE
                     AFEHAGEVKEEDKDEKKRQKEEKKRKRDEKEVKEKEKKRKRDDDEDEKKDKKDRKSRE
                     GQKEKERKKKKEKSS"
     misc_feature    391315..391483
                     /note="CT-rich"
     gene            392823..394379
                     /locus_tag="CNM01320"
                     /db_xref="GeneID:3255201"
     mRNA            join(392823..392881,392997..393058,393120..393339,
                     393393..393605,393655..393678,393729..393834,
                     393888..393971,394024..394379)
                     /locus_tag="CNM01320"
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /transcript_id="XM_568437.1"
                     /db_xref="GI:58262053"
                     /db_xref="GeneID:3255201"
     CDS             join(393006..393058,393120..393339,393393..393605,
                     393655..393678,393729..393834,393888..393971,
                     394024..394088)
                     /locus_tag="CNM01320"
                     /codon_start=1
                     /product="ribosomal large subunit biogenesis-related
                     protein"
                     /protein_id="XP_568437.1"
                     /db_xref="GI:58262054"
                     /db_xref="GeneID:3255201"
                     /translation="MEEHRKRHGRRLDYEEKKRKRTAREAHKASADAQKIFGHKAKLH
                     HARRHAEKVQMKKTLKAHDERNVKQKDDGAVKEGALPAYLLDRDGQKDAKALSSAVKD
                     RRKDRAAKYSVPLPKVRGIAEEEMFKVIKTGKSKSKSWKRMVNKATFVGEGFTRKPVK
                     LERFIRPMGLRMTKANVTHPELKTTFQLPILGVKKNPQSPLYTSLGVLTKGTILEVNV
                     SELGMVTTGGKVVWSKYAQITNNPENDGCINSVLLV"
     gene            394610..395641
                     /locus_tag="CNM01330"
                     /db_xref="GeneID:3255096"
     mRNA            join(394610..394975,395036..395233,395291..395433,
                     395503..395641)
                     /locus_tag="CNM01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_568275.1"
                     /db_xref="GI:58261729"
                     /db_xref="GeneID:3255096"
     CDS             join(394646..394975,395036..395233,395291..395433,
                     395503..395551)
                     /locus_tag="CNM01330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568275.1"
                     /db_xref="GI:58261730"
                     /db_xref="GeneID:3255096"
                     /translation="MSSLPQEAALPITNTLFPPPPPYFQAFTDEAIERYETLTGKSLF
                     VNDEKGKTKGKEKKSDDRDMSVDIRIQDLTEEEQNEKLELEGKLEKPRADWVNEDGRW
                     MCFGTMYTTEPIIPTAQSIGLPPFIDPAVEPQESLPPLLHSFLHTLLLLLDTLTMTAR
                     TPNELAAAGWASEGDQYIQHLTNLSANMMVASNQLRSAQSEATLVLLMEKELEERRKQ
                     TEKLRSKCKEIASGIRALKGL"
     gene            395890..397170
                     /locus_tag="CNM01340"
                     /db_xref="GeneID:3255285"
     mRNA            join(395890..396070,396120..396216,396268..396290,
                     396348..396395,396452..396541,396601..396632,
                     396687..396700,396752..397170)
                     /locus_tag="CNM01340"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_568272.1"
                     /db_xref="GI:58261723"
                     /db_xref="GeneID:3255285"
     CDS             join(395897..396070,396120..396216,396268..396290,
                     396348..396395,396452..396541,396601..396632,
                     396687..396700,396752..397086)
                     /locus_tag="CNM01340"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_568272.1"
                     /db_xref="GI:58261724"
                     /db_xref="GeneID:3255285"
                     /translation="MSANAPLLSGTIEPDEEAPSIPRGNIGTSSSPRPAQTPVVLVPG
                     TQASGVGNAEEGGIRGILKQSSHPMALAFLYLFRSAAIAVYVLCGLFTDNYVLSIVVV
                     VILLSLDFWNTRNVAGRTLVGLRYWNEVDEEGESSWVFESRDPSRPANPIDAKMFWVN
                     RPLCVSFRMVSTLNRIPSQVQCFVSLSCFSFLEHNLTWPRFLPIVVLALVFNLSNLLG
                     FTYVPLTVPILFFSHLSDMPIVTLRNDGPTELSAETFLASILVALVARWLAA"
     gene            complement(<397259..>398180)
                     /locus_tag="CNM01350"
                     /db_xref="GeneID:3255193"
     mRNA            complement(join(<397259..397307,397337..397825,
                     397876..397970,398025..>398180))
                     /locus_tag="CNM01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_568270.1"
                     /db_xref="GI:58261719"
                     /db_xref="GeneID:3255193"
     CDS             complement(join(397259..397307,397337..397825,
                     397876..397970,398025..398180))
                     /locus_tag="CNM01350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568270.1"
                     /db_xref="GI:58261720"
                     /db_xref="GeneID:3255193"
                     /translation="MSITPLSPSRPVENGAQHPIQSIQLSFSSGPGGAWDDRELVNAA
                     NSAMKEFHVHHPGPGSWLDKATAAMALGRPLPGANDYGSAWYTASAPAVPVEETSSAA
                     PPKKKRKTVKKPDAVNPYDPINTTYALNDNGAGPSAPSLINRNGRASPTYQPPSPGGP
                     NAVEQAQVEADEQAAEDAEWGDVEENWDEEDEEEEDWEVEDYTYPRQAGPVQPQPAPA
                     APAYGVYPAAGVSRDEALGHAMTAQYWAGSRRGEEEQTESAKAR"
     gene            <398256..403017
                     /locus_tag="CNM01360"
                     /db_xref="GeneID:3255071"
     mRNA            join(<398256..399080,399133..399235,399287..399384,
                     399432..400185,400354..400399,400454..401272,
                     401327..401610,401665..401732,401781..402283,
                     402380..402498,402628..403017)
                     /locus_tag="CNM01360"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535786|gb|CF681627.1,gi|41535789|gb|CF681630.1,
                     gi|41563665|gb|CF709506.1,gi|41563677|gb|CF709518.1,
                     gi|41563835|gb|CF709676.1,gi|41563843|gb|CF709684.1,
                     gi|41566548|gb|CF712389.1,gi|41566556|gb|CF712397.1,
                     gi|41572494|gb|CF718335.1,gi|41572501|gb|CF718342.1"
                     /transcript_id="XM_568268.1"
                     /db_xref="GI:58261715"
                     /db_xref="GeneID:3255071"
     CDS             join(398256..399080,399133..399235,399287..399384,
                     399432..400185,400354..400399,400454..401272,
                     401327..401610,401665..401732,401781..402283,
                     402380..402498,402628..402866)
                     /locus_tag="CNM01360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568268.1"
                     /db_xref="GI:58261716"
                     /db_xref="GeneID:3255071"
                     /translation="MVFHILSYVVAAVTEQVKEWWLLHLIPFEVEAGTPTTYEAGDKR
                     YMRSLVIVYILSICEMASPPSFSSFPDLPASQLKKAEAGPSQNPVPSFSSFPELEPEA
                     RKRQSRSRSKGRAPDDDGQRRQKKDRERMREKERDRDSRKRKERDEVTVRDERQKEKD
                     REARQSGEREHEGDRRERRRDREEDEGRRRREKKKRKDERDHSAETRYKEERREHERK
                     QAEALIRGDVRIPQPTLAVEKPPKKEDGWVKEDDGVPWYETLGKTSKKKRYEDFDDPN
                     SSSTFFVDIAGDRDILRYGSSSSFSAPKYHRDGGNRIIGYNEGLRIVYSRDRTEKGIE
                     VAPKGRPYVPRYNKQTKSAISHLERILLRPSPHGEIDSRANFLAFEVRTRQEESDVPK
                     YRSIAHSVEEDKGDQLSVLHSIIGDFTTMEQEVRKRTSWMEQHLRDYPSDAERWIEYS
                     RLHLKLSPNAERAPGVADPAKLPTTKAQAEITLSILSRALKATPENAYSERLHLAYLR
                     AAETVWSADKVTSRWKNVLRELGEQSGKIRGLEEGMMELWLGYIEWREGQGFGRGDGE
                     KGKGESIDEVVDVYLECIDKLKDKAGNGHGERALSAFQALMEITFFKPDHLRYTPPAD
                     QLAAWYQAVIGEFETFWDTEAPRIGEPGSVGWRNTPPGTPPPPSRPAPSFAHISFDPF
                     ERWLEAEMSAEKAYALPGRVRDLDPATEDDPFHVIVFSDVSPFLFPIFTPEVRLQLIY
                     AFLTFLGLPFTPPDVPSASPANADPHLRWDLVENRSARQAFWPLKQGTKRIAWQTVGG
                     EPMEPERMRGMDDPFGCPVKCWAQDRETMFGRKGVWFRDVEALDLQAIDVELVRSVFE
                     LLRPLVPDPSFTLASFALEAAVSPKGAVKAAKAVLASERSNLLLWDGYARIERQRGNV
                     SAARTVYATALQAASQERGDRPRSEDEMDLWAGWAEVEFEANERERCLEVLIMAAGTG
                     SEGLAEHINPTYIPTTPSPINVLKSRQYYNSVSTPLSPSHLLLISLFNYLLDGIDSAR
                     DFLLQSSQTYAPSSAESEESLQLLTKILYHHTTRHSTPPALTREVLEYALSSFPNNTS
                     FLSLYMYGELGNRVYGRVQRLIAEITNEHKDGGVMKGVMGHLWAVWAEAVSAHRTFWD
                     DGGGGAERVRMALDKGINSTSGRYSAALWMLYIEFEALMGRHQTAKQLCYRAVSTLGG
                     CKALYLLPFSLPLRSHFSTRELKEWAELMVERGLRLRIPFELFWSTEEKEESERAIVL
                     PEDEELAEDELRFLSERQALKPY"
     misc_feature    398627..398809
                     /locus_tag="CNM01360"
                     /note="GA-rich"
     gene            <403116..>404244
                     /locus_tag="CNM01370"
                     /db_xref="GeneID:3255169"
     mRNA            join(<403116..403176,403235..403312,403396..403466,
                     403538..403697,403758..404046,404096..404123,
                     404179..>404244)
                     /locus_tag="CNM01370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568461.1"
                     /db_xref="GI:58262101"
                     /db_xref="GeneID:3255169"
     CDS             join(403116..403176,403235..403312,403396..403466,
                     403538..403697,403758..404046,404096..404123,
                     404179..404244)
                     /locus_tag="CNM01370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568461.1"
                     /db_xref="GI:58262102"
                     /db_xref="GeneID:3255169"
                     /translation="MAPITIKARGILFDLDGTLISSTTICESVWHKWAEVYPVDLTEV
                     FKSSHGIRTRELLRHWLNITDPVELETATEKFETDVLKEAQRLASIGKGGITLLPGVE
                     KLLLALNAASKDAARWAIVTSATNAYATNAITTLSLPRTSHLITADEVSQGKPHPEPY
                     IMGAAALGLKPTDCIVFEDAPSGVKAGVASGARVVAVCTSHKRSALEGLGAHLIVENL
                     SDINLDTEGDEGYQWDHLNYCFHRSVCYILHQ"
     gene            405098..407019
                     /locus_tag="CNM01380"
                     /db_xref="GeneID:3255200"
     mRNA            join(405098..405404,405460..407019)
                     /locus_tag="CNM01380"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530902|gb|CF676743.1,gi|41532666|gb|CF678507.1,
                     gi|41532671|gb|CF678512.1,gi|41534107|gb|CF679948.1,
                     gi|41536103|gb|CF681944.1,gi|41536110|gb|CF681951.1,
                     gi|41539800|gb|CF685641.1,gi|41539808|gb|CF685649.1,
                     gi|41540159|gb|CF686000.1,gi|41540168|gb|CF686009.1,
                     gi|41542230|gb|CF688071.1,gi|41542237|gb|CF688078.1,
                     gi|41546112|gb|CF691953.1,gi|41548292|gb|CF694133.1,
                     gi|41548298|gb|CF694139.1,gi|41549525|gb|CF695366.1,
                     gi|41549535|gb|CF695376.1,gi|41550009|gb|CF695850.1,
                     gi|41551591|gb|CF697432.1,gi|41551592|gb|CF697433.1,
                     gi|41552297|gb|CF698138.1,gi|41552302|gb|CF698143.1,
                     gi|41554100|gb|CF699941.1,gi|41555302|gb|CF701143.1,
                     gi|41557175|gb|CF703016.1,gi|41558995|gb|CF704836.1,
                     gi|41563383|gb|CF709224.1,gi|41563463|gb|CF709304.1,
                     gi|41563471|gb|CF709312.1,gi|41564857|gb|CF710698.1,
                     gi|41564866|gb|CF710707.1,gi|41565048|gb|CF710889.1,
                     gi|41566503|gb|CF712344.1,gi|41566509|gb|CF712350.1,
                     gi|41567138|gb|CF712979.1,gi|41567146|gb|CF712987.1,
                     gi|41572093|gb|CF717934.1,gi|41572100|gb|CF717941.1,
                     gi|415"
                     /transcript_id="XM_568439.1"
                     /db_xref="GI:58262057"
                     /db_xref="GeneID:3255200"
     mRNA            join(405098..405404,405460..406203,406261..407019)
                     /locus_tag="CNM01380"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532671|gb|CF678512.1,gi|41534097|gb|CF679938.1,
                     gi|41534107|gb|CF679948.1,gi|41536110|gb|CF681951.1,
                     gi|41539808|gb|CF685649.1,gi|41540168|gb|CF686009.1,
                     gi|41542237|gb|CF688078.1,gi|41543965|gb|CF689806.1,
                     gi|41546107|gb|CF691948.1,gi|41546112|gb|CF691953.1,
                     gi|41548298|gb|CF694139.1,gi|41549535|gb|CF695376.1,
                     gi|41550003|gb|CF695844.1,gi|41550009|gb|CF695850.1,
                     gi|41551592|gb|CF697433.1,gi|41552302|gb|CF698143.1,
                     gi|41554100|gb|CF699941.1,gi|41555302|gb|CF701143.1,
                     gi|41557175|gb|CF703016.1,gi|41558983|gb|CF704824.1,
                     gi|41558995|gb|CF704836.1,gi|41563370|gb|CF709211.1,
                     gi|41563383|gb|CF709224.1,gi|41563471|gb|CF709312.1,
                     gi|41564857|gb|CF710698.1,gi|41564866|gb|CF710707.1,
                     gi|41565036|gb|CF710877.1,gi|41565048|gb|CF710889.1,
                     gi|41566503|gb|CF712344.1,gi|41566509|gb|CF712350.1,
                     gi|41567146|gb|CF712987.1,gi|41572093|gb|CF717934.1,
                     gi|41572100|gb|CF717941.1,gi|41572154|gb|CF717995.1,
                     gi|41572165|gb|CF718006.1,gi|41572276|gb|CF718117.1,
                     gi|41574604|gb|CF720445.1,gi|41574608|gb|CF720449.1"
                     /transcript_id="XM_568440.1"
                     /db_xref="GI:58262059"
                     /db_xref="GeneID:3255200"
     CDS             join(405201..405404,405460..406479)
                     /locus_tag="CNM01380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568439.1"
                     /db_xref="GI:58262058"
                     /db_xref="GeneID:3255200"
                     /translation="MATAVASPSLLSPIPSTSKRSAPSPSSSQPVKRPRQSSSSSKDE
                     DEVAASDEELDEETRAKLARKEARTIRNRESAQRSRNARKAHVAWLEKRVVELEAENR
                     SLKGEPPTSTDPVPTAATPEPAAQPPAREASTEHDVLSFANDLGIPAEVVSSGVSLSN
                     VAPPPSSVDVDVKPIIEPSPLTLASPAVVLTSNDDLMAIKTENANLRQRVTLLENLVK
                     QVVAIANFSPPVPSTSQRTPVNQFASLPAQSSLDWSSTLSATSILPAGLSSTLSPGLP
                     ARNSTVSTTSASQLPHLAQTSQPELASSRNVSNSVACHSAVVATTSAPLIKGRLGVAL
                     QRARGNYSMHSLALALAKDEKRMAQVARLIIALARHKGWISHPQQSNQSLNMAWKGCL
                     EGRKCRQRSRVGMRR"
     CDS             join(405201..405404,405460..406203,406261..406479)
                     /locus_tag="CNM01380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568440.1"
                     /db_xref="GI:58262060"
                     /db_xref="GeneID:3255200"
                     /translation="MATAVASPSLLSPIPSTSKRSAPSPSSSQPVKRPRQSSSSSKDE
                     DEVAASDEELDEETRAKLARKEARTIRNRESAQRSRNARKAHVAWLEKRVVELEAENR
                     SLKGEPPTSTDPVPTAATPEPAAQPPAREASTEHDVLSFANDLGIPAEVVSSGVSLSN
                     VAPPPSSVDVDVKPIIEPSPLTLASPAVVLTSNDDLMAIKTENANLRQRVTLLENLVK
                     QVVAIANFSPPVPSTSQRTPVNQFASLPAQSSLDWSSTLSATSILPAGLSSTLSPGLP
                     ARNSTVSTTSASQLPHLAQTSQPELASSRNVSNSVACHSARARGNYSMHSLALALAKD
                     EKRMAQVARLIIALARHKGWISHPQQSNQSLNMAWKGCLEGRKCRQRSRVGMRR"
     gene            complement(407658..412355)
                     /locus_tag="CNM01390"
                     /db_xref="GeneID:3255133"
     mRNA            complement(join(407658..408534,408592..408805,
                     408867..408873,408932..409006,409064..409152,
                     409209..409236,409286..409564,409616..409705,
                     409759..409885,409944..410163,410400..410607,
                     410671..410690,410744..410918,410972..412248,
                     412317..412355))
                     /locus_tag="CNM01390"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535738|gb|CF681579.1,gi|41535746|gb|CF681587.1,
                     gi|41536540|gb|CF682381.1,gi|41536547|gb|CF682388.1"
                     /transcript_id="XM_568471.1"
                     /db_xref="GI:58262121"
                     /db_xref="GeneID:3255133"
     CDS             complement(join(407814..408534,408592..408805,
                     408867..408873,408932..409006,409064..409152,
                     409209..409236,409286..409564,409616..409705,
                     409759..409885,409944..410163,410400..410607,
                     410671..410690,410744..410918,410972..412248,
                     412317..412344))
                     /locus_tag="CNM01390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568471.1"
                     /db_xref="GI:58262122"
                     /db_xref="GeneID:3255133"
                     /translation="MPEEPKKKRRQNVACDACKHRRVKCDLAPLLQSIHAQSADRPDS
                     SIAGDTNSSTSANSPSPEDIPLADLVRQNPEVCCTNCKNKGLKCTTNQILNPSKPKKG
                     GRRIDEARQKFGGDGGETSGGDAEPVGEPSHTPAGGTSGSAPMWPGFNPWIAEDFIIA
                     TPLQPSPLVQPVSDVNNSLPPEILELNCAASVPDMTSLLGLGPNSWTPFDPPILPTES
                     LPTNTVGPNSITVPPFLPPSTAPTTPLINLSHPPETSLDEKQGSAPIWWSFSDHSREM
                     MEHAEPSGRTPVTKSPVPPPNKSGNGQFLGNAPLNHKGASAPLLVDSYTRSIAESLSS
                     GQSPEYQQLVSDFLSLPPHDNAQTKKRSRGVSPSSSSAPSEKVLVRRKDPWQLYTEEE
                     DWRIVRWGKKEAVQEKLADRALGMELSRHLVKTFFQAVHFSYPAILPESFYLEWMRAG
                     QRSDRMTPAQEVLCSAIEAWGARYSDSPVVLGLSPEKAETAPKVIQANGTFVPGTQAR
                     AHWGRARLAACKALLERTKRLIDTNGILRKPSITGVQALTLYIQLMLMTDDTVDAPTH
                     YMEGVYSGLILLEMLSGPLHRGTNQGCELFCLLSQSYDTINNKSRPKADMDAAGNWLL
                     SVTNLLPISSFNALSFCLSCYYRITLIGRDIATSLSIPSKIKGAVDVVEFCNHVQRIW
                     RDIDAFDKDMNPQVTRVLSSCPNNDILAFSPLNYFSNLRLSSPFLLLLIHQLIREQLE
                     FRKTLSSAYIAASQDHPDPYKTLNDESRDEARGVWTTAQSHVQILEDLSSQSIDIMLR
                     SCRAQVGMFKALMPTGTIQTAMLLLRELIATAQFLAEVPTNEQGYPDDTPGGYDWTWE
                     KKQEEMNCCIEALYQVGWAWADVADVLDKIMVTMERLTPTPAQLAAYKERVASRPPSQ
                     TPKMTEAARRREQEKKDDEAALKAVLSHWPPVSVPELIENAIATGELDLQNDQSVMRL
                     TFFHSRLVEEMDSLAGSGESHHSSPSSFASPEVASESGSSAQGGFGQDSTQNLRSTNS
                     SSTNPSTAKVLNDLFPHTWDREFLSDFNSSGRCPDNEQLYSVRTWFNNGKPEDGERNG
                     QSPKPTGENSIRGVGHRGMEPKTSLTDLMTPLDRAENKAGLVVPDISIESQTENLSKE
                     SSTSKDADEAQDGLQEFFDEWGKDMGLEITSGWMDYRGR"
     gene            <414176..414898
                     /locus_tag="CNM01400"
                     /db_xref="GeneID:3255156"
     mRNA            join(<414176..414497,414568..414608,414660..414669,
                     414737..414758,414812..414898)
                     /locus_tag="CNM01400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568266.1"
                     /db_xref="GI:58261711"
                     /db_xref="GeneID:3255156"
     CDS             join(414176..414497,414568..414608,414660..414669,
                     414737..414758,414812..414851)
                     /locus_tag="CNM01400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568266.1"
                     /db_xref="GI:58261712"
                     /db_xref="GeneID:3255156"
                     /translation="MSLFISARVLRLSRPVSLARSYATPPTPSTAPLPKEQPDASSPR
                     YLQQSPNVPTTWSTNQNPKPHAYDNARFEQTAWEYQPNRPSAMGMVAEDPVRLVQGRK
                     AACDGGGGALGHPKIFINLDKPGPKVCGYCGIRFEQAHDAHH"
     gene            complement(415691..417341)
                     /locus_tag="CNM01410"
                     /db_xref="GeneID:3255109"
     mRNA            complement(join(415691..416635,416690..416790,
                     416855..416908,416983..417053,417118..417341))
                     /locus_tag="CNM01410"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537549|gb|CF683390.1,gi|41537556|gb|CF683397.1,
                     gi|41553487|gb|CF699328.1"
                     /transcript_id="XM_568350.1"
                     /db_xref="GI:58261879"
                     /db_xref="GeneID:3255109"
     CDS             complement(join(415740..416635,416690..416790,
                     416855..416908,416983..417053,417118..417264))
                     /locus_tag="CNM01410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568350.1"
                     /db_xref="GI:58261880"
                     /db_xref="GeneID:3255109"
                     /translation="MTSIKTPKLSKPRMDPKDYTIRVANDDQAIKHAEACYEVVSWRQ
                     GMTFEEFCHIGEREKAEAGWAQNYGDICWVIVRRDDYDGEIYSSLETHRSKCFVKGKG
                     QEDVKAGWYYDITAVVTPMKYRGQGYATHLLRLLHYILTSPVFPSSSSDVLPLFPCAA
                     WGDPPPAIPSELIPYIPRANGAILWSDVPVEFYGHCTMGLDGKGFQSKKEWNNRLVWK
                     LLPVAETSLGKLEKEWEPIWQEDLESSVYDILSASHRQKLENTDTSNHAAFIQDPASP
                     GTLTMVPVWGSFSRQPAWRTKPIPFGFRLRQKKGKKREEVIVMISLFNPWVTNKLAIT
                     FVHNVTPVLLSTMLRMLDKAVKDAGAPWTEGEIWGLDPQSDLVKAWVAEEGREAKVDI
                     RQGLKNHVLGVRWYDDEEVQIGDTQMWSWV"
     gene            complement(418094..418802)
                     /locus_tag="CNM01420"
                     /db_xref="GeneID:3255269"
     mRNA            complement(join(418094..418260,418312..418366,
                     418425..418583,418645..418802))
                     /locus_tag="CNM01420"
                     /product="long-chain fatty acid transporter, putative"
                     /transcript_id="XM_568458.1"
                     /db_xref="GI:58262095"
                     /db_xref="GeneID:3255269"
     CDS             complement(join(418241..418260,418312..418366,
                     418425..418583,418645..418743))
                     /locus_tag="CNM01420"
                     /codon_start=1
                     /product="long-chain fatty acid transporter"
                     /protein_id="XP_568458.1"
                     /db_xref="GI:58262096"
                     /db_xref="GeneID:3255269"
                     /translation="MVNTKAQFDKAVAIVKGLPEDGPVKPTQDDKLAFYAHFKQANEG
                     DVSGPAPGMFDFVGKAKYNAWKKIAGMSKEDAMAKYVELLTEMLKKSDDEASKQYLAE
                     LEAAGASA"
     gene            <419165..>419937
                     /locus_tag="CNM01430"
                     /db_xref="GeneID:3255188"
     mRNA            join(<419165..419179,419228..419441,419503..419604,
                     419673..419743,419809..>419937)
                     /locus_tag="CNM01430"
                     /product="dUTP diphosphatase, putative"
                     /transcript_id="XM_568442.1"
                     /db_xref="GI:58262063"
                     /db_xref="GeneID:3255188"
     CDS             join(419165..419179,419228..419441,419503..419604,
                     419673..419743,419809..419937)
                     /locus_tag="CNM01430"
                     /codon_start=1
                     /product="dUTP diphosphatase"
                     /protein_id="XP_568442.1"
                     /db_xref="GI:58262064"
                     /db_xref="GeneID:3255188"
                     /translation="MDQSQLLPKFVAEMDVKLLSDRATLPTHGSVFAAGMDLYAAEHK
                     IIPARGRALVDLQLSIAVPQGHYGRIAPRSGLASKHGIQTGAGVIDSDYRGPVMVLLF
                     NHSDVDFEVNPKDRIAQLILERISVPKLRQVESLETTVRGAGGFGSTGGFGPAAKKQK
                     VEEEIVETTTIKRKEI"
     gene            complement(<419964..422624)
                     /locus_tag="CNM01440"
                     /db_xref="GeneID:3255070"
     mRNA            complement(join(<419964..420155,420210..420548,
                     420603..420827,420893..421697,421749..422039,
                     422103..422376,422453..422624))
                     /locus_tag="CNM01440"
                     /product="alpha DNA polymerase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538012|gb|CF683853.1,gi|41538021|gb|CF683862.1,
                     gi|41548917|gb|CF694758.1"
                     /transcript_id="XM_568348.1"
                     /db_xref="GI:58261875"
                     /db_xref="GeneID:3255070"
     CDS             complement(join(419964..420155,420210..420548,
                     420603..420827,420893..421697,421749..422039,
                     422103..422376,422453..422540))
                     /locus_tag="CNM01440"
                     /codon_start=1
                     /product="alpha DNA polymerase"
                     /protein_id="XP_568348.1"
                     /db_xref="GI:58261876"
                     /db_xref="GeneID:3255070"
                     /translation="MSSSDSTARQELGDRFGRAVMDHPDVMAECLSLMRLYNLTASDL
                     FFKYEAFVMSRPSGLRAKLSTITINSVKELRTELQRSQQAKAVANMGAANVPRLNGSE
                     KKAAVGVKKAKGLGDLEGLLGNLTTPNRPTKPRPSASSTISPSHFASPASTVKATPSH
                     LTTPQRQSPLPPTASSYRPNPSKLASSNNVFLDTPMDKGGNGLLVPSSPLSPSGVSPS
                     SSPQPSQSFTKQANSNTVVETLNIHLPQLPPSHTRLTSKPRVELSSTITAADYNYRYM
                     FEKLSERSEALDDSIDEYADAIKDAYGLSELGDPHFVSDESIYTVGRVLSNTTSSKSD
                     KTALKNSFHLQSSRLIGAGKRIALELPEEKLKVRGGAPGVKGFSLYSGCLVCVKGRNG
                     GGSKFVVEEVLLVRAFRLLELNHLTCSVQLPPSLLPQTPASELIDFQYGDKLKGEPLS
                     LMVAAGPYTLNENLLFEPFETLVDKVLEDRPDVLILLGPFVDSQHPIIKSCAVTETPQ
                     EIFRKQISSRLQKVVTQSPSTVIILIPSVRDVVSHHMAFPQSMLEKEYLGLPKKVKAL
                     PNPCTFSVNEVTISLSSVDILFHLGQAHAPIRAQEADADPGMSGSPAPDPLANHIRQV
                     LGQRSFYPLFPPQEDVAGEVNLDVTHYPLLKMDQAPDILILPSRLNKFVKIVDSTLVI
                     NPSHIARARATGHYAKVIIHPTAREVLEESMEVDGEESLCEHQVYERARSEIWKI"
     gene            complement(422822..424575)
                     /locus_tag="CNM01450"
                     /db_xref="GeneID:3255255"
     mRNA            complement(join(422822..423000,423085..423206,
                     423277..423309,423365..423434,423493..423664,
                     423731..424128,424183..424575))
                     /locus_tag="CNM01450"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41566980|gb|CF712821.1,gi|41566985|gb|CF712826.1,
                     gi|41568178|gb|CF714019.1,gi|41568179|gb|CF714020.1"
                     /transcript_id="XM_568455.1"
                     /db_xref="GI:58262089"
                     /db_xref="GeneID:3255255"
     CDS             complement(join(422843..423000,423085..423206,
                     423277..423309,423365..423434,423493..423664,
                     423731..424128,424183..424507))
                     /locus_tag="CNM01450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568455.1"
                     /db_xref="GI:58262090"
                     /db_xref="GeneID:3255255"
                     /translation="MENASSALTAFRQAEKHFKNRANKDIYPSLRQWQDRLIDLSRPD
                     SQEEDEIWAAGWWSPDHDVVPAATSGRRRKGVEKKDKGERPELDIASLESLSLHGGKT
                     GYIVAPGCVLIPGYLTVEQQLSFLHDSLARYTLPPNPLSLSTHYDLPPNLFSLFVSNP
                     EATVLPKHMTGTVNPEALASASQPKSRKLNDTEPASVIGYEEIVARNKAWTGDLPSDK
                     LGAKEVRKLWKEIRWANLGWVYQWSTKSYDFAPETPIPFPAPLADLCSEAVASVPWEN
                     VFSSVSDPDASTYGWQSWPRDYKPDTGIVNFYQLNDTLMAHVDRAELDPARPLVSVSL
                     GHAAILLLGSDSRDEVPRPIILRSGDMLIMSGKGRQSYHGVPRILEGSLPSHFLVQES
                     DSEEMKAAKNWISTARININARQVFPPGFKRVN"
     gene            complement(424921..425803)
                     /locus_tag="CNM01460"
                     /db_xref="GeneID:3255250"
     mRNA            complement(join(424921..425011,425067..425126,
                     425178..425366,425421..425530,425583..425656,
                     425713..425803))
                     /locus_tag="CNM01460"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_568453.1"
                     /db_xref="GI:58262085"
                     /db_xref="GeneID:3255250"
     CDS             complement(join(425000..425011,425067..425126,
                     425178..425366,425421..425530,425583..425656,
                     425713..425771))
                     /locus_tag="CNM01460"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_568453.1"
                     /db_xref="GI:58262086"
                     /db_xref="GeneID:3255250"
                     /translation="MLIYQDVLTGDEMISDAFPIKEIGDIAYEVDCANIIIKEGDVDI
                     GGNPSAEEAAEALEEGAQQVNNVVHSFRLQSTSFDKKSYLTYLKGYMKAIKSKLQESN
                     PDRVAAFEKGAQDFAKKIVANFKDYEFYIGESMNPDGMVCLLNYREDGVTPYFTMWKD
                     GLKEIKI"
     gene            <427123..>429214
                     /locus_tag="CNM01470"
                     /db_xref="GeneID:3255049"
     mRNA            join(<427123..427252,427304..427353,427407..427529,
                     427590..427715,427761..427883,427944..428002,
                     428057..428095,428151..428237,428295..428412,
                     428478..428685,428754..>429214)
                     /locus_tag="CNM01470"
                     /product="RNA processing-related protein, putative"
                     /transcript_id="XM_568346.1"
                     /db_xref="GI:58261871"
                     /db_xref="GeneID:3255049"
     CDS             join(427123..427252,427304..427353,427407..427529,
                     427590..427715,427761..427883,427944..428002,
                     428057..428095,428151..428237,428295..428412,
                     428478..428685,428754..429214)
                     /locus_tag="CNM01470"
                     /codon_start=1
                     /product="RNA processing-related protein"
                     /protein_id="XP_568346.1"
                     /db_xref="GI:58261872"
                     /db_xref="GeneID:3255049"
                     /translation="MIWFCSQWGAQELLDLAQKYACRFLGSTSTVSKSLSQIYFALSG
                     GRGIDTSILSQDFSTERSDFTRGAELPASIVLNRLGKRTYSVDNDKTYDVDNILSDFG
                     HILEKMLTSEAKDLKRFLLSSPEESVSDAERTEREAYHYKKIGSMLLRSQLDCYHPDL
                     PGSGVFDIKTRACFPIRYDSANYLANSVYDIFKDRGYTGSYEREYYDLMRAVMLKYSF
                     QVRIGGMDGIFLAYHNTSRIFGFQYVPLTEIDQRIFGSSEMADAAFKISVTVLQKLLD
                     LSVKAFSGVDVKMIIKHTPNIDQNSVTAYVEPKHWKDEKGPPPVQAITITMENFLDGQ
                     PVQGQIPAFVIDERTRKVPEWTVKYSVIKTEMDENGQLEARKGAQSLRKKLIDMASLY
                     IPEGHTVESMTRYYEARRQAIEAGRHAATASLTDLPEPTDDIGNDVKDVESDTQNEES
                     LVPASAEEEAVKSGDQLMTIQWKKPGKHTLKLRREAKESGKAYEKRKKAWRSAHRKP"
     gene            complement(<431084..434749)
                     /locus_tag="CNM01480"
                     /db_xref="GeneID:3255239"
     mRNA            complement(join(<431084..431154,431311..431415,
                     431497..431649,431732..431769,431892..431965,
                     432055..432135,432264..432347,432400..432428,
                     432498..432750,432810..433208,433261..434084,
                     434136..434266,434314..434340,434389..434749))
                     /locus_tag="CNM01480"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537443|gb|CF683284.1,gi|41572013|gb|CF717854.1,
                     gi|41572769|gb|CF718610.1"
                     /transcript_id="XM_568344.1"
                     /db_xref="GI:58261867"
                     /db_xref="GeneID:3255239"
     CDS             complement(join(431084..431154,431311..431415,
                     431497..431649,431732..431769,431892..431965,
                     432055..432135,432264..432347,432400..432428,
                     432498..432750,432810..433208,433261..434084,
                     434136..434266,434314..434340,434389..434735))
                     /locus_tag="CNM01480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568344.1"
                     /db_xref="GI:58261868"
                     /db_xref="GeneID:3255239"
                     /translation="MADLSQHANYTAAYSGLLDNFYLTVAIAGACLVGYEIEAHIPRQ
                     RGRDGPRQRLAVRVYNALARQRRTRKDPGVPHQSRQRRRSWRLSSEGLVAGDTPADPE
                     RERLGSRESWEFGYIFQPKAWAVNACRPLPRWPLAWIGTALKFREQDMPAKCGLDLTL
                     HARFLRGCFFYTLLQTLIIMPILMPLHIFYSPKDIASTSMLRASISSLVQSSGSRWLW
                     VHALLIWWVSITWTCTVLWITWGGLAYRRREIRALAAKVQKERASKRVASGGEEGMAV
                     LEDCEGIKRFRTVMVLNIPPDMRDENVLQDYFDHYIDKYHQRKQGPSKRKPLAKMFRQ
                     AIPIGQNPSYSVDVGPSEKSSVEDIVLVRKLGVLINLRSRREEVLKKLEIAHTELAKR
                     VLADVAKYYKRPKALYSIKDPARAARMSILVEKLGRFTEPKSPHGDKTVWDALHSVPR
                     ECLDPYQAMTHSKPLSILHDQNPPLIDYLTTKLAYLTHLLTESLSKPLESYATASTAF
                     VTFRDAKTARLVLKILDSHPKRSLACKTVPAPDWTDLLWPRLGKSVYRSEFVRGWAVY
                     LGVWAFTLAWIFPVSLLCALASLTNIAGFIKPLKAFLDNNPKAASAITSLAPVILVAL
                     LTLAICPILLVIANKAETIMTRLGVHNSVLERFWKFLMVNGVVFFAIGQSAIEAYLTA
                     FQTNDFDPLPIVASAFPTAAPYFASYILLQVAIQPFFEVFRFGLPAIVYVFGTRRSVI
                     PRQRRSRTQYPTFSHFSQLPQQLLAGAIMHLFMLLNPLVIAFSKCYRYTSIPTSSVLV
                     LNMVVAALVFYGACYLVWKRQFIYVYGRLYEVNGRRSCIRIQRYSMDALAYKAKGHAI
                     ATGVLFALTLISKIM"
     misc_feature    431826..431847
                     /note="GC_rich"
     misc_feature    432186..432207
                     /note="GC_rich"
     gene            <434787..436024
                     /locus_tag="CNM01490"
                     /db_xref="GeneID:3255159"
     mRNA            join(<434787..435085,435130..435148,435194..435248,
                     435288..435409,435487..436024)
                     /locus_tag="CNM01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_568342.1"
                     /db_xref="GI:58261863"
                     /db_xref="GeneID:3255159"
     CDS             join(434787..435085,435130..435148,435194..435248,
                     435288..435409,435487..435885)
                     /locus_tag="CNM01490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568342.1"
                     /db_xref="GI:58261864"
                     /db_xref="GeneID:3255159"
                     /translation="MQPGPGTKVSGGDHSVVEAKKAAGQLRNCTWTYPRWCRVWRLRW
                     GSGDLLRWPLETVVTAPPPVCDPPPPPWSAPPPSSEMRPSQSPCPQTTQSTTSPPPAS
                     GKSLMCCVVNRGLCRRWVSWSHLNPEISSGLPIPTENRYPQPASRPETYATPATKASD
                     PAFNPYWKRDARRAYPQTSVITQSHLSTLLLSSPALASLPSPETAVETKWESSGIAPQ
                     SPPSDAQQVVPATKVPALADVLQKLPQGKAYLGGGLTTGQGEGLPPVPPPALISKKWV
                     PRAGEPVPHGKFDYFPMYTVA"
     misc_feature    435546..435597
                     /locus_tag="CNM01490"
                     /note="C-rich"
     gene            complement(436005..>440023)
                     /locus_tag="CNM01500"
                     /db_xref="GeneID:3255258"
     mRNA            complement(join(436005..436240,436308..436715,
                     436836..436989,437063..437080,437167..437207,
                     437296..437555,437701..437803,437919..438008,
                     438074..438169,438247..438605,438711..439450,
                     439582..439925,439976..>440023))
                     /locus_tag="CNM01500"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41552684|gb|CF698525.1"
                     /transcript_id="XM_568340.1"
                     /db_xref="GI:58261859"
                     /db_xref="GeneID:3255258"
     CDS             complement(join(436076..436240,436308..436715,
                     436836..436989,437063..437080,437167..437207,
                     437296..437555,437701..437803,437919..438008,
                     438074..438169,438247..438605,438711..439450,
                     439582..439925,439976..440023))
                     /locus_tag="CNM01500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568340.1"
                     /db_xref="GI:58261860"
                     /db_xref="GeneID:3255258"
                     /translation="MCTIGPLFPVAQYTLAKQLLIPAACYIAIALASIIFIFPQTLNH
                     IVLDSLDKTILTPAISLLTLLEQVLETSPSDTEAWGKVAEKGYETREQLVGAVAALEG
                     QTGMLQLEITRGQIGPKDLEKMFAKLKVLDMQENAMPHPTVGAQKHWERLEKHNHPSR
                     SLDALVPILNESSADLRQASVKALKDISQWLTLVNHTRWKKVPADAPPISQREENLEN
                     VKRALKEFRASKQFAVLEPYRQFFDPITGEIKPEALESYRYVTRDLFRAYVLTSNLTN
                     FALSLISFLSLTLEIERANPKAKIQLPNKFAKMLIKNANDKNGGGNPLDMGLKDTDGI
                     DEASGRTSEATEDDVDDDDNDDASETSLAVKKKEKKEKKKRVYAKDPDAGDPRNALQR
                     LGRHIYSLWKGLTGHSGIFALKYALVSVALFVPAVCENSAQFFYENRYVKKNRLYSRT
                     RMGEKKKKRTRLTGSGLKKRGLWALIMAQTGMGVFTGEQITSFFVRMGGTAAGLVIGM
                     LAWYIGSGNGNGNPYGITAATLVLIAPCLFIRIAVPMDKAVFFLMTNVTIMFVVGYSW
                     VDDHIVQTANQGHGAGLAGRRALLVIIGFTAAFIMMIFPRPNSARALFRRRLAKNMSD
                     IGDLYGKVVTNIENEVDAAEWGKEGTSTHKHIKGEVEGDDVEKRRAQYRGVFLKVMGR
                     MMGMKPHLYYASAELGLKGPWPKKKYARLYRTQGQVLATLALLAGAYSRMSLLTCKRL
                     ATKSDLMHPAFIADCLLLFSTLQQSLRNGQPLPAMLPIFERLSIHSKHGNLSRFAQAA
                     SQQVDRAEEGSERGVGGEEKRSLLREQRGGDNMMGGGEKMENGEREDGDVQEDKDEMP
                     RDADGNVDQTELVRRNAEKVMKGMINWDSWHDEQFALFATANTALVHIVIGLNDMYRV
                     VRDLVGEKDLHGLDRASERWATGAYDV"
     misc_feature    436281..436300
                     /note="A-rich"
     repeat_region   438720..438751
                     /rpt_type=tandem
                     /rpt_unit_seq="ttc"
                     /satellite="microsatellite"
     repeat_region   438774..438807
                     /rpt_type=tandem
                     /rpt_unit_seq="cat"
                     /satellite="microsatellite"
     gene            <441049..443385
                     /locus_tag="CNM01510"
                     /db_xref="GeneID:3255107"
     mRNA            join(<441049..441220,441278..441395,441470..441476,
                     441529..441551,441625..441714,441798..441914,
                     441978..442166,442430..442492,442545..442673,
                     442788..443385)
                     /locus_tag="CNM01510"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41558426|gb|CF704267.1,gi|41558432|gb|CF704273.1"
                     /transcript_id="XM_568338.1"
                     /db_xref="GI:58261855"
                     /db_xref="GeneID:3255107"
     CDS             join(441049..441220,441278..441395,441470..441476,
                     441529..441551,441625..441714,441798..441914,
                     441978..442166,442430..442492,442545..442673,
                     442788..443226)
                     /locus_tag="CNM01510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568338.1"
                     /db_xref="GI:58261856"
                     /db_xref="GeneID:3255107"
                     /translation="MSLRDKSCYTLTIHASSTDPAVLQLVESMGPATGYEEPRYARVK
                     ETRHDESYSSAIYDVLSGARLASAGYTIEKAKKRRLQLHGPDEDIPFDFTGKINFEWS
                     FIFEGNKYRWRREIYGRDYICTMDRKPDPPVEICLAREADKKEPAKIQILHYNIDRFP
                     NEIKDLRGLETLLVASLLCLLDAGEDRSTTLSSKLSKSASAPSPPLPSKDSPPVPERV
                     ISEEDFEPVSFMSCTMTLGVHGTSYAHFFSLFHFISSHPCLLFRHHENLSDLHQYIIE
                     DTSPSPPSQRQSTRPGPRVINLDDEPTSSSSPASSSSSSSLRRKLTRTKTKTQTQTQK
                     ESWTPPQNIAIYLSTIVLPDLNPGRRASSSSSMKNSYPYSNERNGHGHGQVNGGGGKM
                     MMFGGEEGSTSMSTSAAAGKQAVGGSHAAGSSGSENGSAVKSFRGSLGKKLFRSSS"
     misc_feature    442724..442754
                     /locus_tag="CNM01510"
                     /note="AT_rich"
     misc_feature    442789..442827
                     /locus_tag="CNM01510"
                     /note="CT-rich"
     gene            complement(443359..446151)
                     /locus_tag="CNM01520"
                     /db_xref="GeneID:3255236"
     mRNA            complement(join(443359..443901,443981..444680,
                     444746..445019,445086..445297,445356..445594,
                     445660..446015,446072..446151))
                     /locus_tag="CNM01520"
                     /product="chaperone, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530850|gb|CF676691.1,gi|41530860|gb|CF676701.1,
                     gi|41531050|gb|CF676891.1,gi|41531056|gb|CF676897.1,
                     gi|41532184|gb|CF678025.1,gi|41532187|gb|CF678028.1,
                     gi|41533837|gb|CF679678.1,gi|41533844|gb|CF679685.1,
                     gi|41533970|gb|CF679811.1,gi|41533976|gb|CF679817.1,
                     gi|41534485|gb|CF680326.1,gi|41534489|gb|CF680330.1,
                     gi|41535454|gb|CF681295.1,gi|41535469|gb|CF681310.1,
                     gi|41535954|gb|CF681795.1,gi|41535958|gb|CF681799.1,
                     gi|41535960|gb|CF681801.1,gi|41535962|gb|CF681803.1,
                     gi|41536780|gb|CF682621.1,gi|41536793|gb|CF682634.1,
                     gi|41537224|gb|CF683065.1,gi|41537234|gb|CF683075.1,
                     gi|41537855|gb|CF683696.1,gi|41537863|gb|CF683704.1,
                     gi|41538077|gb|CF683918.1,gi|41538084|gb|CF683925.1,
                     gi|41538521|gb|CF684362.1,gi|41538532|gb|CF684373.1,
                     gi|41538765|gb|CF684606.1,gi|41538893|gb|CF684734.1,
                     gi|41539423|gb|CF685264.1,gi|41539436|gb|CF685277.1,
                     gi|41541024|gb|CF686865.1,gi|41541029|gb|CF686870.1,
                     gi|41541673|gb|CF687514.1,gi|41541682|gb|CF687523.1,
                     gi|41541966|gb|CF687807.1,gi|41541975|gb|CF687816.1,
                     gi|415"
                     /transcript_id="XM_568451.1"
                     /db_xref="GI:58262081"
                     /db_xref="GeneID:3255236"
     misc_feature    443393..443449
                     /note="A-rich"
     CDS             complement(join(443576..443901,443981..444680,
                     444746..445019,445086..445297,445356..445594,
                     445660..446011))
                     /locus_tag="CNM01520"
                     /codon_start=1
                     /product="chaperone"
                     /protein_id="XP_568451.1"
                     /db_xref="GI:58262082"
                     /db_xref="GeneID:3255236"
                     /translation="MSTETFGFQAEISQLLDLIINTFYSNKEIFLRELISNSSDALDK
                     IRYAALTDPSQLESEKDLYIRIIPNKEEGTLTIRDTGIGMTKADLVNNLGTIAKSGTK
                     AFMEALSSGADISMIGQFGVGFYSSYLVAEKVEVTTKHNDDEQYIWESAAGGTFTITE
                     DTEGPRLGRGTSMKLFIKEDLKEYLEEKRIREIVKKHSEFISYPIQLVVTKETEKEVE
                     DEEEEVKEGDSKIEEVEDEDSGKKTKKTKKIKETTTENEELNKQKPIWTRNPQDVTQE
                     EYASFYKSISNDWEDHLAVKHFSVEGQLEFKAMLYIPKRAPFDLFETKKKRHNIKLYV
                     RRVFISDDNEDLMPEYLNFVVGVVDSEDLPLNISRETLQQNKILKVIKKNLVKKALEL
                     LSEIAEDKENFDKFYSAFSKNLKLGIHEDATNRSKIAEFLRFHSTKSVDEMTSFKDYI
                     TRMPEVQKSIYYLTGESLEAVKDSPFLEVLKKKGFEVLLLVDPIDEYAVTQLKEFDGK
                     KLVCVSKEGLELEETPEEKAEREKEAAEYEGLCSAIKENLGDKVEKVVISNRITESPC
                     VLVTGQFGWSSNMERIMKAQALRDSSMSSYMASKKTMELNPSHPIIRELKGRVAEDKS
                     DKTVRDLTYLLFETALLTSGFTLSNPQDFASRINRMIALGLSIDAEPEAAPAAEAPAA
                     EDAPALEEAGAGSMEEVD"
     misc_feature    445176..445257
                     /note="CT-rich"
     gene            446421..>447465
                     /locus_tag="CNM01530"
                     /db_xref="GeneID:3255212"
     mRNA            join(446421..446693,446905..447071,447210..>447465)
                     /locus_tag="CNM01530"
                     /product="transferase, putative"
                     /transcript_id="XM_568444.1"
                     /db_xref="GI:58262067"
                     /db_xref="GeneID:3255212"
     CDS             join(446487..446693,446905..447071,447210..447465)
                     /locus_tag="CNM01530"
                     /codon_start=1
                     /product="transferase"
                     /protein_id="XP_568444.1"
                     /db_xref="GI:58262068"
                     /db_xref="GeneID:3255212"
                     /translation="MPDKTSSPSAPATTSNTSDRQHTQPQPADDDRSQQPDVESPEPS
                     GAEREQVEEEAAAEADDESDDEEPETGDEIIDMETFQQIMDMDEEDDVDEDSDEKHSF
                     SKGIVWGYFTQAEETFKDMEDALSRKDLSKLSSLGHFLKGSSAALGIIKVQASCEKMQ
                     HYGNLRDEEAGADLDDAEALKRIDALLVKCKKDYKAAKNWMVKMYDDLK"
     gene            complement(447915..449703)
                     /locus_tag="CNM01540"
                     /db_xref="GeneID:3255228"
     mRNA            complement(join(447915..448747,448858..449236,
                     449296..449357,449413..449477,449526..449581,
                     449629..449703))
                     /locus_tag="CNM01540"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534304|gb|CF680145.1,gi|41534309|gb|CF680150.1"
                     /transcript_id="XM_568449.1"
                     /db_xref="GI:58262077"
                     /db_xref="GeneID:3255228"
     CDS             complement(join(447999..448747,448858..449236,
                     449296..449357,449413..449477,449526..449572))
                     /locus_tag="CNM01540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568449.1"
                     /db_xref="GI:58262078"
                     /db_xref="GeneID:3255228"
                     /translation="MSDRVLQLVIASLQHKLPNMLWNARGEKKHKVHVERGDDYQFCY
                     FLRSTTRTEVVLLKSKTVSLRPPTPPPAVLSEPQGSKRKRPTQSRRSNSKAPRQSRAG
                     TRASSRARSVSVRYHDGEEEEEEGDRYEEEETETFEGENAMRGYDPDGIQVKAEPDPD
                     EEEDEFAGQPNIKDWKPDVDVTFKGFGTSSIQLVLIIEPYPPLPPSQYAPPSSRLSSR
                     SASVMSSHSRARSSQTRLRGERESGRYSSTSLSLSVAPDGSTGGGEGGGVRGDNIANM
                     RNASRAPSVANSRRGGTSTPFREESSTPGLSGSGGMGSRRRMSQTPLFMPRDTPFDDD
                     EEDEEEHEMYLSALAEGRERLPSVSHPAGEGRERGRRRGRGRKEEEEEEEDVPESVVD
                     IGERLVRNSEIEQGVVRVQGGWEERGDGEESAVMGRDEPGD"
     misc_feature    448147..448214
                     /note="CT-rich"
     misc_feature    449006..449053
                     /note="CT-rich"
     gene            449942..451897
                     /locus_tag="CNM01550"
                     /db_xref="GeneID:3255091"
     mRNA            join(449942..450158,450226..450405,450476..450683,
                     450730..450835,450883..451258,451327..451481,
                     451537..451612,451673..451765,451822..451897)
                     /locus_tag="CNM01550"
                     /product="endopeptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532262|gb|CF678103.1,gi|41532271|gb|CF678112.1,
                     gi|41560439|gb|CF706280.1,gi|41560446|gb|CF706287.1,
                     gi|41568144|gb|CF713985.1,gi|41568150|gb|CF713991.1,
                     gi|41574259|gb|CF720100.1,gi|41574265|gb|CF720106.1"
                     /transcript_id="XM_568336.1"
                     /db_xref="GI:58261851"
                     /db_xref="GeneID:3255091"
     CDS             join(449970..450158,450226..450405,450476..450683,
                     450730..450835,450883..451258,451327..451481,
                     451537..451612,451673..451765,451822..451833)
                     /locus_tag="CNM01550"
                     /codon_start=1
                     /product="endopeptidase"
                     /protein_id="XP_568336.1"
                     /db_xref="GI:58261852"
                     /db_xref="GeneID:3255091"
                     /translation="MSAPAQDPPPPNPPAGDSSKPQESSDVPQQTTQEIESAEQQQQQ
                     EVEQPKEDTFEDVPEHVVKSDAQEIKMQTRMIDNEIKMMRQENLRLSHEREQMVEKIA
                     DNTTKIKQNKVLPYLVSKVVEILDVDSEEQEGATHNEQNAKKSKCAVIKTSTRQTVFL
                     PIIGLVPHNQLAPGDLIGVNKDSYLVLDKLPDEYDARVKAMEVDERPTETYTDIGGLD
                     KQIEELVEAIVLPMQQADKFKTLGITPPKGCLMYGPPGTGKTLLARACAAQTNACYLK
                     LAGPALVQMYLGDGAKLVRDAFELAKQKAPAIIFIDELDAIGTKRFDSDKSGDREVQR
                     TMLELLNQLDGFSSDSRIKVIAATNRIDILDPALLRSGRLDRKIEFPLPNESAREHIL
                     QIHSRKLNHHGVNFEELARSTEDMNGAQLKAVCVEAGMLALRQNATQLTHEHFHGGIL
                     EVQARKAKEHHYFA"
     gene            452073..454192
                     /locus_tag="CNM01560"
                     /db_xref="GeneID:3255206"
     mRNA            join(452073..452274,452403..452585,452639..452892,
                     452959..453054,453112..453292,453349..454192)
                     /locus_tag="CNM01560"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531759|gb|CF677600.1,gi|41531767|gb|CF677608.1,
                     gi|41535153|gb|CF680994.1,gi|41535929|gb|CF681770.1,
                     gi|41542018|gb|CF687859.1,gi|41542031|gb|CF687872.1,
                     gi|41552722|gb|CF698563.1,gi|41552734|gb|CF698575.1,
                     gi|41556575|gb|CF702416.1,gi|41556588|gb|CF702429.1"
                     /transcript_id="XM_568446.1"
                     /db_xref="GI:58262071"
                     /db_xref="GeneID:3255206"
     CDS             join(452184..452274,452403..452585,452639..452892,
                     452959..453054,453112..453292,453349..454094)
                     /locus_tag="CNM01560"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_568446.1"
                     /db_xref="GI:58262072"
                     /db_xref="GeneID:3255206"
                     /translation="MTAFPPLAAVFLTYFDDIKGQSVLYYSSLPDIPEGTIEHATLPS
                     GLHNLSEDLICFRHHDLPGVGLFRSREKPEGENRGRGRTMGVVGVVLAEGDVADLYSS
                     KSALKEIYDKLENLSQSPFISSVEQDGEREKVLDEVWQKYRADKVKKLEAAMDEGKEN
                     ELDRVHKLITERGRVPSAHPIAFMPLLLGLLGPNIVPVYKAALSGQRILLYSQPPVLP
                     LSALAWNIWALSLPPRAALANGEAEISEYLGNVGLMDLDNIKAKKGGWVATTSDMIFK
                     SHTKLYDIFIDLSSNPLPPSPVSSPSSFTSPSPIILSTSPSSSSATPLTYTLPSLPLY
                     RSLLLLTSSPPTIHAGMWKEGGWWLVIYELLEKVWKVCVGVCEFAVGRGNVGAQGGNG
                     VRLGDDEEEEQLLDNAGEEDLLDLLEEAGDEAATVQEESAPEAEEDEAVRQGRLVLRQ
                     LFHHTYHLHSHLLSVLNGRPRGERSIGQLTDLEVKTLSGRWAGAQDAIFWRGVARRWG
                     AVVDLDEE"
     misc_feature    453441..453559
                     /locus_tag="CNM01560"
                     /note="CT-rich"
     gene            complement(454214..457294)
                     /locus_tag="CNM01570"
                     /db_xref="GeneID:3255122"
     mRNA            complement(join(454214..454318,454374..454505,
                     454571..454672,454741..454920,454976..455140,
                     455197..455469,455523..455714,455766..456334,
                     456384..456615,456663..456788,456835..457294))
                     /locus_tag="CNM01570"
                     /product="intra-Golgi transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537464|gb|CF683305.1,gi|41537470|gb|CF683311.1,
                     gi|41538184|gb|CF684025.1,gi|41538193|gb|CF684034.1,
                     gi|41562377|gb|CF708218.1,gi|41562387|gb|CF708228.1,
                     gi|41573024|gb|CF718865.1"
                     /transcript_id="XM_568334.1"
                     /db_xref="GI:58261847"
                     /db_xref="GeneID:3255122"
     CDS             complement(join(454226..454318,454374..454505,
                     454571..454672,454741..454920,454976..455140,
                     455197..455469,455523..455714,455766..456334,
                     456384..456615,456663..456788,456835..457284))
                     /locus_tag="CNM01570"
                     /codon_start=1
                     /product="intra-Golgi transport-related protein"
                     /protein_id="XP_568334.1"
                     /db_xref="GI:58261848"
                     /db_xref="GeneID:3255122"
                     /translation="MDSSPTPPSPSRSPVPLNPRQLTSPQQIGTQLALLTKRQAELSL
                     SLNALVADREDIDDSLEHLTILGQHVERLVQEVDGGSRSTHGQPRGLGFQPNGHDMYE
                     EEDEGLVERVRKVWETSERVGGKVRRLDVEVGRVKESVDIVSEVIDLKNSLVTLSLAI
                     AKEDWESASRACRRAMSVRKQVIDGNFAGNVVPTSQYPLPPSQTLQELRDTLLQTFRR
                     EFDAAVTRKDQPGVSRFFRLWPAIGAEEEGLEVYGNFVVDLVKARNPTTGKASSPLYY
                     LTSLTNLLESIAHIIDQHQPVVDKYYGPGRMVAVVGRLVGESDRVVRNLVEGWEEERR
                     VGRLIGDTKSSSFLLLSNPSLFPPLFPSLLPSNANPITLATLANSTTSALPNLSSASH
                     LLQSYTHGGRKSTPTQAPSSASSQAGGQQEHEQEGPDPRDVDKVLGELVALGGRWALF
                     RRFIWSRIADEDEDESEKNGEKKEEKGELPEKKPYEVQMGILEQSGSQRAIENLLKVY
                     YEPLEFWFLRMSIEKAHKIDTPDLTTQPHLSSILDDTFYLLKLVLSRLLSCGSLSTLK
                     NMRRKVTEVLERDYTDAIRRKMDNVHSLAGGDRTERERREKDQREAFSIYLNDLDVSA
                     DYMERLVDETLQRIPQVFIEPEIVSVKDELEGFKDIGNRFKSVCKTGLEQLFNQLTRP
                     RLRPILDDAYRDINYLLDDDAFQEAEEMDLVRKRFVKSWDSLILGYRGSFTEHNFQAF
                     FSLAVEVLVRHWEKMILSMRFTELGAIRYERDIRSVANYLSAQTSFGGAREKFTRLQQ
                     IGTILNLDAEEDPQEFYSNSGVPWRISKVEYDSILEQRQ"
     gene            457691..461536
                     /locus_tag="CNM01580"
                     /db_xref="GeneID:3255090"
     mRNA            join(457691..457867,457926..457938,457986..458226,
                     458281..458692,458744..458780,458833..458940,
                     459000..459306,459350..459463,459530..459623,
                     459677..459728,459780..459874,459947..459969,
                     460022..460041,460078..460187,460243..460407,
                     460488..460597,460651..460807,460876..461001,
                     461078..461536)
                     /locus_tag="CNM01580"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544607|gb|CF690448.1,gi|41562310|gb|CF708151.1,
                     gi|41562541|gb|CF708382.1,gi|41564729|gb|CF710570.1,
                     gi|41564736|gb|CF710577.1,gi|41569980|gb|CF715821.1,
                     gi|41569989|gb|CF715830.1"
                     /transcript_id="XM_568332.1"
                     /db_xref="GI:58261843"
                     /db_xref="GeneID:3255090"
     CDS             join(457737..457867,457926..457938,457986..458226,
                     458281..458692,458744..458780,458833..458940,
                     459000..459306,459350..459463,459530..459623,
                     459677..459728,459780..459874,459947..459969,
                     460022..460041,460078..460187,460243..460407,
                     460488..460597,460651..460807,460876..461001,
                     461078..461495)
                     /locus_tag="CNM01580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568332.1"
                     /db_xref="GI:58261844"
                     /db_xref="GeneID:3255090"
                     /translation="MDYSQIDPQLRSLDAQSPDNDSVSGTSNTPPRVLARNSACHQCR
                     KRKLKCDAQKPICGNCAKPRARGKSGDEQPHEDCTWDEPKEPSARTKRRRELAKRQAM
                     ESGHTDGKESGEKTKRARLNELEGRIAAFEGAMESQHYPTTTNPTPVQTLQEAMPYAQ
                     QTESNPYAANGPYDYHRPPFSAGPLSDFTFGPHGHGHDTPNHAIGQNEDGIAREERTW
                     ADQAENQALWENRMGRAALREWSRSENVAVESGPSFSPDGYMGMVFPDWPKDLPPPAV
                     IEHAIRVFFEKVPLLPKMLNKTLLLQSLQRPPSNPNFACVSLLHAILAVTANFISETS
                     LSSPAYFPVGTPSNATIHPEHDFEIPANPLTRGGSCSMHFQSSNFRTAMSPMARFQLW
                     HRRKAFETFYHYVDKGNKFLQSLQAQIIATTVDQYNAWWTDIWLESGSCMRIATPMRI
                     NESPHCDETSLRRYASLLLPPAQTAYEQAERDRTWWMTFILERSVTAATTWPSSMVNE
                     DITVELPCLQSSFDSASGVLGGSQSFQSPDLLTNHPPEHRDVLIPTSKGLSFLIKSLK
                     LLGDVNCFFRRYSRGRHSIAGYVSNPTFRLLLSQINAFRMSFPPEFRRPTQSLPGLGG
                     AKVLDRDLINALWITHSAIMGLGEPLITRDSWMDEGARVTLSAIRATLSLLYDVTSTS
                     YDLSLFSPHCTFVWSLSCRGLVRFMGTALQSGDMVSASVFRSEIEVFRMALKRYGERF
                     PIGIRHLKVVDDLLKEMEVSQVTGLPLSIEYDCRKTNLGDRPIGVSVTEETVSSQVVT
                     PETSSSVGDLSFSATSASTYPDSTSANGSYTASRQINTSQAPKNVKASSVEGLGMNVA
                     GMPAIAATSPLLMNPSPGEGFDISSFSFDVNNVVGMFEGVEGTFIGAEYGLWTS"
     gene            462770..466204
                     /locus_tag="CNM01590"
                     /db_xref="GeneID:3255286"
     mRNA            join(462770..463844,463895..465444,465491..466204)
                     /locus_tag="CNM01590"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535416|gb|CF681257.1,gi|41535425|gb|CF681266.1"
                     /transcript_id="XM_568467.1"
                     /db_xref="GI:58262113"
                     /db_xref="GeneID:3255286"
     CDS             join(462811..463844,463895..465444,465491..466044)
                     /locus_tag="CNM01590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568467.1"
                     /db_xref="GI:58262114"
                     /db_xref="GeneID:3255286"
                     /translation="MFPFGTKGTVAPKAREDRDAIQYASYSARKVANHGPPPLRTYAG
                     EKAAYDFTAGAEDKNIAASEDTKGRGRFFTTSTGLWQRPSVASPASTSSTGGGSQWPE
                     ASAVQYPQPSPGYESQATLFKKRIPTGPAAMVSHDTRPIQSLPSAQADRSRDPRLTAT
                     DIAPDTALKPVETPEKPLDPRLYRPSPYPPSQPTQSPRDLHLPALEQSIPSAVRESNI
                     SAPTLPLPMESTQRAPLWFGIPSKPSTTSSAKSDNSALERTSVKPIAAEKSHVTNPAG
                     DINGQQLNLEAIAAKEGGEQTAMGASKDTEPAAEMVDVKPTPEELEKASSATMPQVRD
                     EDRLEGCVSFSRSELPAEYWSKDAVERRDWRTKLRAEQEKELEKMGRKLMKGHWRDDG
                     VAFDWVLSRNNTGTNGTVKDNEAREVVEVAGATSPRAGERYSQFEEEDFIPLETQTTA
                     RKFIEPGEISERAQNSATATDPTVSDVADALPSSSPQMQQPNPGSQSGEKVGSASAIA
                     LISAPAKHSKAEAKWGPPIIGKPPATGPINRIYKYDIPVPKIMKAGGRFTPEFQVWKL
                     RHRDEASCLDARGCPTREAFLNHNTAADCDILSMKVVPIDMSDPDSWPMTMFPEQVSV
                     PIPASVKLGKEFEVWSAMICERVSEPDWKGRPTRWVRSLHTPSSTAQFKVKWRAKTRE
                     EIESYNGPAIFPSQASLLKLGQKTVDIVNNSSSSSIATPKAGTSAKLNQSLLEQQKKR
                     MSSMLEAEAAEAAKSKRRTSESYFEREWDRGKRPGSPAFKEGRLSKMQKKDKGMDKSR
                     ERDKEKERERERERTRDLDREREVERVREREREREMDREAEGEKRDTALQLNSERRQS
                     PPHYSKSSRTVVSNRILDLAGAPPPESAMSPSANVPALPQVVQRADSESSFARFEVED
                     VMTELHASEPTHLIPEASTAAPSVDQPDRSVVAPGLLPAPSAVSHVTDSHTSSPVPSA
                     PPFATQSVPAISSRLQELRKNVRQKMTEISKWTHLLEDFPDMAETVNVQIQRTQDEIF
                     RLHDVIREEKAKLQD"
     misc_feature    465226..465382
                     /locus_tag="CNM01590"
                     /note="GA-rich"
     gene            complement(466305..470862)
                     /locus_tag="CNM01600"
                     /db_xref="GeneID:3255075"
     mRNA            complement(join(466305..468362,468577..469790,
                     469887..470647,470712..470862))
                     /locus_tag="CNM01600"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41549328|gb|CF695169.1,gi|41555953|gb|CF701794.1,
                     gi|41569739|gb|CF715580.1"
                     /transcript_id="XM_568330.1"
                     /db_xref="GI:58261839"
                     /db_xref="GeneID:3255075"
     CDS             complement(join(466346..468362,468577..469790,
                     469887..470528))
                     /locus_tag="CNM01600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568330.1"
                     /db_xref="GI:58261840"
                     /db_xref="GeneID:3255075"
                     /translation="MPPSSPSKTSTSSLSLDSVHSGQSSLSIGSNNSQQTHSPTKSLR
                     SNSFQTRTQSPVYTPPTRNQPSSSRFLPDQRASQSPPAANVSQNYHQQLNASPSSLSM
                     LPTGFASLHVGIGSPKLEFGREWPGTGRRQRESSLGPEALENDRLMRERAAQEQRIME
                     EIGSGREDEERGGYVDKVSGLPSPPGTESDIAPPVETNHSPSGNGNDASARYEQQPQY
                     QSPPSRPVPSSSSSRRLSRRTSSYSGSSTIHPPEFAAQQARPHQNSSQHNSSASMSMS
                     RSSSSTSVARQSGPLSEQRRAEIFGRSRKSPVSELTKGQSHSANQSFESSGSPSSPRR
                     RGGPPPLDLSPSSYSQAYSPEANGTAKPKFPPVAYNNKVRELPHRPRSSSSRRQITES
                     IKTSVQVDDDPEQKQRGRRKSQGEVLDEKIDEVEEKIAHIRVSPPKRQSIDIASNTTT
                     TPLRENVRQYTPDSYGDRLPGTRASPLVANTQAGRLMTRSMDLETAMEMVNGNSLLKN
                     GSYEHEYEEEERMKNGERSGGSGGSRPRKALPTDFRNGSFVSTPRIYETSIANWRHYK
                     VYSECAENRFIATLQRSCTLNAVPSPSNDRFTCALPFPITPLVSLLNHIPSGPVLDNV
                     DDKSRYHTRTSTVTNNALGQTRETKVRRGVSMLISERDLANANLDFGRRFNSIAPGDS
                     VSVIGTKSERDTSKEKEKDPLDVIRRLEEQRVESKRRWEHMPRSSTSMSSMRDIYHNP
                     YPRKMPVSADVIRHRRSMEHDAPASPLYGRGGGSRLSMIGPRGLPMPATEPRRQRSYT
                     SLGGRSSAALGLDHRMTSSSEHGKLLSEAYRSLESKLTQDGLGTEILGPLGSATKASE
                     SANTVLQAAFNLVKQISLDAVVDEDSAKVREGYKALTMLLRDAGRASDQNVRDMTRVM
                     LDLPKLLRHSNGHGVSPSTPSGSVRPRRSASLANSLAHESPRYGSAGDERPRRWTPSA
                     ASVYSEAGTYEPSPLYNQVGASTPRRSFDVLRASTSMGDSYSPLSARSPRERPASAVS
                     SLMSKVRNMGRTPKRGPLSPKPELATIEQSPDQLPTPQVPTQPFPVLSPLPQSPSHSS
                     LALSRSSHSSLSRSQSVSPEKLSPAKPSPERPSPNILKKKPSVASNHTVKASFPSLPS
                     ASRGKPTTAISQVTAGDLSPETEAMSIRARTTFGPEDEPNSPMSRFSFRSSHQRMGSR
                     DEGGSENGEGETGWARERRDSGFENDAVSILEQNLVLAAKAREEGENRKKERGTEGER
                     EEEGRTKRMTDRLKASLRRSSNKHPGDV"
     gene            <471466..472912
                     /locus_tag="CNM01610"
                     /db_xref="GeneID:3255041"
     mRNA            join(<471466..471524,471583..472118,472175..472912)
                     /locus_tag="CNM01610"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536273|gb|CF682114.1,gi|41565173|gb|CF711014.1,
                     gi|41565228|gb|CF711069.1"
                     /transcript_id="XM_568465.1"
                     /db_xref="GI:58262109"
                     /db_xref="GeneID:3255041"
     CDS             join(471466..471524,471583..472118,472175..472794)
                     /locus_tag="CNM01610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568465.1"
                     /db_xref="GI:58262110"
                     /db_xref="GeneID:3255041"
                     /translation="MLTQAPAFAMAQQRVINPRPAQPILCFPPRDVPIEDIYSYTIPI
                     PPEYSSGQVTKEYQDWEDSQWIHASNLSKHGDPTRTVVTCPRRSTSGHGDHLSVIVGP
                     LVKQVPQRWPRKMFRHERFTPYPFYAGKDPHARDAEIVTWRKKLRAKAERKDARGRPL
                     TWVQIEPQNDGVMIRWRNRLGVRSRKEEKSHCDVSRKSDDTSPNPKTNLPSPAISPAT
                     GESVKAGSHISPSLSPTARRTLLSPCSSLSTSPCSSSVHSSSSTISLQPPSTPTGILS
                     PSLTPSSSAAPSPLLAHPLSPSISGPPSLIIPASIPSSIPTPSPSPSPPPFHHSLTFI
                     KPFAAQSPTVSSEMHQQLTELLAKKDEQLTQWEKLKEEFHNDHHMLKAFDNQIIRLLK
                     EIEEIKQLQRRT"
     gene            complement(<473233..>478049)
                     /locus_tag="CNM01620"
                     /db_xref="GeneID:3255069"
     mRNA            complement(join(<473233..473282,473353..473452,
                     473512..473641,473705..473781,473831..473893,
                     473947..474039,474091..475590,475646..477451,
                     477504..477800,477852..>478049))
                     /locus_tag="CNM01620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568328.1"
                     /db_xref="GI:58261835"
                     /db_xref="GeneID:3255069"
     CDS             complement(join(473233..473282,473353..473452,
                     473512..473641,473705..473781,473831..473893,
                     473947..474039,474091..475590,475646..477451,
                     477504..477800,477852..478049))
                     /locus_tag="CNM01620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568328.1"
                     /db_xref="GI:58261836"
                     /db_xref="GeneID:3255069"
                     /translation="MSTWDHGFLRSSHATRFVSFVQLLTVCPSVLPSHQLSCLSSFLL
                     PTRTKVDSSPRAQIPFATRCLTDAMTDRQSTPTSPISASPKFSHAQAIHDFDPSLLAS
                     TSSSNSNLYLSFKAGEIIRVHVRDPTGWWDGEITSKVAADNDGRTLRRGWFPSNYIRE
                     IEWDPTHRRSESSMSVTSPKSPYKGTHSRHGSVASHQSNASSSSISQILTSPRTDIAP
                     LPAAFQILIQPIVQSLSLLDTAIHNNRKSHIQPSTACVISAIRAALSQTDCLSKESRT
                     LMSWPVLAKERKVVLVELSRLVGCARTASGMTESAGDSSPGGEMEDMEELAKSARGVF
                     QSVKRFLNLAHQCGVQVTLDTQNEGVPMSVSSSSSSEIASVSALVNAPAKSRASPGSN
                     ARLQETFQKRVASIGDLRAAKQRSESPPPLPTGSSQSSKHAHTRTASKANTPISASFS
                     DVSSPISSRPFEHRIQGSMDSVFSHGSTATSEDTHSPWEDRTSVSTAAVQPSTPCGNS
                     IADIHLRISYAEDTLLSIIAAFIGHIHSHHIHSHPSSHSTLIEMTRETIDAVRTLLTA
                     VETVGRNTCIRSKRPKEIESLRVAKDRLYDVAGRLVESAEIVANAPFEEVVEEGYEKE
                     KAGLLGAATGTLRAGTECVRLVRICVPEDETIHFNDTPKQSAPTASGGRQQLTPRINF
                     DNPVMERDRTVGVRGPHTLSSLHRKATSLDHLQKRFMEDGGMVQGRFYGALQNESRQE
                     DEEEEEEVIDEKEEDMTARPSQGVTFPPSPDPSSQEVQLYPTPRPRRPSGELLRGFSE
                     TGRRGPRVRSTSLSTSPTPRIGHMGHRSPSKSADLDKFTSGEDLKLGTDAKPREAGEA
                     KDRWEASGNVTAASSRLSMFTSVSSLPSLTHTDSSAKSASENGDQSTPVKNRKSPHES
                     LRVVIPKGISNQMSELSLQNPAEESVSTAGSSTTLKTLTSRPPVLRTQTSPMPVPVGD
                     ISYLIRSPTYSPADITYNPDGNMVGASLAVLVEKMTPHDGPVDSSFSATFFYTFRLFT
                     TPVDLLEAVQERWFISPPEELLLSEKDEAVWREAKVLPIRIRIFNFLRTWLEFHWQPE
                     VDNVILNDLEKFGREEMAGSLPVMGERLINLVQRKKDGGEDEKRKRESMNGPTSASSA
                     TLHPPAVSGLPPTPIISKNLHSLLKKSTAASSSSSSSSTHIHITEFDTLELARQLTII
                     VSKMFRQLEPEELLMTGKKTVPELKALSTHSNQVTGWVADSILNEGDAKRRAGLLKFF
                     IKLADKCLLINNFFTMFAVLGGLNSSTILRLKKTWDALSVKYKILIERLRGIIEHTKN
                     HAAYRARLRQAPTPCLPFLGLILTDITFTSDGNPTTRPSNSAPDLMLINYDKFAKLGK
                     IAIEFRRYQEPFNFHELEAVQTFLHTVLTERGSGSIDALYRKSCRVPKNYVPMSKNQI
                     G"
     misc_feature    477915..477969
                     /note="GA-rich"
     gene            <478177..484406
                     /locus_tag="CNM01630"
                     /db_xref="GeneID:3255150"
     mRNA            join(<478177..478798,478854..479701,479736..481150,
                     481200..481527,481586..483183,483235..483332,
                     483385..483495,483549..483675,483724..483832,
                     483858..483992,484067..484406)
                     /locus_tag="CNM01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_568326.1"
                     /db_xref="GI:58261831"
                     /db_xref="GeneID:3255150"
     CDS             join(478177..478798,478854..479701,479736..481150,
                     481200..481527,481586..483183,483235..483332,
                     483385..483495,483549..483675,483724..483832,
                     483858..483992,484067..484201)
                     /locus_tag="CNM01630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568326.1"
                     /db_xref="GI:58261832"
                     /db_xref="GeneID:3255150"
                     /translation="MDSPRRNMHGLPPTCLAHLKALLHQWLTQQTAPTGDSKLWSDER
                     VAQIERAIWEGAVLTSAERGSRRESGILEQNWEGWIGGSTKRKSLWREETRQEEEKIK
                     EDEKTKAHASRKSSMGDEDRGRLSLLVMQAGSAASTPSKASTRASSVASTERRQGTDN
                     APQDVNKEKTLEQSDKGKLQEWCRIVSTLDGYEPLSLAKTDDWEDVNIDRVPKSTHQD
                     IPGSFPQSGVSIEYRHSLDNPSQSKGTFSTLGLPSSPPKHDPSNKSYDLLKPVFCLHF
                     PTSHSSYTSAKGHVHKEGSQSTIRIRRDPSLSARSAGSAGSSRWWGSGNKWGDILGGP
                     LLQDEGERIEVDFVQGKFALPFDLFDYPALERQGSKKGRATQRKRRRSIFSALEVVSS
                     SLSTNSSLPSESTSDTTSEADSGLSDTDTDDEQSGKEVKRRIPRRRHRPLSLILSGAE
                     DDIPRSAAERGKMRLVGGTIVVRGLRGGERKGLGEVLKALGADRTKIWTIGMMKLELD
                     LYTAFRLPQEPDPPTTPALCASSSVPLTLPALSPQTSSNPTPRPSGEVSRSNSLRDKD
                     LSWGRESRNEKKGFLSRLGRDTKGVWNGLLGRKRSARDKARGQSGVEGEVYTSPILSP
                     TLPSESSPSLPLFPSQPSSSHHHSPSHSSSSSPFPRFKYSSHPKDPSPDSNPSLHTNP
                     NINTDANANANTNANPPSQHLQTLSSLCTLLPSSTPGLKYPMPPILLRIQEEERIRRE
                     KTQKEILTMSENSSGSGNANGNMLRGKAMAYRPGGDVRSGLHVLAVGMDTLAGWTRLQ
                     LLCVLYCVGLPPPISGSNSGSIANEGAQLGEDGNGEVDEEKGDEGEICESPQAQIIPP
                     TLTIRDYLQHLGEELGENLLCTRSGCEKEVGQHVRWYVHAGVKVGVRVENVKVREDGG
                     RDEDGEREDEDEGAVAGKAEDGRDVEGWVKCTVCREESEPRQLGEGALAYPWSKLLEL
                     LIYTPHLQPPICPHHTTPHAYITLFRTSSYTASLTSSPVKLYDIRLPKLQIGPNVPKR
                     KVGGGRQGMGLMMDDAKEGENGLKREVERWCEALENRIDIMREKIEREYEAAKELSEG
                     SEKTGPGLQEKFDTLLSLSTDFAAFKNNLLESISSTPQGLFNDLRISFSAFIRSSLSE
                     IEAWEKKYLPENADEGLEALKEMIPEYAKEGGRVHALPGSGVLVREDEPASVVAYTLS
                     QVDLNIQVIAFGDANGINRSLAYLIELTNTSKPPDASNPVTATTTPRDPIDSSIPTAP
                     TTGANTPTSASTPSGGGWSTKIDHRDSPRDLLSLRSIVKKKSDASVSLDKAKSTPPAL
                     GLSALSSGAPSLELNLEKVEGVSEGAESGDRMEEIAKAVGKATGQEMTLGTTTAYADP
                     NSLSRRASMTESDTSSLSGVRLSSQMAKSSQAPPSSFRSFRSVSNTPLSRSPMSPLPT
                     ATESTASGARTASTLSPNTATSPGGRDSSWDSVTSSFANSVNSLWKLGSEMGETISSM
                     RSRPRDRSLQSLMGPLSSMDNSLSTLSPRPHLHFTYAFAHKLRLSCTVYFATAFDSLR
                     RRCAIDKVLVQSLQRTEVWDAQGGKSKAGFWMTEDKRFIVKELLSKWTVSDMHALLEI
                     SPAYFHHMAGTHNRATALAKIVGFYTVTIKDSQSGQKRQLDLLVMENLFHNQSISKTF
                     DLKGIGLEGRRVAKTKDGVQEVKLGTTMFDADWLEGMQKGLVLLQPRKRQTHPFRCHL
                     SRYKISFLTIYNGLLTVTRRRHPLLSDKVEQERENGLLIVGLVDAIGSFNLFKTIESR
                     GKMVMNRGGDVTVIPPDQYRERFENAIRHYFVACPDKWSKVSRKVGGLTGCEVSSVL"
     repeat_region   480271..480358
                     /rpt_type=tandem
                     /rpt_unit_seq="ccccaa"
                     /satellite="microsatellite"
     gene            complement(484490..487237)
                     /locus_tag="CNM01640"
                     /db_xref="GeneID:3255054"
     mRNA            complement(join(484490..486370,486423..486891,
                     486969..487237))
                     /locus_tag="CNM01640"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550307|gb|CF696148.1,gi|41550313|gb|CF696154.1,
                     gi|41563920|gb|CF709761.1,gi|41563926|gb|CF709767.1,
                     gi|41572770|gb|CF718611.1,gi|41572775|gb|CF718616.1"
                     /transcript_id="XM_568469.1"
                     /db_xref="GI:58262117"
                     /db_xref="GeneID:3255054"
     CDS             complement(join(484899..486370,486423..486891,
                     486969..487070))
                     /locus_tag="CNM01640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568469.1"
                     /db_xref="GI:58262118"
                     /db_xref="GeneID:3255054"
                     /translation="MSAHPSISTYNSSIHSSATTWKDATAAKTFRTKNARPHIDPEII
                     SLTPSSIFAQSPTAMQSSPSPLFTTSSGWQLPPNTPSPPPPYRSPFATHLTTAATHSY
                     SRLEPTRGMRRQSNPFQSLHSSKQGRKWGGKKFGEATVSLGVGLGVEVEREMQDAEIE
                     RILELADDKSKVLLKRRLEEMKIHVEQQVRAESCQRIMQLENALADAYQTIQRLEKEK
                     VVLEDTMKEVEERITLEYQLAIKASERPRPSGLRPLGLLSKARPASVSLDGEQPTSKR
                     QSMNSVPVSDPPFKRHSFSRHSGIPYRASTLPANLPSTPLPASPDAVSSTADSPLCTP
                     IDSPTHCATSPSTSSSRPKSYRLSQMFTCLSSNSVNARAYEELEMLADSPKKGNVFGA
                     KSEAANKLMTTTPENEQAKRESMRQRRTRPQTMYNWSPPIMEEDFPSKQGDCPITTTY
                     NKLVGRPSLPASLHHNTVDTPQDTFSAYKPPTPPDSNQSHHDHHRSKRAYEDEDEDDY
                     DHGHDTHPYSRTRPHNHSTGITRARKRLSVNGAGHNSEPDDRSLLEGYHATQRNIHRK
                     TQMVGGIDDVSGDGDGGSPFIVSLSSDSTCFPRTSSSPHPHSGSDSASPSSERKLTTR
                     NQQDHVRTHPQTRALDNPYQANPRQMACLLGTIAKCSGWMTMVGFAGLTVGGWMKK"
     gene            complement(490728..492370)
                     /locus_tag="CNM01650"
                     /db_xref="GeneID:3255215"
     mRNA            complement(join(490728..491387,491446..491532,
                     491588..492162,492230..492370))
                     /locus_tag="CNM01650"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540883|gb|CF686724.1,gi|41540899|gb|CF686740.1,
                     gi|41544478|gb|CF690319.1,gi|41544492|gb|CF690333.1,
                     gi|41554983|gb|CF700824.1"
                     /transcript_id="XM_568447.1"
                     /db_xref="GI:58262073"
                     /db_xref="GeneID:3255215"
     CDS             complement(join(490846..491387,491446..491532,
                     491588..492162,492230..492234))
                     /locus_tag="CNM01650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568447.1"
                     /db_xref="GI:58262074"
                     /db_xref="GeneID:3255215"
                     /translation="MSSKNSKIIERQPPNHGRIYSTFKYAVKVPSDITSPQFDILQTN
                     EWIKASLLDSRGLPTRDVTIRRAGKIAKGQNAVLHITVSPLKSHDSTKWPVRLWGIPH
                     LIVPYPKAEWAKWHKRNYNKEIFNQWDAKVKEGFEGKDQWGRTKRWVKTSASKKGLVV
                     WVKEKPQDVIEEESLSKTPAISGVSPSVFYNDRDSQSTHAGSTLETTMLAASPRESTL
                     PKFSAVLRHSPDRIERAISTILTAKKRPIMDIQRPVDPRLSYTSNVVKRPRLSDGPGQ
                     QPSSDDFQGRPTTTFPLSGIKPCIMLNNPTDGAQPSSLNISTNDLHSQIPPSFRSPSL
                     SVPVDTTKASLDLIKSRIIDKKKQLQSWRALMEEFPSMSSTFTMQIERNERELQNLEM
                     ELQKVSGCQS"
     gene            <492912..498599
                     /locus_tag="CNM01660"
                     /db_xref="GeneID:3255117"
     mRNA            join(<492912..493004,493174..493303,493354..493903,
                     493955..494415,494471..494955,495010..495097,
                     495159..495298,495350..495472,495528..495791,
                     495847..496026,496076..496207,496263..496378,
                     496429..496533,496580..496870,496922..497000,
                     497058..497327,497376..497482,497527..497671,
                     497721..497863,497910..498599)
                     /locus_tag="CNM01660"
                     /product="protein ste16, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539503|gb|CF685344.1,gi|41549005|gb|CF694846.1,
                     gi|41549012|gb|CF694853.1,gi|41568429|gb|CF714270.1"
                     /transcript_id="XM_568324.1"
                     /db_xref="GI:58261827"
                     /db_xref="GeneID:3255117"
     CDS             join(492912..493004,493174..493303,493354..493903,
                     493955..494415,494471..494955,495010..495097,
                     495159..495298,495350..495472,495528..495791,
                     495847..496026,496076..496207,496263..496378,
                     496429..496533,496580..496870,496922..497000,
                     497058..497327,497376..497482,497527..497671,
                     497721..497863,497910..498117)
                     /locus_tag="CNM01660"
                     /codon_start=1
                     /product="protein ste16"
                     /protein_id="XP_568324.1"
                     /db_xref="GI:58261828"
                     /db_xref="GeneID:3255117"
                     /translation="MAFSISSRQLPRPSIDSNVTAGADDVEDGETVIEKKDGGADGAE
                     QEKVKANITAQLEAANEHIKSLEAKLERLRGTPQRTRRRPQARLHGYPSSSSLNPLSS
                     SHSSNALLSAQRPRVLRQHSNLTPERDREDGGYFTQGLGTPSRGLPRMGTSSTLASSS
                     GGSGNRPRSRSAGEDVLSASSSWDQSSGILMEDENTSVLLDNVRIFLRRLKEIGRGKG
                     KERPVDNGTEELEVLARLGDMLKKSEGLRLSVELDEIVQSVLPSLDDSSAPKRRAAAY
                     RILRYILTRESWAKMLSAGIEWLFIRTFTRDAKAVHEREQALRLIRSVIVLPPPSLRP
                     ISSPVRSRSHSQSQAYSRSNSRSTKRGVNGDHEEGFVAVVMENKVPLTDGIVRAVVSV
                     AENPDDAMRTICMETLLEIGLLDLECLARSNAFRTVLLTFKDGPAELGPAITGLLLFL
                     VNKPSTRELLLPGSDLEVGIQFSHDQEAFVKLTWVLQTVLVGLTEAYGKIPTRLHGRH
                     LENLEQCVANIGMILASWPGEYSSDHLIRRDDAHSAQGLLYMCMDDCRAIKSLISSLH
                     VPNADMRNALLNLFFQALRIKMPKYMNAFLDGKRLTVYNRTQEATAQQLQESSNEEEE
                     LQSLTLVDHYIALLLTICIESGLLEALIAVIEDGNSTLNRKATLLLGEVLQMANRILP
                     LQFAAQLQSLPRLFTEATDFAKPGDRIAALSALSSIDSLNRNQTKAVRRAAADKAFAS
                     TAQQDSLMRGQRQVQQVKLRLGLQIEDKQFQQMIADSGLLLHRDHNKWNYEVIVDLVE
                     GPLLNPKRLDEAIRATKFVRRLFSFFHPYNNRFSTVKRTRPNHKWVKLGCSLLSTMLS
                     TPEGIRFLTEDKLLKQLLDCFNELDQYVGQPTAQPLFARDRLEGTLTYGYFEMIGTLS
                     KHREGMKLMEKFKFFTCFYHLSEQRSRDDIIRIIIECFDYTLDAHPRIVLSKALTSSY
                     METRLYATHHLGRLLQEQPVLVDWGLQLMITQLYDTAMEVCDVAVMYLEEACTDPMWL
                     EKVVQLRPTLEHLGDVGHPLFMRFVSTSVGFQYLNQAQYIERELESWLAERNLLYVIE
                     AETFISKTIRPWASDTVEDYWVYDGLAPSHFLGELTKTPEGCELLKERGIVAEFAEIV
                     RLHGMEGGDPSVLTNLKSVLWALGNIGSTEGGLPFLEDEEIIMEIVEVAEQSPVLTIR
                     GTCFFVIGLISSTRMGAEILEEFGWIATRTPLGDTTGLCLPNDVSRFVAIDTWERPDL
                     RPFAPNLPKLHGLESEIMTSIANLSNYVLAAGAMNNLKRIRTRHPKYFSSITLFHRAL
                     RTISTNHFQAPVRRFILDLFELKLERPTLIQLAGIEANIWRSAERHAAK"
     gene            complement(499464..>504789)
                     /locus_tag="CNM01670"
                     /db_xref="GeneID:3255105"
     mRNA            complement(join(499464..499585,499640..499997,
                     500050..501969,502016..502144,502198..502305,
                     502355..502465,502518..502739,502787..502963,
                     503026..503100,503145..503356,503401..503500,
                     503551..503711,503751..503939,503991..>504789))
                     /locus_tag="CNM01670"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541300|gb|CF687141.1,gi|41541312|gb|CF687153.1,
                     gi|41560107|gb|CF705948.1,gi|41560114|gb|CF705955.1"
                     /transcript_id="XM_568322.1"
                     /db_xref="GI:58261823"
                     /db_xref="GeneID:3255105"
     CDS             complement(join(499560..499585,499640..499997,
                     500050..501969,502016..502144,502198..502305,
                     502355..502465,502518..502739,502787..502963,
                     503026..503100,503145..503356,503401..503500,
                     503551..503711,503751..503939,503991..504789))
                     /locus_tag="CNM01670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568322.1"
                     /db_xref="GI:58261824"
                     /db_xref="GeneID:3255105"
                     /translation="MSEDEFGDDSIFLDDSFLRQVDTISAQMTAASTSSKNDGLRPVS
                     SIARNSRLATAVSRTASHNEVSPKRSQTMHGVGRTFSAPGPISKALPQQRPAAISRQQ
                     AVSKVPPQRSSDEYDTIDIPTESLDAFDAIIANPPKKPSHPVFSGFPPKPSTSALSSR
                     NTSAPSRPSSSFARHPSSSNKQDSLHQTHLNWRSESRYTKGKRWDRTQFAKTGRRIIS
                     LAGRDKVSGGKGKERESIAPRWEDDAIDEDEFMDDDMGDVLAPAPRDFNAPYGPQKQL
                     PSKATINTYIYPTNHPKRDYQFEIIRNCFLDNTLVALPTGLGKTFVAGVVMLNFYRWF
                     PTGKIVFLAPTRPLVAQQIEACQLSCGIPSRDAAIMTGEGGARKGRERLWEEKRVFYC
                     TPQTLDNDLKNGAVDPRDIVLVVLDEAHKATGNYAYTTIVAYITAHHPYFRVLALTAT
                     PGADVEKVQNVVDALHISRIEIREAEAPEIRKYMNTKHIEKHVVPMSDVIVDFRDRLS
                     ALMVPFIKKLVDKDILTERDLDAKRLRPFRITAKKMELGKSGQRWAFGPLGVLDKMAR
                     AMSHLLEFSLGMFHSSLDEMVSAGGKSKAGAGGANSIANNFEFQRLQRDVSQELSSIK
                     IGRNGKTGADRHPKMQKALELMLAHFSQAEEEENTLGQKNNTRAMVFCSLRPCVMELV
                     DMFNEHPNLLRATKFVGQSNGKDERDKGFNQKEQKKTINEFKAGTFNILVSTSIGEEG
                     LDIGEVDFVVLYDMPRQSIKLLQRIGRTGRKRDGIVHVLMSENREDMNWDTAQQTHRD
                     IQEEILHSRNLELFEDVEPLIPDRKMPECLEQVMPVDPWNPDDPQYKKMMDEGEKELR
                     RMQRAHQPPASRKKKKPMVNEVPENARGFTSVRDLLREADKVLLRPDTEGEDEDAGGG
                     KSKGKGKGKAKAKDPSAPKIKHRARKRARTPSPIQTESEDGEDQSLEALFAVQEKEDR
                     TEKPSTKRKAPVAKVALVTKRPRKSSPGLSTSSLAKTGSSAKASFPSGKSTVDALKAE
                     QGAVSDADTNNNPVSPSPSPFLKAPSPQPPPALPEQAKAMQQKTIQQKRAEAAEKRRL
                     AEARAAEARLKHVQQPLQQQDQQKREQDQAGLDFFHAEGPLRRGLDPFVATSSSPAKA
                     PSSSPQKLRFSSPSRDPIDDEIILPPSPPQRVNARIATSSKPNGNKLSPRTAAAAGFS
                     QIDPIDLSWDDDDEADAANWQVSPSPHVRPLLPKTPGSSVATRSDMPPPPVPSTSRMG
                     IVASSPFAPLVPSAMSTSVGDTQFPVRRLGMARRRIILPSSEENNSPIGPSNNTDVIH
                     SRMQSSGGVVDPDSSPMVPVGARRRPGRLRRRIAIDPSSSPVRNEPSVGSERPHARVI
                     GREGRREDGRQGGEKKKGPMGNFMDLDAELSGNDSGDTSEHSASSIASSSDLNFANEF
                     APTQAPKGYNQRAIYLAGLGTQAQGHGLQFKRDMAKEREEFLQRARRPVYITDEEDGG
                     PKRRSSEDEYELGSFIVDDEDDVGFISHSDPLFD"
     misc_feature    508070..508112
                     /note="CT-rich"
     gene            508109..510483
                     /locus_tag="CNM01680"
                     /db_xref="GeneID:3255106"
     mRNA            join(508109..508217,508445..508717,508779..509099,
                     509151..509316,509367..510483)
                     /locus_tag="CNM01680"
                     /product="metal ion transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534820|gb|CF680661.1,gi|41536292|gb|CF682133.1,
                     gi|41536300|gb|CF682141.1,gi|41540293|gb|CF686134.1,
                     gi|41540626|gb|CF686467.1,gi|41540633|gb|CF686474.1,
                     gi|41541672|gb|CF687513.1,gi|41541680|gb|CF687521.1,
                     gi|41542694|gb|CF688535.1,gi|41553682|gb|CF699523.1,
                     gi|41559822|gb|CF705663.1,gi|41559835|gb|CF705676.1,
                     gi|41560869|gb|CF706710.1,gi|41560880|gb|CF706721.1,
                     gi|41562785|gb|CF708626.1,gi|41562793|gb|CF708634.1,
                     gi|41562802|gb|CF708643.1,gi|41564884|gb|CF710725.1,
                     gi|41564889|gb|CF710730.1"
                     /transcript_id="XM_568320.1"
                     /db_xref="GI:58261819"
                     /db_xref="GeneID:3255106"
     CDS             join(508454..508717,508779..509099,509151..509316,
                     509367..510325)
                     /locus_tag="CNM01680"
                     /codon_start=1
                     /product="metal ion transport-related protein"
                     /protein_id="XP_568320.1"
                     /db_xref="GI:58261820"
                     /db_xref="GeneID:3255106"
                     /translation="MSQYDPIQGGLESSAGPESSAQTSIHSARSSRHRPRRHASIPDP
                     GEMDAAFDGPDVDNDEFDQGETHGLLNNTRDRGMPGDYDFERDYTLPPPSPPPFEPYS
                     AHNPAPGNSHGIIPTTVPARPRRAPPRHFLGGLLPSSFLPRQQSPAPSAGRAVGGGMS
                     GVFDNLAARPDRHTIAEGEGGLQYVPEDESKDAPPSYQAALRDAVPPYWDTTVVLPSS
                     SSPFGPLSSSISGDEILIDGMPSGNFFSFLWNLVVSASFQFVGFLLTYVLHTTHAAKY
                     GSRAGLGLTLIQVGLNLRSKAQDLMKNNTFPAASSDPSDPDPPANHVPSDEEIAENAI
                     EAIWGPGNSPWPAQFREPGTGENGPVTIVHNTHEAEMWAMAHNTTLTQMLNLPSAADV
                     GRANEWFSFFLMSIGWFIVLTSVGGWWRVKRFERGLRAAQQESEAAQAAAAANTAAEN
                     GENGATVPEADESINASTTPVPTQPGPSQLSYYTSPFISAWQGARHIQEGFLGQHGSR
                     SQGRRGLGLWGGLRGQGHTAVSQEDDEHELLDAQGFGLGPMAIDVDEAPGAEVRRQRG
                     LWN"
     gene            complement(510538..512507)
                     /locus_tag="CNM01690"
                     /db_xref="GeneID:3255046"
     mRNA            complement(join(510538..510711,510774..510948,
                     511008..511215,511269..511557,511615..511748,
                     511924..512069,512144..512161,512220..512292,
                     512343..512379,512430..512507))
                     /locus_tag="CNM01690"
                     /product="formaldehyde dehydrogenase (glutathione),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41558268|gb|CF704109.1,gi|41558283|gb|CF704124.1,
                     gi|41564525|gb|CF710366.1,gi|41564528|gb|CF710369.1,
                     gi|41568021|gb|CF713862.1,gi|41569254|gb|CF715095.1"
                     /transcript_id="XM_568318.1"
                     /db_xref="GI:58261815"
                     /db_xref="GeneID:3255046"
     CDS             complement(join(510658..510711,510774..510948,
                     511008..511215,511269..511557,511615..511748,
                     511924..512069,512144..512161,512220..512292,
                     512343..512379,512430..512447))
                     /locus_tag="CNM01690"
                     /codon_start=1
                     /product="formaldehyde dehydrogenase (glutathione)"
                     /protein_id="XP_568318.1"
                     /db_xref="GI:58261816"
                     /db_xref="GeneID:3255046"
                     /translation="MSTEGQVITCKAAIAWEAGKPLSIETVEVAPPKDGEVRIKILYT
                     GLCHTDAYTLSGNDPEGAFPVILGHEGGGIVESVGEGVDNVKVGDHVVPLYTAECREC
                     KFCKSGKTNLCGRVRTTQGKGVMPDGTTRFKCKGQDILHFMGCSTFAQYTVVSKFSVV
                     AINPKAPLKTSCLLGCGITTGYGAATKSPGIEGSNVAIFGVGCVGLSVLQGAKAKGCK
                     RIFAIDTNPKKKEWAVKFGATDFINPKDLPEGKTIVDYLIEETDGGLDFTFDATGNVG
                     VMRNALEACHKGWGVCTIIGVAPAGAEISTRPFQLVTGRVWKGSAFGGVKGRTELPGI
                     VEDYLAGKLWVNEFVTHNETLEGINKGFDDMHAGDCIRCVVDMGFNEAP"
     misc_feature    513443..513579
                     /note="CT-rich"
     gene            complement(514401..>515817)
                     /locus_tag="CNM01700"
                     /db_xref="GeneID:3255248"
     mRNA            complement(514401..>515817)
                     /locus_tag="CNM01700"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41572896|gb|CF718737.1"
                     /transcript_id="XM_568316.1"
                     /db_xref="GI:58261811"
                     /db_xref="GeneID:3255248"
     CDS             complement(514837..515817)
                     /locus_tag="CNM01700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568316.1"
                     /db_xref="GI:58261812"
                     /db_xref="GeneID:3255248"
                     /translation="MPPKTYIPPSINRRSTRLHPPQPFPLQIASTHALDLSSLSDITP
                     LHLPSMSSHQVTDSTPVRPRALSVGATARSHDPIHTHTPTTSVQPRSTISHPQPLVHE
                     IARLYETEMTNRLATHLQHVDTIFQQRFNELHDLFQATHGAALCHSTPLHQADPSLDT
                     SLSTSLTLPLRPTSHQPVAPPTQPPTIPLDPPSSTAVIGKTDFALSTSQSTQLKASDL
                     PKFYGRDDDDIVDWVQKISSIKRGSQATDIDILRLLPSLLRSNSLNYYARLSEKEHTS
                     LTTWAAWSKELQDRFFLPNRLADLKERCIRRHLGQNEKFADYYKDKVYLQ"
     gene            complement(516309..519046)
                     /locus_tag="CNM01710"
                     /db_xref="GeneID:3255182"
     mRNA            complement(join(516309..516540,516589..516665,
                     516729..516812,516874..517273,517356..517530,
                     517608..517705,517835..517849,517919..518005,
                     518068..518270,518342..519046))
                     /locus_tag="CNM01710"
                     /product="(R,R)-butanediol dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41570225|gb|CF716066.1,gi|41574819|gb|CF720660.1"
                     /transcript_id="XM_568486.1"
                     /db_xref="GI:58262151"
                     /db_xref="GeneID:3255182"
     mRNA            complement(join(516315..516540,516589..516812,
                     516874..517273,517356..517530,517608..517705,
                     517835..517849,517919..518005,518068..518270,
                     518342..519046))
                     /locus_tag="CNM01710"
                     /product="(R,R)-butanediol dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546643|gb|CF692484.1,gi|41570225|gb|CF716066.1"
                     /transcript_id="XM_568484.1"
                     /db_xref="GI:58262147"
                     /db_xref="GeneID:3255182"
     mRNA            complement(join(516326..516540,516589..516672,
                     516729..516812,516874..517273,517356..517530,
                     517608..517705,517835..517849,517919..518005,
                     518068..518270,518342..519046))
                     /locus_tag="CNM01710"
                     /product="(R,R)-butanediol dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542514|gb|CF688355.1,gi|41542519|gb|CF688360.1,
                     gi|41546651|gb|CF692492.1,gi|41570225|gb|CF716066.1,
                     gi|41570234|gb|CF716075.1,gi|41571332|gb|CF717173.1,
                     gi|41574829|gb|CF720670.1"
                     /transcript_id="XM_568483.1"
                     /db_xref="GI:58262145"
                     /db_xref="GeneID:3255182"
     mRNA            complement(join(516326..516648,516707..516812,
                     516874..517273,517356..517530,517608..517705,
                     517835..517849,517919..518005,518068..518270,
                     518342..519046))
                     /locus_tag="CNM01710"
                     /product="(R,R)-butanediol dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546343|gb|CF692184.1,gi|41570225|gb|CF716066.1,
                     gi|41571324|gb|CF717165.1"
                     /transcript_id="XM_568485.1"
                     /db_xref="GI:58262149"
                     /db_xref="GeneID:3255182"
     CDS             complement(join(516746..516812,516874..517273,
                     517356..517530,517608..517705,517835..517849,
                     517919..518005,518068..518270,518342..518622))
                     /locus_tag="CNM01710"
                     /codon_start=1
                     /product="(R,R)-butanediol dehydrogenase"
                     /protein_id="XP_568483.1"
                     /db_xref="GI:58262146"
                     /db_xref="GeneID:3255182"
                     /translation="MQAAVSLVQDYMGTEPTSTKSPYKHRQDGSTMRALAWFGKEDVR
                     MVDAPIPDITQDTDVIVKVTGTTICGSDLHLYHSEMLGMQKGDILGHEFMGIIDRVGP
                     SVNHLKIGDRVVVSFQIACGTCRYCQQKLSSFCDKTNDSSVVVNLWGQRDSAFFGYSH
                     LTGGWPGGQSEYVRVPFGEVNCLKVPAEVPDEQALYLSDVLPTSYHAVVDTGVQKGDI
                     VGIWGLGPIGICCVKWALLKGASKVYAIDTNPTRLALARSLGPEVITVDFKADDVKKR
                     IHDEVPQGLDVCIDATTFHEPKTFLHKVEKALMLETDVSETPNEMIWLVKKMGRVGLI
                     GVYTAYTNHFNIGALMEKGVRFIGNGQAPVHLYWEEILHDYIMTGKFDVGFMISHRVD
                     LEDFPQLYDKFDRRVAGVEKVFVQTKASAPPAKGFPALSKVDDWADKII"
     gene            <519310..>520372
                     /locus_tag="CNM01720"
                     /db_xref="GeneID:3255068"
     mRNA            join(<519310..519732,519783..519822,519872..519944,
                     520005..520254,520316..>520372)
                     /locus_tag="CNM01720"
                     /product="carboxylesterase, putative"
                     /transcript_id="XM_568314.1"
                     /db_xref="GI:58261807"
                     /db_xref="GeneID:3255068"
     CDS             join(519310..519732,519783..519822,519872..519944,
                     520005..520254,520316..520372)
                     /locus_tag="CNM01720"
                     /codon_start=1
                     /product="carboxylesterase"
                     /protein_id="XP_568314.1"
                     /db_xref="GI:58261808"
                     /db_xref="GeneID:3255068"
                     /translation="MVQLEKLSSNKAAGSFLTKYKFPSASLALPTQFNVFVPSSASPD
                     SPAPVLFYLAGLTCTEDTGAQKGGFFNTAGKEGIALVFPDTSPRGAGVEGEDDDWQLG
                     TGAGFYINAETDKWRKHYNMYDLIVKELPEVLKEANLGLDFSKWSIMGHSMGGHGALS
                     IYLKNPGLFKSASAFAPICNPAAVPWGINAFSNYLSSSSSWLAHDSSALLPQFADEPK
                     ILVDVGTDDQFLKQGQLQPQTLEKAGKKGVEVRMQDGYDHSYYFISTFGPEHVAFHAK
                     YLKA"
     gene            complement(521013..523631)
                     /locus_tag="CNM01730"
                     /db_xref="GeneID:3255143"
     mRNA            complement(join(521013..521887,521948..522758,
                     522808..523134,523202..523313,523387..523526,
                     523605..523631))
                     /locus_tag="CNM01730"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41565573|gb|CF711414.1,gi|41566995|gb|CF712836.1"
                     /transcript_id="XM_568481.1"
                     /db_xref="GI:58262141"
                     /db_xref="GeneID:3255143"
     mRNA            complement(join(<521113..521887,521948..522758,
                     522808..523134,523202..523313,523387..523558))
                     /locus_tag="CNM01730"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41565584|gb|CF711425.1"
                     /transcript_id="XM_568480.1"
                     /db_xref="GI:58262139"
                     /db_xref="GeneID:3255143"
     CDS             complement(join(521113..521887,521948..522758,
                     522808..523134,523202..523313,523387..523539))
                     /locus_tag="CNM01730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568480.1"
                     /db_xref="GI:58262140"
                     /db_xref="GeneID:3255143"
                     /translation="MSPVAVHNKHGDSASHGTALSKNPHVKSSEVDTEKLVINAIRCL
                     AADLCQQYKGGHPGTVMGAAAIATALWKYSMRYNPANPDWINRDRFVLSAGHACLLQY
                     IMLHLSGYSSWTLDQIKKYHAPTMDGIAAGHPEIEFPGVELTTGLLGQGIANAVGLAV
                     ANKNMAATYNKDGFPIIQNKVWCFTGDGCLQEGVGQEALSMAGHWGLDNMILVYDNNS
                     VTVDGNIDICFTDDTSAKLKSLGWHVLEVEDGSNDLAAIVDAFEQAQKLTGKPVFINI
                     KTIIGIGSINQNSGKVHGAALGEDDVARVKTALGFDPKDKFIVPDAVYDYFKETKIKG
                     AQYEQEWNDLFKRYKESFPSEAAEFQRRLDGKLEEAWENKFPSKDALPKDPKATRQSS
                     GIALRSVIPEDKSFLVGSADLCESTFVNWDGMVEFQNPKSGYGDYSGRQIRYGIREHA
                     MVAAANGLAAWHKGAIVPIMSSYFIFWLYAAPSLRMAALMKLRFIAIATHDSIGVGED
                     GPTHQPIAFPLFLRALPNFNYIRPADAEEVIGAWILGLRDADHPSLLSLTRQPVPLLS
                     GTDRNKVQYGGYVVYGDENSIPDITLVATGSEVARAVDTAELLKDKYSVRVVSMPHTG
                     RFDAQPLEYRRSVIPSTKSLVVSIEPYASFGWAKYAHAGAHMTGFGHSAPYSVLFEHF
                     GFGPKTLAEKIRAWAEPKRNGDGWDIPGVGEFEELLVNSGNGH"
     CDS             complement(join(521113..521887,521948..522758,
                     522808..523134,523202..523286))
                     /locus_tag="CNM01730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568481.1"
                     /db_xref="GI:58262142"
                     /db_xref="GeneID:3255143"
                     /translation="MGAAAIATALWKYSMRYNPANPDWINRDRFVLSAGHACLLQYIM
                     LHLSGYSSWTLDQIKKYHAPTMDGIAAGHPEIEFPGVELTTGLLGQGIANAVGLAVAN
                     KNMAATYNKDGFPIIQNKVWCFTGDGCLQEGVGQEALSMAGHWGLDNMILVYDNNSVT
                     VDGNIDICFTDDTSAKLKSLGWHVLEVEDGSNDLAAIVDAFEQAQKLTGKPVFINIKT
                     IIGIGSINQNSGKVHGAALGEDDVARVKTALGFDPKDKFIVPDAVYDYFKETKIKGAQ
                     YEQEWNDLFKRYKESFPSEAAEFQRRLDGKLEEAWENKFPSKDALPKDPKATRQSSGI
                     ALRSVIPEDKSFLVGSADLCESTFVNWDGMVEFQNPKSGYGDYSGRQIRYGIREHAMV
                     AAANGLAAWHKGAIVPIMSSYFIFWLYAAPSLRMAALMKLRFIAIATHDSIGVGEDGP
                     THQPIAFPLFLRALPNFNYIRPADAEEVIGAWILGLRDADHPSLLSLTRQPVPLLSGT
                     DRNKVQYGGYVVYGDENSIPDITLVATGSEVARAVDTAELLKDKYSVRVVSMPHTGRF
                     DAQPLEYRRSVIPSTKSLVVSIEPYASFGWAKYAHAGAHMTGFGHSAPYSVLFEHFGF
                     GPKTLAEKIRAWAEPKRNGDGWDIPGVGEFEELLVNSGNGH"
     gene            complement(<524470..>525901)
                     /locus_tag="CNM01740"
                     /db_xref="GeneID:3255175"
     mRNA            complement(join(<524470..524478,524578..524737,
                     524798..524966,525022..525084,525138..525233,
                     525302..525427,525502..525559,525710..525768,
                     525874..>525901))
                     /locus_tag="CNM01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_568312.1"
                     /db_xref="GI:58261803"
                     /db_xref="GeneID:3255175"
     CDS             complement(join(524470..524478,524578..524737,
                     524798..524966,525022..525084,525138..525233,
                     525302..525427,525502..525559,525710..525768,
                     525874..525901))
                     /locus_tag="CNM01740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568312.1"
                     /db_xref="GI:58261804"
                     /db_xref="GeneID:3255175"
                     /translation="MSVIDRWGKEIWPHQRIRNRFAWFSLTSLVPRRSYQRWALICKY
                     NPTEPFKTVDAQYPLYGKHSTPPLTPEEWWTRIIYETLREAGASKRELDGKIDAIGPA
                     LMSRFESDLGYRNFPETIACLKELKELEIKTSVVSNADPRILKTLDSLQILPLLTCSP
                     TLSWDVEAAKPSATIYEKACEISDEKVGEGIIMVGDELKADFHGATSAGIEARLIRRP
                     GEWSDGAVRDAKEELGGVNVVSSLEDIVKEVKQRNHK"
     gene            <526118..>532213
                     /locus_tag="CNM01750"
                     /db_xref="GeneID:3255077"
     mRNA            join(<526118..526180,526279..526410,526471..526602,
                     526657..526767,526818..527453,527530..527568,
                     527680..527771,527871..527971,528069..528173,
                     528276..528394,528461..528527,528574..529154,
                     529211..529325,529379..529405,529457..529497,
                     529548..529685,529737..529836,529909..530010,
                     530066..530501,530556..530695,530742..530930,
                     530981..531224,531275..531364,531421..531523,
                     531575..531735,531784..531857,531945..532138,
                     532202..>532213)
                     /locus_tag="CNM01750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568473.1"
                     /db_xref="GI:58262125"
                     /db_xref="GeneID:3255077"
     CDS             join(526118..526180,526279..526410,526471..526602,
                     526657..526767,526818..527453,527530..527568,
                     527680..527771,527871..527971,528069..528173,
                     528276..528394,528461..528527,528574..529154,
                     529211..529325,529379..529405,529457..529497,
                     529548..529685,529737..529836,529909..530010,
                     530066..530501,530556..530695,530742..530930,
                     530981..531224,531275..531364,531421..531523,
                     531575..531735,531784..531857,531945..532138,
                     532202..532213)
                     /locus_tag="CNM01750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568473.1"
                     /db_xref="GI:58262126"
                     /db_xref="GeneID:3255077"
                     /translation="MPEANKALQEEELESLRAIYPDEWHDIPPTKTAWGTEVDAGWWE
                     VKICAMEDERVNVILKGKMVQAYPHQVPPLLLREPEYLTANHVQQLHKIIQDKARSKV
                     GEVMIFELIDTVRDFISENHAPLPSPGDVNLMEEKARREEAQRAAEEASRATEAERKK
                     KELDKNNRYLHDQIQLNTIKKKETANNAKYLEEERRRQESLAMLDIGDLDKRELELDE
                     AIAIDGWEGTWKSWILFGGKRETLWTTYSAEPDRKHNFSQRSDTISFVRASSPNVTVH
                     IVDFANPYYSTPLGIKRIEACTVEALRAQGTMSEHVVKVYAVKREKSPKGWERLILVT
                     EGLSDSMKLRSWIPKEGFGEDLSKDLVSCINETVAKSLAGTGYARRIVDLHRSNPFIK
                     NVIQTVPEEWPRDMWHVGLLLIQMLFGPDTLRTYHSFPTLLQHGLLHPNPKKRLTADE
                     SLAKLRSFDDVTRRAVRISSALLGVSPVNRSLFNFLPNTPQPLTPRLSRYRADFEEVE
                     FLGKGGFGEVVKARNKLDGRFYAIKKVKLRPEDNEQKVYREVNNLSRVNHQHIVRYYG
                     CWLEDANPPDLTPTLEDSVHTASTAGTGATCSTEEDIFAVNFDDFSLSRRDQSRSASF
                     PRIRFTNSNGDDDDDSDEDDSSEEDDTESDTESDSSAATADPSEPRGRSQPQSSLFQQ
                     RPQAQSQRQSIPGKPSASTSVMTSSTSDGMVRRILYIQMEFVEKQTLREAITAGLTDD
                     EVWRLLRQVLSALAHMASLGIVHRDLKPSNILLDGDGNVKIADFGLSTSEMTAIETAS
                     GPIASTIDNIDQTSNIGTSLYIAPEVAISRSYNEKADMYSLGIIFFEMCYPFKTTMER
                     VHILTAVRQPTHDPAARFKATELLRSPLLPTPEKRKEDYDAVIFELTDPKSSHYNTLL
                     DTLFDRTSHNIVDVNHRLVDYTYDNDSDDQLQVWLTVVIQRLVDLFQRHGAVETYLPL
                     LIPETTLLDAFPNLDPVRLIEKSGQVVQLPSSDVLAMGRSATRRQIERIKRYHVGRKY
                     TEHQLGGQPVISGLLSFDIVSPIRSAAAEAECLEVVDKVISEFRGMRGTSSVEYEFHV
                     SHETVLDAILDIIPDRPDKPRLKVLEQFRNLGASNSANPSAQSRNLLSNVTGLSRILM
                     DELEQCCIAGDFEVVRKRLESIFTSTSAKRKLDTALDDMANVINSARACGVARKILFR
                     PTLAKHSEFFRGGFMFECVRKGKQKDVVAYGGRYDSLLEHFKQPVMHSQSRRVFGVGM
                     SIAVDQLARIVSRYESSLSRRLMEKPNEDERSFGYWSPARCDVYVASFPQVDLAHRLQ
                     IIGELWRAGIRADFQYDDGRSLEEVTQECQDQNILYLVIPKASRSTIKIRSILRRSEV
                     EVISDQRRIDASYASAEGSIPSAQAAALSVEPKQAEVEIKLILPPEPISAKGTKGRPV
                     RKHRHGTKLSS"
     misc_feature    532505..532559
                     /note="G-rich"
     gene            complement(532867..536404)
                     /locus_tag="CNM01760"
                     /db_xref="GeneID:3255199"
     mRNA            complement(join(532867..534027,534084..534359,
                     534410..535183,535232..535483,535537..535734,
                     535784..535899,535971..536152,536214..536404))
                     /locus_tag="CNM01760"
                     /product="endopeptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532242|gb|CF678083.1,gi|41532251|gb|CF678092.1,
                     gi|41535053|gb|CF680894.1,gi|41535845|gb|CF681686.1,
                     gi|41536645|gb|CF682486.1,gi|41540696|gb|CF686537.1,
                     gi|41540710|gb|CF686551.1,gi|41541627|gb|CF687468.1,
                     gi|41541644|gb|CF687485.1,gi|41547136|gb|CF692977.1,
                     gi|41548717|gb|CF694558.1,gi|41548726|gb|CF694567.1,
                     gi|41551800|gb|CF697641.1,gi|41551807|gb|CF697648.1,
                     gi|41553431|gb|CF699272.1,gi|41553436|gb|CF699277.1,
                     gi|41558652|gb|CF704493.1,gi|41558656|gb|CF704497.1,
                     gi|41559525|gb|CF705366.1,gi|41560352|gb|CF706193.1,
                     gi|41562900|gb|CF708741.1,gi|41562909|gb|CF708750.1,
                     gi|41563034|gb|CF708875.1,gi|41565131|gb|CF710972.1,
                     gi|41565138|gb|CF710979.1,gi|41569263|gb|CF715104.1,
                     gi|41569274|gb|CF715115.1,gi|41574339|gb|CF720180.1,
                     gi|41574342|gb|CF720183.1"
                     /transcript_id="XM_568478.1"
                     /db_xref="GI:58262135"
                     /db_xref="GeneID:3255199"
     CDS             complement(join(532957..534027,534084..534359,
                     534410..535183,535232..535483,535537..535734,
                     535784..535899,535971..536152,536214..536362))
                     /locus_tag="CNM01760"
                     /codon_start=1
                     /product="endopeptidase"
                     /protein_id="XP_568478.1"
                     /db_xref="GI:58262136"
                     /db_xref="GeneID:3255199"
                     /translation="MPVPAVTTSAAGSLTLLEDPDKDVRVYALNHLLSIVGQFWAEMS
                     DKLPYLELLADPLSKELAPENRPFAALLISKIYFYMGFQDEAVEFALKAGVAFEKESE
                     GEYRETIIAGCLDQAIDKTQKGEDIPADLQSIVDSVLRSSSGENAKLAMGLALSLRRL
                     DLIEMIYLSSRGPSQASSSKSERVVHDENLLRYVLAEVVSGTSGNEAWPEDFRANLFS
                     LLRRLFHLNPNPDWNSITTVWAQSSDVESTVESLVKLLEVDDNLTVYQIAFDLTEVAS
                     QAFIDEVREKLGETKWAAPVDGSEDDVRVVLNNILRGDTSAELFLNFLSRNNKTDMSI
                     LKVTKETLEDRYSIYHSAITFTNAFAHCGTTSDKFLRENLDWLGRASNWAKFSTTAAL
                     GLIHRGSWVNGNRVVKPYLPGGAAPNKYSEGGALFALGLIYAGRVEFAEEELKKGLAE
                     GNDPLVQHGAALGMGVSALASADDEIYDEIRPILFQDDAVAGEAAGYAMGLVMLGTAS
                     ERALEEMLSYARETQHEKIIRGLAMGIAFLMYGQREAANPVIQRLTEDKDAILRYGGM
                     YTIALAFAGTGNNKAVKKLLHVAVSDVNDDVRRAAVTALGFVLFRNHTTVPRVVQLLA
                     ESYNPHVRYGATLALGISCAATGLESAIELLEPMTKDPVDYVRQGAYISLAMILIQQS
                     EAACPKSITIRELFAKVVADKHEDPMARFGASLAQGIIDAGGRNLTLALSTRAGTLNQ
                     NAVVGMALFVQFWYWFPLAHGLGLAFTPTAVIAIDGKMKVPQLELECHARPSLYAYPA
                     TEKKVEEKKKDKQKAAVLSTTARAKARERVKKAEAGEVMETDDKAEESGKGKDAAPTP
                     KKSKPSEPSSFKIPNMSRVTPSQLAYVTFPTSGRYTPVRPLDHSPLSGSNINGKPSTL
                     ASGASASGSIVVLRDEKPEEPAEYIELSKELWPGWLPANPEAAAAILAQATAEGSGGA
                     PGSGVTGQAQQQQQEPEEEAEAPPAFEYPFEDE"
     misc_feature    533538..533576
                     /note="CT-rich"
     gene            complement(537066..>539712)
                     /locus_tag="CNM01770"
                     /db_xref="GeneID:3255130"
     mRNA            complement(join(537066..537564,537621..538851,
                     538905..539381,539431..>539712))
                     /locus_tag="CNM01770"
                     /product="aconitate hydratase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534018|gb|CF679859.1,gi|41538897|gb|CF684738.1,
                     gi|41539369|gb|CF685210.1,gi|41539377|gb|CF685218.1"
                     /transcript_id="XM_568476.1"
                     /db_xref="GI:58262131"
                     /db_xref="GeneID:3255130"
     CDS             complement(join(537191..537564,537621..538851,
                     538905..539381,539431..539712))
                     /locus_tag="CNM01770"
                     /codon_start=1
                     /product="aconitate hydratase"
                     /protein_id="XP_568476.1"
                     /db_xref="GI:58262132"
                     /db_xref="GeneID:3255130"
                     /translation="MIRPRPSIARPLARGLATPAQLPVKDCTSITPPYPRLLKTLDNV
                     RQVLPKNSKLTLAEKILYAHLRNPEESLGGGGKIRGERYLKLRPDRVAMQDASAQMAL
                     LQFMTCRLPSCAVPASIHCDHLIQAQTGAASDLSRSIDANKEVFDFLQSAATKYGIEF
                     WKPGSGIIHQIVLENYAAPGLLMLGTDSHTPNAGGLGMLAIGVGGADAVDALTDTPWE
                     LKAPLVTGVKLTGELKGWATPKDLILHLAGKLTVRGGTGRIIEYFGPGVTAQSCTGLA
                     TIANMGAEVGATTSTFPYSANMRQYLHATGRGPVADAADAAAAKGFLQADQGAEYDEV
                     IEINLSELEPHLNGPFTPDLATPLSGFSSFLNENKYPTTLSSALIGSCTNSSYEDMSR
                     VASIAEQAKAAGLKSKVPFLVTPGSELIRATIERDGLQGTLEDVGATVLANACGPCIG
                     QWKRDEKKGEDNAILTSFNRNFKARNDGNLKTMNFLASPEIVTAMAFSGDLNFNPVTD
                     SIPTPNGAFKFSPPSGDRLPPTGYTPGDLSYAPSPSPKPEPSTQIAISPSSTRLEILE
                     PFGTNFPSGGGELPQLTCLMRVRGKCTTDHISAAGAWLKYKGHLSNISENTLMTAVND
                     EGGQINVARDAGGEEDTIPKTMQKYKAREEPWMLVVDDNYGEGSAREHAALQPRFYGC
                     ALILARSFARIHETNLKKQGILPLWFVDKADYAKISAHDKVTTKGLEDVMAGKGGEIV
                     KIVVEKPSGEKVEIEARHTLSKDQIEWLRAGSALNWIGEQARKAGKV"
     misc_feature    540128..540222
                     /note="CT-rich"
     gene            <540548..>542138
                     /locus_tag="CNM01780"
                     /db_xref="GeneID:3255074"
     mRNA            join(<540548..540610,540642..540740,540794..540826,
                     540952..541104,541156..541244,541300..541499,
                     541558..541601,541649..541741,541799..541863,
                     541932..542042,542117..>542138)
                     /locus_tag="CNM01780"
                     /product="meiotic recombination-related protein, putative"
                     /transcript_id="XM_568468.1"
                     /db_xref="GI:58262115"
                     /db_xref="GeneID:3255074"
     CDS             join(540548..540610,540642..540740,540794..540826,
                     540952..541104,541156..541244,541300..541499,
                     541558..541601,541649..541741,541799..541863,
                     541932..542042,542117..542138)
                     /locus_tag="CNM01780"
                     /codon_start=1
                     /product="meiotic recombination-related protein"
                     /protein_id="XP_568468.1"
                     /db_xref="GI:58262116"
                     /db_xref="GeneID:3255074"
                     /translation="MIGRAGGVSPPTIHPHCLSQTGINALDIAKLKSAGIVTILGVAQ
                     TPRKNLLKIKGLSEAKVEKLKPPAFLTGTEIADRRANVVYITTGSKSVDAMLGGGIAT
                     QSITEVFGEYRTGKTQLCHTLCVSTQLPEDQGGGSGKVAYIDTEGTFRPDRVRAVADR
                     FGVDSNMALDNVLCARAWSSEHQCDLLVDLAIRFVEERAYKLLIVDSIMNLFRQDYSG
                     RGELSERQQKLNQFLARLQKLAEEFNIAIVLTNQVQADPGAAAMFAAASSAKPVGGHI
                     LAHASATRIALRKGRGDERIAKLQDSPDMPEGEATYTLRTGGWEDPS"
     gene            complement(542415..547256)
                     /locus_tag="CNM01790"
                     /db_xref="GeneID:3255232"
     mRNA            complement(join(542415..543021,543071..543373,
                     543437..544932,545204..546058,546188..547034,
                     547081..547256))
                     /locus_tag="CNM01790"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543091|gb|CF688932.1,gi|41543100|gb|CF688941.1,
                     gi|41566824|gb|CF712665.1,gi|41566832|gb|CF712673.1,
                     gi|41570093|gb|CF715934.1,gi|41570103|gb|CF715944.1"
                     /transcript_id="XM_568310.1"
                     /db_xref="GI:58261799"
                     /db_xref="GeneID:3255232"
     CDS             complement(join(542602..543021,543071..543373,
                     543437..544932,545204..546058,546188..547034,
                     547081..547242))
                     /locus_tag="CNM01790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568310.1"
                     /db_xref="GI:58261800"
                     /db_xref="GeneID:3255232"
                     /translation="MNKHAGKQYPQGAQGPAPPLPPGQPPAQQQHQNPYGQTPEQAAA
                     HAAAWAAYYQAQGITQQAYSAPAMPAQPPAAGTPTVNNPYANYGYGAGAQHNKPQPVA
                     GPSQPYRPPPNTQAYATAATQPSLGYGQQQAYGQQQYQAYPARPQPGARPPHQTAAVA
                     GPPPAAAAAPAGQQAYAWGQPQPQASVQQQQQQQQPGFRPQPVAQQAYPAYQQQYYSP
                     AAQQSYTPPPQQPSYRPNVNANPSPSPMQPPAPTPFRPPTQQNRPPRPPMSSPQVGGL
                     ASGPGGGGGFPPAKRPRFDAPPGPAGNRMNNRPPNSNNNNMNNTNSMQAGGPKQGPGP
                     SSTFNAGPSGPAAMGPGAGAGAGMVRPPPPAGGMAAPMRGHPARGRGAPNAPRGPANM
                     RRNANANGNDVSSTFSASSSAGNLPGFNQAGGGGGGGAFKGNKGFEKAQAKKRNQGGK
                     EKDNKEVKPTMTDFRIVGVKFGSGQNVWEWGIVDGKVPDLVGVAVGEGETENQLQAQI
                     ETHDGLVKVEEEEAEPASVSVSAPIPTSQANQSPEKKVTIKQEPESLDPSPVLEGEGE
                     DVAAPSVTGTEALIAEAEDVEEKGKVKDEEKEGKDEKEQEKEKRGEKRKAKSPDAEDE
                     HSAKRTAAYLLAHKKSNLAPNPPSLAKQVPAPGSGDGNTTSTSGFGSGATAATTAATT
                     AGTSTNTAGNNALSKFESNSNRFRIYFNSPPELDRMPKVRGNAGNKRWRRDSSVATSV
                     MAAGGAEKGVEGEGKEQEQGQKVGPQTEHGQEQSEKAEGEPVEGAASTKPDTETQQDD
                     DAAPVPISNAPAHVPVQGEAETNEQDQDQVEQTIEGQLSFAGEGEGEGEELSGYHRPE
                     QEQESGAQETVEEEIGQGDVSMRTDQGDLDASLQGPLDGEVPADGEAETLIENDAAAD
                     ENVVPEEGEGNVVEQDGQDAEDEAALVAADKVESTDAPTTGEEQPSAAVITTPDVPNP
                     AEPSIASEVAPATSASTKEKKVTDDSAEAIAAALAASASNTASAYKTRARRHSSVSTT
                     SEHPRTHGSTTTNTNTNSKGGVPQLKEGQPSWNRLSILWEDSRRRMCFDVDVVEKVRI
                     WRKEGKIEVELKMLETSEQEEGAEARLPKGVLMELWNKNEDRFVPYSISDASSLNSST
                     ESDPTVPPFHLLSPNLSMDKKPLTVTVYLNQKNPLSEPKWLRTNTADAWLFESFESRK
                     GVDAGWRGKLEVVDPDPAPTLQSILDNWASNSSLGTPSSRRAFIADLSSSPNDLLEIL
                     LRLARGERNPTLGTSTVPSFGPLATLIRPDSPFASHQTHVSLAILAMYRLTTDYAAKA
                     GESLEVVEEKVGDIIRTLPTVLVGKSLDGLFKEWQGGDGR"
     repeat_region   546234..546267
                     /rpt_type=tandem
                     /rpt_unit_seq="ttg"
                     /satellite="microsatellite"
     repeat_region   546683..546732
                     /rpt_type=tandem
                     /rpt_unit_seq="ctg"
                     /satellite="microsatellite"
     gene            547367..549666
                     /locus_tag="CNM01800"
                     /db_xref="GeneID:3255166"
     mRNA            join(547367..547464,547512..547531,547582..547694,
                     547768..547880,547943..548461,548515..548595,
                     548667..548711,548791..548920,549014..549103,
                     549202..549389,549445..549666)
                     /locus_tag="CNM01800"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534376|gb|CF680217.1,gi|41534381|gb|CF680222.1,
                     gi|41540601|gb|CF686442.1,gi|41540612|gb|CF686453.1,
                     gi|41567774|gb|CF713615.1,gi|41567787|gb|CF713628.1,
                     gi|41569015|gb|CF714856.1,gi|41572504|gb|CF718345.1,
                     gi|41572513|gb|CF718354.1"
                     /transcript_id="XM_568308.1"
                     /db_xref="GI:58261795"
                     /db_xref="GeneID:3255166"
     CDS             join(547379..547464,547512..547531,547582..547694,
                     547768..547880,547943..548461,548515..548595,
                     548667..548711,548791..548920,549014..549103,
                     549202..549389,549445..549502)
                     /locus_tag="CNM01800"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_568308.1"
                     /db_xref="GI:58261796"
                     /db_xref="GeneID:3255166"
                     /translation="MPSTAQNTLPLPYAQVAAQPRREQRQPTRTSKLGSKLKVLPTQP
                     ETPTIPEEEEDDDGTGRALADHDESEGVEFYTPISQIPKGTARRDAQRLTKSEKAKLP
                     RVTAYCTAATYNLQAMQAYLASRPAYHRTHPRMFDTECLHTPYLPPPTLGPHGMSAHR
                     NSPRLKPVSGAGHVPEGDLLNLGNDYSSTAHKRASSPSRSNQNQNQNEVKRQPGFSKR
                     PGSGRKKSSSGSTSKDTGADGMTDSEREEDDDFEDEWIPDVFLFEYGCVVLWGMTERE
                     EKKFLASIKRFEIERLSAEDVEMEDLNFYYADYSRIYNDVITLRKGSSYMTKLSLSHA
                     LSQSVKISLFEELIMGTIEQTKDIPKSLSETGKIGLPRSEIMKQIGNLFILRININLV
                     GSILDSPEFFWTFPDLEPLYNAARSYLEIGQRVELLNARVDVLQDMLKLLKESVNSSH
                     GERLEAIVIFLIGIEIVLGIITILVDLSFS"
     gene            complement(550022..550816)
                     /locus_tag="CNM01810"
                     /db_xref="GeneID:3255253"
     mRNA            complement(join(550022..550114,550188..550469,
                     550599..550816))
                     /locus_tag="CNM01810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568306.1"
                     /db_xref="GI:58261791"
                     /db_xref="GeneID:3255253"
     CDS             complement(join(550062..550114,550188..550469,
                     550599..550803))
                     /locus_tag="CNM01810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568306.1"
                     /db_xref="GI:58261792"
                     /db_xref="GeneID:3255253"
                     /translation="MFSLRPLFRSSQLTTAARRTLHYTAPALNTSTRPESPVTPVPTV
                     QDGTVPTEYELANGPQADLVSGAPAELLHRPVRIFRPTKNTMQSAKGKTKRWIIDFDV
                     LQGAGRWENRLMGWASSADYVQGTTLAFRSKEDAIYFAEKQGWPYKVDEPKKIEIPPK
                     SYANNYVHVPGKLRIHHTK"
     gene            complement(552855..556340)
                     /locus_tag="CNM01820"
                     /db_xref="GeneID:3255238"
     mRNA            complement(join(552855..553234,553291..553575,
                     553626..553901,553953..554046,554095..554992,
                     555042..555113,555162..555952,556000..556150,
                     556202..556340))
                     /locus_tag="CNM01820"
                     /product="DNA unwinding-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532747|gb|CF678588.1,gi|41532753|gb|CF678594.1,
                     gi|41534272|gb|CF680113.1,gi|41557765|gb|CF703606.1,
                     gi|41559812|gb|CF705653.1,gi|41559826|gb|CF705667.1,
                     gi|41562386|gb|CF708227.1,gi|41562397|gb|CF708238.1,
                     gi|41570315|gb|CF716156.1"
                     /transcript_id="XM_568304.1"
                     /db_xref="GI:58261787"
                     /db_xref="GeneID:3255238"
     CDS             complement(join(552944..553234,553291..553575,
                     553626..553901,553953..554046,554095..554992,
                     555042..555113,555162..555952,556000..556150,
                     556202..556313))
                     /locus_tag="CNM01820"
                     /codon_start=1
                     /product="DNA unwinding-related protein"
                     /protein_id="XP_568304.1"
                     /db_xref="GI:58261788"
                     /db_xref="GeneID:3255238"
                     /translation="MSSPNAGRSSSPLHFPTSSVGGTPRASRVQQLSGSGAPAASSSP
                     LHFPTSSPQASSRAARTPGGLRSDVPSSAAVRRIRDETPLFFPPSGGSTPRRARRGDI
                     HSSFPHSSPSLARRQAQVPADSLSLRASSPGMGTDSFGTPRVFGSAAPTLSAVAQSQL
                     GADGDDIDGMVKFIWGTTISLQESMNLFRDFLRGFKPKYRAVYNAEQSRHAEESGGVA
                     PPPMTLYDNLSAERAEVPLYETYLNRLRLTGETNLNLDALNLLAYRPTKKLYQQLVNY
                     PQEVIPIMDQVLRDVMIELGHEELEKAQTKFAEGNLSQLELSLITNEIRDVESRVYKV
                     RPFGGEKTVNMRDLNPGDTDKLVTVKGLVIRATPVIPDMTTAFFRCLVCQHTVQADID
                     RGRISEPERCPRDVCGSTGTMSLIHNRSEFTDKQVIRLQETPDAVPDGQTPHTVSLCV
                     YDELVDLVKPGDRVIITGIFRSIPVRVNPRQRSIKSLYKTYLDVVHVKRTNTARMGFD
                     PSTRAGESKPPGVGVGGEDDEDELLARQDGDAAMDEDLGSPVRSAAAEMEQRIIELSN
                     HPDLYNILASSLAPSIYELEDVKKGILLQLFGGTNKSIARGGGGGGPRYRGDINVLMV
                     GDPGTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDPDSKQLVLESGALVLSD
                     GGVCCIDEFDKMSDATRSVLHEVMEQQTVSIAKAGIITTLNARTSILAAANPINSRYD
                     PNLPIPANIDLPPTLISRFDLLYLVLDKVDEVNDRKLAKHLVGLYLSDVEDQPADNII
                     PLQTLTSYITYARSKIHPVLTEGASEALVQAYVEMRKAGMDSRTQEKRITATTRQLES
                     MIRLGEAHARMRLSDRVEEEDIREAVRLIKSALRESATDPLTGQIDLDLINTGAGQTM
                     RRARADLKREVIKLVVEKARSQGIRWAAVIDELNKQSSVPVDHAQFAEIVRELEEESI
                     VKVMGERERRIIKSLGV"
     misc_feature    556473..556502
                     /note="AT_rich"
     gene            complement(558294..561510)
                     /locus_tag="CNM01830"
                     /db_xref="GeneID:3255276"
     mRNA            complement(join(558294..558848,558928..559094,
                     559170..559293,559377..559463,559517..559857,
                     559919..560054,560099..561510))
                     /locus_tag="CNM01830"
                     /product="origin recognition complex subunit 4, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535287|gb|CF681128.1,gi|41535295|gb|CF681136.1,
                     gi|41559354|gb|CF705195.1"
                     /transcript_id="XM_568303.1"
                     /db_xref="GI:58261785"
                     /db_xref="GeneID:3255276"
     CDS             complement(join(558642..558848,558928..559094,
                     559170..559293,559377..559463,559517..559857,
                     559919..560054,560099..561493))
                     /locus_tag="CNM01830"
                     /codon_start=1
                     /product="origin recognition complex subunit 4"
                     /protein_id="XP_568303.1"
                     /db_xref="GI:58261786"
                     /db_xref="GeneID:3255276"
                     /translation="MPKRKLSSGHSQSPDPLSMSQHGSDDDDTPLEEQITVKNPPPRK
                     HAVKPTPTRLQAVVEIDVPAHRLRSRTVVSSPSKRTPVKTPVKTPAKTPMTAKRTRMV
                     NDVPSPTPNGKGKGKAKEVPEGEEQPTSSILKASINSNKSSRKLKTPARTPATKASAS
                     TSKGLVNSTPTLASSISKPLPTPSPALLEGSARKRPRLNQFAAKTLDFDNGIFSDPDD
                     EQEQGKDGVVVSTEVFRANERLKKQREARNFTYEGEANAPRMMRSGRALVKVNEDKGD
                     EDEEMDEYGPRLEEENPLAPQAPVIPDVPVEPLLITPSEPLPLSTQEPSSPPIIIPAF
                     QRTYLQAMLNTLTSQNVSINPPPFEDEDHNETLRGVLNLMKGTVERGEGNSAIVVGPR
                     GSGKTRTVARALNLLPCSSSTSPIIVRLSGHAQTNDKLAIREVGRQIAEAEGRKYGDE
                     GTGDEGEDVDDDDDEDYAPTTLPSHLLALLTAPSPRAIIIILEEFDLFTEHARQALLY
                     CLFDVVQSVKTGPTESTPRGIAVLGLTTRVDTLLLLEKRVKSRFSHRIWRVTSPLASI
                     AASNTINGTNGTDGTNGVKEEGGWKRLVQRALVLWKTEEGEVDDEVGKWKGDWEYSVD
                     EILRKPTIQRNFDRLASLTTDVRNIYRPFIEPLIDVINGKTEYLRLDKILNNVVNQVE
                     WAGWGLQSSKLRGLPHPALGILIIAKHLAYAGRDEFNFAQVEEEYMRFSRTRLVGSGK
                     VRWPIGVLKRSFDHLQNLSLLIPTTSTSSSSLNRQQPQFARVRCALAPNEIVAWFKGE
                     GKDVLGVEMGNWGRMMGGHA"
     gene            <562089..>564034
                     /locus_tag="CNM01840"
                     /db_xref="GeneID:3255126"
     mRNA            join(<562089..562164,562214..562344,562462..562566,
                     562635..562994,563087..563461,563597..563793,
                     563863..>564034)
                     /locus_tag="CNM01840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568301.1"
                     /db_xref="GI:58261781"
                     /db_xref="GeneID:3255126"
     CDS             join(562089..562164,562214..562344,562462..562566,
                     562635..562994,563087..563461,563597..563793,
                     563863..564034)
                     /locus_tag="CNM01840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568301.1"
                     /db_xref="GI:58261782"
                     /db_xref="GeneID:3255126"
                     /translation="MNGRTNRSSKSESISENIAVHSDDPVILRTQITSLKAALESAKK
                     KLSEVENYRSDSPVLPDIPFVTPLKPRQAALVLRQEVSRIQREVMILDAGLAYPNPTA
                     GVAVVSQATALHPTPSISSPRQSSASSPSHSSIPNPDSSLRSPFFPPGSPQSFGEWPS
                     PSPQPSAHEGYSLSPGSAGSGRKVSGSAASTRVIDSLQTELLSVKNHLERVKTEVRAG
                     QRRVEQLTRQKEDLQETKERMRVENDSLNNVIARKERLLQEILERARTAETSLKDLQQ
                     THKSLEQATKKKIQEMKQQMNDARVEKTKAERECVSLRDGVKSLRDVWAREVKALKEE
                     IRRKEEGDKKEMEEAGNAHTAQLSAERASTQELINKTLSNYTALHGHFETETSSLRAR
                     AKELEDIVDKQAKENASALQQVEKLAGELQRLRRLMREMPSEELDKAMTAGNKVNDRS
                     EETDEENQAGKVKSQNATKTG"
     gene            complement(564469..>565582)
                     /locus_tag="CNM01850"
                     /db_xref="GeneID:3255203"
     mRNA            complement(join(564469..564536,564592..564718,
                     564799..565207,565292..565387,565466..>565582))
                     /locus_tag="CNM01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_568299.1"
                     /db_xref="GI:58261777"
                     /db_xref="GeneID:3255203"
     CDS             complement(join(564470..564536,564592..564718,
                     564799..565207,565292..565387,565466..565582))
                     /locus_tag="CNM01850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568299.1"
                     /db_xref="GI:58261778"
                     /db_xref="GeneID:3255203"
                     /translation="MTPSKSPEPSDTAESSGQALERYIVEQLSSLSLSAPQDDIEMMA
                     RFVEEEGLERDEKTEGVKGMLEGVVEGGVLPEEGIDEVLNQIIDEQARLHQLDLDRAA
                     AEEESARSPSPESSKVNDILATLTPEELAAARRQALLRQYAYVDSPDDAPVSSPFGGE
                     GRPEGAPPKGGKVAENEEKRKAEERRKLIEDALRKDSKKKKHRKNDEMDLLAPNLNKE
                     KATYVMAMQREAQKKASQEKKDRDRAALEKQRADQAKAKADKQKRAAKQERRA"
     gene            complement(565838..568130)
                     /locus_tag="CNM01860"
                     /db_xref="GeneID:3255242"
     mRNA            complement(join(565838..566420,566472..566774,
                     566826..566851,566906..567020,567073..567385,
                     567438..567500,567557..567647,567709..567759,
                     567824..567863,567929..568130))
                     /locus_tag="CNM01860"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536484|gb|CF682325.1,gi|41536487|gb|CF682328.1,
                     gi|41539329|gb|CF685170.1,gi|41539337|gb|CF685178.1,
                     gi|41542265|gb|CF688106.1,gi|41542273|gb|CF688114.1,
                     gi|41544488|gb|CF690329.1,gi|41544496|gb|CF690337.1,
                     gi|41550437|gb|CF696278.1,gi|41550451|gb|CF696292.1,
                     gi|41551619|gb|CF697460.1,gi|41551625|gb|CF697466.1,
                     gi|41554499|gb|CF700340.1,gi|41554516|gb|CF700357.1,
                     gi|41557305|gb|CF703146.1,gi|41557312|gb|CF703153.1,
                     gi|41558363|gb|CF704204.1,gi|41558376|gb|CF704217.1,
                     gi|41561348|gb|CF707189.1,gi|41561353|gb|CF707194.1"
                     /transcript_id="XM_568294.1"
                     /db_xref="GI:58261767"
                     /db_xref="GeneID:3255242"
     CDS             complement(join(566011..566420,566472..566774,
                     566826..566851,566906..567020,567073..567385,
                     567438..567500,567557..567647,567709..567759,
                     567824..567863,567929..567977))
                     /locus_tag="CNM01860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568294.1"
                     /db_xref="GI:58261768"
                     /db_xref="GeneID:3255242"
                     /translation="MTVLSRLSQLRVGAARYNSPWTQVIIVGFVCFCSVGMFSAVSGL
                     GAGGTQDTALSDTANAVLYGVFAIMGIFAGSINNVLGPRLTLSIGATGYSLYVGALWA
                     FQVHGTRWFLILAGGLLGVTAALLWSAQGSIMMSYSLEKDKGRAFSLFWSIFQMGTLI
                     GAAIALGIQAHSTLPSVSTGVYLAFMIIQLTAIATSWLILPPHLVVRGDGTIVKLDDA
                     ISPKEEARHFLKMFKDWRMLMLFPMFFASNYFYAYQGAITAFLFNGRTRALVSLLTGL
                     GAIVGAILIGVVLDRVPLSRRKRSMVGCLTVVVLNIVIWVGGLVFQVKFTRSTDHAVW
                     DWSDGAATGPIILLMSYYIGDAAFQGLAYYTMSCITNDPFRLARMAGYYKGVQSAGAA
                     VSFGMDAVATPFLTEHLVSWIILLVSLPLCGYVLWTANETNYEVEGVVKVEDVEGNAV
                     EGAALPKGHHMHQKEKVSTDEKFEGNIAKVMSVQKE"
     gene            569193..>571206
                     /locus_tag="CNM01870"
                     /db_xref="GeneID:3255155"
     mRNA            join(569193..569467,569541..569641,569705..570020,
                     570091..570111,570166..570248,570308..570512,
                     570571..570754,570813..570889,570952..>571206)
                     /locus_tag="CNM01870"
                     /product="streptomycin biosynthesis protein StrI,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41543467|gb|CF689308.1"
                     /transcript_id="XM_568475.1"
                     /db_xref="GI:58262129"
                     /db_xref="GeneID:3255155"
     CDS             join(569273..569467,569541..569641,569705..570020,
                     570091..570111,570166..570248,570308..570512,
                     570571..570754,570813..570889,570952..571206)
                     /locus_tag="CNM01870"
                     /codon_start=1
                     /product="streptomycin biosynthesis protein StrI"
                     /protein_id="XP_568475.1"
                     /db_xref="GI:58262130"
                     /db_xref="GeneID:3255155"
                     /translation="MTAQVRTLPTESTSLFSPAAVLTEIDEPEFKRPKVSNSDSLQDL
                     AESKTTKHVTVAVIGAGQRGLVYTSYALEHPELVKVVAVAEPRAHRRKVMSRLHSVPP
                     ENQYASWEPLLARGRIADALLITVLDDLHAELVSAFAPLGYHILCEKPMATSVQDCVK
                     MVKEVELSGAGIFGIGHVLRYSPYNRAVKEVIDSGVLGEIVNIQHIEPVGNQHFAHSF
                     VRGNWKKESESTFALMAKSCHDLDILSFYLSGLEPRKVHSFGSIHHFKNSKKPAEAGD
                     AKRCLECAFEKDCVWSAKKIYIDGLKDEGHKDGKWAQHIVDADVLDIENVTDALKTGP
                     FGVCVYEAGNDVVDHQVVNIEYEGGVTASMTMVAFTEAICDRGTRIQGTKGELIGNMA
                     SFTVFDFLTRTKTQHTPKSLPGNHGGGDAGLSETFFEAVSKSDQSVLGVTPEEVLNSH
                     LLAFAAEQARKEGRVVDFAEFKDKAMAY"
     gene            572512..576290
                     /locus_tag="CNM01880"
                     /db_xref="GeneID:3255136"
     mRNA            join(572512..573493,573545..574512,574567..574903,
                     574948..575052,575199..575970,576032..576290)
                     /locus_tag="CNM01880"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533671|gb|CF679512.1,gi|41560858|gb|CF706699.1,
                     gi|41575321|gb|CF721162.1"
                     /transcript_id="XM_568470.1"
                     /db_xref="GI:58262119"
                     /db_xref="GeneID:3255136"
     CDS             join(572678..573493,573545..574512,574567..574903,
                     574948..575052,575199..575970,576032..576168)
                     /locus_tag="CNM01880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568470.1"
                     /db_xref="GI:58262120"
                     /db_xref="GeneID:3255136"
                     /translation="MSLPQRLPILTPPNHGPPPLSSHPASAPMHQSRGHHQQAMYFHY
                     PQSAHPSQFHYVPPPLVAPVLETRPSNSHHTNGNNADGDTPWLTRDFPPNSHMHHAAS
                     QSQAGGPSHPHIPRRMTYQPSPSDPMVEYDQWKSSRRNSQISSVPPRYLEHEPHGCEK
                     ERGHKNEFSQPESSAAESQIKWQKKRPRTTSMSQHESIMNTTQQSKPPQQSEQGSSTA
                     EKLVYPAVLTREKKQKACGNCRKAKLKCMLEPDGNVCVRCKARKEKCAFYPKGHDEDW
                     QQTLQSDLYAATNHLSQLSAAVNHMLSHLVSQNIIPPFSPPLKHYEHPDRDAVLTYME
                     NTKKNSMTEGGSTEEGTKKSKKRKGSKSEDSAEDGGSVPLANSPDGTDKPQNSSSSEI
                     TVPQPMQSHPEQSSHELPDTLFPSYSPSDIIPNQSLPSISSQMFSPTSSSARLGPTQQ
                     SFSLPPLHSDCMATAQDQRVTPTSLQNHSPTSGISSSPPQPTLPQSDDARQITSSVPP
                     EYAGVTHAPTQEEYGPQSQGGGYAQSGTQRHLTSSLRDEPIKGQYEVEGEYEDENGME
                     IVLGSKDPRQDIIKKNIVKNKDALILVNYFHGHLSSFLYGYRLQFRKFPYLEGGPSTI
                     TPLILAVLCLISSERFAIHQHYRLPLIDEVQALLGTSPAESWQSFEGDQSKGFGDVEA
                     DDPLDAEFGLGPEEIVAACVLATYMMGKGLDQGEIVFLLLFGRDLMGRASVVVVDASK
                     GDIVDSTERLQFTDIPAPLSRDALSYCNLLIPPSTSYQSPFFSPGSPPRPEDAPDPHD
                     ILLTSHARLMTILNEWRHRLEQIDVPGANRQVYVAQLKRLAGKVNGELEWWNAGYQAT
                     KPSYVNGNNGEEGIGEGKGLRWRYTEMTWLFVKMLVNSTVSKALSPSPAVAPHTRPLV
                     PSVTSTSASNNSTTLSTSDSKLREASIALVVDCALEILEMCARWVPREEITNFGPTYL
                     YFITLAGSELVSALGDGGGEGVVSIDELITLFRTVGEALFMGELHEQHVTRMTGKSLF
                     YNCDQLGMMKSWRQ"
     gene            complement(576289..578078)
                     /locus_tag="CNM01890"
                     /db_xref="GeneID:3255154"
     mRNA            complement(join(576289..576721,576794..576960,
                     577021..577089,577153..577472,577520..577831,
                     577880..577942,577999..578078))
                     /locus_tag="CNM01890"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532879|gb|CF678720.1,gi|41532884|gb|CF678725.1,
                     gi|41559187|gb|CF705028.1,gi|41559191|gb|CF705032.1,
                     gi|41560905|gb|CF706746.1,gi|41560909|gb|CF706750.1,
                     gi|41565062|gb|CF710903.1,gi|41565068|gb|CF710909.1,
                     gi|41567073|gb|CF712914.1,gi|41567084|gb|CF712925.1"
                     /transcript_id="XM_568292.1"
                     /db_xref="GI:58261763"
                     /db_xref="GeneID:3255154"
     mRNA            complement(join(576289..576721,576794..576960,
                     577021..577089,577153..577472,577520..577831,
                     577880..578078))
                     /locus_tag="CNM01890"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532879|gb|CF678720.1,gi|41549440|gb|CF695281.1,
                     gi|41557751|gb|CF703592.1,gi|41559187|gb|CF705028.1,
                     gi|41560905|gb|CF706746.1,gi|41565062|gb|CF710903.1,
                     gi|41567073|gb|CF712914.1"
                     /transcript_id="XM_568293.1"
                     /db_xref="GI:58261765"
                     /db_xref="GeneID:3255154"
     CDS             complement(join(576339..576721,576794..576960,
                     577021..577089,577153..577472,577520..577831,
                     577880..577933))
                     /locus_tag="CNM01890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568292.1"
                     /db_xref="GI:58261764"
                     /db_xref="GeneID:3255154"
                     /translation="MSDIVRFTNGYLAMPDGTAVKADLYISSSSGKIISGQSSFYSNH
                     SPCRTVDLQGNLLSPGLIDIQINGAWRVDFSELDVQAGEEGEKKYIKGLERVARRLAQ
                     YGTTSFVPTIITQHQELYSKLLRLLCPRSPPGSSHILGYHAEGPFLSPIRKGAHSSTL
                     LLTASSTSPIFPPGASDTSPMKALEIVYGKEGLDQQGVKIITLAPDVDGVMDCIEPLV
                     ERGVVVSVGHSDASLEQVEEAFDKGARMITHLFNAMPPIHHRDPGVVGMLGNPNRRPY
                     FGIIVDGLHSHPNTVRIAYGACEEGCVLVSDAQSIMDPSQPDGVIDWRPGLRFRKEGL
                     KVLVDGTSTLAGSAAPLAPLAHNLAKFASISLPMALVCATKHPAECLGGEVAKRKGQL
                     IEGFDADLCVFDWEGNVKDVWIMGEEIWKDGEGWVDGRGDGP"
     gene            <579104..581123
                     /locus_tag="CNM01900"
                     /db_xref="GeneID:3255173"
     mRNA            join(<579104..579324,579375..579955,580016..580178,
                     580242..581123)
                     /locus_tag="CNM01900"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542285|gb|CF688126.1,gi|41542290|gb|CF688131.1,
                     gi|41546556|gb|CF692397.1,gi|41546566|gb|CF692407.1"
                     /transcript_id="XM_568477.1"
                     /db_xref="GI:58262133"
                     /db_xref="GeneID:3255173"
     CDS             join(579104..579324,579375..579955,580016..580178,
                     580242..580944)
                     /locus_tag="CNM01900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568477.1"
                     /db_xref="GI:58262134"
                     /db_xref="GeneID:3255173"
                     /translation="MLQENGSGLVSDQPTVTGDQVSDVAMPTRLPTPPASPTVPQLIL
                     CADGGGSKVCVVVRSADGLEVRGTAGPCNVQSVGYAAATQSLLLATYRALAQLPRSHI
                     PHNLLMPSIDLSDSTRSSPQLQAVPMILKNQLPSPPSSIGSKSVVIHNLPSVMNNLTL
                     EPPSASSSFSSSSSLPPSSSPSTTHSSPTSIPLTHLSSYPTLTDKSISTPNPGNPTPR
                     TRLPPLSVPIFQYAWLALAGISCKADEQAFAKVVCGVLGLDMERLKVTNDVNLLAAPA
                     LDLPDIDHVIALVAGTGTVGRAIKVGDKKRGLPLEDVAMSRGWGYLLCDEGSAFWIGR
                     LAIRALLSLSDRHASSGIYSSPPPPFLPLHNDLLAYFGTSNPLDLINVASLTASGMAE
                     PTESVGEATSRRNALLAGAARVVFKHAFPGDVSPRPGFLTPPRSTDGGADMDEDHEST
                     SSPRQPEELKHDGILDHASHLEALGIARQAAAPLITLTLSLLGDRTIVRPERSALTLG
                     GGLMMSEGYREMLLDGLKKEGVSFGRVMVVGDAAGEGAQALGRVEFE"
     misc_feature    579641..579699
                     /locus_tag="CNM01900"
                     /note="CT-rich"
     gene            581388..587062
                     /locus_tag="CNM01910"
                     /db_xref="GeneID:3255297"
     mRNA            join(581388..582014,582066..582668,582732..583552,
                     583656..585192,585248..585834,585970..587062)
                     /locus_tag="CNM01910"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534171|gb|CF680012.1,gi|41534181|gb|CF680022.1"
                     /transcript_id="XM_568291.1"
                     /db_xref="GI:58261761"
                     /db_xref="GeneID:3255297"
     CDS             join(581705..582014,582066..582668,582732..583552,
                     583656..585192,585248..585834,585970..586911)
                     /locus_tag="CNM01910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568291.1"
                     /db_xref="GI:58261762"
                     /db_xref="GeneID:3255297"
                     /translation="MRTERGPKPTPEMSTNGHAPAPVPQQKKGFFRRLSLASGGSNST
                     AQVQPSNKLGKRNKEKETQVQGQAYEQLDAGSAPSGFKVTADMKRTKSKDRGFWSRGD
                     KSTTPTPSLASQSSKPPIPPPATSSYIRPSAFPELDSSSGPYPSFPTANPSHQQQQQH
                     SQQSYRQQPSFGGFSQEGPYPQIRQFPQPQIHQPRAQYPQPQQQQQPQQMYQQQNQFK
                     PFRTPSQNRAPVHPALASSPSPVSTTTASPAQKADPTGSGSVRSPYGSPQDGRAPRAF
                     GGPSLGQENVRPVNGREEGARKVWLNGEEPRAPPQLQPINPAPRSSSRTYPVMRSTPP
                     PEPFVSPPPRAPNPPSGEPSMPNSANVASHNPNANSNGEGSWKMMAPIAAARAEAGVN
                     GNAGVSHTRERSGSLRPQPPPLIIPSDPRQPQTQAQSYPPVQPPPRIQPQSQPQPQPQ
                     YQALPETQNIQSSQSQSFSQPQAQIQGQIERSRRAEQKLQEVQRGRNQNRDSRFEDAE
                     HFEIPREAPPAYTPSPARERVVSPVASLSLPPGAAPAQVGGQSSQVQQQQQQQRHQQQ
                     QDFTVAAARPKEPNSSTQSQIPSPITPRPAPPIPSNSSPTVLTRATQSQPHPQIPNQP
                     PTTPIRPRSETPRRMDRDGREPMSEASKYARAVAVAMRSDSVSSSETGARHATVTSRG
                     VGAGAGVWDIAAEKPSTPSKMERLHTPKASMNSPVGSEQGDGSPRKRALPQVPGGGAS
                     VGPGVGVNQRGSMIVPKGGKAPAQVENQVETEGTPDKRFEKEIRTEEPPMIREERPVP
                     VEKMEKEAPPLPLEKDNLRPPEPIAKSPKIDRPVSQTLAFEFPRSPTLPPLVDPRNAP
                     PSSTTSPLATPSAHQGSEQEHDPISKWAAGMEKNNETVKTSGTLLMPSWGGDAPPPRG
                     SSMQGLGVPSGLSHPPPGKRTVSSPLSGRSSPMFMSPIGGMPSPRAPIQNQLQYPNQS
                     SRSVSQPLPTLPNSNSIPTLPPLLPSEPIPELVPRGPRPKATITFILAYPSIQAALLP
                     YLPINSFLSLTGSSEQVRRRFTGEMVGRWVMREWGMAVAKEKGGEGGKGGWPNLTVWE
                     GFLESLLHDPASFSTYPAQWHSLLRHLCLSHTLVTLHLRSLPNNLFPNPPPMAFEDDF
                     ALAAPNLPFSLSHNSLSNQGRPKSRVNSFVGSDSGSVTAPVTPSGGMKMPKAERLVEI
                     VMPEPLASRPADEVDSPVSQRFPPSAGSNQIRRRGSNGSLASTVSMPFMRKRPSSSAM
                     SLSEMPLHRSAAPMPASGKANLPPNARMWSAASSRASFAVSKNAPPVPGFPGAADLPM
                     PPPIGGGKRGSFSSLSEHGRSSHSGNSPVDAMGKRELYTPSPPVSKRIEPAFDKPMPY
                     SLEKAPLLRVFVPLTEVVQKWPSAEGAAAAVRELEKCGAMRKLKLGDLIINTAIRAPK
                     TTEHVLIYVPFTQHLLLPLSYTFSPTGHLPPLVNAFQLPPSYYYPFLPTPQIVYLDLA
                     PFGEEALASLRLAYDRRDMIVASGARVSAKRYLHVAGFQVKSGDGTEPGWEGFVSLEG
                     EGTAEGKRDIEKRLVGARGGRPIVGPWEVVRDKCMVGNIWLKLVKEE"
     repeat_region   582353..582382
                     /rpt_type=tandem
                     /rpt_unit_seq="cag"
                     /satellite="microsatellite"
     repeat_region   583082..583240
                     /rpt_type=tandem
                     /rpt_unit_seq="ccccaa"
                     /satellite="microsatellite"
     repeat_region   583481..583519
                     /rpt_type=tandem
                     /rpt_unit_seq="cag"
                     /satellite="microsatellite"
     gene            589832..594166
                     /locus_tag="CNM01920"
                     /db_xref="GeneID:3255088"
     mRNA            join(589832..589931,589989..590825,590876..591105,
                     591157..591873,591925..592164,592243..593639,
                     593689..594166)
                     /locus_tag="CNM01920"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550207|gb|CF696048.1,gi|41550215|gb|CF696056.1"
                     /transcript_id="XM_568472.1"
                     /db_xref="GI:58262123"
                     /db_xref="GeneID:3255088"
     CDS             join(590225..590825,590876..591105,591157..591873,
                     591925..592164,592243..593639,593689..593872)
                     /locus_tag="CNM01920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568472.1"
                     /db_xref="GI:58262124"
                     /db_xref="GeneID:3255088"
                     /translation="MTSALLPTGQTLKGSAIMSQDFSIYREPADYHHSRLRDNISTGG
                     SHYARSASHAYSEPASSQNFANSSPSPYPAQYRTPEEYIATPDSTVPIQQQQQAVYSR
                     QAQAQAQQQQQMYQQQVYAQSGHPLSSQVAGPSSYRKPSANSVPSSSTIPEYRDGQAS
                     GNMSIIQGVNGHGGVERRDRGNRMTDPDAENDGRVGVEDPRADRVYTELKCLGDGSFG
                     TVWLCDWHSPVKPDVLLSAMQCGAGARPEWSGKRLVALKRMKRVWEGGWTQAKSLGEL
                     VSLRNIPPHPAIIPLYDAFISPKSRELYFVFECMEGNLYQLTKSRRGRPLAAGLIASC
                     FHQISSGLYHIHGHGYFHRDMKPENLLITTTGLADYLTAEALAEINMAGGDINRVGDL
                     AYEKDVSVIVKLADFGLARATNSKPPYTEYVSTRWYRAPEVLLRSSEYGPPVDMWALG
                     TILAEMLNLKPLFPGVSEIDQVYRICDTMGDPSSEYGVDERGMTIGGGPWNSGIKLAK
                     NVGFSFPKRKPVRFRSLFNDSVPQSLVDCIADLLRYNPKYRMTAAQCIDHPYFHETLP
                     HLQQTLPLPRIPFSAGQPPPHAIPRPTLSTARPAFANGDIRTLPPPIGTPDSQASSQR
                     AFFPQHIPPHVSSSSLVHQLRELDLPTDDLGSYGQRPPEAAAADARAAQYAQSPVQLH
                     QWVGDLQIDSRKPSAAQSMMYDSSVTEESQGGRSNQSLPNYSNVSLEQQPQVQVPPQS
                     GQSAQSYGRSNISVAAYVQQQQRYAQEAPAQQVTAPAAPPPIEPTVGAARAEKLGVTS
                     KKKKWGLSSVFGGADKSTASLAAVDEHEYSGTSLKRTQSGHRTIDRNPSVAGSSLTLG
                     VPALGMNSSAGASSISVLDDPKKAKKEAERQAKELAKAQREAAALKQKERARAVMQKR
                     NQLIESRSQLKTKGEIEYSSTNLASEAPTPNQDTRSIYASSSASVNQMRNYAASPVNQ
                     SLQSIRSQDSGHSGHSGHSGHSGHSGRSGRSGRSGLNASALADLDEHGRWDEMRHKAR
                     RRDDDDDHSMSSFGHNPLRSRSVLTVGTVDSDPGPRRRSEWADPLLRRDKRTTSASSA
                     SLQYQQSAQTLPSFSDIANYAFEGRNKQSQPPQQ"
     gene            <594806..>596517
                     /locus_tag="CNM01930"
                     /db_xref="GeneID:3255275"
     mRNA            join(<594806..595393,595453..596392,596492..>596517)
                     /locus_tag="CNM01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_568290.1"
                     /db_xref="GI:58261759"
                     /db_xref="GeneID:3255275"
     CDS             join(594806..595393,595453..596392,596492..596517)
                     /locus_tag="CNM01930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568290.1"
                     /db_xref="GI:58261760"
                     /db_xref="GeneID:3255275"
                     /translation="MFIANITLKEVLEAQKRRYSDEAHLNLCRSQKKRVPFRNTGLWI
                     TIPKTASPWFVQMGKQREGSHGDLAPHFGAPHHPVHWKCQVCERGEGGDTTKSKQVNR
                     RRKAAESSRWSYCNYTTTTEPLAEDEQVEEEEQVQIVYPVAPRRFPPRDTAFPRPRRT
                     LHVPHYPALPERDYFGTRATWLSEEGYCDASGHAVATSARCEARRVYNDSLDLEATTP
                     SPATKPSSDRLVPGTRSLPSNQSSWQPADYDAVVLKDDSSFSESTWYSSSMSASHGSL
                     ASNGDEDESDEEEDGDDDLYEWNAINPDAPDQEWEHLKARVNIQQMDRDARRRLRLGR
                     RIEERDEWDEGGYLVGGGGVGDRHHHGDGIPVELKRIMVEMSGGDYVYAAGHGTRFGE
                     GYGIGSDSTISEWRQNSSSDTSLSPWSNRAPSLLPPLGTHCSVDDLVHPDDSMSRCRS
                     PIDLDIPDTPCIPAPRGSPVARQQAEGSPPTFDFDEVMEEVMDSIWASEGVRWVYPGS
                     ENGVVMQMD"
     gene            complement(596554..>598119)
                     /locus_tag="CNM01940"
                     /db_xref="GeneID:3255198"
     mRNA            complement(join(596554..596623,596678..597598,
                     597645..>598119))
                     /locus_tag="CNM01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_568289.1"
                     /db_xref="GI:58261757"
                     /db_xref="GeneID:3255198"
     CDS             complement(join(596589..596623,596678..597598,
                     597645..598119))
                     /locus_tag="CNM01940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568289.1"
                     /db_xref="GI:58261758"
                     /db_xref="GeneID:3255198"
                     /translation="MHKRLVAAIRISHPHLIPSPPPTMALPYDATPPPEAAPAPAPQD
                     ALDRPLDDFSPAVPAHVQSLVARMSAAKVYLVDESPAVLHLDGHARRRERPVRRLVQQ
                     LDRMGDQGVHAWLDGVGSERGVTVKANAVYLSSELIQHLSTSKIFSWATGLGAEPMGI
                     EWINDTALHILFPTPQLSILALSLLSKTGFALGDDGQVEEEGAETQRDDPLQERSAHP
                     FPLSLLPRKPARLLEQPIETSALTPEEGTDTVTKRGRGQFALPDRPSPSLRSSYDDDN
                     TALLESIPLEDGVNPLARIALRLALVEDMTVRQRGKESGWYKKHGFEAGKERLGGGLV
                     RRPFAKAARGERGGWASGEGDGDGQAGGEELAKRLGRERKPYDRPARSLPSSGGSGRT
                     RGMVTQEELDRELESLRSGVTPRGQVEGGGMDIDVESYHDMPRRKGRGFRTARGESGA
                     GSRGKGKVGKDDLDRELDEMFANRGD"
     misc_feature    596984..597048
                     /note="C-rich"
     misc_feature    597919..598022
                     /note="G-rich"
     gene            <598271..>599485
                     /locus_tag="CNM01950"
                     /db_xref="GeneID:3255121"
     mRNA            join(<598271..598716,598762..598835,598886..599013,
                     599063..>599485)
                     /locus_tag="CNM01950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568495.1"
                     /db_xref="GI:58262169"
                     /db_xref="GeneID:3255121"
     CDS             join(598271..598716,598762..598835,598886..599013,
                     599063..599485)
                     /locus_tag="CNM01950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568495.1"
                     /db_xref="GI:58262170"
                     /db_xref="GeneID:3255121"
                     /translation="MGFFKRKNAPLIPPVAPTAGQQPNADPYAAPAAGGYGGGDPYTK
                     SKPRPAAGESTEKGGGDPYAATPVYAAGGDPYAKRNPGPRANPNAANDAARAELFGGY
                     KAADVPAERKYGYEGREMEEDFDEDEEIEGIKQEMRGVKQDSLASTRNAVALARQAEE
                     SARGTIGKLADQSERIANSERYLDMAKANNQRAEDKTTELKVLSRSIFRPAIVWNKES
                     KRQAQEDKINERHAMERMDRAKALMDVQDTRKRLGAAANPSPHASSPAPEPMPGQQRA
                     RKDARSRYQFDATASDDELEDELDENLDETLEVTRRLKGLATAMGDEVSGQNSRLTRV
                     TDKTENLEFAVMKNTERLSRIR"
     repeat_region   599521..599667
                     /rpt_type=tandem
                     /rpt_unit_seq="ttg"
                     /satellite="microsatellite"
     repeat_region   599668..599726
                     /rpt_type=tandem
                     /rpt_unit_seq="ccg"
                     /satellite="microsatellite"
     repeat_region   599758..599807
                     /rpt_type=tandem
                     /rpt_unit_seq="catct"
                     /satellite="microsatellite"
     gene            600270..603137
                     /locus_tag="CNM01960"
                     /db_xref="GeneID:3255086"
     mRNA            join(600270..602036,602111..602350,602407..603137)
                     /locus_tag="CNM01960"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550407|gb|CF696248.1,gi|41550412|gb|CF696253.1"
                     /transcript_id="XM_568474.1"
                     /db_xref="GI:58262127"
                     /db_xref="GeneID:3255086"
     CDS             join(600534..602036,602111..602350,602407..602988)
                     /locus_tag="CNM01960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568474.1"
                     /db_xref="GI:58262128"
                     /db_xref="GeneID:3255086"
                     /translation="MTRLVLSTARPRLGRLLHLGVEIRREGSESGDGEKGIAEGEEEE
                     TRAALRRMRRVTVELFRRVIIHPPPSAANTDTITHQTLLHASGKSLRYPGPSRANPPL
                     RLLFTIPTIPNPSSSTTTTHNGTGEQSWGEVSMVGGYHQVTFGLRVGVGGGVMGGGIG
                     LGVGGAAGRAEGGGCDENDFVVEKEIEILPKIWSPLAPRPAPAPAPPPTHQTQYQLQT
                     QDGVEFDIPHELAAELALVDSSSPPSAYPSFDPAATDTLSAREAYRLKGRDVVGPSGT
                     TRLPPSSSGNADRGGDGGEGQGEREDDLPPPFESSTVDSTSLGRGPSEEYSEEYFLSP
                     PVDLGEEPVPYDDHHHHHHQPGTSTAVSTTHRADPQPHAQEPDQVQRDDQGEGQGSGL
                     PTFLESEQQEERRARARAASQSDAFAFALRGARGKEREASAGRGVGIGASARTDEGAG
                     EGAESRGRDGAAVQEKGQGQAEEGETGGWSDDGEMGVGREGLGGELATWIEYDGYETF
                     SQPPPSLAASLHARGSMDPPQEGEQPLALAGGVVGEVAARLGFGGVGVGVGEEGLELM
                     EHLGLGEGTRIVDLQDDLPPGIDEPSLPALPSFTNDSHSHSHSHPHSPYTPPPPPHPE
                     HVHEQNIMPIPASPPPPHPDAHAHAHAHAHAHPRDEPPAHDPPSFDASQAASAVGVAA
                     TSGPPSIPLPLGLAAHAPPPPPSSTSSSSSSSSTTSSPPPPPPAHHASHHPVHQGVGV
                     AVAPSRSVGTVEVGEQEDAPPDYERGGLPPYSQG"
     repeat_region   601575..601594
                     /rpt_type=tandem
                     /rpt_unit_seq="cca"
                     /satellite="microsatellite"
     misc_feature    602468..602633
                     /locus_tag="CNM01960"
                     /note="C-rich"
     repeat_region   602774..602820
                     /rpt_type=tandem
                     /rpt_unit_seq="cat"
                     /satellite="microsatellite"
     gene            complement(<603260..604599)
                     /locus_tag="CNM01970"
                     /db_xref="GeneID:3255247"
     mRNA            complement(join(<603260..604144,604268..604599))
                     /locus_tag="CNM01970"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545297|gb|CF691138.1,gi|41545314|gb|CF691155.1"
                     /transcript_id="XM_568487.1"
                     /db_xref="GI:58262153"
                     /db_xref="GeneID:3255247"
     CDS             complement(603260..603532)
                     /locus_tag="CNM01970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568487.1"
                     /db_xref="GI:58262154"
                     /db_xref="GeneID:3255247"
                     /translation="MVYISSLGISQSWGSWVSGFTFMDYRQKRGVPYSVSLLSFPFLL
                     MFLFSFPTFLLLSFLSIHYVFQDFHLHHIPQERMKLMRGKTISLIV"
     misc_feature    604195..604252
                     /note="GA-rich"
     gene            604973..610397
                     /locus_tag="CNM01980"
                     /db_xref="GeneID:3255125"
     mRNA            join(604973..605638,605698..606255,606314..606428,
                     606487..608520,608583..609110,609319..610397)
                     /locus_tag="CNM01980"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536969|gb|CF682810.1,gi|41536974|gb|CF682815.1,
                     gi|41572454|gb|CF718295.1"
                     /transcript_id="XM_568500.1"
                     /db_xref="GI:58262179"
                     /db_xref="GeneID:3255125"
     CDS             join(605082..605638,605698..606255,606314..606428,
                     606487..608520,608583..609110,609319..610272)
                     /locus_tag="CNM01980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568500.1"
                     /db_xref="GI:58262180"
                     /db_xref="GeneID:3255125"
                     /translation="MSETHQKDHSKNNRDLKLPNKPTISSISIPPTPQSVHTLPPRPN
                     FALPPRPSATLSPPRSARPLRPSLRSPLPSRVSWRSRVADKGARISRSRSPSPRRYRS
                     RSIERYRPSKYKRYRSPSPTYQRRSPSPRVRSPSPARRSSIRRSPSPRPRSRSPPRKK
                     PREEPKGSLLSRLGGHHPSKADHHIAPPATSFKRSLSPSTPNEQPRKLSAVSIPIPTG
                     PRTSQIPTGPRTDCTLTGPKSLQNQSLNQSQPTKPIPTGPRNLNSILIPSISNTNATT
                     APEKENSENTLEEMGNPKKRGGGGNPPPTGKKALTPPMHDLVYISETYGNGITLKSQW
                     AENPKSPVANFILKGKSGDISGTYSYTEGIVDGKKVHRVTMTPANGIYGIGDSTNKKE
                     AEKLAALSSLLQLINVGYLERGKASEGRNGPNNLTKPSTSALATSQLDPEDASETATL
                     SDGKTKIDYDRARQFMEYYCHRYRFRKPDVEYTQTTVKDPQNKKKTKMVWEGVIIVGN
                     RRIGMGSGANKKKAAIQCYLDVTQYLESCDPDLWQDFIEHTKKDKSLNIGLAPHLVFN
                     MSEALIDDVQGTCIDIRHSNLYQNAPPSGSAGNEVQAPPTWHGGAQYIPTEDEMYYKS
                     QELQARLAAYESDPRMARMRRTRASLPVYSRASEMLRTIRENDVTIIMAATGSGKTTQ
                     VPQLLFDEMIKQGLGGGCNIVCTQPRRLAAMSVAERIAEERGQMIGQEVGYQVRFDAQ
                     LPEANGSITFCTTGIFLKRMQSALGENADDVAVQRMDLVSHIVVDEVHERDIDTDLLL
                     VVLKRLLQDRKRRGVPIKVVLMSATIDPTLFQSYFTDAQGAPAPVAEIPGRTYPVEKF
                     FLDKIIPQLQSIPAQRGGWVFNEKNVKEYLSRELSSNASNFGPGTGIELEIPYPLVAL
                     TIAFVLSRSGDGHVLVFLPGWEEIRKVADILLAGRYPLLGMDFRDSRRFSIHYLHSTI
                     PAAEQKEVFRTPPPGVRRIILATNIAETSITIPDVVYVVDTGRVKEKRYDPERHMSSL
                     VSAWVGSSNLNQRAGRAGRHREGEYYGLVSQRRLDSLEAHQMVEMKRSDLSNVVMHVK
                     ALNLGEVQEVLAATIEPPEPSRIVAAMEVLRMLGALDARQNLTSLGRVLLQLPVDANV
                     GKLCLYGAFFRCLDAALTLAAVLTNRDPFLAPPAQKAKADSIKDRFSPKAFRSDPLAI
                     VAAYNQWLPYEESGDFYSATRFCDNNFLSKATLLQIKQVKQSLLQSLDKAGVIAVSAG
                     GMVVVIHNSSVNSRRREVSGPEETSASFNPAEKRLYAFAEKSRNVPVGGNPNSAPTNL
                     RTVTRLDPMTYMLFGAYELVVTARGLECDGWLPVTGNTHALDDVQRLKTALDVCMLRV
                     FEGLGKSLVMGRDQRWLNGAGGVEVHEGSSRIREGGGEEENESDDEDYNRPREKGDQA
                     SSRYAGPLTIEEINELEMLTTDIVTILNKYADEREGGGVDTVPQTRVNTRPPSPQGRA
                     AQWAADVAAAASYGGGGSAQWGDASGGASFGGGGWGSDLHTSRKQGDDGRKFDTWDDG
                     DGWEGRQGEQGGEDDSGRVVSRYKPPQTR"
     gene            complement(610421..612567)
                     /locus_tag="CNM01990"
                     /db_xref="GeneID:3255138"
     mRNA            complement(join(610421..610829,610889..611038,
                     611102..611281,611332..611406,611473..611515,
                     611565..611654,611749..611876,611971..612567))
                     /locus_tag="CNM01990"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41556447|gb|CF702288.1"
                     /transcript_id="XM_568288.1"
                     /db_xref="GI:58261755"
                     /db_xref="GeneID:3255138"
     CDS             complement(join(610590..610829,610889..611038,
                     611102..611281,611332..611406,611473..611515,
                     611565..611654,611749..611876,611971..612141))
                     /locus_tag="CNM01990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568288.1"
                     /db_xref="GI:58261756"
                     /db_xref="GeneID:3255138"
                     /translation="MPAQTLGKRRLSSGSPSLQSSASASSSRGPRTSSRGLKASQEEL
                     GLSALVVCNADQEAKLNYVSESMQDILGYTPSDLIGKSVYLIFHPDEVPFLRQIHYQA
                     LTEERTACVAYFRVLHREGYYVECCCSYYTVYNMSLALYTRATVEQALTAREVIEVSP
                     ASQGRFSVKRWSSSAPQTSSPQSITTIDINHPWPKPPKPTPRTFYIMDRFTDTSRVIY
                     VSNDVIINGSSLLKQSFYSIIRPSDRPRIRKYIEAAKKSTPIMFDEQRSGGHGYTTFH
                     VLKIPDLPPAGEIWPQGNDESERSMPGQEFILVEGIFTANSDGLTCIISKIPEESKAS
                     EPPRALENNTNSKASAMAIENLTG"
     gene            614732..616276
                     /locus_tag="CNM02000"
                     /db_xref="GeneID:3255095"
     mRNA            join(614732..615147,615202..615341,615396..615531,
                     615583..615841,615897..616276)
                     /locus_tag="CNM02000"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535072|gb|CF680913.1,gi|41535083|gb|CF680924.1,
                     gi|41544769|gb|CF690610.1,gi|41545600|gb|CF691441.1,
                     gi|41545601|gb|CF691442.1,gi|41547666|gb|CF693507.1,
                     gi|41547675|gb|CF693516.1,gi|41560544|gb|CF706385.1,
                     gi|41568589|gb|CF714430.1,gi|41575164|gb|CF721005.1"
                     /transcript_id="XM_568501.1"
                     /db_xref="GI:58262181"
                     /db_xref="GeneID:3255095"
     CDS             join(614847..615147,615202..615341,615396..615531,
                     615583..615841,615897..616206)
                     /locus_tag="CNM02000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568501.1"
                     /db_xref="GI:58262182"
                     /db_xref="GeneID:3255095"
                     /translation="MPSELLHLPPLYAIVGLYRLATDPSIRTPVLDKVKHAAVRGIVV
                     GGVYTVLSWKAMEWFIRKFLISGGWWKKGEEVLKDSVDGSVQVGLGKFSLNLNAVLYT
                     HLLILLPQLSSILRFFIYKNLKIARSRAYALTVSSRRKPAEFWSQGYIEEWAHPPQIQ
                     TGELDKNGRRVRRNANWISWILWWPTQLVMRKYLLLPLSPSLPLLSPLVTSVLKSLAT
                     AEYLHRPYFEMKGMSNDEIWRWVEERKWAYRAFGFATSLLESVPIIGLFFSISNRIGA
                     AMWAFDLEKRQHLFANNIIQPLQPDQVGFYGMGRVDDLGVDIQEAEDELEKKWSQKKR
                     ADDESDKLESIKASSLEPAVAGSKSDILELHGGDIGLKGKDRETGVL"
     gene            complement(<617215..>617726)
                     /locus_tag="CNM02010"
                     /db_xref="GeneID:3255226"
     mRNA            complement(join(<617215..617319,617416..617625,
                     617703..>617726))
                     /locus_tag="CNM02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_568287.1"
                     /db_xref="GI:58261753"
                     /db_xref="GeneID:3255226"
     CDS             complement(join(617215..617319,617416..617625,
                     617703..617726))
                     /locus_tag="CNM02010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568287.1"
                     /db_xref="GI:58261754"
                     /db_xref="GeneID:3255226"
                     /translation="MQQVEISLWCSPPLIVHPTFSEKHAQHLEHYWPLFIFGTMIEFV
                     AFLLVHPDLFTLVVCLKTTALLGIWLGRDDKGGFISVRYPLSAVTPERRGKLNPKAVV
                     LLENQVREEK"
     gene            <624871..>627101
                     /locus_tag="CNM02020"
                     /db_xref="GeneID:3255283"
     mRNA            join(<624871..625191,625274..625403,625455..625601,
                     625654..626292,626356..>627101)
                     /locus_tag="CNM02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_568286.1"
                     /db_xref="GI:58261751"
                     /db_xref="GeneID:3255283"
     CDS             join(624871..625191,625274..625403,625455..625601,
                     625654..626292,626356..627101)
                     /locus_tag="CNM02020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568286.1"
                     /db_xref="GI:58261752"
                     /db_xref="GeneID:3255283"
                     /translation="MLKRISEGEKVPGIDKAREELGLSLLHGGSGDEGSGNKSMPPPP
                     VKKVKIRKGGKMPTEDYIALGPGKGGKGLPQSDISKVISHLWKNEIPDIRAVYENRAN
                     ARKLEHRKLYPDYKFQPKRKAEKLKQRIEREREKQEARRLREEEKRAGKTKRRSRNRE
                     KRSPVSPYSITQARHEMPSLGRTLTYDSESSGFYPSSFETSNMSDLRATAAQATFRRP
                     FPLPNYAVPALPGAEGPSSSTPGQAVAHDYTWRHTRHTGPLMMNDLDLLAPPMTEQYS
                     SNSLSARSQPLTAPASPGQLLFLDSANYDVPLRATASPFPEDSVSDEDFQKALLSITS
                     AAHDVSHRPMAVLDIDDIPVLSDEPFDTHEDPAALAQAWWDLDQHAFENDTERGPSTS
                     GLIADDQTLSATVLEAGPSLGSSSNLISVTIGEPSHHQEVSDAADHDAEPSQSPLMIE
                     GVTYQSLAATYQQPVYYTPVFDSNSSFLGMTPVFEPALFEQMPSLFDQGPFLSTAQPL
                     SPTETYSADPTFRESTFLQTGQDSNCVSSLSSREGTVRSVSSANTAPRYISSSAYPPT
                     PSSMDTMGLPSVTGIVDRNTSFSALTAVLAGQGMGMMGEDMLAWDEDEYAAEYAAANA
                     SIIVDENRKRRESASMVSLAPVGEAKSPTNPSGLDA"
     gene            628975..631339
                     /locus_tag="CNM02030"
                     /db_xref="GeneID:3255274"
     mRNA            join(628975..629310,629385..629448,629501..629591,
                     629646..629660,629716..630260,630309..630376,
                     630432..630783,630838..631034,631100..631339)
                     /locus_tag="CNM02030"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539451|gb|CF685292.1,gi|41540277|gb|CF686118.1,
                     gi|41552639|gb|CF698480.1,gi|41552645|gb|CF698486.1,
                     gi|41554106|gb|CF699947.1,gi|41554114|gb|CF699955.1,
                     gi|41567658|gb|CF713499.1,gi|41567667|gb|CF713508.1"
                     /transcript_id="XM_568285.1"
                     /db_xref="GI:58261749"
                     /db_xref="GeneID:3255274"
     CDS             join(629079..629310,629385..629448,629501..629591,
                     629646..629660,629716..630260,630309..630376,
                     630432..630783,630838..631034,631100..631119)
                     /locus_tag="CNM02030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568285.1"
                     /db_xref="GI:58261750"
                     /db_xref="GeneID:3255274"
                     /translation="MVRHATFDTEPVEIEKPAEVQTEDVNVEKQSSLHPIGTRTTEGG
                     DTEKGSTRYAESESGLLYKKEQKKAERKLLMKLDVAILPFAVLLYLSAYLDRGNLANA
                     RLQGLQDEVLDGKDKNYSIALCCFFVTYIVFSVPGTLMAKQFLPSRSIACGAMIWSIA
                     ATCQAAAFNKAGLYVCRLFVGIGESMFGQAMALHFSYWYTKTDLAKRVGLFISAGAVS
                     GAFGGLISFGVSNIKNSPIEQWRILFLIEGCPSILLAICVFFFMPSKPEKSKYLNEEE
                     RTLCLTRLNQENNVEKDLGIDWGGVKRCLTDWKTYVISIAYSCMNLTLGSVSGFLPTI
                     IKGFGYSNARAQLFTVPPYAVALVFMLILTSFSDYRQTRGLPAASVFCLGIIGWAILL
                     AVPADEHYSARYFGCICVVTAGYTNIPLIMSWQSGCTANQSQRATSLGMLNTLGQCLS
                     LAAAFLFPSAEGPQYTKGASINLAFQGLGLILTLFMTSYYRWENRRRDMKEGGQPAVG
                     VPIDVKEGYDRAVGFRYVP"
     gene            complement(631613..633615)
                     /locus_tag="CNM02040"
                     /db_xref="GeneID:3255278"
     mRNA            complement(join(631613..631996,632054..633615))
                     /locus_tag="CNM02040"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530378|gb|CF676219.1,gi|41530383|gb|CF676224.1,
                     gi|41531830|gb|CF677671.1,gi|41531844|gb|CF677685.1,
                     gi|41537933|gb|CF683774.1,gi|41537944|gb|CF683785.1,
                     gi|41540605|gb|CF686446.1,gi|41540609|gb|CF686450.1,
                     gi|41544748|gb|CF690589.1,gi|41544779|gb|CF690620.1,
                     gi|41544795|gb|CF690636.1,gi|41545825|gb|CF691666.1,
                     gi|41545830|gb|CF691671.1,gi|41548323|gb|CF694164.1,
                     gi|41548330|gb|CF694171.1,gi|41550994|gb|CF696835.1,
                     gi|41550998|gb|CF696839.1,gi|41551989|gb|CF697830.1,
                     gi|41551997|gb|CF697838.1,gi|41555107|gb|CF700948.1,
                     gi|41555115|gb|CF700956.1,gi|41557093|gb|CF702934.1,
                     gi|41557104|gb|CF702945.1,gi|41558187|gb|CF704028.1,
                     gi|41558204|gb|CF704045.1,gi|41560951|gb|CF706792.1,
                     gi|41560960|gb|CF706801.1,gi|41570960|gb|CF716801.1,
                     gi|41571352|gb|CF717193.1,gi|41573605|gb|CF719446.1"
                     /transcript_id="XM_568400.1"
                     /db_xref="GI:58261979"
                     /db_xref="GeneID:3255278"
     CDS             complement(join(631812..631996,632054..633368))
                     /locus_tag="CNM02040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568400.1"
                     /db_xref="GI:58261980"
                     /db_xref="GeneID:3255278"
                     /translation="MKLLSLLLLLLPVLLAAPAPGPHAYNPFFPTSKHSGFILPAKRG
                     LSSRTEAQRINPEFFKKQGRSKVDSVKRDVVTKVVKRATGTCIASTTTAFVTSVVTVI
                     PDSLPTSASGSDSTVSISATESLSTAQSSDLSYVAVSATASATDSSSQIASTSVSSSF
                     TSPSSSPWSSSAANSASDSLVSSVYALPSTSVTSESASVTQSHPADASSAGSRAEMSM
                     SASASATLTSSFAASSFSSSADKGKQTKTKTLGATSTAAVNTRQASQSTASSSTTALS
                     AEVTPMSSVRSSSRATSSSTSTAIHSTVHSSTVSSTSSHSSTATLVSSSSFTRATASS
                     TSTSTSFTPTFTSLSTFSAPSSTTATSAAAATSSAVSADPDGDGPFYGQGTWYYQYNT
                     AGACGTVNPDSAFIVAVSAELFDNWPGYNGLNPNNNPICGHQVNLTWQGTSITATVAD
                     RCPGCELRHLDLSRGAFGALSNDDYDIGVFSTTIDGQSYNQDLEWSWLN"
     gene            634070..636257
                     /locus_tag="CNM02050"
                     /db_xref="GeneID:3255082"
     mRNA            join(634070..634180,634233..634455,634504..634670,
                     634721..634994,635042..636257)
                     /locus_tag="CNM02050"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532602|gb|CF678443.1,gi|41535943|gb|CF681784.1,
                     gi|41543356|gb|CF689197.1,gi|41543360|gb|CF689201.1,
                     gi|41561095|gb|CF706936.1,gi|41561617|gb|CF707458.1"
                     /transcript_id="XM_568502.1"
                     /db_xref="GI:58262183"
                     /db_xref="GeneID:3255082"
     CDS             join(634140..634180,634233..634455,634504..634670,
                     634721..634994,635042..636220)
                     /locus_tag="CNM02050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568502.1"
                     /db_xref="GI:58262184"
                     /db_xref="GeneID:3255082"
                     /translation="MLSKSNQPSDALLDADFSFSQPPFSTLIDSRVLVALADQKFAHP
                     TLVQAKAIPLLLEGKDVLARARTGSGKTAAYIVPAVQKILEAKADLSPASAEYQATRA
                     IILVPTKELALQVSSFTKNVTKYCDGLVQCVDVAAGGASIQRVLLNDKPDIVISTPTK
                     LLSLLQSKSLSLSQLSFLAIDEADLLLSYGFKDDLTRIMDPTSGWIPKLGVQGCLMSA
                     TLSDDVEGIKGLVLRNPAILTLSEPASASSLLSQHYTHTSERDKFLLIYVLLKLKLIR
                     GKSIIFVNDVERGYRVKLFLEQFGVKCCVVNSELPLASRYHVVEEFNRGVYDVVVATD
                     EGAGADAEEEEDVKQEESESEGEEDEDDDKEAEDKEKEAKEEAKPAPGPSKRRATSPP
                     SKPNKRARRADPTSSLARGIDFTSASSVINFDLPLTSTSYMHRVGRTARAGQSGLALS
                     FVVPRENWGKDKAVSIKSAEKDEKVFERIKERVKKESDSEIKEWDWKGRKGEIEGFRY
                     RMEDALKAVTGKRVAEARREEVRRELLNSEKLKSHFAANPLDLSYLRHDAPLHPARQQ
                     THLKHVPNYLMPKIAALPTGGDVTDHAGVGFSRRGRGGHRGRGGRGSKSGRGKKVDPL
                     KFK"
     gene            638780..639464
                     /locus_tag="CNM02060"
                     /db_xref="GeneID:3255260"
     mRNA            join(638780..638977,639039..639129,639195..639464)
                     /locus_tag="CNM02060"
                     /product="expressed protein"
                     /transcript_id="XM_568284.1"
                     /db_xref="GI:58261747"
                     /db_xref="GeneID:3255260"
     CDS             join(638867..638977,639039..639129,639195..639283)
                     /locus_tag="CNM02060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568284.1"
                     /db_xref="GI:58261748"
                     /db_xref="GeneID:3255260"
                     /translation="MFVRSLLRTTTTTMPSARSMVTRNASTYVPRPEPMGPFRQFFHD
                     KPVPVDAYPLIAIVVVMCSGATYMLTKHIKEDRDHLRWLPKHGGVKFEIPRE"
     gene            640925..643700
                     /locus_tag="CNM02070"
                     /db_xref="GeneID:3255114"
     mRNA            join(640925..641137,641205..641403,641468..642868,
                     642929..643279,643334..643700)
                     /locus_tag="CNM02070"
                     /product="heat shock protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530599|gb|CF676440.1,gi|41534607|gb|CF680448.1,
                     gi|41534612|gb|CF680453.1,gi|41538752|gb|CF684593.1,
                     gi|41538758|gb|CF684599.1,gi|41539658|gb|CF685499.1,
                     gi|41539670|gb|CF685511.1,gi|41542312|gb|CF688153.1,
                     gi|41544416|gb|CF690257.1,gi|41546751|gb|CF692592.1,
                     gi|41546760|gb|CF692601.1,gi|41551067|gb|CF696908.1,
                     gi|41551077|gb|CF696918.1,gi|41554781|gb|CF700622.1,
                     gi|41554905|gb|CF700746.1,gi|41554909|gb|CF700750.1,
                     gi|41555240|gb|CF701081.1,gi|41555248|gb|CF701089.1,
                     gi|41556856|gb|CF702697.1,gi|41556866|gb|CF702707.1,
                     gi|41558708|gb|CF704549.1,gi|41558719|gb|CF704560.1,
                     gi|41559482|gb|CF705323.1,gi|41560830|gb|CF706671.1,
                     gi|41560840|gb|CF706681.1,gi|41561863|gb|CF707704.1,
                     gi|41561877|gb|CF707718.1,gi|41564341|gb|CF710182.1,
                     gi|41567818|gb|CF713659.1,gi|41574647|gb|CF720488.1,
                     gi|41574656|gb|CF720497.1,gi|41575065|gb|CF720906.1,
                     gi|41575075|gb|CF720916.1"
                     /transcript_id="XM_568283.1"
                     /db_xref="GI:58261745"
                     /db_xref="GeneID:3255114"
     CDS             join(641028..641137,641205..641403,641468..642868,
                     642929..643279,643334..643594)
                     /locus_tag="CNM02070"
                     /codon_start=1
                     /product="heat shock protein"
                     /protein_id="XP_568283.1"
                     /db_xref="GI:58261746"
                     /db_xref="GeneID:3255114"
                     /translation="MASVVGIDLGNLSSKVGVARHRGIDIIVNEVSNRATPSLVSFTP
                     RQRFIGEPAKTAETSNFKNTVGSLKRLIGRSFNDPEVEEYEKKFINAQLIDVNGEIGV
                     KVNYLGEPTDFSFTQLVAAYLGKIRDTTAAELKQSVSDVVIAVPGWFTDVQRRALLDA
                     ANIAGLNALRLINDTTAVALGYGITKADLPESTEAPRHVVFVDVGHSDYSVAVVAFSK
                     GQLTIKSTAYDRHFGGRDFDYALVQHFAEEFKTKYKVDVLSSPKAVFRLTTGCERLKK
                     VLSANAEAPINVESLMNDIDATSTLTRESFEKLTDHLLSRVSDPLAEALEKAGLTIDQ
                     VDAVELVGGSTRIPAIKERIQQFFGGKILNFTLNQDEAIARGATFACASLSPVFRVRE
                     FAVHDIAAYPIKISWEKEAGNPDEDTELVVFGTANPIPSTKVLTFYRQGPFELEAAYA
                     DPASLPKGINPWIGKYTVKSVEKPASGDLSIVKVKARLNLHGIMNFEGAYCVEEVEKE
                     EEVTVGEGEDAKTEKKLVKKIQRKGDCPVVGQYTGLVQDKVNDLVEKEGKMHAEDKLV
                     METEDRKNALEEYVYDTRGKLDDRYANYVQASEKEALLQGLQEAEDWLYSEDGEDATK
                     SAYVQKLDALKAMGDPIVLRWKESEDRPRAAAALREALNTYLTAAQGEDEKYSHIEES
                     EKAKVIEKCATTQQWLEDQLFRQSEKPKNVNPVITSAEINRRREDVVYSSNAILNKPK
                     PKPKVTTEAPQQPPAQEKTENEPEAKVEEMDID"
     gene            646112..647697
                     /locus_tag="CNM02080"
                     /db_xref="GeneID:3255298"
     mRNA            join(646112..646248,646304..646580,646624..647697)
                     /locus_tag="CNM02080"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539565|gb|CF685406.1"
                     /transcript_id="XM_568503.1"
                     /db_xref="GI:58262185"
                     /db_xref="GeneID:3255298"
     mRNA            join(646145..646248,646304..646580,646624..646780,
                     647160..647421)
                     /locus_tag="CNM02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_568504.1"
                     /db_xref="GI:58262187"
                     /db_xref="GeneID:3255298"
     CDS             join(646425..646580,646624..646780,647160..647203)
                     /locus_tag="CNM02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568504.1"
                     /db_xref="GI:58262188"
                     /db_xref="GeneID:3255298"
                     /translation="MVDRIGKKGVIGGPRVQEEDAAFEQHVTDIFERGQDIVTENAFL
                     DEDWAIKYDQLHSVPRQDLPHFLPHHRYLGQELFCLHLHSQLLGFCRPFETLEHAHSL
                     WYRQSMGFCKRATARV"
     CDS             join(646425..646580,646624..646845)
                     /locus_tag="CNM02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568503.1"
                     /db_xref="GI:58262186"
                     /db_xref="GeneID:3255298"
                     /translation="MVDRIGKKGVIGGPRVQEEDAAFEQHVTDIFERGQDIVTENAFL
                     DEDWAIKYDQLHSVPRQDLPHFLPHHRYLGQELFCLHLHSQLLGFCRPFETLEHAHSL
                     WYSEWNFGSVYSALFFAGSIQPP"
     gene            complement(648237..649083)
                     /locus_tag="CNM02090"
                     /db_xref="GeneID:3255060"
     mRNA            complement(648237..649083)
                     /locus_tag="CNM02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_568496.1"
                     /db_xref="GI:58262171"
                     /db_xref="GeneID:3255060"
     CDS             complement(648575..649063)
                     /locus_tag="CNM02090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568496.1"
                     /db_xref="GI:58262172"
                     /db_xref="GeneID:3255060"
                     /translation="MASTDLHSSDPLSPQPGICPPSPIIRVPEAEIYSGHQSMAFDFD
                     EGNLHAMEGSDSSEVSNIADEEDSEDDIIQAPIDSFNDDEMISTPGFDEQAYYQSKDE
                     CKGAVQAYAASQGFAAVIRRSKRKKPTKTHKEGRELIQYSCIFGDEYRCTRGVQFQRC
                     AH"
     gene            650344..651112
                     /locus_tag="CNM02100"
                     /db_xref="GeneID:3255165"
     mRNA            650344..651112
                     /locus_tag="CNM02100"
                     /product="expressed protein"
                     /transcript_id="XM_568505.1"
                     /db_xref="GI:58262189"
                     /db_xref="GeneID:3255165"
     CDS             650443..650883
                     /locus_tag="CNM02100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568505.1"
                     /db_xref="GI:58262190"
                     /db_xref="GeneID:3255165"
                     /translation="MPIRKTPSLSKLIIQFKLPFPSFSYPQCTSPGEETPAQTPDSPT
                     SQTSSRRASTISFMIITPLAEYSAQFPPLYPAEYPTETVVNESSESDDEIVEDLTSLV
                     SQKEDGQGKRWDEKGREPLGRNAVCPGAPKPSPIDLPNECTWSK"
     gene            652753..655168
                     /locus_tag="CNM02110"
                     /db_xref="GeneID:3255176"
     mRNA            join(652753..653169,653222..653470,653520..653886,
                     653940..654523,654572..654860,654918..655168)
                     /locus_tag="CNM02110"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530494|gb|CF676335.1,gi|41530506|gb|CF676347.1,
                     gi|41531294|gb|CF677135.1,gi|41531302|gb|CF677143.1,
                     gi|41531802|gb|CF677643.1,gi|41531819|gb|CF677660.1,
                     gi|41534246|gb|CF680087.1,gi|41534254|gb|CF680095.1,
                     gi|41538294|gb|CF684135.1,gi|41538307|gb|CF684148.1,
                     gi|41543785|gb|CF689626.1,gi|41543787|gb|CF689628.1,
                     gi|41544048|gb|CF689889.1,gi|41544064|gb|CF689905.1,
                     gi|41547008|gb|CF692849.1,gi|41547020|gb|CF692861.1,
                     gi|41548817|gb|CF694658.1,gi|41550954|gb|CF696795.1,
                     gi|41550960|gb|CF696801.1,gi|41551853|gb|CF697694.1,
                     gi|41551863|gb|CF697704.1,gi|41555609|gb|CF701450.1,
                     gi|41555616|gb|CF701457.1,gi|41557737|gb|CF703578.1,
                     gi|41557744|gb|CF703585.1,gi|41562644|gb|CF708485.1,
                     gi|41562653|gb|CF708494.1,gi|41564157|gb|CF709998.1,
                     gi|41564163|gb|CF710004.1,gi|41567375|gb|CF713216.1,
                     gi|41567392|gb|CF713233.1,gi|41567821|gb|CF713662.1,
                     gi|41569407|gb|CF715248.1,gi|41569414|gb|CF715255.1,
                     gi|41573145|gb|CF718986.1"
                     /transcript_id="XM_568282.1"
                     /db_xref="GI:58261743"
                     /db_xref="GeneID:3255176"
     CDS             join(652855..653169,653222..653470,653520..653886,
                     653940..654523,654572..654860,654918..654928)
                     /locus_tag="CNM02110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568282.1"
                     /db_xref="GI:58261744"
                     /db_xref="GeneID:3255176"
                     /translation="MSDPNSDLYPIHLLMDELKSEDVVLRLSSIRRLSTIALALGPSR
                     TREELIPFIQYQLDDEDEVLLVLAEELGNFVEYVGGKEYAHVILGPLENLTAVEETLV
                     REKAAESISKISVLLSAQDLEQYFLPIVKRLSTGEWFTSRTSACALFAAPYPNASSSS
                     QEEMRKLFGALCHDDTPMVRRAAAKALGPLAKVVSETSGQHDTIVSELIPMYRKLAGD
                     DQDSVRLLTIPDLIALAAALSDEETKTNLLEPMRASITDKSWRVRYMVANEFVGLAES
                     AGESIIREELVGAFVGLLKDNEAEVRTAASGQVPGFAKLVDKEVILARLLPCVRDLST
                     DSSQHVRAALAMEISGLAPLLGKDATIEHLLPLFLQLLKDEFSDVRLNLIGKLDMVNE
                     VIGIDRLSQALLPAIMTLAEDKQWRVRQAIIEYIPLLAQQLGVEFFDDKLGSLCMSWL
                     GDTVFSIREAATINLKKLTDVFGVEWAKTTIIPKVLEMGNHQNYLYRMTTIFAITTMA
                     PSLNTAIIRDTVLDAALNLANDAIPNIRFNVAKCLETLASVLAQTPEGQELVHRRVVT
                     ALRKLQEDQDADVRFFATKAYERTTGDDVRGAEPMILS"
     gene            complement(655263..>657752)
                     /locus_tag="CNM02120"
                     /db_xref="GeneID:3255245"
     mRNA            complement(join(655263..656453,656510..656631,
                     656680..656882,656937..657047,657095..657194,
                     657251..657429,657489..>657752))
                     /locus_tag="CNM02120"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542596|gb|CF688437.1,gi|41542601|gb|CF688442.1"
                     /transcript_id="XM_568509.1"
                     /db_xref="GI:58262197"
                     /db_xref="GeneID:3255245"
     CDS             complement(join(655318..656453,656510..656631,
                     656680..656882,656937..657047,657095..657194,
                     657251..657429,657489..657752))
                     /locus_tag="CNM02120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568509.1"
                     /db_xref="GI:58262198"
                     /db_xref="GeneID:3255245"
                     /translation="MQSLIHNQTSQDAFIHTFIYPAGISSTLSLRGQFATESLTDERD
                     DSDANRPIGLITEVQTNDPDGDFDGANVELSDGTSGFWGMGVYQADKSRSMFGDMITV
                     NGSGSSSQETSFAVGFDINNYSTSTAEQAGIIHWGGVPNGSWTGNFNWLDANTSVAGS
                     WGFGLDSMRVSDEVINLDSYYGSIDPGFDEIYVPTSVAEKFFAKISGAQRDTIDTTRR
                     NLPCGTNISMTLIISGAAYAVASSQLVQARDVAGRTCWGSVVAWQNNSLAEQKGEIRL
                     GTPFMSNIYSVLYYSDSAQYVGLAGKPNSVNAHNLAARSEGHTNTKLAGILIGTLLGV
                     VLLLFAICYSRNRSSFQSIYYRAVRRQHRAQMNVMVRSAILPPHQMMAMPIANPAIMG
                     PMRPMPMGGPGNPMTSGMTGLTFAGGGYQPVAPPAYQHPINAGQPAASYDQTQLLLAN
                     HDHNNNDQHQFEKMPVVVEQKPQGFYSPRLQETSPPRSSFLPFIPRLSAISHQGLRPQ
                     SSSAGYARPSQSGEPKVRFGSTGVRIARSASSMSAGKSVNEFGILDGSGRDLQSGVKG
                     REARREKFMQDYASAGNLGVQQTSHYTPFPGASNVSNPPSRYYSPSQTHVQMYPTVAL
                     QANGDYAHSQTSEKKRYFSWKPGGDAGKGLYKPVLGGMSEASEEQTARKSWFGARSGG
                     WKEAERARDRERLAQGGRECVN"
     gene            <659766..>661195
                     /locus_tag="CNM02130"
                     /db_xref="GeneID:3255170"
     mRNA            join(<659766..659838,660075..660077,660369..660419,
                     660480..>661195)
                     /locus_tag="CNM02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_568278.1"
                     /db_xref="GI:58261735"
                     /db_xref="GeneID:3255170"
     CDS             join(659766..659838,660075..660077,660369..660419,
                     660480..661195)
                     /locus_tag="CNM02130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568278.1"
                     /db_xref="GI:58261736"
                     /db_xref="GeneID:3255170"
                     /translation="MLKPCACDYSQCTVVESELKSEISEGTGSGAGAMEIDDESLLAQ
                     RKKVCPFYEILLPVLGDRASVTAHHASSTLHASLNRPDRDLAALDGLIERQRGEMAAD
                     DSEDELSGEDGGLFGDGAGEASETESEADAPIIAAIRRESRSSSQPARSSSVLGSVST
                     PIRAQTQSQTASIRSSRAKAVSADDKMDELVMRQEGNDDRRHQELLAIQERKISVQEK
                     HHADMVNIAQENMTIARENAATEKMKMLAESWNRKMEMLMRSGKSWEEAKVMVGPEPG
                     APSL"
     gene            complement(661216..662755)
                     /locus_tag="CNM02140"
                     /db_xref="GeneID:3255190"
     mRNA            complement(join(661216..661636,661695..662218,
                     662289..662755))
                     /locus_tag="CNM02140"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538940|gb|CF684781.1,gi|41573676|gb|CF719517.1,
                     gi|41573686|gb|CF719527.1"
                     /transcript_id="XM_568482.1"
                     /db_xref="GI:58262143"
                     /db_xref="GeneID:3255190"
     CDS             complement(join(661244..661636,661695..662218,
                     662289..662709))
                     /locus_tag="CNM02140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568482.1"
                     /db_xref="GI:58262144"
                     /db_xref="GeneID:3255190"
                     /translation="MPRRSAKYKATARARELYRMATILNHKQLKTSLSIPYHALRTSR
                     YLNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLRVNHAEFRKLLCLIKDHPVFVSH
                     GPRKQANPLLQLTVALYRLGHCGCAASTFEIGEQFGVSEGTSAIWTTRVIKAILSLER
                     NNVYWPDENERKAIDRHFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVNFFSHKGRY
                     GFNILGICDHLKRIRYFQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVH
                     SEMISQGEYLLADSAFPAGDWCVPLFKRRRGQNDLDRPEAKFNKKCSSARVKIEHAYG
                     ILKNRWQSLRSLRVKIRNVRDESVATCWIRACVVLHNLLIDTGDWYNQLDGDADEPDD
                     YIDIERMQERMERVLERHREEEEDEARDARDASNLTRKRVMERMQEIERRDLL"
     gene            664997..666584
                     /locus_tag="CNM02150"
                     /db_xref="GeneID:3255153"
     mRNA            join(664997..665391,665617..666010,666061..666584)
                     /locus_tag="CNM02150"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41548539|gb|CF694380.1,gi|41563045|gb|CF708886.1"
                     /transcript_id="XM_568506.1"
                     /db_xref="GI:58262191"
                     /db_xref="GeneID:3255153"
     CDS             join(665002..665391,665617..666010,666061..666524)
                     /locus_tag="CNM02150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568506.1"
                     /db_xref="GI:58262192"
                     /db_xref="GeneID:3255153"
                     /translation="MFGKLSSAISSFTNGSLPPGHHAPEREKANAALAQKLAEADVPV
                     SESDCVSCGLPCPAAAGIESGAGTVVEAYSGKPYEEYVEEKYGEIEGLPKGFEQDWET
                     DLAGSAKGGKGRVVVISTGKSDWERDHTDEKGSLAQFLNKVVESAPSIKGNNNKDFLP
                     YISSSLFPPPSRPLSSPISAPPSLYSSSLISQSNDPTDQSVLVFPDWKVVHEVETSKE
                     GAKCLYESVLSGELGRAGKEGKGEEGVERRRSWVMPYRAIVLLCSHKRRDKRCHIAAP
                     LLRSALHTCLTAHDITIDETGSSLVNLDGPPLEEVSGTEEDREREMGRRIKGIEGVNG
                     GEGGEVGIFNINHLGGHKYAGVMLILFPSGAYISYGRVTPQEIPRVVEDTILKGKIVP
                     GLLRNAVGVTRTGEKADKGFLSW"
     misc_feature    665714..665800
                     /locus_tag="CNM02150"
                     /note="C-rich"
     repeat_region   666529..666556
                     /rpt_type=tandem
                     /rpt_unit_seq="ta"
                     /satellite="microsatellite"
     gene            complement(666637..667846)
                     /locus_tag="CNM02160"
                     /db_xref="GeneID:3255221"
     mRNA            complement(join(666637..666862,666970..667521,
                     667601..667846))
                     /locus_tag="CNM02160"
                     /product="expressed protein"
                     /transcript_id="XM_568276.1"
                     /db_xref="GI:58261731"
                     /db_xref="GeneID:3255221"
     CDS             complement(join(666749..666862,666970..667521,
                     667601..667756))
                     /locus_tag="CNM02160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568276.1"
                     /db_xref="GI:58261732"
                     /db_xref="GeneID:3255221"
                     /translation="MKLNPAIPLLALATFSAATPAAQLPVGLDLGKEPDSSKVNVSLY
                     VMSKCPDARLCENVFGQVLRTESILPKISLSLHYIGTLDPSLPLGVDVKHGPTEAYGN
                     AHQLCLYNHVPLTQFWAAVECMNFPSSFPKDIGTVGFTRQCAETVGVDWWGSGVGKCV
                     EGKKRMGKAKKDKETQAEEKEGYYVGKEGRKLLLENIRETEKTGVTTSCTIEIGSTLV
                     PEGKRTCVVDGGVWKGCDDGHTATDFVRIIDAEWKNLKKGTSSIDEAFIDEHAED"
     gene            668603..670195
                     /locus_tag="CNM02170"
                     /db_xref="GeneID:3255157"
     mRNA            join(668603..668817,668882..669069,669119..670195)
                     /locus_tag="CNM02170"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543218|gb|CF689059.1,gi|41563865|gb|CF709706.1,
                     gi|41563871|gb|CF709712.1,gi|41576620|gb|CF722461.1,
                     gi|41576624|gb|CF722465.1"
                     /transcript_id="XM_568479.1"
                     /db_xref="GI:58262137"
                     /db_xref="GeneID:3255157"
     CDS             join(668757..668817,668882..669069,669119..670189)
                     /locus_tag="CNM02170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568479.1"
                     /db_xref="GI:58262138"
                     /db_xref="GeneID:3255157"
                     /translation="MEISMILALAFDLAIPLQYQNDDYLEKKHDKHLENYWPTFVMGC
                     LIEGVAFFLLHPDLFTLIVCLKTSALTIMWMSRDQGASSIKVRSRSSKSSNNETSKSR
                     PTSQPKSRSSKPPDPPIPANMPISTHISNPYKYLHRAGYADPAVAGMILALNSVDKEG
                     AKKNMNVWVKEKDKKEVDRRNKDYAERARKAGWPDKFGSHGQEAEGGEGGKLKIPEDS
                     VKKAEEAMRLEKVPADERKKVLSLLENPKSESEIQMAAKILERMGIPVEGPKKDRTQQ
                     SRGGNSSKPESKVKHKFGESDGQGGYRDIQLTKDTVQKLAKGMVRRGWSEADVNQWYT
                     YLQRPFSRREVETKVIPLAKSVDVYLGGGYTGGGPHRFDTKKLQALKPQLRDKCGVDS
                     NFAEHMILVAINQPTANKSQGMFNRWLTNGLSRAEFEQLRKTGPDWA"
     gene            complement(670432..673124)
                     /locus_tag="CNM02180"
                     /db_xref="GeneID:3255214"
     mRNA            complement(join(670432..670824,670876..670970,
                     671022..671104,671163..671259,671306..671392,
                     671454..671470,671531..671621,671673..671858,
                     671913..672031,672081..672285,672342..672384,
                     672439..672484,672536..672640,672707..672755,
                     672805..672877,672923..673124))
                     /locus_tag="CNM02180"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530112|gb|CF675953.1,gi|41530125|gb|CF675966.1,
                     gi|41537157|gb|CF682998.1,gi|41541833|gb|CF687674.1,
                     gi|41541834|gb|CF687675.1,gi|41542261|gb|CF688102.1,
                     gi|41549677|gb|CF695518.1,gi|41553862|gb|CF699703.1,
                     gi|41553866|gb|CF699707.1,gi|41555531|gb|CF701372.1,
                     gi|41555540|gb|CF701381.1,gi|41555803|gb|CF701644.1,
                     gi|41566093|gb|CF711934.1,gi|41566102|gb|CF711943.1,
                     gi|41569043|gb|CF714884.1,gi|41569050|gb|CF714891.1"
                     /transcript_id="XM_568508.1"
                     /db_xref="GI:58262195"
                     /db_xref="GeneID:3255214"
     CDS             complement(join(670530..670824,670876..670970,
                     671022..671104,671163..671259,671306..671392,
                     671454..671470,671531..671621,671673..671858,
                     671913..672031,672081..672285,672342..672384,
                     672439..672484,672536..672640,672707..672755,
                     672805..672877,672923..673053))
                     /locus_tag="CNM02180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568508.1"
                     /db_xref="GI:58262196"
                     /db_xref="GeneID:3255214"
                     /translation="MVHKTTARVARLKQEERERLVSEMESLLGLQSEHLEDEQYISAR
                     PEEIVGNLKSRKEGWTAERVMIAFIRAACAAQRKTNCLTEVLFREALDEAKRLDKEFL
                     ETGKAEGDFWGLPSSFKDTFNIKGVDSSIGVSLHCFQPTEDASQEGALVKLFRAAGGI
                     PFCKTNIPQTLLSFECKNPIFDRATNPTAVDRTCGGSSGGEGAIIALKGTPMGWGSDI
                     GGSLRIPAHYCGIYALKPVTGRWPSDGGRASVKGFEGIKAAVGPMARSVDDLIFASRT
                     MLTLAQRSLVSLNGEQLLPIPWREVELPKKLRVGYFTDDHAIKASPACVRAVLESVQV
                     LEKAGHEVIQFDPPDVSEALKIFAGLTSSDGYKTLLGNLGDDPMEASMRLTTLGAKYP
                     RWLHRILTWLIAKFTGDHLYAEVFASSRPKTVTEYWQYVHKRNVYANKFRKLAWEENK
                     FDMIVCPVQAVPALKHDETEWLSPLCIGTVLFNVVDSTVGVLPVTRVDRHLDALRADY
                     LEDSKGSKLLEKRVYIGKPWKEDPTYDAEKMHGLPVGVQVVGKAWEEEKVLEMMKVLV
                     GLIGYEP"
     gene            complement(673518..676078)
                     /locus_tag="CNM02190"
                     /db_xref="GeneID:3255064"
     mRNA            complement(join(673518..673778,673823..674042,
                     674092..674425,674482..674541,674594..674731,
                     674784..674953,675002..675097,675140..675254,
                     675309..675357,675409..675523,675592..675695,
                     675781..675825,675888..676078))
                     /locus_tag="CNM02190"
                     /product="neddylation-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531365|gb|CF677206.1,gi|41533183|gb|CF679024.1,
                     gi|41533199|gb|CF679040.1,gi|41536210|gb|CF682051.1,
                     gi|41536227|gb|CF682068.1,gi|41545201|gb|CF691042.1,
                     gi|41556929|gb|CF702770.1,gi|41556933|gb|CF702774.1,
                     gi|41557986|gb|CF703827.1,gi|41557992|gb|CF703833.1,
                     gi|41559390|gb|CF705231.1,gi|41559397|gb|CF705238.1,
                     gi|41573681|gb|CF719522.1,gi|41573693|gb|CF719534.1"
                     /transcript_id="XM_568274.1"
                     /db_xref="GI:58261727"
                     /db_xref="GeneID:3255064"
     mRNA            complement(join(673518..673778,673823..674042,
                     674092..674425,674482..674541,674594..674731,
                     674784..674953,675002..675097,675140..675254,
                     675309..675357,675409..675523,675592..675720,
                     675781..675825,675888..676066))
                     /locus_tag="CNM02190"
                     /product="neddylation-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545216|gb|CF691057.1"
                     /transcript_id="XM_568273.1"
                     /db_xref="GI:58261725"
                     /db_xref="GeneID:3255064"
     CDS             complement(join(673619..673778,673823..674042,
                     674092..674425,674482..674541,674594..674731,
                     674784..674953,675002..675097,675140..675254,
                     675309..675357,675409..675523,675592..675695,
                     675781..675825,675888..675994))
                     /locus_tag="CNM02190"
                     /codon_start=1
                     /product="neddylation-related protein"
                     /protein_id="XP_568274.1"
                     /db_xref="GI:58261728"
                     /db_xref="GeneID:3255064"
                     /translation="MPPSPSDLESRPTKITKMDDSMDVADAVTGTAPVPSYRPDAKAR
                     RYDRQLRLWASAGQRSLEQARVLLVGCDAAGSQSLKNLVLPGISQFTILSSKITTAQD
                     VATNFFLHPDSIGSNIAQESVKYLQELNPAVKGEAHMEDPALIIKTNPRFFLSFALII
                     LSNVEPYLENQIAEILWEASSSVDGPDIPLIAIRNSGFISRVQIQLREHTVVDSHPDT
                     THTLRIDQPFPALEQHARSLDFANMDSMEHSHIPWVVLLVRAASLWKESHGGKLPETN
                     EEKAEFKEKLKAEKIKEDEENYDEAMAQAYRVWIKSELPWEIKCLLDDETVKNISTNS
                     KNLHILLHTLSQYIIPAPHLPPTSPSLPDMHSSTAHYVALQNMYKAQYQADLKQFKSL
                     LNEVLRNIGLPTDTVPDEELEGFVKNVGGVGIIKGTPLSDSKNIRGLLPTELENFDEE
                     IDSATCLSMYLALLASETFFESEKRWPGASSLDNLAADNEKVQQILLDLFPIFSEGLP
                     EILEQSVEEVIRGGFATVPNTAAFVGGIVAQEAIKLVTNQYSPLDNTVVLNLIKSESS
                     KFKF"
     CDS             complement(join(673619..673778,673823..674042,
                     674092..674425,674482..674541,674594..674731,
                     674784..674953,675002..675097,675140..675254,
                     675309..675357,675409..675523,675592..675720,
                     675781..675825,675888..675939))
                     /locus_tag="CNM02190"
                     /codon_start=1
                     /product="neddylation-related protein"
                     /protein_id="XP_568273.1"
                     /db_xref="GI:58261726"
                     /db_xref="GeneID:3255064"
                     /translation="MILWMSRTPLLGLLLCLHIAQTQRLDVTTDNFAERSVHSVRLWA
                     SAGQRSLEQARVLLVGCDAAGSQSLKNLVLPGISQFTILSSKITTAQDVATNFFLHPD
                     SIGSNIAQESVKYLQELNPAVKGEAHMEDPALIIKTNPRFFLSFALIILSNVEPYLEN
                     QIAEILWEASSSVDGPDIPLIAIRNSGFISRVQIQLREHTVVDSHPDTTHTLRIDQPF
                     PALEQHARSLDFANMDSMEHSHIPWVVLLVRAASLWKESHGGKLPETNEEKAEFKEKL
                     KAEKIKEDEENYDEAMAQAYRVWIKSELPWEIKCLLDDETVKNISTNSKNLHILLHTL
                     SQYIIPAPHLPPTSPSLPDMHSSTAHYVALQNMYKAQYQADLKQFKSLLNEVLRNIGL
                     PTDTVPDEELEGFVKNVGGVGIIKGTPLSDSKNIRGLLPTELENFDEEIDSATCLSMY
                     LALLASETFFESEKRWPGASSLDNLAADNEKVQQILLDLFPIFSEGLPEILEQSVEEV
                     IRGGFATVPNTAAFVGGIVAQEAIKLVTNQYSPLDNTVVLNLIKSESSKFKF"
     gene            complement(676243..678012)
                     /locus_tag="CNM02200"
                     /db_xref="GeneID:3255279"
     mRNA            complement(join(676243..676702,676756..676953,
                     677008..677242,677297..677404,677465..678012))
                     /locus_tag="CNM02200"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542193|gb|CF688034.1"
                     /transcript_id="XM_568271.1"
                     /db_xref="GI:58261721"
                     /db_xref="GeneID:3255279"
     CDS             complement(join(676605..676702,676756..676953,
                     677008..677242,677297..677404,677465..677530))
                     /locus_tag="CNM02200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568271.1"
                     /db_xref="GI:58261722"
                     /db_xref="GeneID:3255279"
                     /translation="MSTVTQGVKDFFKSTSKPDSTEVCTETAPEVVQEHVRPQEHTES
                     AEAIDRERHIHHHQHRIQPIEHKQALDAKHVHVTAPAVVREHKEEMLPEHQDTLQKQR
                     TLHSNQQTIGEVEKSHAHIGTHVNQHEHHHIHETVQPVIQRETVQPTVVHHTAAIHEK
                     VHDAPIVHEVTTLPTIGHNEFLKMKEGLKSATHTDKGHQHQYYEGAPRVGSQQTSAAN
                     AASTTNAASTKEVPTA"
     gene            679249..679341
                     /locus_tag="CNL02210"
                     /db_xref="GeneID:3255295"
     tRNA            679249..679341
                     /locus_tag="CNL02210"
                     /product="tRNA-Tyr"
                     /codon_recognized="UAC"
                     /db_xref="GeneID:3255295"
     gene            679351..679469
                     /locus_tag="CNL02220"
                     /db_xref="GeneID:3255252"
     tRNA            679351..679469
                     /locus_tag="CNL02220"
                     /product="tRNA-Lys"
                     /codon_recognized="AAG"
                     /db_xref="GeneID:3255252"
     gene            complement(680339..682437)
                     /locus_tag="CNM02230"
                     /db_xref="GeneID:3255244"
     mRNA            complement(join(680339..680792,680843..680954,
                     681008..681319,681372..681604,681660..681817,
                     681863..681940,681992..682113,682234..682437))
                     /locus_tag="CNM02230"
                     /product="peptidyl-diphthamide biosynthesis, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544556|gb|CF690397.1,gi|41544564|gb|CF690405.1"
                     /transcript_id="XM_568269.1"
                     /db_xref="GI:58261717"
                     /db_xref="GeneID:3255244"
     CDS             complement(join(680443..680792,680843..680954,
                     681008..681319,681372..681604,681660..681817,
                     681863..681940,681992..682113,682234..682416))
                     /locus_tag="CNM02230"
                     /codon_start=1
                     /product="peptidyl-diphthamide biosynthesis"
                     /protein_id="XP_568269.1"
                     /db_xref="GI:58261718"
                     /db_xref="GeneID:3255244"
                     /translation="MSDAFSTPADHALSHPELEAILENAQAGPSSIGDGAEGMSIEEA
                     FEVDETVRRVLEGDYKTIGLQFPDELLPSSVSVYRAIQTRIAHTGAQAYVLADSTYGN
                     CCPDVLSCLHLPADFLVHYGHACLTPTDALPVHYVFPRQKLDVKQAVESLLAASKNEL
                     DGDGRKGIVVVWDVSYDWLANDIRDTFSQDSTIQISFASIQKPTLASQKGLKDVKGKT
                     PALRSVEPPQGLEMNDCVLWYIGEEGRSCMNLQMTHANNPLFIYSPSSQSVSPLHRTT
                     SRLLSRRLFALHQALSADVFGLIVSNIGLASSKPLLAQLREDLKRAKKKSYTLSVGRL
                     NPAKLANFAEIECFVLVGCAEGGVVDSKDFLRPIITPWELELALQGPDHVWAPENWTL
                     DLGTVLKDAQEREIKIKQDSSTADSDDDSLEFSLITGTMRTKKRFAFGNGTHTLENNK
                     LLGDGGVQDLTLRNQNFSLSKLESAGSTFLASREFQGLEPRYGMDEPSVLEQGRSGVA
                     RGYTEEK"
     gene            <684558..685285
                     /locus_tag="CNM02240"
                     /db_xref="GeneID:3255186"
     mRNA            join(<684558..684674,684876..685105,685181..685285)
                     /locus_tag="CNM02240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568507.1"
                     /db_xref="GI:58262193"
                     /db_xref="GeneID:3255186"
     CDS             join(684558..684674,684876..685105,685181..685223)
                     /locus_tag="CNM02240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568507.1"
                     /db_xref="GI:58262194"
                     /db_xref="GeneID:3255186"
                     /translation="MPAHIPIVKKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRF
                     KGQIPMPKIGYGSNQKTRHLLPSGHKELLVHNLSELELLLMHSGKYAASIAHGVSSKK
                     RVEIIARAKVLGVKVTNPAAKLRTEEA"
     gene            complement(686017..689424)
                     /locus_tag="CNM02250"
                     /db_xref="GeneID:3255092"
     mRNA            complement(join(686017..687355,687418..687578,
                     687650..687717,687802..687907,687973..688315,
                     688386..688680,688747..689095,689176..689424))
                     /locus_tag="CNM02250"
                     /product="chromosome condensation-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539084|gb|CF684925.1,gi|41539094|gb|CF684935.1,
                     gi|41544227|gb|CF690068.1,gi|41544228|gb|CF690069.1,
                     gi|41558593|gb|CF704434.1,gi|41558597|gb|CF704438.1"
                     /transcript_id="XM_568267.1"
                     /db_xref="GI:58261713"
                     /db_xref="GeneID:3255092"
     CDS             complement(join(686275..687355,687418..687578,
                     687650..687717,687802..687907,687973..688315,
                     688386..688680,688747..689095,689176..689241))
                     /locus_tag="CNM02250"
                     /codon_start=1
                     /product="chromosome condensation-related protein"
                     /protein_id="XP_568267.1"
                     /db_xref="GI:58261714"
                     /db_xref="GeneID:3255092"
                     /translation="MMLRHIGTYRAPSRKTDWSGFDEFLRSWIPSHTVPQLRSFASAL
                     VTYGRRDPFMRSGDRKADVIQKIQEAFMALKAKMDLDAYVEARYHCEVAVGGGWDPFP
                     RTNTTIMVPPAQPIRAHPSVQPPPPPTFGGVPRWSSGVNNNSSGLNGYRSTSGFASGS
                     VGYGNTSAHAVSSTPSHGPQHALQDWKINPMWKPLRAITSMETLPDISANESHSTYRT
                     KRTQFVLPNDVIEKLKASRESPQTPPHYSLRLFCTSSDHYRPTSVHARHIPPSTNIPI
                     EYPGNPEVSVDGTLLPFKEKGLRGKAGSAPPFDLDKPINNGVAAGGRVALVPGRLMGV
                     NVGHRGPTTGKNKTQSKRFFFQIVLAEMTTKEELLAKLNKLEPTKAEHAIEQLRKKQE
                     NDDDIVAGTASMSLKDPLSYMRMTRPIRSSKCSHIQCFDATWWIESNAVHPQWLCPHC
                     SKELRFDDLIVDGYVMDILKVVPDTVDDVILEPTGEWHTEDNKYGTASWLASHVKPSS
                     ATVEASTPVAPSVPASFSSEIETKPSVCDMNDISSGDGANRGGTGLKRKVVQVIDSDE
                     EGDGTPAKSSVPPAGRVTALGSSSSVGGSRTGASTPIIDLTLSDSDDETDEETGPVTS
                     SRAPPAPIQVPRTSTAASAIVSPKRPVSAAGTQFHSFRETTSNVVRSPSTSSWPGLSV
                     AGIGGVSGRSSPLNNSSGQTSASASGSATTSHLQPPSNQYPPISPPHFSDPPPQTTVA
                     SPRITALPPPSHIFPSSSPPSASIAPAVPLDHVPPARAFSGPGWVNPLRPNSSSEISS
                     STYASTTSPSDNRGNERESSGSKY"
     gene            <689608..690591
                     /locus_tag="CNM02260"
                     /db_xref="GeneID:3255294"
     mRNA            join(<689608..689701,689836..689948,690045..690129,
                     690189..690225,690270..690591)
                     /locus_tag="CNM02260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568265.1"
                     /db_xref="GI:58261709"
                     /db_xref="GeneID:3255294"
     CDS             join(689608..689701,689836..689948,690045..690129,
                     690189..690225,690270..690549)
                     /locus_tag="CNM02260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568265.1"
                     /db_xref="GI:58261710"
                     /db_xref="GeneID:3255294"
                     /translation="MTEGKSYEGMSKEERDAHDQQQREKEKKEQAVLPYSWTQELATA
                     TVTVPLPKGTRSKDLEVVIGKRKLKVKLKSSPSSILEGELYNDIVVDDSSWTIDDGTL
                     TIELDKLSTHPPERFHIGSPQWWPHILTHHPTIDTTKINPTPSSLSDLDPKTRGMVEK
                     MMWDNQQKALGRPTSDERKKEEVMKKFMAEHPEMDFSNAKIE"
     misc_feature    690912..690989
                     /note="GA-rich"
     gene            complement(<691632..>692130)
                     /locus_tag="CNM02270"
                     /db_xref="GeneID:3255066"
     mRNA            complement(join(<691632..691701,691764..692051,
                     692093..>692130))
                     /locus_tag="CNM02270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568264.1"
                     /db_xref="GI:58261707"
                     /db_xref="GeneID:3255066"
     CDS             complement(join(691632..691701,691764..692051,
                     692093..692130))
                     /locus_tag="CNM02270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568264.1"
                     /db_xref="GI:58261708"
                     /db_xref="GeneID:3255066"
                     /translation="MFRASRVVLSALRPLKASTNITGLAVHPDPLPALTSIYTSTLSS
                     LSQLPAASVYRQATEALTKYRLAIVEKAQGDVEKVESELGSIVEIVIEEAKSEEGLVV
                     KMKDWKSWEGLMEEPHPGQWRYFEPLSDE"
     gene            <692838..>696266
                     /locus_tag="CNM02280"
                     /db_xref="GeneID:3255067"
     mRNA            join(<692838..692988,693192..694615,694662..694941,
                     694991..695306,695359..695745,695808..695886,
                     695937..>696266)
                     /locus_tag="CNM02280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568263.1"
                     /db_xref="GI:58261705"
                     /db_xref="GeneID:3255067"
     CDS             join(692838..692988,693192..694615,694662..694941,
                     694991..695306,695359..695745,695808..695886,
                     695937..696266)
                     /locus_tag="CNM02280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568263.1"
                     /db_xref="GI:58261706"
                     /db_xref="GeneID:3255067"
                     /translation="MGSSPPPPSFLVPTTRNEQELSFPGSLKLNDKVSNDGEEPGVSM
                     YVRLFDDEPRYLLTRLLLRRPSRVHTYTSLVASYSSEIGEEGIKMAMKTLTRRLAVPK
                     DIVNSDPDPVPGTPIASSSRPGPSPLSAKAEGRRPANALWANKPWVDSPSGLTEAQER
                     ADPELAAALKESYWASKVGRVNVDSDDEGDGLPAANNRSELVSTSVSTPTVSRQSSGI
                     PTISPIEFSLTPESPPPVSFLAEDEKSLSLDDLMTCMSFDQLRKVAKAHKLSASSLLT
                     RESTLNALRGMAKQQTVLGFAPMKGKGKATTPAQVHGKQTTLPFASKPKQTSELLLTA
                     QMLSSFGGSAIRLTPSLHSLISRVNLIFSRTPPIAPGTASLMLPSILVTSNKRRYPDY
                     GLTTRSKIWKDRDELLVWERAVGWEATVTEALGETWDQTRKNPNAAPIPGSTSRTGWV
                     NRKEGAKIVRKIWEGTWDVWKEMVDGDKGKEVDVSKEEGGLVGDRFQTGKFLFIMFCS
                     LILTNRAGHVLTRIVYKGAEALGILHEYDNECMVLRALLAQRRWRRGKRGYVSVSDLF
                     QTNLTKRHRAWYDRLALVLMNHYNSSPAEKEEKQREATQVCIDGLLDEATHLIYRPAL
                     SRRLKRLENKLNLPSDERHISFASLLTCKTRELNAVRSPENRGVVRAKSCSGSVAREG
                     DDDEGTGGKGKLVGKSLWMGKEGEVSVEQWVLEWWEKKGYKGYHSESSILTTLFTLLI
                     WPVLFHPLPGAFETSYQTAPLDLGEDTFAPSRRTLLEDRLAEISKTKRALELLREVDN
                     RERPKGTWAVGVDWGYEKEDLEEILECLSGKALSGVCRMLAEEYRHRASGVPDLIVWN
                     PQTKDARFVEVKGPGDSLSETQKIWIDVLLSSGIQVEVCRVKALSPTAAQLQSLEKKR
                     KTSPALNISSNSIDVKRLKRRSTTSTISAYVKTDDGEYVKADEVVELDEEDDGWERRD
                     EMRFESGVERREGRLE"
     gene            complement(697698..701078)
                     /locus_tag="CNM02290"
                     /db_xref="GeneID:3255237"
     mRNA            complement(join(697698..698094,698148..698357,
                     698414..698509,698564..698838,698909..699036,
                     699098..699194,699256..699675,699732..699802,
                     699855..700135,700206..700384,700441..700812,
                     700889..701078))
                     /locus_tag="CNM02290"
                     /product="osmoregulation-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538553|gb|CF684394.1,gi|41538565|gb|CF684406.1,
                     gi|41558312|gb|CF704153.1,gi|41558326|gb|CF704167.1,
                     gi|41569306|gb|CF715147.1,gi|41569317|gb|CF715158.1"
                     /transcript_id="XM_568262.1"
                     /db_xref="GI:58261703"
                     /db_xref="GeneID:3255237"
     CDS             complement(join(697762..698094,698148..698357,
                     698414..698509,698564..698838,698909..699036,
                     699098..699194,699256..699675,699732..699802,
                     699855..700135,700206..700384,700441..700812,
                     700889..701030))
                     /locus_tag="CNM02290"
                     /codon_start=1
                     /product="osmoregulation-related protein"
                     /protein_id="XP_568262.1"
                     /db_xref="GI:58261704"
                     /db_xref="GeneID:3255237"
                     /translation="MAPFGGRGSSGRGRGGFRGGRGGRGGRGGYGGPQLPSSLLEQVD
                     AKYGSGGKKDVTRKEKRKATRDDRKGPAQTQKTRRRSPPSDHEEEEKDESEQPPFKKS
                     KTSKPKSVSSSEKSNSEKKEKKKKLPELTLPEESVGGDVEDREIEWLEYMLRKEKGKS
                     KDEDDLDDGLDDLLNFAEAFEHGGKGVNKQILDDEDDEGISDFGEENEDDGEEEESEE
                     DQDEDGGEDNEIDDEEEEFMGFSDQDDQEKEEDESSAQEKHQAGHDDAEPSVPSDPTP
                     SSSTDTPAPTKYIPPHLRAAQLEEKSKGNKEKAEEKIRLERKAQGLLNRLSEQNIESI
                     LAELETLYRNHSRNDVTTALTDLIIQMISNKANLLDSFVVLYATLVGALHRVIGMEFG
                     AHFIHTLITKYSGLQSPSSLSVESQQSTTIQTTIYQTPDAGKESLNLLTLIAELYNAQ
                     VVGSRLIYDLIRGFLEGEEKDREVMGEREVEGLLKILRCSGAQLRTDDPASLKDIVNL
                     VQEKTKGKEKTMTARARFMVETLTNVKNGKVKSSATSEAGNDAAQRMKKFLSGLGLLA
                     YEPLRVSYSDLLSADKKGKWWLVGAGWSGNPLVELEQQREQAKSSGKTEKTGKKKEEK
                     DSEAALLELARKQGMNTDVRRGVFVVLMTSEDYVHACDRLSMFKLSDVQQREFVRVAL
                     HCCGLEATYNPYYTLILSHLCANSYDHRFTFQYALWDFMRELENGSKVSKEKLGNVAR
                     AVGYVVARGGLSLTVFKAVDFTSLSKPLIKFLITVLVHLVIALQTVSPIFTLPKSYDL
                     ARNFDDEVIQERFEQVLSNTELAGGWLWMLDREMKDGKKWEEEVTGERERVVVKKSLE
                     IAQNVLRAAAL"
     misc_feature    700219..700289
                     /note="CT-rich"
     gene            <701329..702320
                     /locus_tag="CNM02300"
                     /db_xref="GeneID:3255065"
     mRNA            join(<701329..701457,701526..701909,701988..702132,
                     702227..702320)
                     /locus_tag="CNM02300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568411.1"
                     /db_xref="GI:58262001"
                     /db_xref="GeneID:3255065"
     CDS             join(701329..701457,701526..701909,701988..702132,
                     702227..702276)
                     /locus_tag="CNM02300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568411.1"
                     /db_xref="GI:58262002"
                     /db_xref="GeneID:3255065"
                     /translation="MVKDIPIPRYDFYQTPNELILALYIKGYDKLKDDVKVEFGTDSV
                     IINLPALAPSTEEQRIALKPLASTLSPGSSTYRVLGTKIELKLAKAGGMTWPCLLAEE
                     RKGAAVVPQQQVPEAETSRSASGSGSASGLKSDAATGDTVGGQEEEKKKKKKNWDKIV
                     DDDEEPDPSDPNAGGDAALQKFFAQIYGNADEDTKRAMIKSFTESGGTTLSTDWSSIG
                     KQTTPVRPPEGVEPRKF"
     repeat_region   701830..701860
                     /rpt_type=tandem
                     /rpt_unit_seq="gaa"
                     /satellite="microsatellite"
     gene            complement(702513..>704947)
                     /locus_tag="CNM02310"
                     /db_xref="GeneID:3255129"
     mRNA            complement(join(702513..702949,703040..703139,
                     703236..703465,703520..703646,703703..703941,
                     703989..704057,704099..>704947))
                     /locus_tag="CNM02310"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540139|gb|CF685980.1,gi|41540150|gb|CF685991.1,
                     gi|41542423|gb|CF688264.1,gi|41542436|gb|CF688277.1,
                     gi|41551478|gb|CF697319.1,gi|41569993|gb|CF715834.1,
                     gi|41569997|gb|CF715838.1"
                     /transcript_id="XM_568261.1"
                     /db_xref="GI:58261701"
                     /db_xref="GeneID:3255129"
     CDS             complement(join(702884..702949,703040..703139,
                     703236..703465,703520..703646,703703..703941,
                     703989..704057,704099..704947))
                     /locus_tag="CNM02310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568261.1"
                     /db_xref="GI:58261702"
                     /db_xref="GeneID:3255129"
                     /translation="MPDSPPRPAASPTASLSGMGIQFHSANPLPPPLHDSPPPSAAPL
                     LRSYSDDRRQRAQDERTLLSHQTSSAGVPGSAVPSAPFSGGNLNLREGVHRNSFSHSF
                     SADRVRTSPPPPHVPPAPPSHHPSSAVHASLPTPAAPRARALSPRLPIAQTARPAPKT
                     SSSAMSSSIGLQTNEPRGRVVSPQHGPPGGPSPPEPAPSTPAPPNPYEPPHLASAWRG
                     DSAYAAAMYHPLSGKDAQYGSTPTVHPAKVPFTESTAYWLGLYFVFNLGLTLFNKFVL
                     VSFPFPYTLTGLHALSGCAGCYIALERGAFTPARLAQRENLILGAFSVLYTINIAVSN
                     ISLQLVTVPFHQVVRASTPLFTIFISSIFLRTRFSIMKLVSLLPVVAGVGFATYGDYY
                     FTAWGLILTLLGTFLAALKTVVTNLIQTGAGGRLKLHPLDLLMRMSPLAFIQCVIYGW
                     YTGELERVRAYGATQMTSTKAVALLVNGVIACGLNIVSFTANKKAGALTMTVSANCKQ
                     VLTIALAVVLFNLHITPTNGIGILLTLIGGGWYGYVEYQEKNKKSKVLDRM"
     misc_feature    704336..704393
                     /note="GC_rich"
     repeat_region   704474..704616
                     /rpt_type=tandem
                     /rpt_unit_seq="cgggg"
                     /satellite="microsatellite"
     gene            706308..707582
                     /locus_tag="CNM02320"
                     /db_xref="GeneID:3255251"
     mRNA            join(706308..706338,706612..706695,706872..706971,
                     707038..707375,707458..707582)
                     /locus_tag="CNM02320"
                     /product="structural constituent of ribosome, putative"
                     /transcript_id="XM_568413.1"
                     /db_xref="GI:58262005"
                     /db_xref="GeneID:3255251"
     CDS             join(706612..706695,706872..706971,707038..707375,
                     707458..707535)
                     /locus_tag="CNM02320"
                     /codon_start=1
                     /product="structural constituent of ribosome"
                     /protein_id="XP_568413.1"
                     /db_xref="GI:58262006"
                     /db_xref="GeneID:3255251"
                     /translation="MSAFSAQPIVIDGKGHLLGRLASVVAKQILTGQKVTVVRCEEIN
                     ISGSFFRNKVKYHNYLHKRHIVNPRKSGPFHFRAPSRILYKAIRGMIPHKSSRGAAAL
                     KRLELYEGVPPAQDRVKKMVVPAALRVLRLKPGRKYCTVKRISAEVGWNYKDVVDRLE
                     EKRKVKGQAYFERKQAALKLRAKAEASAPKDAKLVEFGY"
     gene            complement(<707707..>709483)
                     /locus_tag="CNM02330"
                     /db_xref="GeneID:3255293"
     mRNA            complement(join(<707707..707727,707900..708097,
                     708212..708565,708633..708931,709088..709202,
                     709268..709328,709446..>709483))
                     /locus_tag="CNM02330"
                     /product="metabolism-related protein, putative"
                     /transcript_id="XM_568488.1"
                     /db_xref="GI:58262155"
                     /db_xref="GeneID:3255293"
     CDS             complement(join(707707..707727,707900..708097,
                     708212..708565,708633..708931,709088..709202,
                     709268..709328,709446..709483))
                     /locus_tag="CNM02330"
                     /codon_start=1
                     /product="metabolism-related protein"
                     /protein_id="XP_568488.1"
                     /db_xref="GI:58262156"
                     /db_xref="GeneID:3255293"
                     /translation="MLKYIYVCRHGFRSNWVDPSIKSGPTGMNRDPPLAAHGLDQAES
                     LAAFLSSPSSTSPYPIPEIVFSSPFYRCVHLEHGVGEWYSPVYPNTGLHPRPSLSHTL
                     SPLFPPGSINPSYEPTLFPSRKGESLEAIHERAEIFIDAWTRRVEGEWPDVECVVIFA
                     HAASIIALGRALTGNRSLEVIAGCATTSLYARKPTASSSSSSSLKPNPGSSQYTVLYS
                     GRHDYLPLGLERDWSFADVVLTPDGEVVGDNGDGDGHLGEEWEEGLSEVGKRWLEDTR
                     FERERVRGKGQIGDTSGLIQQRIVYLLHCKMIGEGKNVSLNVIIAVFSSLRRHCFEFL
                     WWRIHRNQLMIKPGRTIPDARLHRRSP"
     misc_feature    707828..707848
                     /note="AT_rich"
     gene            <710411..>711695
                     /locus_tag="CNM02340"
                     /db_xref="GeneID:3255120"
     mRNA            join(<710411..711042,711100..711375,711671..>711695)
                     /locus_tag="CNM02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_568497.1"
                     /db_xref="GI:58262173"
                     /db_xref="GeneID:3255120"
     CDS             join(710411..711042,711100..711375,711671..711695)
                     /locus_tag="CNM02340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568497.1"
                     /db_xref="GI:58262174"
                     /db_xref="GeneID:3255120"
                     /translation="MDTSITPSGSRIPRNPFTRAFTSHSRHKQTLSDLSSLQSLNSAL
                     SARLSQVLPLEEALQSEVTTLTESLNVLSSEGARMKSENDSLRQRLEAAKFLTTGFNT
                     QVEELSKALHQSLANQRVDMWENDTATAKALSTAKEKKAAIMDIMSSLSKRDEIKRFV
                     TDVLQSQVDYATTGDFIFNKDDLVRAMDLDPSINNGSFGWEMRLGIPGSNGFKTAESA
                     AMDETVIFLATQGAEALKTLPSTYVYSRPVLEKIQKCDWDGISSAAFTKLRGPIRDRL
                     TSNAKTRLTKEAMGQGTLSRLSMITIPASTIVSR"
     gene            <711791..714686
                     /locus_tag="CNM02350"
                     /db_xref="GeneID:3255119"
     mRNA            join(<711791..712754,712956..713230,713293..713825,
                     713886..714080,714353..714454,714527..714686)
                     /locus_tag="CNM02350"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532890|gb|CF678731.1,gi|41532894|gb|CF678735.1"
                     /transcript_id="XM_568260.1"
                     /db_xref="GI:58261699"
                     /db_xref="GeneID:3255119"
     CDS             join(711791..712754,712956..713230,713293..713825,
                     713886..714080,714353..714454,714527..714542)
                     /locus_tag="CNM02350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568260.1"
                     /db_xref="GI:58261700"
                     /db_xref="GeneID:3255119"
                     /translation="MESSQLTAQRPEAQLRTAYLENQVALLTSQLDKSSLENANLRNQ
                     IETLESRSVDFDERLSILTRALFKQLAEKRVAQSTYDIVTANVLDTPQRVEEAMTDIM
                     FNTEQHGEIKSFVEEALKKRIRRVTAGDFTGRDIRNAMDVPMTTSIERNFWEVCLGHE
                     GTTDYSLHDVLSPKFHNTSLLERFAASESAEMDNTVGRLTRQGAESLCTARSSVLPSS
                     TLGGKMEQYDWDNISQAASSRLSQHIKNQLTTQAEKRRGMLASGQGTMSGLKVELLPW
                     YKVEDKSLQLELFILSNDGYFESTGVPTAIDLRSTVFPDFESFRENLKSTSSCRVFST
                     SPPNLPYSFSVILFLFSPTMTELPGAKRHKPNVPQNPVVGSALKKRQPKVPGPDYEKG
                     LEYWDNVEASVDGVLGGFGTGPVPHIEQLTSRLLLLSLIPSLSPFSNPLCPSPIANPS
                     PPPHRRVALDVGAGIGRVTRHVLIPLFDDVILVEPVDKFVSEAYRSAAAGEWRDLPSL
                     EPLPPKPSTSAEEDKRALEQWKEAKRRQDESKAGRGKRVRFVKGGLQYLDPKSPGKGG
                     EELGVVGAKRGGEGGLDGEDVLYDVIWCQWCLGHMNHADLVAFLRRARAALREDDENR
                     QSYIFVKENCCDDGPGGIPQEFMDEEDSSLTRSSAKWLQAFADAGLKVVKEVTQEGMP
                     EELFVVKAWALK"
     gene            complement(714892..717068)
                     /locus_tag="CNM02360"
                     /db_xref="GeneID:3255189"
     mRNA            complement(join(714892..715233,715301..715831,
                     715929..716032,716089..716103,716158..716477,
                     716531..716637,716690..716711,716774..717068))
                     /locus_tag="CNM02360"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537359|gb|CF683200.1,gi|41545778|gb|CF691619.1,
                     gi|41545788|gb|CF691629.1,gi|41561827|gb|CF707668.1,
                     gi|41561832|gb|CF707673.1,gi|41570984|gb|CF716825.1,
                     gi|41570999|gb|CF716840.1,gi|41571243|gb|CF717084.1,
                     gi|41571250|gb|CF717091.1"
                     /transcript_id="XM_568434.1"
                     /db_xref="GI:58262047"
                     /db_xref="GeneID:3255189"
     CDS             complement(join(715034..715233,715301..715831,
                     715929..716032,716089..716103,716158..716477,
                     716531..716637,716690..716711,716774..717058))
                     /locus_tag="CNM02360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568434.1"
                     /db_xref="GI:58262048"
                     /db_xref="GeneID:3255189"
                     /translation="MLPRFWPVILTMKPRIPKEPYVRTPEQIALAERRRAERAAKKAA
                     VAAGKVEPTEEEKLVTGNCKFLKRDWIDVSGKDKEEKGRSQGKRAKIITWNLLAQTLV
                     RRELFPGSDCLRWADRKPMLLAEFAHHSSSDIICLQECDKLPDFLPALPQHAYIKGTG
                     PGKLHGLVVLYRKDRFSLRQSKLIHLDFEEIHPRSSDLVIREDGAESLEEVRRRRGGS
                     RQTKNVGLIVALECKDGEGVIIATTHLFWHPKFVYERVRQTLLLVRAIRRFQKANCCT
                     TWPVVLAGDLNTQPSEATYQLLVSPHSPLPQRYLDEISQSRLVHDSLSKIPLTPPEIP
                     SSASEPASTTGTGTTTPAIINKTEAEKDAENEDLDDKSIANTRPPRPSDGLPTALELV
                     DLFKAEFPLIDGDSDQPEGAMSAYGSTQWKEGKGIDGFDDRKGFGDGEKGQGGDEPGW
                     TCFTPLFRLTLDYLLVLPPLNSPPFLIAPPASSTSATSGAEIRKVMLPPKVSDLGEGL
                     PRKGICASDHVAVGCEIEW"
     gene            717242..>718467
                     /locus_tag="CNM02370"
                     /db_xref="GeneID:3255040"
     mRNA            join(717242..717647,717718..>718467)
                     /locus_tag="CNM02370"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41565778|gb|CF711619.1,gi|41565791|gb|CF711632.1"
                     /transcript_id="XM_568419.1"
                     /db_xref="GI:58262017"
                     /db_xref="GeneID:3255040"
     CDS             join(717351..717647,717718..718467)
                     /locus_tag="CNM02370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568419.1"
                     /db_xref="GI:58262018"
                     /db_xref="GeneID:3255040"
                     /translation="MPFTPIHSLIGAILLHLSTSELLEDTGHVFGISGIVSGAVLGER
                     QGWRWAVVGGLVAGPALAAVTGVKALFPGQALSALEIIGKGKLALAGILVGLGSRLGS
                     GCTSGHMLCGVSRLSVRSIVATITFFATAVITSNIFPQYPTPSTPAYSIELPSLSTTV
                     VLICVPLVARLVQRATSTTLTRMSSVPKTARLLPYFVSSLIFSVGLSLSGMTDPSKVS
                     AFLRFPHPQCWDPSLLLVVLGGVLPNMLHYAFIINENKRPGDGQPKPKPRFSWESWQV
                     PTREDIDSKLVVGAAIFGVGWGLVGICPGPALVSLGSALLDVCSGSGSWQVLGKISTF
                     LGTMLLGMAFGGSI"
     gene            complement(718510..719873)
                     /locus_tag="CNM02380"
                     /db_xref="GeneID:3255161"
     mRNA            complement(join(718510..718672,718737..718797,
                     718873..719131,719199..719265,719324..719478,
                     719536..719592,719648..719665,719730..719873))
                     /locus_tag="CNM02380"
                     /product="expressed protein"
                     /transcript_id="XM_568432.1"
                     /db_xref="GI:58262043"
                     /db_xref="GeneID:3255161"
     CDS             complement(join(718606..718672,718737..718797,
                     718873..719131,719199..719265,719324..719478,
                     719536..719592,719648..719665,719730..719834))
                     /locus_tag="CNM02380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568432.1"
                     /db_xref="GI:58262044"
                     /db_xref="GeneID:3255161"
                     /translation="MPMPDEHIHPTATGLAKKVVDAHQDPQDLVFWSGWFCPFNQRIW
                     IALEERKIPYQYHEVNPYKKEEAFLKLNPLGLVPTVEIKTAEGSKSLYESDVLVEFLE
                     DLYPPSEEHPSIFPSDPYEKSWVRLNIQHVSKKIIPNYFKLQQSQTESDQVAARKELI
                     SALRTYAKRIKGPYFAGEQWTAVDGTLAPFIRRLYILEKHRNFDEKAVGDGWWEYRER
                     LMTRDSLKNTCSEDQYYEEILGRYLKNEAQSEVAKATRAGQSLP"
     gene            <721121..>722518
                     /locus_tag="CNM02390"
                     /db_xref="GeneID:3255172"
     mRNA            join(<721121..721204,721336..721479,721561..721661,
                     721711..722394,722485..>722518)
                     /locus_tag="CNM02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_568498.1"
                     /db_xref="GI:58262175"
                     /db_xref="GeneID:3255172"
     CDS             join(721121..721204,721336..721479,721561..721661,
                     721711..722394,722485..722518)
                     /locus_tag="CNM02390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568498.1"
                     /db_xref="GI:58262176"
                     /db_xref="GeneID:3255172"
                     /translation="MSNSTEVIASHNPYPVTPTGYLMGSYFCLLVIWIWVLSSVQVVL
                     VLVSSWKYFVDGLTNTKIWGEFWWPLSIQDALLYFGRRAWQLMGKKMWLICTLYGFST
                     LTLFCGWALAITGRLWADNPYSTNEEFRSRVIGVPSQVVAILWMGLSAAIDGCITCML
                     LYRFSRARHSISQSTRTLVRRMMTLTLSTVLLTHIVGGVMCIIFIASPSSHRTKSNFL
                     WVLLELITELYALSAVFTINSRVPRSSPSSLYENGKEEDGKFRGGAEFPMTQTALDRQ
                     VEGYQGSTPFGVRVTFSSRCQRNKNGKKSGADGALVTHEDAVPALSAEGTRIPDTPTA
                     ELTGEEAGQKRSWA"
     gene            723331..725302
                     /locus_tag="CNM02400"
                     /db_xref="GeneID:3255152"
     mRNA            join(723331..723433,723497..724057,724117..724326,
                     724390..724600,724666..724972,725038..725302)
                     /locus_tag="CNM02400"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533033|gb|CF678874.1,gi|41533038|gb|CF678879.1,
                     gi|41535231|gb|CF681072.1,gi|41535240|gb|CF681081.1,
                     gi|41538149|gb|CF683990.1,gi|41538159|gb|CF684000.1,
                     gi|41539846|gb|CF685687.1,gi|41540588|gb|CF686429.1,
                     gi|41540594|gb|CF686435.1,gi|41548345|gb|CF694186.1,
                     gi|41548351|gb|CF694192.1,gi|41548520|gb|CF694361.1,
                     gi|41550028|gb|CF695869.1,gi|41555831|gb|CF701672.1,
                     gi|41555844|gb|CF701685.1,gi|41556454|gb|CF702295.1,
                     gi|41556461|gb|CF702302.1,gi|41562396|gb|CF708237.1,
                     gi|41562404|gb|CF708245.1,gi|41562691|gb|CF708532.1,
                     gi|41562701|gb|CF708542.1,gi|41564286|gb|CF710127.1,
                     gi|41564294|gb|CF710135.1,gi|41566818|gb|CF712659.1,
                     gi|41566821|gb|CF712662.1,gi|41570435|gb|CF716276.1,
                     gi|41570446|gb|CF716287.1,gi|41572151|gb|CF717992.1,
                     gi|41572164|gb|CF718005.1,gi|41572963|gb|CF718804.1,
                     gi|41572970|gb|CF718811.1"
                     /transcript_id="XM_568415.1"
                     /db_xref="GI:58262009"
                     /db_xref="GeneID:3255152"
     CDS             join(723656..724057,724117..724326,724390..724600,
                     724666..724972,725038..725242)
                     /locus_tag="CNM02400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568415.1"
                     /db_xref="GI:58262010"
                     /db_xref="GeneID:3255152"
                     /translation="MSASILALGGGAVARPNAFRRLTTTTTSRLSRGFAGTASTSSLS
                     SIPSMFNASKSGSQLGEVGKLAELAEMIGSLKTGQEELIIAMKNLSTEIEAQKKEMRE
                     KRVYVLDTAKEEGEFGMVDNAGAAKVTTLEDDQFHFLDRVFHEPVQMVEKIGGIKTVN
                     EPAFVILAPTREQLQESLELAQGGILQTPAIIRMCETHLSSSLPELLDAGETFKAQIR
                     LIAGEIANVAVDGQVFSAENDDGTRVSFLTEYNGSMTDPRFDDYFAMKEGEAEKYAEL
                     YAQYREENFHPVDLGEEPAVSTHSLDDPNQPDWLQSHFDKNPSIYSAPAEKIDHNEIL
                     EVVNLPSYNVRFYFHSPVEGSCTIEGWQNWTMRMQVDEDEAADTEIFGDDVMTFNCPV
                     YWQADLPFKLDLSGTVLDIETDGDGPYFTLASQETAAEDCQPQNVIWSAELP"
     gene            725515..727522
                     /locus_tag="CNM02410"
                     /db_xref="GeneID:3255063"
     mRNA            join(725515..725663,725766..725779,725856..725874,
                     725926..725989,726043..726182,726232..726300,
                     726347..727080,727130..727193,727243..727522)
                     /locus_tag="CNM02410"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530201|gb|CF676042.1,gi|41530212|gb|CF676053.1,
                     gi|41530846|gb|CF676687.1,gi|41530854|gb|CF676695.1,
                     gi|41531014|gb|CF676855.1,gi|41531030|gb|CF676871.1,
                     gi|41532681|gb|CF678522.1,gi|41532693|gb|CF678534.1,
                     gi|41538240|gb|CF684081.1,gi|41538244|gb|CF684085.1,
                     gi|41546026|gb|CF691867.1,gi|41546547|gb|CF692388.1,
                     gi|41547662|gb|CF693503.1,gi|41547681|gb|CF693522.1,
                     gi|41559883|gb|CF705724.1,gi|41559896|gb|CF705737.1"
                     /transcript_id="XM_568417.1"
                     /db_xref="GI:58262013"
                     /db_xref="GeneID:3255063"
     CDS             join(725524..725663,725766..725779,725856..725874,
                     725926..725989,726043..726182,726232..726300,
                     726347..727080,727130..727193,727243..727477)
                     /locus_tag="CNM02410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568417.1"
                     /db_xref="GI:58262014"
                     /db_xref="GeneID:3255063"
                     /translation="MKFSSKLSLALVAALPNLASVLASDVLDLTESTFQKEIAGEDLA
                     LVEFFAPWCGHCKNLAPHYEEAATELKEKNIKLAKVDCTVEQGLCGEFGVNGYPTLKV
                     FRNGSPTDYAGTRKADGIISYMTKQSLPAISDVTPESHDTFIKSDNVVLVAYGDDAHP
                     VPEAFKQYAKGARDSYLFGQYLSNDLPSIPENPSLPAIVLYKDFDEGYAVFPSGEIAH
                     ADVDELSEFVKQNSIPLFDEISPENFGSYAEQGIPIAYLFVDPNEASAREKLVEELKP
                     LAKELKGIVNFVYIDAIKFIDHGKSLNLPGDSWPAFVIQDLADQTKFPLTSKATAENI
                     KDFVKKYVVGEISPSIKSEPIPATQGPVYKLVADDWDNVYGDESKDVFAEFYAPWCGH
                     CQRLAPIWDTLGEKYAGNNNIIIAQMDATENDIPPSAPFRVQGFPTLKFRPAGSSEFI
                     DYTGDRSLDSLVEFVETNRKSDADVAEEEWEDEDETPEHDEL"
     gene            complement(727636..730380)
                     /locus_tag="CNM02420"
                     /db_xref="GeneID:3255162"
     mRNA            complement(join(727636..728108,728212..728395,
                     728484..728704,728787..728979,729065..729245,
                     729322..729477,729562..729641,729695..730045,
                     730099..730139,730211..730380))
                     /locus_tag="CNM02420"
                     /product="acidic laccase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530774|gb|CF676615.1,gi|41531430|gb|CF677271.1,
                     gi|41531437|gb|CF677278.1,gi|41531480|gb|CF677321.1,
                     gi|41531486|gb|CF677327.1,gi|41532036|gb|CF677877.1,
                     gi|41532046|gb|CF677887.1,gi|41533771|gb|CF679612.1,
                     gi|41533776|gb|CF679617.1,gi|41538526|gb|CF684367.1,
                     gi|41541036|gb|CF686877.1,gi|41545562|gb|CF691403.1,
                     gi|41545609|gb|CF691450.1,gi|41545622|gb|CF691463.1,
                     gi|41545851|gb|CF691692.1,gi|41545857|gb|CF691698.1,
                     gi|41546380|gb|CF692221.1,gi|41546390|gb|CF692231.1,
                     gi|41547364|gb|CF693205.1,gi|41547374|gb|CF693215.1,
                     gi|41550041|gb|CF695882.1,gi|41550051|gb|CF695892.1,
                     gi|41550319|gb|CF696160.1,gi|41550323|gb|CF696164.1,
                     gi|41550811|gb|CF696652.1,gi|41550815|gb|CF696656.1,
                     gi|41550830|gb|CF696671.1,gi|41551282|gb|CF697123.1,
                     gi|41553364|gb|CF699205.1,gi|41553375|gb|CF699216.1,
                     gi|41554011|gb|CF699852.1,gi|41554018|gb|CF699859.1,
                     gi|41555140|gb|CF700981.1,gi|41555151|gb|CF700992.1,
                     gi|41555605|gb|CF701446.1,gi|41555613|gb|CF701454.1,
                     gi|41556181|gb|CF702022.1,gi|41556186|gb|CF702027.1,
                     gi|415"
                     /transcript_id="XM_568259.1"
                     /db_xref="GI:58261697"
                     /db_xref="GeneID:3255162"
     CDS             complement(join(727710..728108,728212..728395,
                     728484..728704,728787..728979,729065..729245,
                     729322..729477,729562..729641,729695..730045,
                     730099..730139,730211..730327))
                     /locus_tag="CNM02420"
                     /codon_start=1
                     /product="acidic laccase"
                     /protein_id="XP_568259.1"
                     /db_xref="GI:58261698"
                     /db_xref="GeneID:3255162"
                     /translation="MYSTTALLASALALAATAAHAATHEHWWNITYSAANPDGLQERR
                     VIGVNGTWPPPVLTATQGDVIIVHATNSLDDDTVGTSLHSHGMFFNHSNWYDGAVGVN
                     QCPIPNGQTLDYVIDTTTQVGTYWIHGHLDGQNTDGLRAPVVIFPQNGTGRTDNVTWD
                     AEFIVAAADWYHEEYPVLEQRDFLTWKNPTGAEPVPKSAVIYAAYQNGTYMSTNEEIC
                     AGEGVSDGLSLYFEPGKSYRIRMINMGTLAMFWAALEGHEMYIIEMDGIEVEPYLVDA
                     VTISVAQRYSVWVRALNQTDRNYAFMFIQDTDMYDAVPDDLVLNNTIQIVYNSSAPPA
                     TPYIVYDIETFDDTKVVPLEQEDFLRNPDVEIDLHAYFDTYDDGTNRASFNNITYQMP
                     TSTPSMLTALTMGNDSFNDAVYGAMTNAFAYRHNSIVQLTVYNWDAGFHPFHLHGHVF
                     QLASKSFDVTSNDTDINPPLNESQSNPARRDTVVVPPTGKVVLRWRADNPGTWMFHCH
                     IDWHLSSGLAAIMVEAPEAFQALASDVPEQITDQCRWWNKGTEGNVVGKFSTTDFAGQ
                     PWGPWPLKMGWTPKAIGALAGCIITALLGIATIIWYASGELDEEELEEEIKREVERKK
                     SKVPIWKKVLKTEVKV"
     gene            730988..733234
                     /locus_tag="CNM02430"
                     /db_xref="GeneID:3255211"
     mRNA            join(730988..731195,731271..731545,731607..731693,
                     731755..731985,732042..732114,732189..732418,
                     732503..732560,732638..733234)
                     /locus_tag="CNM02430"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530025|gb|CF675866.1,gi|41530030|gb|CF675871.1,
                     gi|41530162|gb|CF676003.1,gi|41530635|gb|CF676476.1,
                     gi|41530637|gb|CF676478.1,gi|41530676|gb|CF676517.1,
                     gi|41530685|gb|CF676526.1,gi|41530696|gb|CF676537.1,
                     gi|41530795|gb|CF676636.1,gi|41530803|gb|CF676644.1,
                     gi|41531385|gb|CF677226.1,gi|41531395|gb|CF677236.1,
                     gi|41532315|gb|CF678156.1,gi|41532322|gb|CF678163.1,
                     gi|41533301|gb|CF679142.1,gi|41533310|gb|CF679151.1,
                     gi|41533320|gb|CF679161.1,gi|41533328|gb|CF679169.1,
                     gi|41533623|gb|CF679464.1,gi|41533630|gb|CF679471.1,
                     gi|41533856|gb|CF679697.1,gi|41533874|gb|CF679715.1,
                     gi|41534011|gb|CF679852.1,gi|41534020|gb|CF679861.1,
                     gi|41534620|gb|CF680461.1,gi|41534621|gb|CF680462.1,
                     gi|41534623|gb|CF680464.1,gi|41534628|gb|CF680469.1,
                     gi|41534632|gb|CF680473.1,gi|41534634|gb|CF680475.1,
                     gi|41534664|gb|CF680505.1,gi|41534675|gb|CF680516.1,
                     gi|41534748|gb|CF680589.1,gi|41534761|gb|CF680602.1,
                     gi|41534909|gb|CF680750.1,gi|41534915|gb|CF680756.1,
                     gi|41535836|gb|CF681677.1,gi|41536343|gb|CF682184.1,
                     gi|415"
                     /transcript_id="XM_568258.1"
                     /db_xref="GI:58261695"
                     /db_xref="GeneID:3255211"
     CDS             join(731150..731195,731271..731545,731607..731693,
                     731755..731985,732042..732114,732189..732418,
                     732503..732560,732638..732963)
                     /locus_tag="CNM02430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568258.1"
                     /db_xref="GI:58261696"
                     /db_xref="GeneID:3255211"
                     /translation="MAKDVFSVPIFFIVFRETIEAAIIVSVLLSFVEQLMAAGSLAHD
                     ESEPSIENASNNGSAADAEDLTNPLTDKERRAKLVKRMRIQIWAGTAVGFFIALCIGA
                     AFIAVFYTTLNDLWADTEQIWEGVFSVIAAGIIYIMATAFLKMDRSRIKWRWKLAAAF
                     DRSQAKALAREKMSKHERKLAEKEGKSGKWALFLLPFITVLREGLEAVVFVGGVSLGI
                     PATSIPLAVVVGIIAGFAVGYAIYRTGSTTTLHWFLVGSTSFLCLIGAGLLSKGVGFF
                     QYYHFSKGVGGDVAETGDGPGSFQVAGNVWHLEYGNPETGSATTNGGWQIFNAIFGWN
                     NTATLGTILSYVFYWILVIATLVYLKWKEGRFSFLGYKSAALQRRHAFREEKKAKEAA
                     RLQEGEECQTGARAGDGTQRNVEGGSSDEGKSPVLTPVDEKKIAALERH"
     gene            complement(<735651..>737042)
                     /locus_tag="CNM02440"
                     /db_xref="GeneID:3255048"
     mRNA            complement(join(<735651..735811,735868..736298,
                     736504..736601,736794..>737042))
                     /locus_tag="CNM02440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568257.1"
                     /db_xref="GI:58261693"
                     /db_xref="GeneID:3255048"
     CDS             complement(join(735651..735811,735868..736298,
                     736504..736601,736794..737042))
                     /locus_tag="CNM02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568257.1"
                     /db_xref="GI:58261694"
                     /db_xref="GeneID:3255048"
                     /translation="MADSMTLALEHKINNPVKAIRKLQIYTGSQSHPSTTPAYTRPIR
                     PRPLDTSIVQEEELVKKINEYAERDTLLTPRYVVEIAGAVKEVYGTGLYAPHLIFNMD
                     EVAFELSSSRALEDYVMLKWLEDAFDPYTRDIANSGRDRRLLIHDGAESHTKVDFLEA
                     CWARNIVVILLPAKMSGRFQPLDVDFFNTLKAAYHRQLDEYQLGSSLRGVAKGMFWGM
                     CNATSVRHPHNCNPNQPVSWLLLSSSMQQTSITTDLSLLATAPSYKQSQKAVYNIVMH
                     TWYSLSTFVQTVSESSVQDSDEERSESYKREIYSRV"
     gene            complement(738032..739758)
                     /locus_tag="CNM02450"
                     /db_xref="GeneID:3255158"
     mRNA            complement(join(738032..738257,738326..738559,
                     738608..738661,738733..738858,738917..739026,
                     739106..739238,739300..739758))
                     /locus_tag="CNM02450"
                     /product="expressed protein"
                     /transcript_id="XM_568430.1"
                     /db_xref="GI:58262039"
                     /db_xref="GeneID:3255158"
     CDS             complement(join(738138..738257,738326..738559,
                     738608..738661,738733..738858,738917..739026,
                     739106..739238,739300..739707))
                     /locus_tag="CNM02450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568430.1"
                     /db_xref="GI:58262040"
                     /db_xref="GeneID:3255158"
                     /translation="MPFLELSPALNKLLDLFTFPIAHLIVVPLNNIYHSIRYLIYGRP
                     FPNWSYRIYIAINRRRILANSYSWHRVAARDVEEDTLPTMSIKYTADCDLKKIDCPPF
                     VEAEYSPEVLEKTRGITIREAVPSFWIQKRGGKSELDRAASPGERVIFFIVGGGYMVG
                     HPLRLHTAWSLAKMTSARVFCVNYHKSLSDATAFPCSLLDTLAGIQYLVEEKSFETKN
                     IMLCGDSAGANACLALARCLGEMEDLGSKRFGQVGSLCLQSVWGDLTSSSPSIKTNRY
                     NDYVIDPETSYIPSHTRHFPNRTDPYFSPALAPSGSFSHLARHRVKVYVSAGSAEKFY
                     DETLTLYAGMKRDKVNVRLRVFEGAVHSDFIFLDRPDIPGLGWSWEIMKKDIAEFWEV
                     TA"
     gene            740278..>742849
                     /locus_tag="CNM02460"
                     /db_xref="GeneID:3255183"
     mRNA            join(740278..740526,740583..740660,740722..741356,
                     741443..742578,742672..>742849)
                     /locus_tag="CNM02460"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41549737|gb|CF695578.1"
                     /transcript_id="XM_568256.1"
                     /db_xref="GI:58261691"
                     /db_xref="GeneID:3255183"
     CDS             join(740283..740526,740583..740660,740722..741356,
                     741443..742578,742672..742849)
                     /locus_tag="CNM02460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568256.1"
                     /db_xref="GI:58261692"
                     /db_xref="GeneID:3255183"
                     /translation="MWSSDRSQGKAQDTAQDAQPTAVPAPKHRHKHHVQPDGTRVWED
                     EKTWEDEGGKGWGRVWVKRWEKGSNKEKEQEQVQTGNVAATSFAGNSDDQTTSTATTT
                     AISSEHEQTTAPTATDKKNRVILDKLLHESYRSGYNDALSSSRLSQPFGFFGFPGLAA
                     FDEPFFAFPPASARILDEDPLVTSSPRDATAKVYSYSSTSSGTGTTVVAALLAGTAAV
                     LAWKTHKRAKGLEKALNEVVALNKAQGFGYQGGRGGNEVHQLNAKVEELNQVIRGLRE
                     MSLSGTSTWSKELRDSRPEGGKVLQELDKGKIKEKEKEKDKEEPRSTQSQSQSQYPSA
                     PHSSSAKNMVKEDVMPISDIHKQVEKIKGQFLNNVRVSESELSGDSGREATNPSTKLQ
                     PQSQSLPPPASSTAATTEADALSTSTSTTPTPRINNNNSPTSKSKSRKVKSSSSSPPL
                     TPSSPSINGEVMPLDDIHKEVEAIKQRFLSEDQKKDVNVDTHELSGTLSGEVNNGEQQ
                     AAFLTDPMEPKVSTGGDGESSLSCMKKSPKETSKSIAQDHTPILESSSSSTIAELPNP
                     EIPGGNAAAGVRGNKRTIYIETETKWGAPTIITETVQPVPPVGKWYFLSSPSIFTQSF
                     DATPVIPFDQHLKPKSTSLPPKVLVGPGTQEKITLIKRKTTEEVVKDVMQDVESVKIR
                     IPGKEVYDRVVVGRDEVRTWEISTMILLAKDDRERGIVKLDGKWWDAKLVSVSADKGK
                     DKVGNEGAVAIWTLGV"
     repeat_region   740621..740653
                     /rpt_type=tandem
                     /rpt_unit_seq="cta"
                     /satellite="microsatellite"
     misc_feature    741308..741357
                     /locus_tag="CNM02460"
                     /note="GA-rich"
     gene            complement(743561..745720)
                     /locus_tag="CNM02470"
                     /db_xref="GeneID:3255142"
     mRNA            complement(join(743561..744904,744957..745228,
                     745287..745720))
                     /locus_tag="CNM02470"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531715|gb|CF677556.1,gi|41532564|gb|CF678405.1,
                     gi|41536125|gb|CF681966.1,gi|41536199|gb|CF682040.1,
                     gi|41536209|gb|CF682050.1,gi|41536639|gb|CF682480.1,
                     gi|41537009|gb|CF682850.1,gi|41537020|gb|CF682861.1,
                     gi|41538442|gb|CF684283.1,gi|41538451|gb|CF684292.1,
                     gi|41538718|gb|CF684559.1,gi|41539306|gb|CF685147.1,
                     gi|41539319|gb|CF685160.1,gi|41539457|gb|CF685298.1,
                     gi|41540288|gb|CF686129.1,gi|41540740|gb|CF686581.1,
                     gi|41540748|gb|CF686589.1,gi|41540914|gb|CF686755.1,
                     gi|41540925|gb|CF686766.1,gi|41541664|gb|CF687505.1,
                     gi|41541675|gb|CF687516.1,gi|41543245|gb|CF689086.1,
                     gi|41543255|gb|CF689096.1,gi|41544112|gb|CF689953.1,
                     gi|41544119|gb|CF689960.1,gi|41545031|gb|CF690872.1,
                     gi|41545447|gb|CF691288.1,gi|41545449|gb|CF691290.1,
                     gi|41545685|gb|CF691526.1,gi|41545688|gb|CF691529.1,
                     gi|41546238|gb|CF692079.1,gi|41546248|gb|CF692089.1,
                     gi|41546959|gb|CF692800.1,gi|41546970|gb|CF692811.1,
                     gi|41552098|gb|CF697939.1,gi|41552106|gb|CF697947.1,
                     gi|41552205|gb|CF698046.1,gi|41552597|gb|CF698438.1,
                     gi|415"
                     /transcript_id="XM_568428.1"
                     /db_xref="GI:58262035"
                     /db_xref="GeneID:3255142"
     CDS             complement(join(743913..744904,744957..745020))
                     /locus_tag="CNM02470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568428.1"
                     /db_xref="GI:58262036"
                     /db_xref="GeneID:3255142"
                     /translation="MSFVDEIDWDQFLVDTDLGDKNTNVSPATSTSTLSSDQSAALDP
                     QPINFGFGMGAFNSSPSTGITHRLENMLPEVTHDQFATSFGLFTGFDTGAFAQPATTP
                     ASSDSSAELLAAISQLVGSSTTSSPSAVEPLQLSLPPTPDSTSDYHTNSNKRKASDAS
                     DEGAPAPKRRGRPPGTGKPKAAKPMERRQSKTSSFSSVSPSSFNGTLPADDSDLEAAS
                     PAVKVTATGKPSTDRPKSVVPAKFLKDGTAQAILGMTIPEILSFPTYEELLKKVKVEL
                     LPGAREFGEKIADNRDKAKDAAKKSRDERRAKIERAEYFEKKCEQLQEQIASMSSFLM
                     TLVELNVLKKDQIQAFV"
     gene            <746928..>749661
                     /locus_tag="CNM02480"
                     /db_xref="GeneID:3255219"
     mRNA            join(<746928..747012,747082..747340,747552..748154,
                     748252..748516,748608..748649,748792..749081,
                     749174..749451,749618..>749661)
                     /locus_tag="CNM02480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568255.1"
                     /db_xref="GI:58261689"
                     /db_xref="GeneID:3255219"
     CDS             join(746928..747012,747082..747340,747552..748154,
                     748252..748516,748608..748649,748792..749081,
                     749174..749451,749618..749661)
                     /locus_tag="CNM02480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568255.1"
                     /db_xref="GI:58261690"
                     /db_xref="GeneID:3255219"
                     /translation="MTDEERDRREEWLASSRGRKGLRIVIVTENFLPKVDGVTRTLSR
                     LLVHLQTSGHSCILLGPSSTIATYASHPIIGTLGIPLYCYPGLKLNFARPKFWEVVNR
                     WEPDVVHFVDPIWNLATYATLFNLPFLTPLIWSFQRLLHSRVRLTLCPSPSTKAMLEE
                     QGWVSEKDGEVGKVRIWSRGVDLHQFGRSKRSWKRREMWGVGLAPGEKQSEDSPLLKV
                     EKDNPAISMEEKVVGLHWNGSKEEGMMTPPLSPENGPEDKKTYHSQIQSQSDLYPPYE
                     RGDVHGEVKQPFKASLAGVYPPDTSLDLPERVVLLYVGRISWEKNIHLLLSAYSHLSS
                     FLPSSSSSSPGPINFMPKLIFVGDGPARKELETKCKEANYDAEFLGHKQGEELAECYA
                     SADVFAFPSFTETFGQVVLEALASGLPVVGLDAEGTRDLVTHQSTGLLLSPPHAHSSD
                     YSNKESTSIPWPRACNTSSPYFKTLAKEYAKLLAEVVRIIRRGRRWVKEVAQRESVDG
                     RGGMLWSYREAMRIARSKRSIRIVPHSPTSPETLIPSFNHDPTVTRDSDYSLNEKRRQ
                     GSFVNRFGFTNKPLTQRGFDEKGRFGKDYIRQEDNGLFWIMKSLYMPYWQQRRFN"
     misc_feature    748269..748336
                     /locus_tag="CNM02480"
                     /note="CT-rich"
     gene            complement(749903..>754853)
                     /locus_tag="CNM02490"
                     /db_xref="GeneID:3255204"
     mRNA            complement(join(749903..750786,750841..751302,
                     751361..751900,751958..754293,754344..754691,
                     754751..>754853))
                     /locus_tag="CNM02490"
                     /product="translational initiation-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41548369|gb|CF694210.1,gi|41548375|gb|CF694216.1"
                     /transcript_id="XM_568254.1"
                     /db_xref="GI:58261687"
                     /db_xref="GeneID:3255204"
     CDS             complement(join(750067..750786,750841..751302,
                     751361..751900,751958..754293,754344..754691,
                     754751..754853))
                     /locus_tag="CNM02490"
                     /codon_start=1
                     /product="translational initiation-related protein"
                     /protein_id="XP_568254.1"
                     /db_xref="GI:58261688"
                     /db_xref="GeneID:3255204"
                     /translation="MSESAKAAAQNGQAEEQQLQQQLDEQQQLEEQQQLPPVTIRIPS
                     PTCSRTVPKPKDSTEPLDRITLYPQPQETIQDIKLLINDWVGAYWLGPYSLQLPFVKG
                     EDGRGKIYSKKKDFSEVRAGEKLNEWLEVQDAFEHLQEGEERVLEAVREPYGELSARQ
                     SIIRLLELIAPSGTTANTTSNPLGLQAGSTIFEQVRDGLVSANAETTYEEVEVSLPSG
                     RKGKGGKKELVKVKRSVSGDKAHAFADWKGWAPASFGSLAVSSDPVEVAPSLKSIQIS
                     HFNPPPPHLRQKGHELYLQVSLLEGEVVTLICSTRGWYVSKSNVNNFDPSPRPSADGS
                     IPAPTHSLIDLLHSISPLFSERVSRLPPISLDGALADPISTVAIPQATPAYPFLTSPP
                     KPAISPEILRTQLAFLHTGAYGPDLVDAARDWNEEIQGIRELPRGTMQERVFREKMLQ
                     KVWAEFDQAAARAVQAVSKGDIPPINPAEDPKAHMYLQSNIFITQGDSDALDTYAHLG
                     GDAAMRISHGKDAAGVKLLNKIDADGLYLLGHTIVDWQGRRWICQSILPGIFSNRRAV
                     EEEKAQAETEAEAETADAVEGEQKKEDWVDVEKPTEKSGSETESDNPMMIYGLDSERP
                     TSVHWDAATHSLLSTIATPLRLAAHTIKDGEGKEHEFYASAEVKGLKGQDGRRYLLDA
                     QRLAPVDVEWLEKDITGPLVGPKKDDESAEEGVQYPHRLVMLRPELIEQFWESELKRW
                     ARGVAEKAQAKKAEAEAEAAAAADAEGEKKKEGEQSEIPQEEQSAAASAAAARRAEED
                     RPVDASLIGDIKQFNLSFNPDAFVEQPVLEAEGQEGKTEIKAAITDESDPSVKAVRDA
                     GLFLRQIAIPAVVLDVLTGNTSGVMDGESLSKHLHQRGVNIRYLGHLASTIIQFSTSK
                     DGAAKEPSGHLAALQSIVLQEMVFRAAKHILRELLYPLQPETATDAVSHFLNCLLGSC
                     LNPAPVASYTPIGINSNEPEPAYVKLTPECLRAQIIKEVKSRFRWTLDESFLESGLRK
                     KQLLRELASRVGFQLAQREYVFSKDQEEEENKREENIKSKEKKKGSKAGAKGETVKRT
                     TTFEGEDVLTLVPVIKSTAPSVSVAEEILEAGRNTINRGKIEFGLDFMLEAIQLYESI
                     HSVIHPEVASVYNSYAQAIHQIARLKIQQIAAQENPDPEQPLGVDISGALRFQRQAVA
                     IAERTLGVYHHETAGYYFQLAMLENLEGNAQQSLRYFRHLLTLWDVIYGPGHPEISTI
                     LSNAGIVLQSMNDLSLSLSLQKQAYESTLACFGPNHIQTGQSLHQLVQGHFLAGDMAS
                     ALETAKQALEIFKARLGEEHNQTKEEAKNVELLTAVIENQERQKEREEAVKKEATERL
                     KMARERIGGGAASTSRPTGIRRLGGAGAGALPQGVRVVDPQTLAALAAAAGQGGNPSA
                     NAAAATAGQGEQANGESTGTPQIGERGTESLEELVRYIQGSAPGVGGSAKRGKNALRG
                     KRRTGAKR"
     misc_feature    751466..751521
                     /note="CT-rich"
     gene            complement(756427..758628)
                     /locus_tag="CNM02500"
                     /db_xref="GeneID:3255265"
     mRNA            complement(join(756427..756773,756859..756969,
                     757088..757191,757290..757499,757665..757688,
                     757735..757742,757800..757965,758022..758628))
                     /locus_tag="CNM02500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568253.1"
                     /db_xref="GI:58261685"
                     /db_xref="GeneID:3255265"
     CDS             complement(join(756606..756773,756859..756969,
                     757088..757191,757290..757499,757665..757688,
                     757735..757742,757800..757965,758022..758247))
                     /locus_tag="CNM02500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568253.1"
                     /db_xref="GI:58261686"
                     /db_xref="GeneID:3255265"
                     /translation="MTSTLTQTIDSLTQKVGTLGVRGSTQPIPRNHSLDKWKSFEVTP
                     FIGQEFGSDIQLSQIVNAPNADEFIKDLAVLISQRGVVFFRAQDINVDDQKTLGKRLG
                     ELSGKPGDSTLHIHPTTELSSSKGDHISVITISSDTLISRDTIWASAYEAYSRLSPHF
                     TKFLEGKEAFHEAAFFSKAAEQYGIELRTGERGSPLNEGPSLSAIHPVIRVNPVTGWK
                     GLYVNQGFTRRILGVTKDESDFILDYLFKVTQNNHDLQVRFKWGINYPTGIADVALWD
                     NRSTSHSATFDYEKQLRVGDRVVSIGEKPYFDPSATTRRDTLGLALPTEGALGEVYRA
                     QVTK"
     gene            <759138..>761244
                     /locus_tag="CNM02510"
                     /db_xref="GeneID:3255134"
     mRNA            join(<759138..759356,759418..759544,759597..759659,
                     759709..759749,759809..759979,760031..760100,
                     760165..760372,760464..760733,760805..760874,
                     760940..761023,761122..>761244)
                     /locus_tag="CNM02510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568252.1"
                     /db_xref="GI:58261683"
                     /db_xref="GeneID:3255134"
     CDS             join(759138..759356,759418..759544,759597..759659,
                     759709..759749,759809..759979,760031..760100,
                     760165..760372,760464..760733,760805..760874,
                     760940..761023,761122..761244)
                     /locus_tag="CNM02510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568252.1"
                     /db_xref="GI:58261684"
                     /db_xref="GeneID:3255134"
                     /translation="MTITLDKRTIPAVGSEATTQGEVQNGRQMTALPLESGFCLSLWL
                     QTVRNNPLLNHRTTDELPREAEVVIIGSGISGSLCALSLLQGPDPPKSVVILEARELC
                     SGATGRNAGHCKVSRSMARFHKVSKASRYRTGFEDSQKRARYLGVHGSFPIKIEWTAL
                     IIVLLQLDVCMTDEVAEMAAKTFSYYMEAGGDVSKIEVTTDSQRAEEISRLKGARAVY
                     AWDASTLHPWKLVAHIAQQALDLGLNLQTWTPVTSISGSAHQWTVHTDRGSITASKVV
                     HTTNAYAGFLLPEMRVAIHPTPHMCDKVIPPTSHSGTKSLQNSYAVIYPTGLYSINPR
                     LNADGAVLFGGSAPNQQRLLDYVAEDPKNRQTNDSLTNFEPVTEAVRKLGREGLEWDL
                     AKGAKGTGARYDYSWSGIIGRSADDVPFIGAVPDKPGQWMSCGHNGHGMARIFTAAPA
                     LAKMVQGATYAETGLPECFEITQERLEKLRT"
     gene            complement(<761616..764870)
                     /locus_tag="CNM02520"
                     /db_xref="GeneID:3255229"
     mRNA            complement(join(<761616..761675,761734..762016,
                     762066..762129,762184..762599,762659..762869,
                     762924..763195,763250..763296,763350..763425,
                     763497..763690,763737..763967,764023..764114,
                     764168..764626,764693..764870))
                     /locus_tag="CNM02520"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41567292|gb|CF713133.1"
                     /transcript_id="XM_568251.1"
                     /db_xref="GI:58261681"
                     /db_xref="GeneID:3255229"
     CDS             complement(join(761616..761675,761734..762016,
                     762066..762129,762184..762599,762659..762869,
                     762924..763195,763250..763296,763350..763425,
                     763497..763690,763737..763967,764023..764114,
                     764168..764264))
                     /locus_tag="CNM02520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568251.1"
                     /db_xref="GI:58261682"
                     /db_xref="GeneID:3255229"
                     /translation="MPKLAVLAALLGVVRFTTADQITLGPTAYTAPGAFPTSFFSEYY
                     NDPTQTVSQVQPKISDSVLNKTYPLELTDPDTISTNDTADPLYYPPTRLHGSAATNLY
                     QNVTDQIKNIVTGDTPSNCSKCINALTAASTLAKRAPELVPDLLVSLCNYYGFASEAG
                     CNVYTANAQGPYYAQVLAYADVSGYDGQYLCQNFITKSQCARPPLDFWTKPKPTNAKP
                     PVPKGTDRIKVLHMSDFHIDPRYATGSEGNCTSGLCCRRGNPVESLNSNYTVSVPAPR
                     FGYFLCDTPWALGAAAVEAIPVLTGTDEDDAFNMTIFTGDMVSHDPYYELSRDYIEYT
                     ETALYDLWKQTLNPTSPLYAAIGNHDSYQQAFDAPSSLPGKLRKQSSWNYEHLAGLWE
                     SEGWIDGEVAQKVKTHYGAYSIQHATNLKIITINTDLWYRANIFAYINSTHPDNFGFL
                     KFLAEELQEAEDCNSRAYIVGHVLSGYDGTNPLPGPTDIFYQIIDRYSHVIAGLFWGH
                     THEDQHMIYYANNGTKMSAETAQNVGWIGPSITPLTDLNSGFRLYEVDAETWDILDAH
                     TWYSNVSTYSSLDGQLEVGPSYVYEYNTRQAYGGNISWPDNAPLNATWWHLVSQDMEN
                     DGGALVELYNAHQGKMSTLSPNCTSAECIEAKVCYLRSGSGTLALDNCKTGYGSVQ"
     misc_feature    765322..765345
                     /note="AT_rich"
     gene            <765561..>768008
                     /locus_tag="CNM02530"
                     /db_xref="GeneID:3255097"
     mRNA            join(<765561..765646,765710..765749,765804..765816,
                     765868..765908,765968..766447,766497..766596,
                     766694..766896,766947..767139,767193..767284,
                     767341..767730,767790..>768008)
                     /locus_tag="CNM02530"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534275|gb|CF680116.1,gi|41534281|gb|CF680122.1,
                     gi|41557200|gb|CF703041.1"
                     /transcript_id="XM_568250.1"
                     /db_xref="GI:58261679"
                     /db_xref="GeneID:3255097"
     CDS             join(765561..765646,765710..765749,765804..765816,
                     765868..765908,765968..766447,766497..766596,
                     766694..766896,766947..767139,767193..767284,
                     767341..767730,767790..768008)
                     /locus_tag="CNM02530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568250.1"
                     /db_xref="GI:58261680"
                     /db_xref="GeneID:3255097"
                     /translation="MAAVTDSSLPSASSSAAVSQSEAPKKATRSRNGCLVCRSRRLKC
                     DLEKPECRRCVNYGAECVYPAKKPFNAEAVDEKLRKRHKRNKSTASPSHSDITPHAFV
                     PIPPIPTARPTQSNAPILNGLSSSQATPLTATPPTSSHPTPFPLPSSHPYLPSNRAPA
                     YEPTTAPAGRAPLAQVKAMEPMELLMALCRDTRMGQFFSGPVDPPDFLRDAFPVEEEL
                     RCFHHCFTYTLSTMVVQEELNPWVEQVVPLFLFPTELADHLKWYDLDSLEEKGSAPNT
                     YGQTRSLGLRYRDEAVKYLRAAQNVPEEMASDVFLSACMMVSHADLLGANHCWREVLR
                     LAHASVRFRGGCARVLFGNAKDADLSNDSDDCQPTPLRVCLIEHLVLVDIFASMTTGQ
                     RCVVLTESSYWWGKLRQEDSSLPDTVERSSGIHRSIFPLIVRANNLLWEYSNLSKCIS
                     PPSPSVHISSLSPIPDLTERALQLSAELSQWREAIFPTIKDKRSRDGSLALWHGLQIM
                     MKRELMGKERGDEGVQMHAVEILEICEGVGVKVEYMNWPLLISCSVLLTPPHRQRARE
                     ILKSFIYQCSYEVAMVESVAEECWRRMDDGMDDEGSSWREVLIEMGCAVLLG"
     misc_feature    766190..766240
                     /locus_tag="CNM02530"
                     /note="C-rich"
     misc_feature    768148..768203
                     /note="GA-rich"
     gene            769165..771776
                     /locus_tag="CNM02540"
                     /db_xref="GeneID:3255087"
     mRNA            join(769165..769458,769522..769692,769752..769812,
                     769862..770025,770080..770182,770236..770278,
                     770331..770545,770710..770783,770836..770998,
                     771053..771220,771287..771447,771525..771776)
                     /locus_tag="CNM02540"
                     /product="trehalose transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41569745|gb|CF715586.1,gi|41569753|gb|CF715594.1,
                     gi|41575042|gb|CF720883.1,gi|41575043|gb|CF720884.1"
                     /transcript_id="XM_568249.1"
                     /db_xref="GI:58261677"
                     /db_xref="GeneID:3255087"
     CDS             join(769253..769458,769522..769692,769752..769812,
                     769862..770025,770080..770182,770236..770278,
                     770331..770545,770710..770783,770836..770998,
                     771053..771220,771287..771447,771525..771630)
                     /locus_tag="CNM02540"
                     /codon_start=1
                     /product="trehalose transport-related protein"
                     /protein_id="XP_568249.1"
                     /db_xref="GI:58261678"
                     /db_xref="GeneID:3255087"
                     /translation="MTLNTVTPVIVEEEKMDVEHVEEAKVDNEFDPNLVIKSPFEDLS
                     FFVTLKTFKKATFLALLAAFSAAADGYQIAMTGSIIANKGFIQTYGTAYNSAGELILD
                     ANVLAAWGGVQSAGQGLGMLSMHFIADKFGRKWAFYGLWLALVLGVTCETVGRHWQIW
                     LVAKLASGYGVGSVQFLTGTYITEIVPSRTRGFILIFYSIWYAIGQLFASAALKVLAD
                     QQPYNYLDLIYTEWAMIGIMIMAYLYLPESPWWYANHNKDDRGRAVVERLNGGIEGYD
                     VDFHYSLIKKTVDNEKAQKTATLGADRGFWKGLWDCREVFTGANGLSNYSSYFAQVAG
                     FSDPFVFSLLLAIVAILITILICLTTDFIGRRAIFLGAVVVTWCMLIIVGGMGLIKNP
                     SHSINQLVLFFSLVWRMSSTCLGTLGWSYVAETGSGRLRAITAGVSAAGGVAIGTLFS
                     TTVPYMLNANYANWGLKTCFFFAGVSAPMCIAAFFIMPDTSKRTPAELDEMFERKIKP
                     WRFRSYVSDAQKALQAQKERTGETDAVALQNASNRR"
     gene            complement(771781..774411)
                     /locus_tag="CNM02550"
                     /db_xref="GeneID:3255140"
     mRNA            complement(join(771781..772224,772304..772814,
                     772877..773052,773126..773258,773315..773420,
                     773485..773607,773673..773788,773846..773868,
                     773940..774128,774204..774411))
                     /locus_tag="CNM02550"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542427|gb|CF688268.1,gi|41542442|gb|CF688283.1,
                     gi|41562946|gb|CF708787.1,gi|41562955|gb|CF708796.1,
                     gi|41568656|gb|CF714497.1,gi|41568666|gb|CF714507.1"
                     /transcript_id="XM_568427.1"
                     /db_xref="GI:58262033"
                     /db_xref="GeneID:3255140"
     CDS             complement(join(772034..772224,772304..772814,
                     772877..773052,773126..773258,773315..773420,
                     773485..773607,773673..773788,773846..773868,
                     773940..774128,774204..774309))
                     /locus_tag="CNM02550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568427.1"
                     /db_xref="GI:58262034"
                     /db_xref="GeneID:3255140"
                     /translation="MTVTQTIRKRLTSPSAWVLPKEESCIAPEEVWSNKDMDPAPLEH
                     RRWTSWTFFAYWISDLITPGGWATSSSFVEMGLTWWESCLAMYVGGFLVAIVITANGI
                     IGAKIHTPFAITSRSVYGYWGSKFVVFSRMACACFWLSINSWSGGVFISLMIEAIWPQ
                     YANLKNTIPVSQGATSVDFLSFFLFWLLQFPFIFIHPSKLKWVFNAKAFLVVIVAVGT
                     MIWALVKAGSHAGEALGSPANRAASGIPRFKAFMYAVTAAQSTWATLSVNIGDFSRYC
                     KKPSASYIQLLVFPILYAGLSFFASITASCASYVYGSENSYYQPYDIVALWNTSAGGR
                     CAMFLASFVWALCNVTTNITANSISAANDMTSLAPKYINIQRGQFIAVTIGVWGFVPW
                     KVLATASNFLTFMSSYSIVLAPIAVIMVTDFFLVKKQKVDIYELYKPHGIYRFSKGWN
                     WRAYIALAVAVAPNLPGMVNAINSSIEIGNIKYVYMVSNIVGNTIALTVYLVLNYVFP
                     ATESQVDAPMHDLLSPEEDYGAAYGIYQSPLKDGEKDVEADAEVKSALM"
     gene            776032..777891
                     /locus_tag="CNM02560"
                     /db_xref="GeneID:3255208"
     mRNA            join(776032..776495,776548..776680,776750..776859,
                     776948..777073,777138..777191,777269..777502,
                     777576..777891)
                     /locus_tag="CNM02560"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41549928|gb|CF695769.1,gi|41553433|gb|CF699274.1,
                     gi|41553438|gb|CF699279.1"
                     /transcript_id="XM_568421.1"
                     /db_xref="GI:58262021"
                     /db_xref="GeneID:3255208"
     CDS             join(776058..776495,776548..776680,776750..776859,
                     776948..777073,777138..777191,777269..777502,
                     777576..777695)
                     /locus_tag="CNM02560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568421.1"
                     /db_xref="GI:58262022"
                     /db_xref="GeneID:3255208"
                     /translation="MVLFLELPPLPHRLLDVLIYPIAQFLILPLTTVYHALRYIILGP
                     PFPGWTLSHYLAINCRRVYYGLYTWRRVALFDPEEAEIPREAEKYLVPGDNGDGRCDA
                     EKVECVPYKEDEFTPPVLRVARDLIVQKAVPGFWIEARGVDGKQDLTRDAAPGERVIY
                     FIVGGGYMGGHPLRIHTPWSLAKISKARVFSANYRKSLSGSTAFPCSLLDTLAGYQYL
                     IEEKHFEPNNIILCGDSAGGNACLALAKCLGEMESLSSKRFGQVGGLCLHSPWSDMTS
                     SFPSIVSNRYNDHLVDLTTSYIPSHTRHFTDKTNPYLSPALSPFGSFEYLKRHDTKVY
                     ISAGSAEAFYDEILALYNGMKRDGVEVELRVLEGATHSEFIWLDRDEISTMGWSWDIL
                     TTDFERLWERAA"
     gene            complement(778348..781417)
                     /locus_tag="CNM02570"
                     /db_xref="GeneID:3255056"
     mRNA            complement(join(778348..778774,778844..778954,
                     779026..779430,779510..780072,780148..780365,
                     780429..781034,781302..781417))
                     /locus_tag="CNM02570"
                     /product="receptor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544611|gb|CF690452.1,gi|41544617|gb|CF690458.1,
                     gi|41556460|gb|CF702301.1,gi|41556472|gb|CF702313.1,
                     gi|41561793|gb|CF707634.1,gi|41561800|gb|CF707641.1,
                     gi|41563846|gb|CF709687.1,gi|41563854|gb|CF709695.1,
                     gi|41570805|gb|CF716646.1,gi|41570817|gb|CF716658.1,
                     gi|41571767|gb|CF717608.1,gi|41571773|gb|CF717614.1"
                     /transcript_id="XM_568425.1"
                     /db_xref="GI:58262029"
                     /db_xref="GeneID:3255056"
     CDS             complement(join(778541..778774,778844..778954,
                     779026..779430,779510..780072,780148..780365,
                     780429..780487))
                     /locus_tag="CNM02570"
                     /codon_start=1
                     /product="receptor"
                     /protein_id="XP_568425.1"
                     /db_xref="GI:58262030"
                     /db_xref="GeneID:3255056"
                     /translation="MPLPKLAVILGAFASFSGFLFGYDTGYISGCKEMETFVRTFGLL
                     QPDGTYVLSSGRDSLITSILSVGTCLGALCGSMVGDRIGRRFGIVFYICLFFIGVALQ
                     TGCKNLAGFAIGRVFAGLGVGGTSCLVPIYQAECSPKAIRGFVVAAYQFFVTVGLLVA
                     ACVVYATKGRPDNSAYEIPIAIQFVWGALIIGGMCILPESPRWLLLKDKQDQAKKNLS
                     RLLGQAENSQAVITEFAEISANLEHERSLGKGTWMDCFKYGESKTRLRIFTGMALQAL
                     QQLTGVNFIFYYGTTFFSNSGISNPFLTTIATNVVNVGMSVPGMLAADRIGRRPLMMY
                     GAAGMAVSQLIVAAVGVAVDTSNQAGQKALVAFVCIYIAHFASTWGILAWVITSEIYP
                     YELRGKGMSLSTATQWLFNFAIGYATPYLVDVAPGSAGLKTNVFWIWGGCCCIAFVFA
                     YFFIPETKELSLEQCDLLYRNSTVLKSAAYRRQILEHDMHDDEIAHYDSNKMPRTEHV
                     EDSKAVEDVKAQQSQLDEWDA"
     gene            781014..783018
                     /locus_tag="CNM02580"
                     /db_xref="GeneID:3255080"
     mRNA            join(781014..781293,781351..781406,781459..781481,
                     781546..782041,782103..782174,782246..782349,
                     782406..782533,782595..782653,782710..782868,
                     782932..783018)
                     /locus_tag="CNM02580"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539939|gb|CF685780.1,gi|41539956|gb|CF685797.1,
                     gi|41565749|gb|CF711590.1,gi|41566875|gb|CF712716.1"
                     /transcript_id="XM_568423.1"
                     /db_xref="GI:58262025"
                     /db_xref="GeneID:3255080"
     CDS             join(781091..781293,781351..781406,781459..781481,
                     781546..782041,782103..782174,782246..782349,
                     782406..782533,782595..782653,782710..782868,
                     782932..783002)
                     /locus_tag="CNM02580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568423.1"
                     /db_xref="GI:58262026"
                     /db_xref="GeneID:3255080"
                     /translation="MRGSPSLRSFNRFNRYSNLIKSTRFTEPAVLPAAAFIPRYTRGF
                     TRTTMRPTAAVEGLGQDDEIPSARLQPEPGPDVRVLIIGAGNINFGSDEGPWNHSQRL
                     EQKLGNRLKIVGLVDPATSRAEAVLKAKSLTFAASAYADTPIYPSVKDAISALSSNPP
                     EMILLGSPPAFRGTTDPSKGYNAEVQLTESFPNAALFVEKPVSTGSVEEALKVAEYLE
                     GKSNLVSVGYMLRYSAAVQKMKQILKENNLEVMMTSARYVMAYEHSAKIAWWTKSVDC
                     GPIVEQATHFCDLSRYFAGEVDLDTVMAHSIEWYEKPGQLTKIPFDESALVPEDDRIP
                     RFTSATWKYKSGAIGHLEHGVSLQGTQFSTEITVFADGYQLKLIDPYNRPTLYVRRPG
                     NDVEEIHNFTDDDAFLSEMSTFIDTSSKGSSEIPVLSSFADAVRTYELTWAIRWASEK
                     TSRSRT"
     gene            complement(<783358..>784371)
                     /locus_tag="CNM02590"
                     /db_xref="GeneID:3255043"
     mRNA            complement(join(<783358..783452,783523..783859,
                     783985..784153,784205..784243,784319..>784371))
                     /locus_tag="CNM02590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568499.1"
                     /db_xref="GI:58262177"
                     /db_xref="GeneID:3255043"
     CDS             complement(join(783358..783452,783523..783859,
                     783985..784153,784205..784243,784319..784371))
                     /locus_tag="CNM02590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568499.1"
                     /db_xref="GI:58262178"
                     /db_xref="GeneID:3255043"
                     /translation="MSSEIQRLAEDVVETYFSQNAENRLLIGVAGPAGCGKSTIAYPL
                     INRINDILATRSAASCEKAISAVCVSLDGWHYTRAQLDQMDDPGAHFTFDQAGYRTFL
                     DLLRIPLSSAPSEIPFPTFDHALKDPTLSPVPITHKDRLILIEGLYTLFDLPGWKECA
                     EMMDFKIWVDVNEETARRRLVKRNFEAGIFDSLDVCATRVDAVDMKNSEVVRAHASKP
                     THIFVSVDGQIY"
     gene            784763..786395
                     /locus_tag="CNM02600"
                     /db_xref="GeneID:3255202"
     mRNA            join(784763..784883,784949..785143,785210..785263,
                     785331..785430,785511..785693,785761..785830,
                     785885..785914,785986..786123,786184..786241,
                     786314..786395)
                     /locus_tag="CNM02600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568248.1"
                     /db_xref="GI:58261675"
                     /db_xref="GeneID:3255202"
     CDS             join(784796..784883,784949..785143,785210..785263,
                     785331..785430,785511..785693,785761..785830,
                     785885..785914,785986..786123,786184..786241,
                     786314..786321)
                     /locus_tag="CNM02600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568248.1"
                     /db_xref="GI:58261676"
                     /db_xref="GeneID:3255202"
                     /translation="MSARALFESISQGGFELPKLFNVEGWVAVVTGGGTGLGLVTATA
                     LAENGAKVYITGRREEPLKAAAESYAKSGNQGRGTIVAVQADVSTKEGIQKFVEEIKS
                     KEKWVNVLINNHGVSLGCANIDDCEQTPEGLSKQMFEGETFECWLNTYKINTASYHFT
                     TFAFLPLLAAAKTVGGSPEPGNIVNLSSMSGITKTSQRGQFNYNAGKAATISLSKQQA
                     AEFARRGLGIRVNCICPGYFPSGMTIIPPENNTGSDAHFKEFRNQWGIPLGRPGNAID
                     YAQCIFGVVTNQYVTGAEIVIDGGWLLEEAF"
ORIGIN      
        1 taacccccta accccctaac cccctaaccc cctaaccccc taacccccta accctaaccc
       61 ctaagtccga tctcagtttt gagtcgccgt gtagttaata atctcaacct cataaccttg
      121 cattaaaatg taaacatcat atacattatt cgtaagcgaa agcttcaaat aaaatttaaa
      181 caaagagatt ctatagcatc caaagtccca tgagaggtac tcgaaggatt ggtcgatttt
      241 cggaatacag ttcaaccgat ctatcgttga atatgtactc acttctcctc ctcaatgtct
      301 tgaaattcca gttctcgacc gcgttgtggt gaaattgagc tctctgcaac tgtggcagct
      361 gacaatctct tgtctcttgc ctcgagcatt ttgaaaatcc ctgtgaagat aatgctcgca
      421 atggtaaagg cggctgctgc cttgtaaccg accttatatt ttggcgcttg acttgctggg
      481 tatatgaaca ctgctgtgta tcagcttgct tgcgttctgt atttgatttg ggacccacga
      541 ttcatccagc tgtccatggc gtaaacgaga ctaacggtaa cgccgatgat tatggctcgc
      601 tcctctggaa tggggcacat gtctgccatc caagcctaaa aatgttcctc agcaaatttg
      661 cctgcagcga gaatggttga tttgatctca cgacgaggat tggcgagata gcatttgctg
      721 tgtaagttaa aaaaaagccg gccattttga ttgggactcc ctcaggccaa acctaaacca
      781 taagtttgtg ttctaggaat ggcccacgat gtgactcaaa ctcacagaaa gtataataca
      841 gccgatgagg aaaagaatct attgggttac ataacatcag aacaggggac aggggaaaag
      901 catgtcggcg agaagtcgaa acttacattt tgcacagaga cccaggtagc tctccacccc
      961 gttctcgagc tgagccatgc gaagagcagc atcaagacga gcatcagcgc aaagccacca
     1021 atgggaatcg cattgatctc ctgaatggtg aaacgcttgg acccgtcagg atgagtcaaa
     1081 gctttaagcc agagcatgaa ccatgagttc gcatctgcag cccaggctgc aaaactgaga
     1141 ggttagcgca gtcaactgcg tcgatgatac gtacgcatac gctccgaaga agatgtaaag
     1201 aggccaaccg gtgaatgttt tcttcagaat agccttggtc aatctctagt aatgtttcga
     1261 tttttcagtt tattgtcgct agatcggggt agacacttac agttggcggc tgcttgtgaa
     1321 ctcttgccat acgtgcagca gatatccgat tgtcttcctc tgacatccaa taagctttgg
     1381 tcgtcccggg agaatctggt acctgtttga gatcagtggt gttatttttg acattgaaaa
     1441 tttggaatgg cgtacgagga aaaagccagc gacggcaacg aggatagtca tgatggcgtt
     1501 gaaaataaac cttggaatat gtagtcagcc agccaagcat tatgaaataa atgttgagct
     1561 actaacagcc atctccaccc agaaatgcca cgcgttccgt taagggtcga ctgaattgcg
     1621 acctgcatga atgagacaaa catcgatgcc gcgggataag acgtgccaaa caacgctatc
     1681 cttgttgcga gctccgaagg tgtactgtat cactgtcagc tgatgtgtcg cctcccgcgc
     1741 cacgaattgt gtatggactg agacctacta ccagttacat agaacgctca cgatgccggg
     1801 atatgatgag gcctcaaatg cgccgatgag gaatcgaagt gcgtacatcc ccttcacgtt
     1861 gtgcgctgca gccattaagc ctgtcatcac gccccataag agctcgagtg gcggaagcca
     1921 gagagaaggt ctgacacgtg tcaagataat ttgggaagga aggaggaata tggcatatcc
     1981 tatcttaaag taggtgttga gataattgag ctcattggca tccagtttca tctaacaagt
     2041 ttacattcag cggacatttt cgtggaatct tctcactcac atcctctttc atccccgaaa
     2101 cgtaagcggt cttgtagttt gatgagtcga tttgctacat ctccatcagc cttcccgtcc
     2161 actgtcatac cttcgatgat ccaacgataa tatatggaga aggtcacaaa cttaccttga
     2221 taagataagc tagccatgcc catgaaatga gacacacgtc cagtttccat aaaaacttcc
     2281 tctcacgctg tcgcgtataa gacaggtcct catagtccaa gtcgaaagac gtggactcca
     2341 ccccaggcgt ctcactcaat tgtttcatga tccggccagt atcgttatcg ctgtggtaat
     2401 tctaaggcta gatacagact agatattagc agtgcacagc gtatgatttg atgattggcc
     2461 acggcaagtc actggtacac aaatttataa tgtccaacag cgtcgggaac catcgagtcc
     2521 cccccgtgtc ggggccccga gcggtttctc ttatgtaatt ctacctttcg cggttgcgac
     2581 gttattcgcg actgtggccc aacgaaagcg gtagcacggc cgggtggtta cccgtatttg
     2641 caagcgtact gggatcaaaa ggtggctaaa gaggaggaga ttacggagat gttagatgtt
     2701 acagagatta cagagaggtt acccacccat gtaacttctc gcccgccaga gattaccatt
     2761 ctaccattta cggggagacc attcaagaag atccgggttt ggacaccata cgtaaaattc
     2821 atcatcgatt tcatcgattg actaatattt aagataacta attacttatc cagtttcaac
     2881 ccaatcctat tcccagccgt atattcaata ccaatgcatg cagatgcgat ctggcagcct
     2941 attccttaaa aatcatcctg cccactttga actcattcca actgaggcaa ccagactgga
     3001 attatcgatg atgtgtttca ataggtcatc catcagccgg aaagcggccc ttcttacatc
     3061 agcagaaccc aatagacaca atgtttttat gcttgcatgg ttaatgatgg cgcttgtcat
     3121 gttgtgtcgt tcgcaaaact gattcatcgt ttctccttag tagagtagaa cccaaataaa
     3181 tcctcgccgg atgatctaga cgagtggtag aaacgaccat aggcgaatgt ttaagatcca
     3241 ggtaactgag gagaaaggtg gacagtggct gacctttgat gtgaaatcgt gagggataat
     3301 gtcgaaaggg gtgggcagat gtgagacgtt ttgagaacat atctagccgt ctataaactg
     3361 aacagtttat gattgaacaa gtcattgcga gacgagctgg aagctaatca ttgtgaaaga
     3421 ggacacgcag tttgttggga gagacatcag ccacaataaa aagacacagg gaagcgaagg
     3481 tcgctcccaa ctcacggaac ataatactca gaaagtcatc ctcagagcca ctctcatttc
     3541 cgggcatcgt caatgagaat taatcgcctg atggaaagat tgaagctagg tataaggata
     3601 gaatctcaag gaagtgtaag cggcgttgaa acattatacg actggagcag ttcgcaagac
     3661 aaagatagta tatcgcaatt aggcttgtat acagcatcag cagatgcgag aaaagcgttt
     3721 agttcgaaag cacttacgtc ttagatccca tgtattgccc tgcaattgct tgataatttg
     3781 gaccactcat cgctttctcc tcatcggaca ttggttcacg aatgttgagc ggcggtccct
     3841 ctgagcgcac ttcccttctc tttcgttcct gctccaccag cctctgatcc ggcatcatca
     3901 cttcaactcc tcctgatcgc aaatatgaga aggacgacat gatatcatat acaacatggg
     3961 cgagcggagg ggaacagatg agaagccgac ctgctgtaca acgtcagcgg atggtggaaa
     4021 agcatgcaag ttgaaagtcc ttacatccga gtcccactca taatcccgca cgttttcctc
     4081 gcatctttcc ttctcccgga tgtaggtatc cgaaaaaaga ggtcgtggta actggcgaag
     4141 atgagagtaa atggaaagcc aggttgccgc actacatcag caggcagtaa ccggatgcgc
     4201 aaagcctaaa cttacagcca acatccccat gcaccgcacg ctttattata tatcaagacc
     4261 ttcctcgaga tgactgtgga gaagaccaag cgactggcga agagaaagaa ataagaaatg
     4321 aataataaac taggttgata acgacatcag caagtgtcac gaatacgagc atgtcgatgg
     4381 tattatacgc acatacaaga cgaactcatg gatgcatccg cgatcgcagt ccacgctcga
     4441 gaacgtgtaa gattacacgt ctgtgcattt agatcaacag tcagcagtca aaaggtatac
     4501 agtacgtcct aatggaatga tcattgaaag caaaggcgtc attgtcaaag cgcattaaac
     4561 ttacacctgt gggtttcgca tatgtaccta ttctgtcttt gcatggtgtc aataattaag
     4621 acgtcgtaag tacattgtcg aaattagccg ttaaatgctg ctttgtatca atacagcatg
     4681 ctacgatgga ttgatggtga gtaaatatga gaaacacgaa agctgccaat ccaagtgatg
     4741 ctgtggactg ggctcagcgg ctcgtgttcc tccaaaggtg acgcaaaaag ctcccaccaa
     4801 aaccatagca acgacagtgg ttacaaaaca tgtgacagaa tcgccaagcc aacagttgtt
     4861 ggttgatggt catagatgaa aacgacgtag catttacctg acttccgtta atctgaagga
     4921 tgatgaggtg gaggtcggtg gagttcgcaa aaaaaggcag cagtactcaa atgtcgcatc
     4981 atgtcttccg ccttgataga tcggtctacg acgacgtagt tctcgggatg tgtgtcgtct
     5041 ggccccacat tttcctgacg tcatccgaca ttaccggcgg caacgtagat cttcgatatt
     5101 cgaggaatgg attaccattt tgttcgcggt caaaatgtta accctataag taatgataaa
     5161 gatgcacatc ttcataacct tcttaacacc tattgaaagc taactcgtca ttacatatca
     5221 accggtaaaa tgaacggcag gcaatcacaa cgactggccg atgtcgagaa ggggcataac
     5281 caacagcagt cgcctccaca cgctggtacg gatgctctct tcagcgcgca agaagacctg
     5341 cttacacctc acagatagcc ctcacgaagc tgagagcaac accacggaga caacgagatg
     5401 cgcacagtac cctacagatg aaaaaggacg tgaaatcgta gattgggatg gcccggacga
     5461 tcctgataat ccgtcagttg actcctttac atgagttgcc atgtttgata gttggggcag
     5521 gttcaactgg tcaaggagtt acaaatggtt gattactatc acaacatgct tcatgtgagt
     5581 aagacatttg agaggcgtca cgctgactcg aggggaatag ttccattctc acgggtctgc
     5641 cagcgggctc gtatagcgct gggaattcat acatggaaca ggattttggg atcaatcaag
     5701 acaactttcc atggttgaca tgggctacgg ctagctggaa cgtaggtgag tcaagaaagg
     5761 ccaatggggc tggtctcgct aatatcattt gttaggagcc gccgtttttc ccctgctgtt
     5821 cgtcccgctc actgagaact ctggtcggat gccggggtat tttgtgcgtg ctttattttt
     5881 ggtcaatgat aaacctcaca aatgacaaac ctcacacctc tgcagatctc ttatatcatt
     5941 ttcttgatct tccttgtgcc gtccggcgtg ggcaccaatt ttgcgaccat ggtcaccacg
     6001 aggttctttg gtggtggcgc tagctcagtt tcgatcaata ttgtcggggg gacaatcgcg
     6061 gatatcgtaa gttggcgttg ttctcaccgt taactgactc aatctccagt ggaaaggccc
     6121 tgccgaacgg agcgtcccca tgtccatctt cggtatgacg tccgtcgttg gcatcgccct
     6181 gggaccgttc atcggaggcg caattcaaac caacgagaca acaatcaact ggcactggat
     6241 ctactggata caattaattt ttgacggtgc tcttctcccc gtcttttggt tcatccttcg
     6301 cgagacaagg ggcgacgtaa tcctcgccaa aagagcgaaa cgtattagga aggagacggg
     6361 tcgtcaggcc tatgccaaag cagagctcga gagtgaaaag gtctccacga tggtcttaat
     6421 ctcgtttaaa cgtccaacaa aaatgctttt cacagaattc gccgtctttt ccttcacctt
     6481 atgggtttcg tttggtgagt tgtggtagaa ccgagctttg ctaacgtgta ctttagcatg
     6541 gggactgcta ttcctctttc agtcgagcat cccgcagact ttcagtgcaa agtgagtgcg
     6601 gtgagggatg tggccgctgc tacctggctt acacacgccc agctacggct tcaatacgtt
     6661 ccaaagttca ctggtccaac tcgccctttc tgtcggcgcg atcatcggca cgatcatcaa
     6721 cccttaccag gacaaattgt acctccgatc cgcccaccac aacaaggaga ccgagggtaa
     6781 gcccatacct gaggccagat tgtacttctc catccccggc agtttgcttt tcgccggcgc
     6841 gttgttctgg tatggctgga ccagctaccc gaacatccat tggattgtac ctaccatagc
     6901 tatcggtttt atcggtttag gcatctatgc tatttgtaag ttctgctgta tcaaacccac
     6961 gctgatgcct tggcagacat ggccaccgtg atgtacctca ctgatgcgta tgaaaaatat
     7021 gcaagttctg cgctctctgc ggcatctttg ggtcgaaatt catttggtag gtctccaatc
     7081 aaccaaaaag aactaccact gacttcaata tccaggcgct ttcctacccc ttgccagcca
     7141 ggacctcttt aacaatctgg gcttccagtg ggcgggaagg taagcgaatg ggtgtgaacc
     7201 acgcgctgat catttggcca gcttactcgg cttcctggct ttggcacttt cgggcgttcc
     7261 tatcctcctc ttcgtgagta tcgatcagtg gtattgcacg agcatttgtt gattcgcgcc
     7321 gcctttcagt tcaaaggcag atatctccgt tcgagatcgc cgtttattgc agaagcgacc
     7381 ttcgaagagg gcgattcgga agaacgtcgc gaaacaacta agcaggaggg gagtaaaggt
     7441 cttggtggtc ctgccggcca ggccaggccc accgcgccga ctatcgggag gtaaggagac
     7501 ttgtaagatg tcaagtacat gcaatgtggt gggattaggt gtttgtgaca cgcgcaggaa
     7561 gccaggttaa acttccgaac gtcgaaagcg atcttgccca ttgccgcagc agaagtcagc
     7621 taatgagcaa tgccaaatgg gaagttacag gttaaggagc tttacttttg ccattagcaa
     7681 cccagaatct cgggactgtg atgtctttca gaagattgga gcactggtgc cctctgtcag
     7741 aattagctgt tcctgtttca gtctctagta attctcgtgg gctagttact tgcgaaacgt
     7801 cgtgactcct tggactcttt ttgcccattc tcatgtcgtc gaaaaataca taattagtac
     7861 ttacccttgc ctgatcttcc ttagggccat gtactaaaca ccaacagaca gagtcaagag
     7921 atataccata caatacttca ttggttagtt aaactacggc ctccaatctt ctcttctcgt
     7981 cttcatggcc gaagatcgtg gaacgagtca taacaggcac actatttgag ggagagacga
     8041 tggaatccat aaggcacgcg aaaatgaaaa cagttcaata catgcaccaa gatgggttta
     8101 cataccgttt atgctacgat tctaggctaa aaattcctat acttccatac cttaaaaccc
     8161 aagaaatgga catccatcgt cccattcact ttctaccccc gaaataccat tccaaactcg
     8221 tcttcgaatg tactatcttc ttttatagga acctcgagca gctggggcac ctccatatga
     8281 cagtcctcgc ctcgctctca tccagatcat ctccatgcgt caacagccat tcctccacca
     8341 tttgtaggat actcggatgc gattcatccg ctccagcgac cttggctgtc acatccactg
     8401 ctttttcctt tgtatcacca ccgccattcc tttcgctatc gctttctacc ttgatattga
     8461 tgacagagtt ggctgaggac gaatatagtg agagattgat ggcattgcag atgatttgcc
     8521 gggctccgag gacttttcgg gcattgccaa ctactccagc tttctcgcct cgtagaatag
     8581 gagcgatggc tgcttgttga ataacttccg ggatctgctc atccacctgt ccagcccacg
     8641 cctgaagctc cgcaaaactc agaacccctt ccttctcctg cctgacctta tcgctctcct
     8701 ggtcatcccg ttttgcatac tcattctgac attctgccaa tccttcttct ctcaatttct
     8761 caatttcttt cggtgtagga gtgccgttaa cgacttccca aaatggtttt ccaggcgtaa
     8821 ggggccggat gacgtcggat tggacttcgg gagacgatgt gtaatctgct agaggaagta
     8881 gttggaggcc agaagagcgg atatatgaaa tggaaaaagg ggtgagggga cggcgatagt
     8941 cgcctccacg ccagtcgaga cagccgagat gaaaccattt aagacaccct aaatacacac
     9001 aatcagtgac ggattcaaag acaagtctta tatgggggag agagacgaaa aaggagtcct
     9061 taccagggtt gggacaaaga gccataggtt ctgggcggtc ggttataggg agatagggtt
     9121 ccgtacagta gcatgtaggt ggttgatatt gctttgatag gtccatcaat aactcatcaa
     9181 gtgctcaaac agagattcac acgtacgaaa agatgtcttg aacgagagat gtcagattga
     9241 cgagctcttt tggagcttgc tttcgcgggg ttcagtttgg cttggatcta gcacaaaaat
     9301 cgtcagcata tgaagtatcg cagccaaagg taaatctcac aacagcagat tcctcgaggc
     9361 tgggggtgcg agcttcactt cgatagaaga tggtattgtt gtcaaaaggc tcctgcatgg
     9421 gattggattc atcatagaga gtcacaggag cgtgagctat gggaaatttc acgatgagtg
     9481 ccggatgtaa gaaagcaagg cagacggaat gacccacatt cgacagtgcc gacaggctgg
     9541 accgcgtcaa actctcgacc aagcataaag atctcacgac caccaacttt gccttttggt
     9601 ctaatacggt actgcaagct tagcgattgg agatttggat aggtcgatga ggtagacaaa
     9661 acgtacagtc cggtcttcac atccgattct ctaagctctt ttactgttcg gcacatccat
     9721 ctgaccttcc tgtcatcgcc aaaatccttc agcatcaatc agcccaaacc agttacttac
     9781 atccaaacgt aagtcttatc ccttgcccta atctccacaa tcctccctat ccagtatccg
     9841 gccttccaca tcgcgtcggc ctcccttctc tgcttctcct cttcagtctc atcaacttcc
     9901 tcctcctcct cctcgtcatc atattcttct tctttttcaa ccgctgattc ggctgcatga
     9961 gaagcgcgtg attttttacg aggaggcgat tccggaatgg gtggtcgtga gtgttcatga
    10021 gcgagccaaa cactacgtgg atggattaat atcagcaaac tttcacggcc gttatatgcg
    10081 agatagcaat actaacaaat ctccaagata gtaagagatg ttcgggggca ctgttggtta
    10141 ctgatcagtg cgtattttga tggatgcaag cgtcaataac ccactcagaa atgacctaaa
    10201 acgcaaccgt taatacggta aacgtaacat aacaacatac cagagtttat aatggcaact
    10261 tacttgtacc gtcttaagct cttatattcc tcttcagagc tacataccgg tggtcttctg
    10321 tcagtcaaag cctgtgcgac agtagctcaa agacaaacga agctcaaaag actcacgggg
    10381 cttcccaaga caaaggcgca agatcgcgag ctcgtttgga tggtgacata gtatatcggt
    10441 gataaattcg tgatggcggg gtatagttta gcaagaggca aggagtggcg aaagaagtag
    10501 tggacgctga gatgggactg aaattgagtg agatgaacgc gattgaccga taacagacaa
    10561 gctcgcgcga agatggcgcc ctcgctcgag gcgtaaaaaa aaaaagacaa acaatctaaa
    10621 aatcgcccaa tcgtaatttg gacctcacgt actttcttaa aataccacgc ttttttgcac
    10681 atctaaatat gcataaaaag tgccctatag aacacacttt gcgttaattc catatagttg
    10741 gttacagcta gcagttggtt tctctagcat agcgttgaat gcaattactt acttattcag
    10801 agtcaataaa catccgttaa gaggcgccac caccctcccc tttcgcccct agcgagtcct
    10861 ccgctggtct tatatttact ttaaattaac cagtgaaaag agtctaggtg aatgtcgacg
    10921 agaagacttg aaaatcgaat cgaaaaagtt catctccgag aaggggcttc tttccttttc
    10981 gatccttcaa agaagacaaa tgtcatcaga tagcgagagt ggcgggcctc tgtcgagcgc
    11041 ccgggggcgt ttgttctatg accatcatcc ctcacaagct tcaccaacaa gacgcaggca
    11101 tagcaatcac aatgatatat tatctctctg tttctgcttt atacatactt ctatgctaaa
    11161 gcaccttacg atataggtta tcgaccaaat gcaacgccgc tttcgccgcc gccctctcgg
    11221 tctttcctgt caaagctttg tccatatcat cgttatctca aatccatagc ttctcttagc
    11281 accgaactga gaccagattt cattttctgt caaaataaga cgacataggg tgtggggtga
    11341 ataaatggga agaacattca ttcagtacag aaagtgagga gacttggacc ggaagtgccg
    11401 gcaacgatga tgttcgctga gaaaacgctt agctacccgc tcaaagaatg gaactcacac
    11461 gccctgcaaa aagtaaccat caccaaagca tttacatcac tctccaaaag ctctagagag
    11521 tcatatttca tttcaactta tgtgtactac gatcccacca cgccacaaac gatctctctc
    11581 agaattccgt accttaggct cccatcttct cgctcaatca acatacctga cagtgatgct
    11641 aataatgtgc ccttcccggc ttgtttttca ttgatttgtg ccagcttgaa attggagtct
    11701 cgtattcatg atcatgtagt cttggcactg atccttgccc aagctttcca aaagggaact
    11761 agctggcctg cacagggcgc acaacttgat cttgaagacg aaacgaacat aaaaacctga
    11821 cccaccaata gaatttgttg gaagattcaa acatcaagct acaagcccat gttcagaatg
    11881 agattgttga gaagttctta agaagatgac cggccttcct catcaaatag gttttcgtcg
    11941 ttataagacg aacaacgaaa tcggttttgc gaagcgagca atcgaaaata aaacatgtat
    12001 cgttcgtttg ttgatcgttc gtcactttaa gacggatgag cgatcaatat ctcgtcgtga
    12061 cgttcctggt gtatcttttt tatcatgcgc ttatcgcggg tggcctatgc cgcctagaaa
    12121 cggccagcga gcaatcaatc tccttttttg ttctgtcgtt ctacttcatt tcctgctcat
    12181 tacaattcac accccgccca tagccgctcc gccaaagtac tatgtcccca cctcaaggaa
    12241 agggtgtacc ggttcctaac cttggcctga agcacgagtc aaagaagaag ggacatgtca
    12301 tgcagagctc attggaactt gttttcagtt gtacgtatcg aaatttgttc tcggtacgcg
    12361 gcgatatgct aataaatagc gaatagattc tcggtcacag caaatgcatt atggatcacg
    12421 atcagctccc tctttcctag acgacagttc atttcgaggc gatcaatttg atgttgatga
    12481 ctacgatgag gatcaaaatt acaacgatat ctacgacggg atagagagaa ctggagagga
    12541 gcagtttgaa ggtagagatt tgagtggcag attggaagat ctgaaagtgg ctggcgctat
    12601 ttctgaagca aatgaagatg gtagcacgca agaagagctt ggacaagact cgcacattac
    12661 gagacgatca tccgacgaac cggcgttctt ccactccgac tctgtgccta tatcacccat
    12721 ttcccaactt caaccgtcgg tgaaccaagg cgccaaagta aacacactcc ttccagatgg
    12781 tatcgggccg attcaagggc tctttttggc tgctatgcca tctccccgac ttgcacccgt
    12841 tcttccacat cccggatcgc tcgacacttc atattgtaca gaggcgggac catcatctaa
    12901 tccacgtaca tccaagcgat ggaacagtca tagtaggggt gattcgaacc cgatggagat
    12961 tagagaatct gctgctctag tatcttcatc cccacaatac catggcaaag gcaagagtgc
    13021 agagaatcgg cctttgctgg atggtcggcc gacagaaggg tatgcttcga tacagtcgca
    13081 aaaggagata agacgaaagt caaatagaag aaagcgaagc gaagatggcc agagcacaga
    13141 aggacaaacc gtaagtctga tcctctctat ctctctctcc cacactaaaa cccgcttgtt
    13201 ctatctccag ctgttcaacg cgacggcagt actagttggt ataggtctcc tctcccttcc
    13261 acttgctttc gcatatgccg gatggatagg aggtacgatc atgcttctcg gcttcgggtg
    13321 gctgacttgc tatacgtata ttttgttctc atctactaac tttaccggaa cactaatcat
    13381 gaggctcgtc atagggcgaa gctactggcg agactgatca gagccgacgg aagaatgatg
    13441 ggatatacag acattggtct gcgagctttc ggcagttggg cgggtgcggg tataaatcta
    13501 ttgtaagtgg cggtcatatc aatcactgaa tgattatgct gattacaggg tagattctgc
    13561 atggagctct ttgcattagg gtacatttca tcgtctcgtc ttgtaatgat ggtatactga
    13621 caacaggctc tagtgttgcc ctagttcttc ttttcggaga cacactcaac gttctctacc
    13681 cttcaatacc atcaaatgtc tggaagctcg ttggtttctt catgtacgct ccaccgagtt
    13741 ttcaccagtg ttcacaccct tggtttgcta acgccctttt gattgacagt atcgtgccca
    13801 ctgttctgct tcctctccgt cttctgtcac tcccttctct cctttcctca atctcctcct
    13861 ttttcctcat catagttctt ctcgtcgacg gttttctgcc ttcccctgag ccctcatcgg
    13921 cttcgaccgg ctctctcctc cacccctcac caaccagcct ttctcctgaa tggtcccgtg
    13981 gtaactggtt gggcggaata gggcttattc tagccggttt tggaggccac gcagtgatgc
    14041 ccagtttggc gagggacatg aagcggccag agaaatttga tgggatcgtt aattgggcat
    14101 ttgtaagttt cgctattgtc tcttcctatc ctctctcaaa ctcggtgtga ccatataaca
    14161 aacttttttt cgttttctga ctcgggattt gacacaggcg atagcaactg gcatatcttt
    14221 cacagcaggt gccgctgggt atcttatgtt cggtgagacc gtatctgacg aagtatgtcc
    14281 ctccagctct cattttttcc aggatggttc cctaggctga tgagatgttg caaaattacc
    14341 taggttacga aagacctgat gcgagagaag tatcattacc ctcgaatact caatattgtg
    14401 gctctatgga tgattgtcat caaccccctt acaaaatttg ggctttcctc tcgtcctgtg
    14461 agtgttaatt tattttatgt tcgccttttc ttgagagcta ggctccatta gtatgggatc
    14521 aaacgctaat ggatagctct ctcttgcagc tcaatctgac aatcgaagga atacttagga
    14581 tatccccttc tccaccaccg tccctcttct ctccctttga tggtggactc gaatcagcgc
    14641 tcgggtcggg tgcaccagag acaagccaag ttaattttcc caaacgtcgc gatcggtcat
    14701 ctttctctac tcgcaacgat ccccgcacat cccgtcgacc gtctgccctc acctctccat
    14761 ccaactctcg cccctttcct cagtcccaat ctcagatagt cgccttcgag caatatgtct
    14821 ctaaagaacg caagaagaga tggctgcgaa tggtgtcgcg agtggtcatt accgctctct
    14881 gtgtgggtgt cgctgtagtc ttgccgggtt tcggacgtgt gatggccttt ttgggaagtt
    14941 tctccgcatt tatgatttgt atcatcttgc ctgtacgtcc tcatctgcgt tttcaccatc
    15001 ctccctccgg aactcaaaac taacttttgt ttttaaaaag ctcctattct acatccgcct
    15061 gtcccccact ctccttccaa cttgtccccc gtcgccccat tcgctcacat tcccaccgac
    15121 tgcccgctcg caaccaacgt caaaatgggc cagcgagaaa tttacgaatg cgatacactg
    15181 ggtattggta atcgccagta cggcgctgat gatagccggg actatatggg cgttcttgcc
    15241 aggaagtggg catgatgagt tggaaacgta gcggtttcga gggcatagaa gggctgtaac
    15301 agttgtagca agtgtttcgt tttgatagtt gtatttttca aatcaggtct cgcattttac
    15361 tttgctgctt ttggttagag ataaggatta gaaattatat aaggatctat agacgaatct
    15421 gaaacgtggt agaatccatt cgcgattgac ttggcctgga ggtatcttaa ccctgttgtt
    15481 ttacttccct gagcgaaaac ctggcgaaaa acataacgga actcttctcg tctgttttcc
    15541 tccaatctct tgaaacagaa tagctatcag agttgacgaa caaaatcatc accgcctagc
    15601 gagttctcca ttcatccctt gtgtttaata agctttccct ataactgatt atctccatcc
    15661 gtatctttca tccatcaagc tgtatacata cgtcaaggtg agtccaactg agcatccttt
    15721 tgtggttcat attcctttcc aatgaattag gccatagatg ctatttcata tgctttgcaa
    15781 tttgctataa aaaatctgcc agtgttaggt tttctagcat cttttcacgt cttgactcga
    15841 atttcaatgg tgaaaaaccg actgtctcaa ggacatctcg cttactccag gttttattcc
    15901 caatcatttc cgagtctcgc tcaattctca ctctcacgtt cgtcttcagt ccaagacgta
    15961 attgccacat ttcccaacat cttgccgatc cgattgcgca tctcatcagt ttatccagta
    16021 ctctccagat gatccatacg caattggtcg tgatctttgc tctccgttgt ctgatctgta
    16081 tgcataccct cggcaccatt cccctgatgt ccaaaacgca aaattctaca ctttctacat
    16141 ttcttttctt ggcaccgtat tgaaaagatt ttgagggtta tctcgcggtt aatccgcttg
    16201 aagataggga tgaatgggtt gaaagattgt gggggagatt acgataaagg gcgggataag
    16261 gagaagaatg agtgtcgtct tattgagcag gtcggacctt caaatcagac aaatcggctt
    16321 gggaaccgac ggcgatagag tggggggatg cttgttcgaa tgagctacgc aggaaaatgt
    16381 tagttgtcat tctgcttttt caccatgtct ggtcgcgatg ccggggtggg tcctctctct
    16441 tttttctctc gtttcctctt ccccttcgtt tcccagattg tgcctttctg caatatctcc
    16501 ctgcacaccc atccacccgc acttcctatc actcgctggt aatcggtccg ccgatgcaat
    16561 cacccgccca ccccatctac cactcgcttt cgctcacaaa ctcacttggg atacctcatc
    16621 ctcaacacct ttggcctctc tccctcctgg aacaacaact tggtctccgc ggcctccttt
    16681 gtcaactcca aatgcttctc attcctctgt gaccacactt cggccttttc cgtctgcttg
    16741 gcaaaccatc tcgtcaaagc tggaagcgtc tcatccttgc gggcggccgc gaacgcttca
    16801 ggatcgagag aaggggatgc gggcttgtcg gaaggggaag ggaggtaagg gtagatgagg
    16861 atcgaggcgg tgaggatgat gaatgcgttg cgccaggaag gtgtgaagaa ggctaacaga
    16921 gtgatgagct atcgcacact gccgggagca acgtcgacct acactcgttg gtataagcgt
    16981 cactctggtc ctcggcgccg tggtggtcgc tgtgggctgc tctcctgggt gccgaggtgg
    17041 cgatacccct ggcggcgttg agggtggtgg cgtgtcggaa gagaggcctg agtgacattt
    17101 ctacgatttc ccgagagacg agtacgagga gtatgtggga tgagagatcc atcaccgctg
    17161 ataggccgaa tcacttaccg cggcgttacg cggtgctctg cggtgtggcg gcggcactga
    17221 gatttggttc cgcggattgt acgcgtcgcg ggtgtctgtg cacactcatt tcgacgcgta
    17281 caaggggatt ccacactccc cctcgactgc ttgaaaacag ccccgaaccg gattcgcggc
    17341 acagcgcaac agcccaggat ggccatgcag agtatcaaat gtacgtcgtt cccttctccc
    17401 gccgctcagc gctgactgtc ccacccaggc gtcgtcgtcg gtgacggcgc cgtcggaaag
    17461 gtacattatc atcccatccc tctcaatccg ctacgccata ctaaccgcag cgacggcgtg
    17521 gatagacatg tctcttgatt tcatacacca ccaactcatt ccccggggaa tacgtcccga
    17581 ctgtgtttga caattactct gccagcgtac tcgttgatgg ccggccggtc agtctgggat
    17641 tatgggatac tgccgggcag gaagactatg agtgcgtttt cccgtctctc ttcttctctt
    17701 cttctgcttt tgcacctatt atttatccct tctttcgcac tgtccttctt tacgtccctt
    17761 tcttcatctc cttgatgtgt gacgcgtgaa caaaaagtgg ctgacatcac cccccattcc
    17821 acctttccca ccactcgaaa cagccgacta agaccactat cctacccaca gaccgatgta
    17881 ttcctcgtct gcttctcaat cgtctctcca ccaagtttcg aaaatgtcaa aacggtaagt
    17941 cattggagtc ttggatttta tggattctgg aggaatcgga cgcgtctgga accgtcttga
    18001 cttgagctga ccattttccc gcttttgtcg tccattgcat cgtaaaaaaa acgtcttgga
    18061 aaatagaaag taaatctttc tcgtgctttc ccccgcgcca cccacgctaa cactcccttg
    18121 cccacctaca gtggatcccc gaaatccgcc accacgctcc aacgactccc atccttctca
    18181 tcggcaccaa actcgatctc cgggacgacc ctgtcaccct ctcacggctg aaagaacgcc
    18241 gtttccaacc gatcgggttt gagatgggtg tcagatgcgc gagggagatt ggggctgtta
    18301 ggtatttgga ggcttccagt cggacgtgcg tttgttgcct ttctcttctt ctgctttccg
    18361 ctaacggtaa ctcttgttgg aaaataaata aacagacaaa aaggcttgaa aaacgtattc
    18421 gacgaagcga tccgtgcggt actcagtcct tctgcaaggg acgcgaggga gaagaagaag
    18481 aagaaacagc agtgtttgat tctctgagcg gccgctttta aacgaggcgg ttgtctagta
    18541 gggcgcgagg gcacagcatg cgagagacat ttagatttag atggattggc cggcggggcg
    18601 ggggggtcat agggaaggac aaagatgagg cggaaaggtt ggaaagaagg tatcaccaag
    18661 agaaaaggaa aaaaggtact gcccccgagt tgaccacaaa aaccaagcaa cgatcactgt
    18721 catacggggt agtcgttgaa tttttctttt tttagcatct ttttggattc atcgattgat
    18781 caagttttcc ccttttccca tgcaagcact gtatttttat ccccccttct tactccgtgg
    18841 tctatgatct aatctcgtgg cggttagtgg gttgcgcttt gtccgttttg accatcctgc
    18901 cctagttgct tcatttccgg ctcccgtgtc aaggtttgac attgtatcat tgtgctctat
    18961 gaaatgctga tgtttcgact cgcctattgg cactcgccct cgcccagata catcccagct
    19021 tcgctgccaa aactgcacct tttacggcct cttgaccttt accttcatcc tatctgaagc
    19081 gcccctgact ttttccctcc cgtgcgatgc tgcgcgcgtt aagccgccct attatgtcac
    19141 gaaccggaaa acgtcagctt acaacgaaaa aaaaaagtaa gaccaaaaaa aaaaacaaaa
    19201 aaacccacct tgccaaccca tccccttttg gtcaaccagc ccacaaactt tggcgtccac
    19261 gcgacggtca accctgctct aataggtaac aacgccgtct tatgtatcgt gtacgccaac
    19321 actgcttctg cccaaaacgt ctttccaaac catccgctct tggcctgctt gccctccttc
    19381 ttttcagcgg ccatctcctc ctccctctcc cgctcatcct cgaccctcat cctctccgct
    19441 tcctcgaccc cgtacctctt tgaccgatag aacgctttcg ccgaatccat cagcggggcg
    19501 atccgctccg cgccgagcga atggacgagc aggaaacaga gggaaaagtc gatggtggag
    19561 aggaaaaagt acatgccgac ggcccacgag ccgtatttcc tggtgagggc tttgaatctt
    19621 gcataggctg attttggttc ggccccgggt tcgtgttcag gttcgtgttc gggtccagac
    19681 tcactctcct gtctcttctg gtcagagcca gagctcgtgg tatttcgttg agaggacgct
    19741 tggaggttgg cgttaaagat gtgcggggtg gaaagaaacg agcgcgagga gagcgtagcg
    19801 gtcaagggga ggataaacga tcgggagagg tgaatggcag tagggcgcag gagagcgggg
    19861 tgtatggctg tcgtgccacg gacacgggcc aacgagacag ggcgtattct ggcgagcggg
    19921 acgggcattg cgcaggggct atggctggaa agcgtgtcga gaaaagcgag gcctggcaaa
    19981 atgtcgttgc gtgtcccggc cggcgggcgg cgggggtgtt atgtaagtgg gtggcattac
    20041 gtaacgcgag cgggtgtgtt tgtgcgggtt aaagtgcggc ggcggctgaa gttcttggcg
    20101 tgcgttttgt gttgccgggt agaggttgct gggtagagga gatgtgcacc gaggcatgca
    20161 gagagtgtgt gcgtgatggc tggcacgtgg ccgctgcacc cgccacgtga gcagcacgag
    20221 acaccgcctc cgctgcagct cgccgtgggg tttccgatcg agatgggtac ccgcctcgct
    20281 ggtttccgca tttgccctgc caaggcggct tatacttggc ggtcgcgccc gtatataaga
    20341 ctcgccccgc ccctgttccc cgttcccctc ccccgttccc cccaccagcc ctttccaccc
    20401 gccctttcca cccgccacca ccatgctccc cctctccttc ctccctgccc tcctcgccct
    20461 cgcccccctc gcacgggcgc aggtgactgc cacctacccc aacggcgcca cgaaccccga
    20521 cacccccgag ttcgccccca tcggctccta tgtcaaccag agctccgagt cgcgcctcat
    20581 ctccctcaac ggcgtcgacg acttttgtct ctggggtccc cgcaatatct cggcggtgag
    20641 cactaatctg atagggaata tcgagccgga agtggtagcg tactgttcca agccgaggaa
    20701 taacgccagg atcatcccag acggggttgt tactgctgcc cacgtgggtc gacttttctc
    20761 ccttttctcc cgatcgaacg ctaaccatcg acgggtagtt tgtcaagacc gcgctgtacg
    20821 tccagatctg gggctgtaag tcgtctcttt tctgtcggcc gaacaatctg acactgatgc
    20881 gctttgtccc attccagtct gggacgcgac caggatcggt attgtacgtc gcgttctaca
    20941 ctgcagagat gtgaggagtc aagacgagaa gctgacatcc gtccaaagcc ggacggcgac
    21001 tctggcggtg aactagaccc ccatggcgct gaaaacctcg gaaacccaat tggcggcaac
    21061 gccacttcca acgtcgatgg aaccgacgtg ttttacgagg aatggatgag ctttgtaagt
    21121 cgctcgtctc tgtctctttc tcctttccaa tctaatggcg aaatcaatgg atagatctcg
    21181 tacgaccagt tctgtctccg tatctgtaca gccgaaactt caaacgtgac tgccgcattg
    21241 cagtgcgagc atgaacttga catcatgggt tgtgcgtttg tcatggctat cgagtacgtg
    21301 tatttctctc ctcccatacc tgccggcctc tgctaacgcc attcgtctct tctcgcgcat
    21361 cacagcgact tttacaacac caacaactct ttcacatcct gcgacggtga acctgccgcc
    21421 ccacccggtc tctaccccca ggccaacgga tcgacctcga ctttccgaca gcgatacacc
    21481 ggtacttggt ccaacgccga aacgaccgac atgtttactg taggacaaac agttacgccc
    21541 agtagtgttg ctttgtgagt tttcatactt tttaagtctc acctatcgct ttcgatcaag
    21601 ctgatgccaa tcggcgatta gctacccggc gacatccaac tgctatacct actctaccat
    21661 ctctagtacg tccatgcccc ttgcccttcc aatccaccct ccacgctaac atcctccact
    21721 cactccttgt cactcgcaga cggcatcgac acggccaact ggcaagtaac ggccacccct
    21781 tccaccctct ccggtggctc caccgtcgcc gtcgcctctg tcggcaccac ctcccagtcc
    21841 cctcctcccg gtatctccac ctcttcccca acttcttctt cttcttcttc cggctcttct
    21901 ggctcatccg ccggcagctc ttccagctcc aacacgggca gcgcgtcaac cggtgcaaca
    21961 gccgtcgatt cttccggctc gtcctctgcc gcaaccaagg cttccaccgt ccacggacaa
    22021 ggaatcgtcg tcatgggtgt tgcagctgtc ggaatgctgt ttggtgctgc cgtcttgctt
    22081 taaatttgaa gaaaaagaaa agaccttttg acaagcccaa gccaactacc tccccgactt
    22141 tcctagtcga atctatcccg cgttcagcca agcgtagcat ttctctcgca tctaaacccc
    22201 agaaactttc gaaccattta aaataaatca atacttgatg tacatagcta atcatgtctt
    22261 tttcgagccc cggatgattt ctgaacgtgt cgtcttcttt tatgaatttc tcatggacta
    22321 tttcttcttt ttaaaacctt gtggtggcac ttgctctcgt cgtccttttt ttccgtttcg
    22381 gttcgtttcg ttgcattgat gtggtgcgcg gtaagacgag atcgatcatc caaagttgac
    22441 gttatacatc ctgaatcgcc ttgatctttt ctctgaaatc atttacgtgg cttcctggtt
    22501 gccgcttccc gacattaacc cctaatacat ggtgaaatgg tgatgatgga tgataaaacc
    22561 cctgccatct tgtcttcaca cgccggcacg caccactttg aaaagcagtc cgagatgaca
    22621 caaaataagc cgtgacgtgg aacatccacc tcccatcgtc cgatcctgtt tttgttttcg
    22681 tccctttccg tcgttccagt cgagtccccc aaggcgaact cgatacaaca cctctgcgta
    22741 tcccaaaaag aatgacgaca ggaacgacga cagtggtatc ctcccccggc aaggtactca
    22801 tcgcaggagg ataccttgtc ctcgacacac actactctgg tctagtcatc ggcacttcta
    22861 gcagattcta ctcttgtgtc tcgagccgcg caacgtcaag ccgcgcaacg tccagcacgc
    22921 caagcatcga tgccgatacc aacaccggca ttgacacaga cacttgtcaa aataaagcga
    22981 ccatctcggt acgcgccggc caattccctc ccgacgcttc gacatgggtc tactgcatct
    23041 caaaaccttc tgcttctgct tctgcttccg ccggtgagga cggcgaagaa ggtgaagaag
    23101 gtggagatgg gactttatat cttaaactag agcagaccaa tgaagagcaa gcgggtaaaa
    23161 acaaattcat ctttatcacg ctttgcaaag tgctcgagta tgtttacgaa tccatcttgg
    23221 cccacgttgg ggatgaggaa acagcattgg acgagttgat gaagcggata aaaggtggtg
    23281 ggggtggtga ggacggtttg gacgtggtcg tctttgcgga caatgacttt tactctcaac
    23341 gcgagcaggt gcgtatgata tattttcttg ttaatgggat aatacggctt cggacctgac
    23401 agacctgtat cccttcagct cacatcgcta tccctcccaa cccggatatc atcccttccc
    23461 catctcccgc cattcacccc tcttccccgc ccaatccccg caaccaacaa aaccggcctc
    23521 ggctcctctg ccgccctagt cacttccctc gtcggatctt tgctctccca cctccatatc
    23581 acccattcct ctccagaggg cagtatcgca gatgacgaca aggctgtcat tcactctgtc
    23641 gctcagctgg cgcactgcca agcgcagggt aaagttggat caggtttcga cgtttcctct
    23701 gccgtctacg gttcccacct ctacacccgt ttctccccat ccatcctcac gccgctcatg
    23761 tcccttgccc cattctcccg acctcgaccc tctcccggct caacatctct cctcctcgat
    23821 gcactccacc cgagcaaatg ggataacaaa tccatccctt tccgactccc caaacatttg
    23881 cgtctcttac tcgccgacgt ttcgtgcggt actgacacgc catcttttgt ctcctctgtc
    23941 ctcaagtgga gaaataacga tagggaaaag gccgatgaag tgtgggcgag gctggataat
    24001 gcgaacaggg ccttgggtaa ggtgctgagc gatatggtgg ccgcagaaaa cgagattgat
    24061 tatgaaaaaa ccatgatggc cgcctcagaa ctcacatcgg acgaggtacg tccgcaaatc
    24121 tcctctccct ctctctccca ttctttcatt ccccgtcact gacttttaac cgtcctgttg
    24181 tagcttttga acctccctac aaccccgagc ccttcacgca cactccatct cctccaccgc
    24241 ctcgccctct ccctctcgtc catccgcgct ctgttgcgtg aaatgtccga tctctcgggc
    24301 gtacccatcg aaccaaaaga acaaacgaga ttgctggatg catgcggaca agtcaagggt
    24361 gttgtaggcg gtggcgttcc aggtggtacg tcctaaattc cctctcgtcc caaccccact
    24421 cgcaaaactt tattcccagg gccctcagcc ccatcgtata acagcacaca tgctcatgct
    24481 tcgatttgtt tctagcgggc ggctacgatg ccctttacct tcttaccatc gaccacccaa
    24541 cccctatagc aggtgtcgat aaactttggg cagagtggac ggagatggac gtctgtcccc
    24601 tgtccgcaaa acagagtgat ggcgggataa ggcaagaaca agttgcggaa gtgaagggtt
    24661 taaaggaagc gctggagaga gcgaggagat gagccgtgca tcggaagata gcatataagg
    24721 ataaaggtta atgccaggct aatagattcg tattgtgttt ataccctgca tgagatatgc
    24781 cgttttgacg acttacgtga cgtgagtcaa atgctctgtg caaagtgaat gatgctatat
    24841 atgttacaac agattgtgtg ttttatgatg ctatggtgat atggtggaat tttcgatccc
    24901 cccccccctc aagatctctc tcattccgcc aaaatatctt ctatctcatt cacactccca
    24961 tctcaccccg tcccccccct catattttcc ccttcacatt ttgtaccgtc gatgaccccg
    25021 cttccaagac accaaccatc atgccagatg gctacgactt gtccagggct cacgccgacg
    25081 atcggatcat tgaactctac agtcacactt tcatttcact tcattagcta ctcacaattt
    25141 cttgggggca aggcgatata agaaattata ggacaaagct atagactcac tccttgacgt
    25201 taccacctac gacgattcga ccgccaacag gattcatcct atgcctgact tgtataccca
    25261 ctttctccgg ttctttcaca agcaattctc gtgggaatgt gtcgtgtatc cagtggaaat
    25321 cggaggtatg aacacttttg cagagcaaca tcggatggtc cctacaatac ccgtcagatc
    25381 cgtaaatcgc attcttcctt tccctgtcca taccaatcgg aagggggaag aggaggggat
    25441 aacaagatgg agaaaactca cgatcccggg acgactaata tatcagtccc cttctcccct
    25501 acgcctttct ttgcgacaaa catgggtttc aactgattcg caaccctggc ccgttgacca
    25561 atggtgtagt accagagtcc cttgtgctct gccaagcgct caccggaaag gttaacaaga
    25621 tagcctgatt cgggtgggga cgtgtattgc gctgtgggtg gaaagtcaag atgggcataa
    25681 taaacggtgg atggtggatt atgatttagc ccagcaatga ataaactgat ggagtaatgc
    25741 gatatataac gcacagatga aatctccaaa ctttccccgc tccccaatga aacacacgcc
    25801 catagactct tccttctttg cgtttggtaa accccaatgc tctgccagtc gtctgacgtc
    25861 ggtttttaat aaacttccga gtggaagaat tgcctaccac acatttattc agcttacacg
    25921 agcaaaaaaa cagaaatata cttttgaacg tacgcgagat agctgttgtt cggtcatttg
    25981 agagaggtaa taggtttgat ctttggattt atccactgct cgtagaagct ttgaaggtcc
    26041 tggatgtgat agtagaggga cgtgagcaac acggccataa tgacccgttg caaggaaatg
    26101 cctgtctttc tttggcaaga catccaacag agcaccaaac ttgatctctc tacattccat
    26161 tatcagccga tcataaacat gtcagtatta ttatgacgta cctattacaa tccacatctg
    26221 ggttaggcgt tccccccctc tcccatactc ccactgcggg ctcaaacact ctactccaat
    26281 actccttcga cagatctaca agcttgatcg agtcctttgg gatcccaact tgtgtagcca
    26341 cttttaggac atcattccaa tctcgctccc attggcaagg agaaagattc tgctctctgt
    26401 tcgaggttga gcccgaagag tatgctagag atatgggaga tggtggcaaa gaagattcag
    26461 gaggcgattc agatagtaga gggtcccagt tgcgcatgaa tacaacgtca agatggatgg
    26521 gcttttagct ttgattagca ctgagcggtc aaatgggagg tgacagatac gcacaaactc
    26581 tcgtaatatt cgcaacgttg ttgcagaatc gaccccacct gacataccaa cagttactgt
    26641 acaaaaaaga tcagtctgaa atacaactac ttcaaatatt ttgcatacat accgtgatca
    26701 ccttctctca gaccgagttc ctccatggtc ggcagaaggc tccgaagctc cctttcagcc
    26761 aaactgtggc tactcctcat tcggaccaaa ggcttcagct tcacatttac ggctctcggc
    26821 agacattgtc gggatttcga accaaacaca tttgaacaac ggaatttgga tgtcgtcggt
    26881 agcggtcgta gacatgcaaa ccacatctcc ttaataagag aaccgaggca gcaagcaatt
    26941 ctgagcttgc ccgtttggtg tgcagtgtat gggtgtttta ttatgctata taatgtacgg
    27001 acaacgaaag atgaatgcag gaggatgagt atcgaccttt ctgttttaac tttttttcgg
    27061 ctttgtccgg tacgatcacg acaaccgctg aaatcgacca aaggagttac tctggctccg
    27121 cgggccatca gactttaacg gttgttgcat cattatttct cttttcatcg tttctacgaa
    27181 ttttcgacgg gcgtcagcac tatagccagg taatcgccag ccatggaaca tagcatcgag
    27241 tcaaaagacg tacctttcac ggcaaacacc tacctttgtg tcaaaaaaga tacatctttc
    27301 ggcttcccgt tgttcgatgc cccaggtccg aggttccgat ttctgactct caataattta
    27361 ctccccgaca cccccgcttt atagacaaga ccagggtact aggccagaat acacatgtaa
    27421 tggagcggag ttgtaacagc gtcccactca cattagacga tagctaaaag gacgagcagc
    27481 ctcgaagtct cgccccctca ccctcaacgt ataaaaactg cttttttgaa aagcaactca
    27541 tcaaagctct tgttaagctc caaggatcaa aaatttcact ggaaaccctt acaaagcaaa
    27601 agcacccggt actacgacga gatgaaccac cgaataaaca acagtcgtac tgatccttcc
    27661 tcttatggaa ccggaggacc cccttctggc tctgatagac gaggcacgag ggacttggga
    27721 tggtatgtcc aacttcttga gcaaatccag tctactactc ctcatgagga aaacatgcct
    27781 gtggtagatt ctgtcatcga aaatgggcag cctggcatta ctgtgacggc caatgcccct
    27841 gttggcgacc tgttcccgta cacagaagaa acatactaca tgggtccagc atcatctact
    27901 tttcaatcta caacacctac aagcggcctg ttcttcccta tgaatgaacc agaaagagtg
    27961 ctgtctacgg ccaccaatta tttcccaaga gggcgccaaa taaccacttc tcattttcct
    28021 tcggcagaga ttgaaagaaa tgatggtggt attactcaca cgcttcgtac tcctcctttc
    28081 caatcacacc cgcctaccaa caacctgtca gaccttacta cccgtcaata tgtccaacgg
    28141 gcattatccg catcaaccct tgcaagctat cgatccgccc ctatgaatag acatgggagg
    28201 gcgccgccta cagccactga ttcttcccgt cacagaataa ctttttattt ttcccctgaa
    28261 gagactggaa gaaatgatgg cattaatttt acagtccatt accctccttt cgtatcaacc
    28321 ccaagtacca atgaggccga atggataaac tacttcaacg ttcgcggcgt cacgacgaga
    28381 gacggaagga gcgagatcgg attggatgag gctgtggata ccgaagttga accgaccgat
    28441 gaggggcatc gtgagcgtgt aatgagcaga atttgggata acttgatgga ggaatttcat
    28501 atgaggagcg gaacgacaag tacagtacga gaaacaggtc gaaggggctg attagttcta
    28561 aaagtcaatt ccagagttaa gagttcgaga gagtaggccg tggcatgtat atgcggcttt
    28621 gtcaagtaca aaatgcatga aaataagaca tggctacgac tactatatta gggtttcctt
    28681 tgtaggagca gtgctagtct tccacccacc gtcggctcca acttgctcaa cgactgtttt
    28741 ttccagctag tatacaccga tagggaaaat tgggcatttg gagaaaggaa caaatcggac
    28801 gattttcaaa actcttgtaa aacaaatgtc aaaactagtc gatacatgct tacaaaacaa
    28861 aaacaaaaca gaaaacacta ctctaaccca tcctaatcaa tcacgattgg ctcaccccta
    28921 tcatctccct tcctccctgt aactccggcc tttcctcctg tggcgtttgt gctgctcgat
    28981 ttcggtgccg ggggtttcac gaccgtatca ggcacttgga tcctcgtatt caacccggcc
    29041 agcgtccgga gtctgggaat ggacttgata ggaaaccgtg ttttacacat tgcacagatg
    29101 ggttttggtt cgcagaagac tacacgtgtt gtaggggtga ggttagcttt tgccctttac
    29161 cgaaaagcgg gagaaaagtg aaggagagaa aaaagagggg aacgtactgg agagacacac
    29221 gctacatacg aatcccacgt ccaacgtcct gtgatgacag aaacatactg cacgaaagtt
    29281 gacagcgtct tgtggcgggg tgacgaacgg gttatgtcgg agagaaggtg gtgtgaggta
    29341 tatactctag ttcccattat gacattaccg catcagctgt cctgctatca catcttacca
    29401 agcttcaatg caagcagatg catgagatga taaaagggcg agaaaaaaga acgtacgtga
    29461 agatactgga gcaaaccgcc tcttccattc cattgccaat acactccatc cgtcagatgg
    29521 gcggcttgtt gcaagaagac gggaggggaa gaatcgatcg tcgatggagg aagggacagg
    29581 atatcgatcg ggactttctg caggactgaa tgtcagacga acgcggtaga tagacaaaag
    29641 agggatcact tgcagctttt tgagcggcaa agacacagtt catcagtccg acataaccac
    29701 cgcgcatgcg ttgttgccgt ctctgatttt tccgttcttc ttcgtttgca tccccatttt
    29761 ccttctccgc cccatcgcct cctcctggac gaccatccgg atccgctcga cctcccacgg
    29821 cagctccggg agtcgcgttt ataactaata tccgaacttc tttacttggt aaaaggccgc
    29881 cagaagtatc cgaggtgccg ctatttgggt ctgaagatag tgggagggct gttggatctg
    29941 cagggactga aggtgatatc cgtcggttaa tgactatcag tgtcacaacg ctatcagcag
    30001 acaatacgaa acagcttggg agacgacgac ttgcagcaga gagctttagt gagtgccgag
    30061 accatggcgg gaggttggtt tataaacccg gcgccttcgg tattcaattt tccctcttcc
    30121 tccctcacaa cttcttttag cccttcttca atcccctgat ccaaaatctg gaacggcctg
    30181 tacatattcg cactcggctt tgccccttct cccctttgcc gtatcttctc gtttgaaggc
    30241 gggtagatca gctcggcctt tccggcggat gcagtataga cgacgacttc attgccccat
    30301 ttgcttgcga gatgggcgtt gagaaagacg gtgaggatgg tgatgaactg gtcgagcgat
    30361 gtcggggatg atgtggcatt gtcgaggatc ttgttgtcgg gcaggggggg cgctgggggg
    30421 agatgggcga ggaggtgcca ggagaggggg tgggtgtcga ggacgaggat gagcgtggag
    30481 gggggggccg gcattttgtg gtgagacgaa tgaaatcacc gggaatcata ataaatcggc
    30541 ggtggaggga ctcgccccgg cggacatccc cgcccaatac gtaatcaatc gatgtgcata
    30601 attttgaatg gatattttgg tttctcgact gtgactatac aagggcatcc acaaaatgtc
    30661 agttcctctg caccgcatac gcttctacga ccacacgccc tcccccatca ccgccataca
    30721 atacaccccc ctccctcttc ccgccccttc ttcgaccccc tctcaaaccc caccagccca
    30781 cccaggagac tgtatcatcg caagagaaaa cggccatgtc gaaatatgga aacatgtctc
    30841 ggacaagcaa gtagactcgt atgggaactg ggtcctctac aaggtaagtc ttatccatcc
    30901 gaaagactag ctaacccatg cacagacact cccaccaacc cttacccatc ctaccatctc
    30961 gcaacttgct ctagttatcc gtgaccctct caactgctcc acacctgcct tgaacgatct
    31021 tcgactgttc acgtctagtt cagattctgg agatctcgtc gaaagatgct tattcaccgg
    31081 caagattctc caaacctact ccatcccctc ggcgcctata tggtctcttg cagtagcccc
    31141 tacacacgac ctcctctgtc tttccaccac ctctcccaac ctccatttcc tctctattcc
    31201 acctccgact atgtttgacc cctcgccctc ccttgaaccg cctcctcccc atctccttcg
    31261 aacagacgct ctcccctctc gaacccgaac aacctctatc gctttcggtc ctcctacgtt
    31321 gacccagctt ccggacggta cagccgaatg gcgcaatacg acattggtga ctggaaactc
    31381 ggattcatca tggaggaaat gggagatccc cgcgcctgca gacgggtcca ggcagggtcc
    31441 caatcgagtg gtcttgaagg gacgagctgt ggtggagaaa gtgcagaaag ctggaagagg
    31501 tggacgtaag gctacgggtg ctgctggcgg acaaaagcag accattgtct ggtccattgg
    31561 tatcctgccg taagttcttg cttttttttt tcttcttttt ccacgtaaca cactaacacc
    31621 ccacgtagag atggaaccgt cgccacaacc gactctctcg gctctcttat attctgggac
    31681 cccctctccc tcgctcagcg tcaacatttc cgcgctcaca aagccgatgc catgtgtctc
    31741 gccatcggtc ccggtggttc aaccgtcttc acatccggcc ccgaccagcg tgtttgccaa
    31801 ttcgttcggg ctcgagctcc tggaggagaa tgggtcctgg tcagcgccaa gaggttacac
    31861 gcccacgacg tgagggctct tgccgtttgg ccgccgtacg tccctgtccc tatcactaca
    31921 gacaccaaac atggcactag cactgtcgga gctgggctcg cccccgtgct cgcctcgggc
    31981 ggttgggaca tgtcccccac cttcaccccc gcctcccacc cttcctcacc tcccctccct
    32041 tcccccttgg ctcgcccctc ccaatcccaa accctcccca catttgaatc cacccatcct
    32101 cgacggatgg gctacctctc ctccggcctt ctctcctcct cttcccccat cacattctcc
    32161 ccctctgctc gcctggtcgt cgggaaacgc gcccgaggcg tgggcatctg gagagtccac
    32221 cccaacgaga acggttggga aaaactgctc gaaatggaac ttcgcctccg caccactatt
    32281 atcgctacca ccatctcgga acacgggaaa tacctcgccg tctccgatct gtacgagacg
    32341 aaactcttca aactcgtccc aacctcttcc ggcctgaaac ccacccgtct ccctctcctt
    32401 cctgccctcc tctcttcccc gcttcttcac catctaaaca cccaattaac gactcaaggc
    32461 tgtggctcaa cgagtatggt gttcaccccc gatggaggca gggtggtgtt gggtctcgta
    32521 accggacaag tgctgatcat cgagctagcc gaggatgagg aaaatgtaga ggtggaagtt
    32581 gtcaagtgtt ttgagcggaa agagagggtg gtgaggggta gagtgatcaa gggcaagaat
    32641 gtcaacggca ctggcgtgaa cggcaacaat accgctcctg atatcgacgt ctctatgaca
    32701 gaaaaagccg aggagcaaga atccaactct ggctctgaat ccgaatccga atctgaatcc
    32761 gattcaccgt caactttcca ctccaatggc gctcacaagc aaactcaaaa cgagtggatc
    32821 tcgactctcg cagtgagcga agacggtcag tggcttggtg tggcggatct agaaggccgt
    32881 gtcgaagttt tcaacctcga cagtttgcag gtaagccctt ttttccccct ctctcaaggt
    32941 cccagactaa tgccatatcc acaaacagct tcactccact ctccccaccc tccctcaccc
    33001 acctacaacc ctttccttcc cctccctccc ctctccttcc ccatacctcg ccatcctctc
    33061 ccctaccaac actctttcac tatacaacct cgaccaaaga cggttcattc cgctcccaag
    33121 tctggggaaa ggcgaattgg aaaagtttgg gaatgtttta agcaagatgc agacgccggt
    33181 tatgggtatg gtttggaggc cgtcaaggtt ctccctccct gttgggcccc gaggagatgg
    33241 agaaggaaaa gcattgcttt ggggaacaga ttacctcgtg accctgcgcg tgagcaggga
    33301 catgctccac cccactccga acgcccacgt caatggcgag gtggcctcca tgcccaacca
    33361 ctcggcttct accaccacca tctcatcgat taatggaaaa ggaggagaat caaagagttc
    33421 aaggaagaaa cgagcgcgcg aagcgcgcca ggcgaaagcc agccatgggc aaggggaaga
    33481 aggaggagcg ggagtgggac gggaccttga ggagaagaag gaagaatatt acaagattat
    33541 cggcgatcga ttcaaatcca tcttgtctgt cgggtggctc gttggttcac accagtccca
    33601 aggtgaagaa aggggagagg agggggagct ggaagtaggt gtggtagaaa ggccttgggg
    33661 cgatttcgtg gcagagttgc cgggtgtgtt ctggagtggg tcatatggtt cgagctaaga
    33721 gcccaacggg tcgtcccaag aaaagggttt atggagagag aaaacgggga gaggaagggg
    33781 aagatattat aggttataga tccatgtata agggctttct gcatcaagaa ctggagtttg
    33841 cgacgagcaa tagtctcaaa acgaaggtgc cggagaccgt ttgttcctaa gaatatacgt
    33901 tttggacacc gacagtccac attctttttt acttgtgaga caaccatttt acaacaggtg
    33961 atacaatcga catacatctt ccacgtaaca acggcacaag gtaagctcaa ggaagtttaa
    34021 tttgaaagac tgattattgt ctgggattac ggaacccaga aggagagtac tttgatccta
    34081 ccccacgatt tccgctccca ttaccaccgt ttccaccgta gccacggtta ccaccagcgc
    34141 cagcactgaa acccccgcta cccccatatc catacccatt accataccct tgacctccct
    34201 cacgaccagc cccagcacca gctccaccaa acccaattcc gaaccctcca gcctgcccaa
    34261 cccccggtcc aagcggctgt ctcaatacac ctccttgtgc gcccgaccct aaccctggac
    34321 ctgcagctga tcctgggatc atgtccgttg atgaatactc tccacttctc aacccagggc
    34381 tcccattgtc tccagttgtg gtgggtcgcc ccattggatt agtcggatta gtcggataca
    34441 tcgaattagt aaggtttgtg ggattggtag ggtttggaga gcacccagtc cggacttggg
    34501 atggcacaag acctgcaaac ggcctgtctg tcgttcttgc tgctgaagaa ggcgatggtg
    34561 aagaagaaga tgtgggagtg tatgtgtatg cggaagagag gtcgcgtggg gtatcagctg
    34621 gaaatcggtt ataactctcg tttcgctggg tgtaaccgct ataaaaccca ttccgctctc
    34681 ccatgcttcc cgctgcacca ccattcccac caaaacggtt gttgctgctg ttgttgctgt
    34741 tattgttgtt cccagcattg gtcccagtag cgttaagtcc tctctgccta ccgttaccgc
    34801 ttgtggatcg tcgatcttgt cttctgtctt tatcggatga gttgagagaa agattggcga
    34861 attctgaagg ggaaggcgca ggactagacg acgtggtggc gtttcggcca gcgctgcctt
    34921 gggcagaagc actagatgtg tctgaagcgg caggggcgac tccggcacca aaaatccgct
    34981 cccttgctag ccggtattct tccgccctct cctccatact ctttcccttc ttctccccat
    35041 ttgctccatt accgggggaa ttagagccag aagaggccga gttgggagta cggcgtaaaa
    35101 gttgaacagt aggtgttgga agcgcttgag gggctatgat agtcgtagac ggggtgcgag
    35161 cgtttctgca attacatttt gcagattaga tatgagtttc tcaattttca atgtataaca
    35221 gcgtacgcgg agtcccaaat ttgacggttc gtcgttggtc tatcacctct gaaccagtca
    35281 tcttcgtctt cattcacatc ccctgttcct ttgtttgctt gtgcgagtcc agtcgcactt
    35341 ccataagagg cgccagcatt ctgcgaggaa gaaattgcgg tggatgatac gttcgggcca
    35401 tgaccgacag gactcgccac cttgggttgc ctgaccaatt ttttgggtag gatcacctct
    35461 tgctgtttcc caaaaacgct atcagcgaga ggaaacgaga atggagtaaa gaaaagcgca
    35521 cagtgtcaat ctcccagtca tcttgttcca ctgattgttg ctgattagga gtcattcctc
    35581 catgcctggg tctgctgttg tgcgtgggcc agtatgattg ctaatttcct gcagaggcaa
    35641 gcttttgaag actcgtctct ggagagaaat gctcaaagag cgacttgtta ttaaccattt
    35701 gtgacaaagt cctgacgtgg aagaataatt catcacgtga cctattcgct cttcgcatgc
    35761 aaaaagttca acaagagcgg ccaacggaaa ataacacgat atttcatctt tcatctcttt
    35821 gactcttacg ggtataccaa tacaaaagac cccatcacta tgagacaaaa gagagccaag
    35881 acgtacaaga gggtaatgac cctttacacc cagacttttg gatttaggca gcccttccag
    35941 atcttgggtg agcaatgctt ttgatcttat tttcggtata ctaatgtgag gcactagttt
    36001 cccaggattt gctgctggaa ggagccaagt cagaattgaa tatgcctaag cagtttgtca
    36061 ccgtcattca gggcgagtgc aagccaagta agtcctagac aaccatgtac taccattaaa
    36121 ccaaaagctg attctgttcg cccatcaaca gtgataacgc agtgctgtat ggaggcgctt
    36181 tataagcttg ggaaacccgt acagaggaca acagatcttg ccaagacgtt tgaaagacga
    36241 aaatgtaatc accgaacagc actagaaccg gatgagtgtt tgaaggacgt tatcggtgag
    36301 tcttctctct atcccaaacc atcgttgtaa tgagcttaca gccagatgca ggagctacaa
    36361 acaaacatcg atatatcctc ggcacccaat ccaccactct tctcaccgct atggaccgta
    36421 tccccggttt acccgtcatc cactttaacc cgcgcggcgt cctcgtcctt tccccaccat
    36481 cgactgccac tatccgagag aagaataaag tagaggaaga aagacgtttg gagggagtca
    36541 aggtccttga aggtgttgtt gatggaggaa acgtggttgg tgcggatctt gcgcctgtgt
    36601 cgggtggacc agcagagaaa aggagtagaa aggtgaaggg accgaacccg ttgagtgtga
    36661 agaagaagaa aactccaggc caggataagg aaggggagag taagaagagg agaagggttg
    36721 aggaagagga agtgaaggag gatgagaatg aagtgaatgc ggaggggaaa agaaagagaa
    36781 aaaggaagaa gaagaagact gcggttggtg aggcgattga agagttgaat gctacgaatg
    36841 ccgatcggac ggagaaggcg gttgtttctg atgatagtga tggcagtgaa gaagaataga
    36901 gttttataac ttgttgtata tgtacaatcc cgtttcggac tgatcagact tcttttgcgg
    36961 ttgcagtcgt taccgcgtat gaatagccct catcggaaaa agccccccaa gtcgtgcgat
    37021 atcggtaaac ttgcccagga acggggatgt tgtgcctggc ttatcatttg ttgatttccc
    37081 atttcacctc caatttccca tttcattgca cgattattcg ttttttcctt gcaccgagat
    37141 catcttataa aaacagcaat ccatccgaac gactgctccc gccccgaatc cttgcaacac
    37201 gaaaccaccg catataacag gatgacaggt caacaaacag ctaaaagacg aagtgtgctg
    37261 atgatcggta cgggcggtac catcgcctct gaaacaaccg caagcggtct cgcacctgtc
    37321 agtcatctgt ccgttcagct cccattccca atccactaac ttcactgttc tagcttcgac
    37381 aagacacatt cttccgccgt atccgacagc atccttcgct cacttcccct cttcagttct
    37441 cctccacctc cgtctccttc tcttccccag tcatcaccac ggtcatcgac aagaacatca
    37501 agtaccctaa actggtcacc ccagaactgg atgatgaagg tcgggatgtt gagtatgaga
    37561 ttctggattt gaatagacat atggacagta gtgagatgac gcctgcagag tggaataaga
    37621 ttgcggcgct ggtatatcag aattgggacg ggtacgatgg gtttgttatt ttgtctggga
    37681 ccgatactct ggtacgtctt accgctttct ttgtatacac ggagctaaat actaaatagg
    37741 cgtacaccgc ggctatctta tcattcttgt tcaaagatgc ggggaaacca atcatcgtca
    37801 ctggagctca aatccctctc tctcgaccga gatcagatgg ttggacgaat attctcgatt
    37861 cgctcttcgt cgctggcgtc ttgccttatg ccggtgtggg catcgttttc aaccaccaag
    37921 taatgcatgg taccaggtaa gtctcaatcc aaccactcca atccccaagc tcgcatggcc
    37981 tgatatataa aaaagggcaa ccaagaccag cccaaacctc tttgccgcat tcaccacgcc
    38041 ctgtatcccc ccactcatca acctcaatgt caaaattact cttgactcca ctctatccct
    38101 tgccccacga tctattacac cccccgcacc actcatcgcc ctcaatgctg accctaccgt
    38161 cctctccgtc catatctatc ccggcctcac cggttcactt ctctccgcgc aaattgccgc
    38221 cgttcccact tgcaaagctg tcattctctc agcttatggt tcgggtaact tgcctctcga
    38281 catggagaat ggagttttgg aggcattgaa aaagatggta gagcgagaag tgctggtggt
    38341 cgtcatttca caatgtgcga taccgaatat ttacccgctg tatacccagg gaaggacgct
    38401 tctggatatc ggtgggttga gtccctctga tgttcgacca taggctgact ggattatagg
    38461 ggtcttgccg ggttatgact tgacgcacga ggcggccttt gcaaaactca tctggcttgt
    38521 gtcaaggccc gatttgacat tcgaacagag acaagagttg ttcgagacgc cattggtcgg
    38581 ggagatgtct gtgtaggtgc acttttacat gacgccgtta ttatatttgt tgtttattgt
    38641 tccgaaaact ggggcaggac cagccgcttg cgcaagacgt agagaagcaa gcttggaagg
    38701 atccgccgtg ctcgtactat gaaattgcac cagatccata caaagccacg tggctctcgg
    38761 agaagaccga cagataacgg gtggcgaata tttatacagt tgttcgggtt tgtgtgcttc
    38821 gggaatgagt gcgtgggtac gccgggccct tctgatgcag ttataagcat gtatgcatgc
    38881 atgggatgat atatataccc agctccatcc attcccactc aacagctatc tctcgcacgt
    38941 tcttctctct gctgcgatat ttatcagtga gtccacgcac gcgctgcctc cacccggtat
    39001 catcggccaa tacccgcatc ctttcacaga tatctcttct cctcgactcg atcttgcttt
    39061 tgcctctata tttatacccc ctatccgcca tcgttccacc cctgcatatt ctcccacaat
    39121 gacagaccta gacaaagtac ttgaattact caacaacctt accgtaaagc aggagcagct
    39181 cgcccaagag gtacatccct tatctctttc ttatctgaca tgataaccca cttacccgtc
    39241 gcgcacagct caagaaccat acctgctcat gcggcgcaca gtatcactac gatcctacgg
    39301 cacaccactc gccacctaca tccccaacag ccggtggcgt tgataccttc cgagcgtcac
    39361 gtggcagtat ctccagtctg agcgcattac tcgggtcatc gcccacgtcg accagcggct
    39421 tttctcccgc tcctaacggc gtcgctaata atagcggtgc ctccaatggt tcatccacgc
    39481 catatggtaa cctttctctg gacgctgctg ctagaggttc tggtgcgccc ggtggtctcg
    39541 tcccacctga gaaggatgcg aagaagaagc ataagggtct ttaccccagc agagtcatac
    39601 ttaccagtga gtctactcct tatcgcattc tgttttgttt tgtggtcgat tccttcacgt
    39661 ttccaatcgt ttgctgttgc accaaacctg cccggtggct acgagtatcg gttcatgaat
    39721 gagacacgga gtagcaacct cggattggtc tgagggttcc gaatgcgcac tgctccaaga
    39781 cagctgcttg tatgattccc ctttttgcaa tcggactggt tatttgggct ttcccatcta
    39841 actatattgc aggttcattc tgtgcttcat gtgcctcttt cgctgctcgg caacccctgc
    39901 actctaggcc tatagagggt cacacctcaa aacgagcgag gccgtcgcta acaaaccctc
    39961 ttagcctatc ctagccaagc cggtatcaac ccaatcccta tcaactgggg tgctggtcgt
    40021 aagccttgct ctattgctcc acttggtttt acctcttacc tgacatctct tatcaattag
    40081 cgaccgctcg cgaacgagga cctgtcgtat gctcgcgtat caaatccaat ctccccatcc
    40141 gtaacgccat tggtgcccat gccggttcat attccatcta ccgagcactc tctattgcga
    40201 tgggacagtt gcggcctgac tggaggcctg atcttaccaa tacccatgta agtttgctcc
    40261 ttttgggctc tggaaaagat aaaaaaggct gacccgatat agccaccttt tgttcttccc
    40321 ccgactgacg gttggttcgg caacaagatt gtctcgtttg atccttgggg tgccatgtcg
    40381 caagaagtct gggccaaggt aagtttcact tccccttcat tactccaccc ctccttccat
    40441 ctctaaaacc cttttaaccc ttttatagga atacgccgcc ggcctcgacg ttcgccctac
    40501 catctcccaa accaaagccc acattaagat ccaagaactc gatgaactct tccgcaaggg
    40561 cgaattccca tgcgatggcg aaatcgtcat caagtcaccc gatctccccg ctttccccgg
    40621 ggcggatcaa ggtattgaag tcaacactta caaagctgcc attgaccctg tttggtacct
    40681 tcctggcgtc gccgacagat taggtattga ggaaggtgtc ttgagaagag cgttgttcga
    40741 ggatacaggc ggtatgtacc ccgagctttt aactcggcct gatatcaaga ctttcctccc
    40801 tcccatcggg ggtatgaccg tctacatcat gggtgaccct gccaaactcc aagatcccga
    40861 cactgaagtc acctgccgcc cacacgactc ttgctccggc tccgacgtct ttggttcaga
    40921 catttgcact tgccgaccat acctcatctt tgggatcagc gaagctatta aatgcgccca
    40981 aagaggtggt gtaggagtca tagtatactt ccaaaaggaa ggaagggcgc tcggcgaggt
    41041 ggtcaagtac atggtgtaca atcgacgtaa gagaggaggc gataccgccg cagagtactt
    41101 taacaacacc gagcgtgtag cgggggtgaa agatgcgcga caccaggcac ttatgcctga
    41161 tgtactccac tttttgggta tcaagcatat ccacaacttg atctcgatga gtaacatgaa
    41221 gtatgacgcg atcattggca gtgggattac ggtcgggaag aggtatgaga taccagagga
    41281 actcattcca gctgatggga gagtggaaat cgatgccaag gtcagtcgtt tcatttcctc
    41341 ctctatacat atcctccaga ttatccatgt atctttgaaa tcagcgctga cgcccaacaa
    41401 tagattcagt ctggctactt ttcaaagaaa gaagtcaccg aagagcttgt gaaagagaca
    41461 aagggtcgta actggggtac gtctgccccc ttacctcctg ccattccctt ttgttttcgt
    41521 aaaggatttc atgaacctga cacgtgtttg cagaggatat cattcattag atcaatgatt
    41581 cagtgctatt cccagcagtc gaattttctg atatttatgg tgcggttgaa ccagatcgac
    41641 atttctaacc actcgcattt cagatattta gtcattgtcc tcaagtcaga gagttgtaca
    41701 tacatcgcgt tggttgcgag agaaattgag atagttgtag ataaactcga atgcatttgt
    41761 atgacccata aagtttccgt ggtctattat tggaatgttc ttcatcctcc ctgtggaggc
    41821 ttattaggat tgttaacccg gagggccgcc attaaacctc tccaggtttt ccgtctgcat
    41881 tatcctctac agctaacttg ccttagagcc agaagaagga attcaaagta gtaggtggtt
    41941 atgtgacgag agaagaggta gtgggcgatg tgcttattat ttcacgaagt ggataccttg
    42001 atatcattta gcttgtagtg gcgagcgtag aaatgtatat aggtccataa tagtagcttg
    42061 gtaacggatt actttactct attcaaatct tgttggatac gagagtttaa gtgttagcac
    42121 cagtaaacaa acatttttca acagcttgac tagctcagac caatctttgg gagctctgtc
    42181 acgccaacgg ttccataata ccgctgctgg atcgagcttg atcgtcgtct gtcgcttctg
    42241 cttgttcctg atgtctttta atgaggcgct ctctcgagcc gccacataga cttcccatcg
    42301 tcctttttta gagccattag gcccctgttt cgccaatttc aatttgtccc tggagaatca
    42361 ttagtggtct cctggcaacc gtggccgaaa atacatgcct gaaagtttgt cgcagtactt
    42421 gcctcccacg taacgctccc attggacagg aagtagcttg tgtccgcctg cttctttggg
    42481 aatcgggagc cccgggatgg gcgggatggg aggacacggg tggagagggg cagctgacaa
    42541 cccagtggtc gggggaaccg caacgggcac aaggatgcgc agcagagggt tgacgccatt
    42601 tgcaagaaag tctcgtgtag aaggcagtaa gagtttcgtc agagcggcag acggagacag
    42661 cgagagctgc aggagatgac gacgcgaagt aggatgccgc agcatcaatg ttggcgatag
    42721 tgagttcgat atcggcggct gtcttgcgag cactcccacc gaactgctcg tttcgcaaat
    42781 gatggaaccg ggaagggagg ccgtggaaaa gggcattgac atggagatcc tcccagtcca
    42841 tcttcatttc ctcaaggtta cgacgcattg tccccaagcg acgcattcag gctaccacat
    42901 cgtccccttc gccacactcc atctcaaaga actctttaac ttttgcatag acatgctgag
    42961 ggtcatagtg accgaaggaa cgggagagag caggataaag acgatgagta taattaccca
    43021 ggccatccat ggcaataggg acgaaagttt cgtggatact aggatcaagg cgaagaagga
    43081 tagcgccggc aattacagag tccttggact ccaagatggg atcataaggc atgggagagg
    43141 gaggaggagg tgcagcacca gcagaaacgg tactgggtga ggtgtcagga gaaggaacag
    43201 tcggagcggg tgacagcgga atggcaagcc ccacatcgag gagacgaggc aacccaagag
    43261 taaggaggga taggcgaagt tggcggctgt actgaggcca atcatcacgt ttggcgagga
    43321 tgggaagaga gtcaaaggtc ttgtcaacga ttaggaggaa gttgccgaga aaggacatgg
    43381 tgacgagaca gcggttccct gactaaccag aaggttgctg tctttcaaat ctgaaaagaa
    43441 gtaaactagt tttaggtttc ttgactcttg gcaatttggc agatggatga tggcttggaa
    43501 ttgaggcaag gtaaggtagg gagaccgtgt gtgcaaagcg tggagttttg gagaagcgat
    43561 gggcacggct gttggtttag gcccgcctga tccttctcac ggtaaaacaa tggatcctcg
    43621 agcaatgtag ctcttaactt cgaccacaag gctatagtat tgacgcttgt cgggtgaact
    43681 agacgtcgta ggtatgtgaa gggagcgctt gtggggagag tttgaagtgc ggacagtagg
    43741 agataatagc accggaatgg agatgttgtt gatagatcga tattgggatt tcgacaattt
    43801 tgtcgaactt gctagaagga atgacgagcg tattgcaggg tcgattctaa tgtctagaag
    43861 tcaaggctca taacctgttg aagtctaggt tatctatgat gcataaagga agagaagaat
    43921 atctgaacgc taaatataaa aaacattctc gcttgccctg aactccttcc ctgaacctcc
    43981 accacatcac acgtactcgc atacgtactg ctgcaacaac acgatgtcat ttccttcctc
    44041 gtcttcgaca agagtgctga gtagtcgggg cgccgctgga aggagtagaa ccacgcgaag
    44101 aggaaggtag actctgaaca agagaagtgt tgagaacaag aaggtctaaa gtaatccaag
    44161 aagaccaatc gacggagtcg ccaagactca tccgcttctg gcagacgtcc aagtggtaac
    44221 gaagaacggc aggaaaacgt ttgttcaagg catgaaaagc caagtaaagc tggatgacat
    44281 gggcggagag gtaatgccca ctaccaggct gaacaacgtc gcggattcga cagtacacta
    44341 tccaaggaag gataatatca tccaaggacc ggtatttagt cagagaacga gactgttcgg
    44401 taaaggcaga ggtgatttgc agcagctcgg acagaccgtt caaggcgcga tcgctgatga
    44461 catcctccgc catcttctcg atctcaaggc gacgggtagg atccaacttc cagagatccc
    44521 ggatctcgaa tgtgccgtcc accaccgaat caaagacagt gggagggata taggcccact
    44581 cggcctgagc atccatcttg gggagaggga cagcgttacg agtggtggcg ctaggcgcac
    44641 gattcgaaag tacggggggc gcggaagaag atggaggtaa agaagagacg agaccaggat
    44701 aagaaggaga ttcgggcagc acagaagagg tgatcggaag aagctcattg gcaagacgtt
    44761 ggtccacata gttgcgctgc tccaatacct caatagtcaa gtcctccacc agtcgagtaa
    44821 gtgtcgccaa ggcctggtcg gtggccgaag gagggggagg ggtgggatcg gaaggagtgt
    44881 gggatggaag ggtagtctgg gaggttgagt gatcaacagt gggggttgag ggaaagggag
    44941 ggtccgagct tgtgttgccc aactcagcgg tgtcactgga aagcaaatca ccagtaatct
    45001 gggcaagagt ctcagtctat ggctcaggga gagaacgggc attatccgcc cagcgagaaa
    45061 taagacccgc cttatatgtg gaaccatgaa ccgtgagccc agcctcggtg gaggcagagc
    45121 gcaggtcctc cttggttgcc gtggtgagga aggcggggcg gagggactgg ggcggagtgc
    45181 tcataacgac aaaaagcaag ttgctaggta gaaatataag tgacagtgat gaagatgttg
    45241 gaacctaaac ccggcccaga gacagaatca gttcttgaat cagttgaacg atagaccagg
    45301 gacaggcact caactgcacg gaaccagcca cacccattcc tccactcgat caccccggct
    45361 aacgctttag ccgccctgag tatttcatac cattgatgcg agtggctgtt tcctgtccgc
    45421 gaaacgtgaa ttcatttgcg aatggccaaa tttacacgat tgtcagccct tgttgtgtac
    45481 taaatctcac ccttgagcat ccttattatt tgcatctatc ttcattgatt caaagccctt
    45541 tccatacata tacatggtca cgaatcaccc agcctcagac attataggcg caccagacac
    45601 accaccaaaa aaagacattt gttcgataac ctagttgata tttccgaccg acgatcatca
    45661 ctataattta atctgcggca cgagcaacca tccgtgggtt tgccaggtcc atcttcaaac
    45721 aattgagcaa ttctacgatc gccaagctga gccgtgatgg cccagcccaa ctccgcccca
    45781 aagcatgaac gcggcgggaa aaacagatgt tgctgatcag gacaggccag attttttttc
    45841 ccctcttgtc ctatcaatcc gagtggcgtc atttgcgtca gtaaaacacg acttcattgc
    45901 gaaaggccag actcacacaa taatgacaca gttgattgga tacctagcac gcgcacggcc
    45961 acgaagagca ggaaaagggg accatcgaac gcccgtaacg caattttgct cgcgaggtat
    46021 tgctggcgac tcaacttcat ctcatggccc agccctgggc tgacaagtgt aggtcagccc
    46081 agtagatata caggggtgtt gtgaggtgcc aggcggctga tgagtcgggt gtacggcggg
    46141 tgcttggcag gtgtatgtct ctgatggtgt gtctagtggg cctctagtgt cttagcctgg
    46201 gtgattcgtg accttggata tgcatccaaa ggtctttgaa tgaagaagag atcaagtacg
    46261 aaaaggaatg gaaacacaaa gtacacgcca cgtaaccgtc cgacgcacca gcctccttcg
    46321 acgcacacag ccttgatgag ctcagaccat cggccactgt accatggacc gcgttgcgat
    46381 gtccgtattt tgtgcccccg aaataaccat caatatggtc cagaataata ctgtaacgta
    46441 cctatatgat caatatggag attaatcttg gttaatttag ccgattgtca cactgcagaa
    46501 cctttcacta tgtccagcgg cttgctatta actggcgcag ttgcttcaat aggataaact
    46561 accaatttca agaatatgag gataatgaat attgataaaa taggtacgtt gtggtgagga
    46621 agattgcata aagcccaggc gatcctaatg tctagcaatc tcgttcaaaa ttaaatacag
    46681 accatttgta agcataagga cgtggtggaa gactgacgag aacgttgagt acgttacatg
    46741 aatatgtatt actgcaagct gcatggaaca atcccttctt tcaactgtac agctctttcg
    46801 tttctcccca caccctcttc tctcactcgc ctccttttat cgttctctgg aatacccgtc
    46861 gttattcctc gatcggtccc cgcttgtatt tcctccccga gtgccgactg ggtaatctct
    46921 agaaggtact gaagaagcag ctcggtccag aagttggtcc agtatccctg taggagtcgt
    46981 cgtagaggaa gagatgccgg catcatccga tgatgccgct gtggcggtca aaccaggttg
    47041 aataatgaag tccactaccg gggtcgcccg gctgtcggtg gagggtgttc tatcgccgag
    47101 gaagtatctc tccagctcgg tcatattacc ttgagggctt gaggcagtcg cagagctact
    47161 ggggagctgt acggaatctg gagagaaaga agaggaggag ttattattgc cgttattgtc
    47221 atcattgtca cccaacgagg agttgttata attgttattc cggccactca tgatgattct
    47281 taggagttat ctggatataa acgtcgatcg tggtgccaag ctaagctatt taaaccctct
    47341 agaggactcc ttggagcctg tttacatgta attatatcta tggtaggacg acgacaaacc
    47401 tcggtcctta ttcaaggtga aaggagacca aacaagttgt cgggcgactc gcttatttag
    47461 gtgtatagcc atctccgaaa tcgagtcgtg ttataaagaa gccaaacaac cgaaggagag
    47521 taaaaaagct cttttatacc gactccgatt acattagtgt gaacctgaat aatgtaacac
    47581 ggcgtcacac ccataggtat catacccgta ggtattataa taacaaaggt gttttacaag
    47641 tgtctcttct cgctctccag ttaagatccc cgaatttgaa aacacttttt ccagtgtgga
    47701 catccacaac ttctttcatg tactggaggg ctttgatggt ttctatcgga gtcatgagag
    47761 gagtttgtac gaggtgcgct tacagttgat gtggcttgga agctaaatag tgctttatga
    47821 agaagattta ttcgctctcc agaattgtga aatatcctct ataatccctc gagcttttat
    47881 atatagcccc caaagccgct ttgttagggt agctagcagc tcgattactt tacaaaacat
    47941 agggaagaat atgagggtta cgagtactgc atagaccata cctttcattc cctttgtgca
    48001 agtttggtct acatcccttt tttcggtctc tgaaattgga caagctgttg ttgtgctatc
    48061 taacatgatt aacatgatta acatgattaa catgattaac atgattaaca tgattaacat
    48121 gattaacatg attaacatga ttaacatgat taacatgatt aacatgatta acatgattaa
    48181 catgattaac atgattaaca tgattagcgt cgtagggggc aatctcagat cgggaccggc
    48241 atttcccata aaatcatgcc atttagaagt cagcattcag ttgtccacac gcctcatatc
    48301 tttcatctca acttgaaacc ccccttcctt cctatattcc aagtacgcaa acgtcgtccc
    48361 ttcactgtag gtgtaagaac aagcgagtag ccagtcagtc taaacatgaa gtctacccaa
    48421 acttcagcgg aaaacgaggg ttataaatcc ggaatcagta catttttacg ttacccaact
    48481 cagctatttt ccggcggaat ccctttctca ctcaacaaca ataacaacgc taacccttgc
    48541 cccctcgtat caggtcgcaa agctggaaag ggcagcccca acagcgctat tgaccatttc
    48601 ccagcaatcg ctttcctcca accaacgcac ccatcaaaaa tcccaacaca atcaccctcc
    48661 acctccattt cctccttctc agcgactctt cttcatgctc aatggacttc ggtcgggaaa
    48721 atttgatacc ggcaaacatg aggaacggca atatcttctt ggctaaggag gaaatggggg
    48781 gataacggag ggatatgaga ggttcgaatc tagtatgaat gggtcagcat gtgcactgag
    48841 gagttgggaa agaacttgca ggtatgggat ctcaagtacg gctgctccgc ggtgattaac
    48901 atggtttgcg ctacaaccca tgagggaatt aaaagggccc acctttgtga tgcgtgaatg
    48961 cgttaaagcc gtctttccca tggtatgaac cccatccact cgcgcccacc cctccaaatg
    49021 gaaggttacg ggcaaaagtg gccatagcaa agtcattcca agtcgcagaa ccactcgtcg
    49081 tctgcgaaat aactaacaag ttgggttgta agtgagatat cagaaagtca cttcgaagtc
    49141 tactcacctt tttcgaagat agatcgtttg ccggcacaga cgtataaagc aaggggctta
    49201 ggacgcgcgt tcacatacgc aatagccccg tcaatatcct acctgtattt tcagctttat
    49261 ccttcattca cttagtagat gagattagac ccacttcaac aggaatgata gccagaacag
    49321 gaccaaaaat ctcgtccacc atcacgcctc cctcctcccg ttccccattc tcgtttagtc
    49381 tgataaggga tattcccatc ctccttgttt tctcatccat ctccccttta tacacgagct
    49441 taccctccat ttcagctttt tcgatgtatg atagttgccg agagaaatcg gcgggggaac
    49501 gaagaaacga ggagccggat ggggagctga gtagtgattt agaggaaggt aagggaggga
    49561 agagctcatc aagtctgatt gtgcattaga gttgactagg gggatggtga aattggacgt
    49621 acgtggactt gcaaacggag ataaattcgt caaccttgtc cttgacgcaa agaacataat
    49681 caggggcaac taagaatggc atcaaactgc agcttgcaag gaatatataa aaaaggggta
    49741 aagaaagggc ttaaagggct taccgcatat ttggccaccg gtcatctgct tgatgctgaa
    49801 caatcttcta gctgcaatct tgaagttggc atctgacgcg acgattactg gactcttgcc
    49861 accaagctag aatgttcatc agtcttcatt atctccggaa gtgcacgatt gagcacactt
    49921 acttcgagag tggtaggggt gagcgtcttg gcagcggctc cagcgacaat cttgcccact
    49981 ccagatgaac ctgtgtaaag aactacagct gatcagcttt ttctccattt ccgatagatc
    50041 aatagctcac tatgtcccca gggttttacc agtaatgcct gtgactgctc cacttctcca
    50101 aggaccgcga catacccctc cgggtcgagg tactttggta gaagatcggc tagaagggca
    50161 gatgacgtgg gtgagtgttc ggaaagtttg agaatagcag ggcagccggc tgagatggct
    50221 cctacgagtg ggcaaagaga tagttgccat gggtagttct accgaacatg agatcagttt
    50281 tgccgcaaag agagggttgt acgagccagc atacccatgt actgatgatc tgcagttgga
    50341 agtgaactat cagcaattct ctaatgacac caaaagagtg actcaccaag gcaacccctt
    50401 tgggctgctt tttcacccgc gaagctaata aagtcaatac aaaacctttg ctcgtccgat
    50461 aactcacgca tcgccttcat agatagaatt gcgtcagcag tgcggctctc atccttcatc
    50521 caattctcca cattcttaac tgcaagatca atctcattca acgccggcca caactgtgca
    50581 tacacttgtc agcatgcagt gtcgggtaac tgggttatat aattcacata cctctccaat
    50641 agtcacgtca aaaggtcctt tgccttgatc attctcaact gctgcctgaa taagcgcttc
    50701 attatcttta ataagataag ctagttgctt gaggttgaaa agcctgtacg cgagagaaca
    50761 ggtaactcca gagtcgaagc gtttgttgac ggtatcgtag atctgttgat ccgagttcga
    50821 gttcgagtta gcgagattgc ttagattgct tagagcgaaa gaagagctga cctgttcaat
    50881 ctgcgggagg ggtgttggag tatgctctgg gaaatacata tccatgaact agctccaagg
    50941 aataggggaa tgggttgata tagattgatg ctgtgaaaat ggacaacgag gacacgaaat
    51001 acccagcagt gcgatgcgta aatcacgatt ggcatggatg acggagatgc aagtggtcga
    51061 tccccgtaag tgtgtaaggg tggccaatgc ccgccatcaa aaggcccttg agggggtttg
    51121 gtgctattcg ttgagcagga tgtcgcattt gctttactct ttttgtgact gttgatcgtt
    51181 ttcctaagta cataaaatgc gaatagacat cggggctagg ctcttacagg tgtggtatct
    51241 gacttagcat ttctaaacgg tttatgctga tcgttaggcc gtggatagca ggccggactt
    51301 caaaaaccct catgggcacc cgcagctccg atccaccggt cattcttcga cttgacaagt
    51361 taacaacaac gtagtatcat cattgcaatc caatactagc agatccgttg gcagttaata
    51421 tctgataatg gaacagagaa tgggaactgc gattttgtcc gtctgtcaag gtcaagcgca
    51481 gcgccgagaa ggacaaagga tagtataagg tgagtatcaa aggatcgctg gagtgactgt
    51541 ttatttcgca tgcttggaaa tgttcgccgc ctgcgccaga cattgttttg tcctcaagtt
    51601 ctaagctgta tgaacaactc tgcgccactt gatctacctt cctggtccta tacgatttga
    51661 attttcatta ctaaaactac cccattcaat cactcgcact tacctagcca gacctctcaa
    51721 gctctcagct tccagatatt agggtagcga atcttactca tactgacata aaatatgggg
    51781 acacgatgaa gcgccgctct gtttttctat cgcaccatga ataccagctc gtcaacccat
    51841 ccatcttact cggggctttc tttctagctg cacacgccat acaagcacaa acatccaacg
    51901 cgacttgtac cttgacagct agcacccaat ggatgtttaa ctctgatggt gattccccct
    51961 ggtatgttgc tcgccccttc acatctacag ccgaccgaac taattctttg tcattagcct
    52021 gatatggtct agaatccagt ctttatgttt attatcttct tcatatatca atgtgccacc
    52081 attactggac tcatcatggt cttacaatgc accgacagag agtagttcgg cttgtttgtg
    52141 taattcggtc tcgtacaatc ttatggtgag tcgttcgtta tgtaaccatc tgggagatag
    52201 cttatgcgga tataataggc ggcatgtaca tactgccaat ggaaaaatgc ctcgatcctt
    52261 accgaggatg attggtcttc tggatgctcc tcgtatacat ctactgggta agcgcaactg
    52321 ttctctctat ttctctttcc ccgctttcag actataggta cgctgacgac agacactcat
    52381 catctagtct cgggttcgca gaagcggttg agcaaatccc tatatgggcg tttagaccct
    52441 cttcaaacga tagtggggcg tgggacccat ccgtttcaag cgttacagct gcggctaata
    52501 cgggttcatg gaccacgaca ctttcaagaa gctttgcgga tgccagtaaa accacagctg
    52561 ggaatccggc tgtgacgact gcgagagtaa acgtgagcgg aagcggggtc agtgaaaatt
    52621 ccatctgggt ccaaaatacg ggcactgaga ctgcttcttc cacctctact tccaactcga
    52681 actccacttc ttcttccgac aaagacggcg acagcaatga ttcatctacg tcccactcca
    52741 tccctctcgg tcccgttata ggtggcgcag cagggggcct catcggattg ataatcctct
    52801 tcctcctctg gagatggtat gtcaacagcc gacatcgtct ttccaacccc tattccccct
    52861 cttccacttc ccccggtttc ggcggacgga tcaagaagga aaagcagaag aagaaaaaga
    52921 ggatgtcgta cccttaccca gccaatacca gagatagctt ggttgcttcc cctcctgtct
    52981 ttgctttagg cggtggggtt gggggagatg aagaaagagg acaatcgaga gggagaagtt
    53041 tcctagatat gctagtcggt ggtaaagggg atgagagcgg aaactggaag ggacagcaga
    53101 gggatacggc gctgtacagt gatccgacga cattcgctga cccgaggaaa gcaccggagc
    53161 cctattcggc cagcccgatg aaatggcgaa ccacaagcga acggttaaca ctagaaacag
    53221 atttatcaga ctctgagtcg gcttggagcg tgagcgacga tggtggtgag gatgacggtc
    53281 gaagaaagaa aaaaggaaga tggaaagagg cgtttatacc ttccatcgca atggcagcag
    53341 aagccaagaa gaaggcagat agaaacaaca ggaagctgag cacgtatacg acgacatctc
    53401 aacaacgctt gacaagacgg acgttgacgc cttcagaaat ggaagaagac gagggggcgc
    53461 ctttcccact ctgcgttcgt ccagaatcaa ttctcacccc gattccgagt acgaagacac
    53521 agcccctcag cactgtgtca catccaggac ccaaaaactc caagccaacc acaaaccaaa
    53581 ctccaaagac aagccaaagc aaccggcaac tgctaacctt accccccaag caacctcccc
    53641 cggcgcacct cccgcctcca gccccagatg aagctcagtc gctctcgctt ctgtcacctc
    53701 ttggtggcag agtagatttc tcccaaccac cgtccatccg acgagaaagg atctcagaaa
    53761 atcctacgct accttcgttg tacgaacctc ccacaggggc taggacgtat agggcttcaa
    53821 gagggtcaga gatgttcagt cctggttcaa ggtatatggg gactatctat ggagacggtg
    53881 gggatgaaga cggtgctaga ggcggaggag aaggaagaag gttcagtgaa agtacgatag
    53941 ggaccgcgtt agggagcgca aggtcattca aaacgcgaga tggaagggga aggtggagtg
    54001 gggagagtgc acccgctttg ccgacgccca agccgaggta gatttcaatc tgttattcag
    54061 atagggatga tccagagtga aatggtcatg agcgatatag aatattaggt tttctcgtcg
    54121 ataatacctg ggtcccttga cgtatgcaag ggtcgcgtat ataccgtttt cacgtgcata
    54181 ctcatgttca tgcttatcgg agcgatttct ggtctatttc taccaattca tgctcacgct
    54241 tatcggagag atttctggtc tagtctacta aactaatttg tttaggaaaa tcgtccaaag
    54301 attgccaaga gaaaactagc ttggatgtaa tggcttgagg cctttttaga aaaggaaaac
    54361 ttggtcctcg agcttggaga cgctcctagg agcagggtaa ccgatctgcg cgaggtggcc
    54421 cctattgaaa catatgcgtc aacagttgtt catccattct tagatcttgc tgcggagaac
    54481 tgaggggaag gaagttaagg actcacttca tagcggtgat cataggagga gggccgcaca
    54541 tcaagacctt gtgaccctca ccgtgattag cagagccaac accggaagaa ggcatagctt
    54601 cctcaatcat ctctttggtg acgaaaccaa caccaccagt ccagccctca ggagggttgt
    54661 taagaacgta ctgattgaag agtgaaggtt aattttaatt cggttcaatc tgtagggcgg
    54721 gataaagggg agaaaagggg cataccttga catcaaaacg gccgttggac ttggcttgta
    54781 gctcgtcaat ttccttcttg agcactgtgc cccgcatcag tgatatcctt gaaaagcgag
    54841 gaaaggtaca gaacatacag atgtcatctt cctgaatgtt ggcgtagatc aaagaaagcc
    54901 tggtcttgtc gccgggagtc ttgatagagg atttaataat ctggtacatg ggagtgatac
    54961 cggtaccgcc ggcaatcatg acaaggtgag gggccatgtt ggggctgcgg acaggttagt
    55021 gtcaagacat tatggggggt agaataggca tacgtgtaaa caaacttgcc cttaggacct
    55081 ttgaccttaa tttcctggcc gatagtgagg agagaaaggt atcgggagat gttacccttc
    55141 tcgtatgtct gttgtcttta ttagttgctt gcgtcgttac gataataggc agcttgacga
    55201 accttgacaa ccaagtcaaa gtgtcctttg tcgtcatcca aagtggtggg agtgtaagat
    55261 ctaacaacct gcttgccatt aatctcggca gcgacagaga tgtgttgacc gatggggaga
    55321 ccgagagaat cagatgctcg gggaagggca aatcggtacc tggtcacatt agagagaatc
    55381 agtgcgagaa gattaaaatc gcaagcaaaa gaaacgtaca aagcagtgtt gtgggacaag
    55441 tgatccttgt caacgagctt gaaagacctc cactcaacag ggtcaagtac ttttctgtcc
    55501 ttctctaccg atgtccagaa caacgcgtca gttcagttcc tctattccga tcattcagac
    55561 gcgagaagtg ggagagaact gaccctggaa gaagatgaaa aggccgagaa tagcagcgac
    55621 gacgagaccg ccgaggaagc tggcatgagg agcaagcttc tgagcgagaa cctcgatggt
    55681 gaacatgatc ggatatcttt cacgggtctg ttatagaaat gtaaatggga aatatcggaa
    55741 aacgatgaac gggaggacaa ccgttgggga aacatgttgt gacgtggaac ttccttccga
    55801 tgtagccatt catttctttc cgcgatgatg ttaaatgtta aacagctcga acagtaccat
    55861 ttcgagatct tcttctagag agaccccaaa agggaatcta tacgaaccga tcatgattcc
    55921 gcgaagcttg gtagaacttt atggaagggc gaaccatgtc atacagcgta tacttggccc
    55981 ggaacaaccg ctgtcggagg ccgaagagcc aattcttcct aggtcgtcat catcttcatc
    56041 aatggcatca actcagcagt ctacaccctc gtatcgatct tcaataaacc aaaatctcct
    56101 tcgaaactct ttcccaaagg ctctttatcc atttctatgt gtatgggtcg tgatttttat
    56161 ctggttgatc cgtcagcaat actattattt tacgcctcct cacgacctca tttcttgcac
    56221 ggcttcacca tgggacgatt ggccccctga taactgcgga attaatggcg agagatgcgc
    56281 ggacgacttg acatctttgt ctgataggac attcagatgt atgagcggat gtaaagttac
    56341 caggctagga aacgagaggt gggttggtaa tgagcgtgtc aatggcgtgc cgcttgttat
    56401 tggtggcggg gatatgaacc atacgtaccg gtaagcccct tgctctcaca ccagtctatc
    56461 gacattaaca taaccttcgc agagcggact cttggatctg cgctgccgcg atccactcca
    56521 atctgatctc ctcttctctc ggcggatgcg tcaccgtcca tcccttacca taccctgccg
    56581 gccattccaa ctttatctcg tctgccgctc atggcctcac ctctacagca ttttctcaat
    56641 acttcccagg cgcgttcacc ctttcacacg ttatcccctc tggctgttgg gacttgcact
    56701 ttattgtcat gggcgtcaac gccgtctgcc tgctcatcct caccctcttc ctccgtcctc
    56761 cttcttctct cctattcact atcctccttg ttctgggata tttccaaatc actttattta
    56821 gcgatgtccc acatttcccg ccagactggc aatccctttt cggcggactc attcctgtgc
    56881 tgatcacagg ctactggatc tggaaacagg ctttcgtcat cactctcctc cattttcgcg
    56941 acgcaccatt taccttagcg ctttggcagg gcgcaggata ttgggtaggt gtggagagtt
    57001 caacagtctt tgccaggttt cccatcagca ggctcgggta tgacactctt actccatctg
    57061 gtcttctggc tcttgtgatc atcgtggtcc tgatccacgt tgtcgtcgga taccaagcgc
    57121 tcgccatgcg taagcagggt ctactccgat actacctcgt ccgctatctc cctttcatac
    57181 ctatccttct catcctttcc aatatcccat cttacaccct tcgactacac cattacctcc
    57241 ttgctctcct cgctatcccg gttttgtccc tccccaaccg acttagtttg gtgttacaag
    57301 cattcatgct cggtttatgg ctagacggcg ttggaagatg gggttgggct agtttcctcg
    57361 aaaagacttc ttctgtacgt ccatccctct ccgctcttcc ttctcttttt ctctatcttc
    57421 aagatcttgg acgcaaagaa ctaaccacct cccctatccg tctttctttc ctcctcccac
    57481 agcttctcgg cgatgccccc tctggctcat ggacacccac atttttcgcc aacctcagct
    57541 cccctcatac cctctcctgg tcacccatca cccccgaaca agctgcggag gatgtaaccg
    57601 ggtactccat cttagtcaac gatatgcagg cgtttgctgg atgggtgaat agtagtaagt
    57661 gcagtgatcc gccttgttct ttgcgtgagg attcagattg tgggacttac gcgctgtttt
    57721 ttcctccttc tttagcaatt gatttgaaag gtgtactgcg ggacggggtg aattatttcc
    57781 gtatcgccgt acgtccaccg tcttggcctc tctttaacgg gtgtgcaaag gctgaccaga
    57841 tggaatagta cgagaagaat ggaatgtcaa tggactttag cgaccccatt gtccgatgga
    57901 agaatggtac atggggaggc atggaagagc ctgtagatct tttttagagt gtagactact
    57961 cctgtttgtt gcgcatcatt atttgggatg ttgtattcac attgtatgaa caattcatgc
    58021 atatattacg ttttcggtcg tgtttgcgtc aacttgaaca gggtacttac cttctcactt
    58081 tctcttcgcg tctcttatcc ctgtttctgt catacactcc cctctcctcc aacccccttc
    58141 cgttgacggc cgcgactctg tcaactctcc caccaactgc tcataaacat catccatatg
    58201 ctgccatgtg gcagcaacaa gtctatctct cctccccgaa ctcagatcca caaactcctc
    58261 atcaatcgtt ggacccacag gcgccatcgc ccggttcacc caatcgtgtt tcgacgatgc
    58321 agcagagatg acgggaatat caaggtaaaa ggtgatatca gtggggcgtt ccgtgtcttc
    58381 ggcgtaatat ttcaacggaa tggggcgata tgatctggaa ggtctggaag cagcggagat
    58441 gggggctttg tcgcaatgag aggatgaact ggctgtggga ggagccggaa gagccaataa
    58501 tgtcgattga tcattctctg cgtaagaggc tccattctcc gccatccact tatttactct
    58561 gtcagcagtt gctcgatcat tgtaaatctc atcgtcctcc ccgccatcct cgcccggcgg
    58621 taggtcgccc atagagatac gtgccgaagt gccattctgg aagatgatga tcgttttgtc
    58681 atccactata atattgattt cgtcctggtt gcatttcgaa gtggactgct gctgagatga
    58741 tgatgggcaa cggtggtgtc gtcgagtaga ttggcaatgt tctttctcgt cactgtacgt
    58801 cttgcgttga cttccccgag gtccggttga tctttcgccc ctgccatgtc tgctccttag
    58861 gttatccgtc ccaacatcat aatcattagt acgctgatga tgcttcctcc ggtgttcgct
    58921 tgtagcaggc gggtaaccat gtggatctcc accttcatcc tccacctttg cagtctcttc
    58981 aatccccatt gacctcgtgc tggctttgtt gtcttccatc cattcccgtt ctctcgtatc
    59041 acgaacaggt cgaaaggagg gagcagtagt catgggagag gaaccatata cccctgtaga
    59101 gctacggcgg aaggtacgtg gtatttggaa acgctggtga ataggagtac gtctaatatc
    59161 ggagttgata aaagaggagt atatcgaact acgcctacca tatccgccat cccaagctaa
    59221 aaaatgttca tcattcaccg ttcttcctga gttgattgga ggagggagat cacggtaaaa
    59281 cgccgatcca ccctggcgcg ttgaaacaag aggttcagta cttagtcgtg tagtggcagc
    59341 aaagcagcgg gggtcattac agcgtgggtc tgaacaaggg ccgcttggag gacgacttga
    59401 gagtttaggc atggtggaga ctcgagagat tggcctgagt cgacaacgag ggtcgcggca
    59461 tgaagggtcg gtacacagtg atggcgcttg ggttgtacat gcagggtcgg tacagttagg
    59521 atcggtacat cctacacctt gggcgactct cagctacatg aatttcagaa taaatgacaa
    59581 ggaaatctca ctggtataag gccattgcgt tggacgggaa actgggtaat aacccatgtt
    59641 tttcgatgcc agatacaggc ttttctggtg aaagtctcac tcactagatg atgtgggtaa
    59701 atcaaatctt ggaattccct ccttatatct tcattctccg cacatacaca atgacccatt
    59761 aacaaaagat actgcatctc acaatactct cgcccccctt tcgaccgcgc gcttgcaaaa
    59821 aattcagctt ccgagacaaa gggtgtggta ccacctctca cactgccttg cctgaagatc
    59881 ggaacggaga tggaatgtga cgagagtccg cttactttat cgatcgattt cgaagtaaat
    59941 gggaaggtac aggcgagtgg atggatgttc gtcaatggtt aacctttccc aaacagtcgg
    60001 caattgataa acgaatcacc aagtgaagaa gaggggaatg gattgctgcg ttttcctgca
    60061 ggtggaattt caatgggagt ttgatttatg gggccggacg acggtgatga tagggggttc
    60121 tggacggcat tacaccgaga aggagacaga acacgatctc ccggcgtctc ttgttctgtt
    60181 caatgggcat ggtcggtttt gactagggct atcgtatcgg tagagcctgc agcagctgtt
    60241 ctagaatgcg agaagagagc tcgctgattg cgaaacctgt cggttgtaat tgttcgaagg
    60301 attttgtgga atgaatcgaa taaaaaaagc gaagttgcgg aatagggaaa aatggaaaat
    60361 gacagatgaa tttcgagagg aagttacaac tagaacaatt tgcaacacca tctttgtcta
    60421 taagggccat aacctccatg aaatcaacta tacatcctat aaaaaacaag ctatgtagcg
    60481 cagacggcat cttctcaaaa atcacgtctg cttctacttc ccctagtcga tctttccctt
    60541 cgtctttcag gcgcctttcc actcccccaa gtttgctcat catcgtcctc gtactcttcc
    60601 gccacaactt catcctgtcc ctgcctggat ctctcccgag ttatgtcatc gtaagcccta
    60661 ttcagagttg cttgcgtaca gtccacaagc cattttaccc ttctttgact taaataatga
    60721 aaatggcttt caagtgttgg aaccaccgcg tccatggctt cgtcgatcca tgccgatctc
    60781 gatggtaaag gtgaatccga aggcatggac aactgaaaag tttcgtcctt atcgccctta
    60841 acatcatctg cgatatacct gataatgaat gttttcattc tctcagaagg tctcgcgcca
    60901 ccttcatccg ccgacccgct ccccatctcg ggctcctggg tgaacctttc gttatttttc
    60961 atccactgat gaacgctctt gtagttatat ccaccactgc cagacatgga cgattccggg
    61021 tctctttgca gtggtcttcc gggggaatct cgagtacgtt cattgctccg cctgctaaac
    61081 ctgttttctc cgtccattgg catagtcctc gaacgtagac caccgggggc tcgccgatcc
    61141 ccctctgcac ggctgccttg aggttcccac gtagtcgctc tcggtaaact cccactacca
    61201 tatggctcaa ccatgctcgc cctccgactg cgattcctcc taggcgtcgc cccatcacct
    61261 aacctattat tgcccagcct gtacgccaaa tcatcccaat cccgatcagt aacctcggac
    61321 gatctacgcg cactgtgacg acgagggata tatgacccac ttatgggttc agcctcggtc
    61381 gcagtaggcg ggatagcgtg gccgctatat gggtaaaaat ctaaacctga gaagctccca
    61441 ttacgtgaga agcgacttct aaccccataa gatcgcggag gagggctgct gaagaacgcg
    61501 tcagaagaag ggtgggttga gaaggtgcgg aaaaatgggg gtcgagagaa aggggaggag
    61561 ggagctgcaa tactatagca tgttgggtct gtacaaagcc ggtctccaca cgtgggtact
    61621 gtagttcacc cagttagcag ggttacactg acatatacaa tgggacggta tcacctctag
    61681 agggaaagta actcatactg ctctatcttg ggactcgtta tcagcttgca gattggattt
    61741 caatatgtaa ctgccaccta ttaaatccta tgcaaagaca cacttttgat agtccctccc
    61801 cagcatctgt tcaacactcc gattcttctt ctccgagctt ttcaaaagaa catcacaaag
    61861 cattcatatt tgggacggct cgcttagagc acaatcattg tcagtccgga taggtaaaat
    61921 gaaagggaga attccatcat aagcctaggc cttccttttt cctgggctgc tgggaagaag
    61981 acgttgaact tgaatgtgtc agattcggat gggatcttcc tatcactgag tgcttttagc
    62041 acctttgtca actatcacag aaacgctcat tattagcttt agacataata acccgcacaa
    62101 cgacttggca catgggaggg aggacacatg gaatggtaga cgtaagacat ataggcatat
    62161 atatgcattt cccaaaagtt ccagctttgg gcaaactgca gattgaataa gccatgtatc
    62221 acagaaaaga aatgatgctt gttgattgct acagtcgtcg tgatcatcac agtaagatga
    62281 gaaaaagtcc ggcatcgaat gccaatctgt cttttggaaa tggcgttcct atgttgctga
    62341 cggttgatta tggaaagcgt gatggatgtt gataattggt tgattaacat catataatca
    62401 tcaaaaaaaa gaaattcttc tatcctcttt tcttcgtcct gccttgttaa tgatcatctg
    62461 caaggtaagg tgatacaaga ttgaaacaga tggattttaa ggttgagctg tagtctcaga
    62521 agcagaaggg atctccagct tcggaggttt gacccaacga acagtatcct gggagagcag
    62581 ttagcggata ttctagctcg atggaatgtc gtctcgtaag acttatagct tacccatgcc
    62641 cagtaacctt tgccgagtcc atctggccag tcatggcatc taattctctg tggtgggctg
    62701 ccaaaaccat ataagtaact ttctcgttaa gcaaaatgat gcaaaaacta ctcactttgg
    62761 gttccaccaa atagtttccc catacgaatc ctcctctgac ggccattcga cccaacccct
    62821 cagcatcgca tcccccttcc catacgtcgc atgcacccca ggaaccaccg ctatcctccc
    62881 aaacccatat ttccaaaagt cccacgaaat gaaggaactc tccgacgcct gacattccca
    62941 gaaatcattc gtgcgaggtg tacctcggcg gaaacggacg ttgtatgggg ggaggaaggg
    63001 ttcgggagac atgacggtga taccgttcca agctgcaaag acttggaagg ggaggagacg
    63061 gttgtagcgt ttgagtgttt cgggtgagga agggaagagc tggtttaagt gtcaattggt
    63121 gaatgtttcc tgtgaaaaaa taggaatggg catggactca ccttttgggg tagatcctta
    63181 tcctcttctt tgacagggaa cggcgtgaac aaatctccac tcatatctct cgcaacccat
    63241 ccatcataga accacttgcc cgcatgatcc catccacaag tcatatctgc atcctgtttg
    63301 aaatgctgat gcatcaattc caaaaagtgc gtcgccgaaa ggtatacatc gttataaaac
    63361 acgatacctg cccaaggatg gccgtcggga gacaaacctg tcgccgcagt gtcatagaac
    63421 ggctgcatac ccgaattgcg catctgcgcc aagagctcga tacgatggtg gttatcccaa
    63481 tctacggctg gaagctgggt ttggatgtgg atgttggaag ggggcacacc gatgttgaga
    63541 aggtgagtac gcatagcata tgcgaggatt tcaccactgt gcaaaaatga ggattttagc
    63601 tagctctagg tcgcagtctg tatgtgaaga cgtaccttcc gtctgcagag tcaccctcga
    63661 aaagcgaaaa gacgagtgat tcggggccca agaagtcggc gaggacagtc caggcatgga
    63721 accagtcagc aagcatacct gcacagattc agcgcatgcg ttttgcgaac ccacgtatga
    63781 attaaatctc accagcaact tgacggcata ccgtcactaa aaaccatctc cgctcgggcc
    63841 ctctcaccca ttgacccgta ttctcgtcaa acacatccct cagatgtcta tacctctcct
    63901 tcaaatcatc tttgagaaaa ggaggaaata tcggctctgt caactcatgc tcccggggca
    63961 ccgatggtgt gcgcgacttg atctcccgca gtagaggatg caaaaactcc cacgcttcat
    64021 ccaatgtcgg taaaggacct tcgatatact ctggattttc tggatctgag ccgggtttaa
    64081 gacgccgtga tctaccagga tgggttggcg ggggtaatgt ggcattctgt ctggtaagaa
    64141 taggacgagg tacgcgttgg tctgtccgta attttggagt gttactccat agcgaccatc
    64201 cttttcgtga tcctggagaa accgttctcc catttccatg gcggtctgac cagctcgacg
    64261 cgtcccatgc accgtcgtct tctccgttac ctagtcttga cagtaacacc aagccgatca
    64321 acaggcttcc taccagcagt actctgacta ttggttttga taatgctatt cgtagccttg
    64381 agtttgacat gtttcgtcct cgtgctttga aattggtgtt gaagaatgat gaagaggaga
    64441 gaggcgttcg aatgtgaggt gctcgttggg acgagatgta ttggggaaga gactcttttc
    64501 gtttcggtat gtcgggaggc atcttggagg aaatttgaat gggctataca gccatgaaga
    64561 ggcagccgac tgaccgacta tttacgtacg taatttatgt tgacaatgtg atgggattct
    64621 atctgggtca gaaagaggaa cgagatggaa atcggccaat aatagcggtg ccgaggcgta
    64681 atcgcggcta atctgaatga accgtataaa tgttcaaatc ccacacaaga tttttctata
    64741 aatgcgatta ttgcatagcc actcggcgtg agtgcatggc aaaggcaaca aggcaagagg
    64801 cgaaactgct ttcgagattc tgtcccatgt cctcctgcta tgtagacgca cgcaataggt
    64861 tatcacgcta taattatgga agctgtgcga gtatgcgacc gcgcgcggca atcgtgaata
    64921 tagaatatgc tgcaagatag gagttcacaa gtcctttcct ctagcagaca aaggtgcgca
    64981 ttgtgttttt atctatggcc tttgtttcga cctgggaact cggggcatat caattatact
    65041 aataaaaaga gctcaactaa ccccaaatcc ctcaaacaaa tctcgcactt gtcactactt
    65101 ttcaacatga atcgcccaat acagttttcc gttgagtccg tgcgtccccg tagacgtaat
    65161 ccctttagtt tacaaacaag gacacgccgg acaatatgag ggaacccagc agatagaggc
    65221 aggaattttg atggaaaccg ctcagaccta ctgcgctcgg ttcgcccctg gcgatccaac
    65281 gatctttccc gacgcagcaa tgtcgaaaca tcagacgaga ccctaattgt ggcagtagat
    65341 ttcgtcactt atccgaacta cctggccgtt gctggtggcc cctcactgga agatttgaag
    65401 aaccccttcc cctatccgac aactgaggaa gtcagtcagt tttcaagcac atccgcctcg
    65461 aattataatg gggaaaacgg tgcagaatca cttgggcagc aaagcttctt tgttccaatt
    65521 tttcttgaaa gtgacttctc ccgctctgac tttactggca gtgagacgcg acgtaatgaa
    65581 aatggagacg acgcagatac agtagtccaa atccgctttt caaccaccca gacaggtaac
    65641 actgacgcat tcatctcgct ttgcccgtca atccgttcag aatacccaga agtcaaccaa
    65701 tggatggaga tggtatacac ccaaggtggg agaggaagtc aagacgaacc gatagggatg
    65761 gatgatgcaa tcgatagata tcttcaaccg aatacggaga gccgaaatag tgtaagggag
    65821 ctggtgttga gcgctttgga tgagtcacac taccggggtg cgacgatttg attctcttct
    65881 cagcccttac cggctccgag gctacttatc cttccccttt gacctacacc ttggactttg
    65941 cctaccaata acacattcaa catcttttct tttggcaaat ctttacatac tttcaattct
    66001 aggacccgat tctccacctg tctcatcccg gccttgtgag atatttcgca cccaatgacc
    66061 tcttcaactc gtcgagtttc cctacgctct atcaccgaga tgaagaaaag tttgtcaaga
    66121 gtcatgcctg acggcttgta gacggtgcta atctaaagca tgaccttgcg gctttccctt
    66181 tactaaatac aattaaaaat agcgttataa agtagtcggc gtcctctcac gtcctcccct
    66241 caccaacatt atttggtaca actgtgtatc atcatcgctc tcgattctca ccagtaacct
    66301 tcttcctcct cagagcaata tccttatatg gccaaggtct atccagaggt agatgatagg
    66361 gtgcaaattt ctctggatct ggcttcagcc tatcccaaag atcaaaccat tcctcatcaa
    66421 atccttcctc gtgaagcttt attacatgtt ttgagagagg aataaacaaa ggtgtgagat
    66481 gacgggtttc tcgtttccca gcactgttta ttgttgcgaa tgggaaaata cgaggattgt
    66541 cataatcata tggaggtata gcagcccatt tctcgggaac gcaatgttca cgctcccaca
    66601 ccttcagggt acgcatcgag aaagttaatt catcttcagt aacagcgggt cagtttatgt
    66661 tcgggagagg accgatattg aaagcacact gaccaagata agcctcccac tggatcagtc
    66721 aagtcagccg acttgtatga caggcgggaa agcaaacaaa ctgacttttt tcaatatcgc
    66781 acccactctg agcatttgat ccccatactt gggttctgct ggattttccc atgccttcaa
    66841 agattcctgg agcccctcga aaaagatcac agcctgcttt gtcaccgccc aagccttgca
    66901 gtactccttc cgctccaact agaatccaat gtcagtatga catgacggct gttatgttcc
    66961 cttgttcact gtacaggata gaggaggaag ggatgtgagt acgcaccgtt gttccatcct
    67021 ccaatgtgaa gcgcataaaa tggtaatcgg tgcgctcagg gtctggatca ccagcaaaat
    67081 aataatactc aatacaagga ttgtcggtac gcaactcgcc atttgtcttg atccttgccc
    67141 attcgaggga catttcggta tcgaagatga atagtggttg attcgtgtcg taccatagct
    67201 tgtattcttg gtaaaagacg cgagtactgt tgtatatttt gtaagggatg ctaacaatag
    67261 aggagagagt tgaccagaga gcagactgag cggaagatcc gcttagggtt gacattgatt
    67321 gtgcattgat tgtgcaggag acgatgtcat gtagaagaag atttggcttg gtaattccag
    67381 ataacaaaga aggagcggaa aacaaaggag gccgggaatg atgtgacgaa gacaacaggc
    67441 ttgttaaaaa ggaaaggatg gataatataa atatatacga gccggacaca acaggaggac
    67501 gagtggcggt acagcgcgga acgcccaaac ccaaacccaa aataaaaaaa gttctcaaaa
    67561 agtcctgaaa tttcggccag agattcctct cgtcgagaac atacgtcctc ggccccgccg
    67621 tccgtctccg tccgtcatct tgactccctt tctttcaacc ttcttccttt cgaccaacat
    67681 ttttctgcac tgggctccta tcccactgat gggtcctgac agggaatgct agtgcacacg
    67741 tgggtgagag aacatggtga aatcttgcac gcaacgacgc ccaaccccca atgagtggca
    67801 gcaatatata ataatatctc cacgacgaac tttctcttgc atccgtacaa ccaattatca
    67861 ctctgacttt gcctctttga caaagaaagc tcataaagca ttcacatatc tgacgctagt
    67921 caccaaagcc ctgcacggat aacgatttca aacagtaata gtcgtaacta tcaaagatgg
    67981 aaaacgcaag gacaaccaat gagccgggac tgcctattac tgtctcggag gaatcctctc
    68041 aagttggggg gtgcctgccc caagcagaaa ggcggccaac acacagaatc aagctatttt
    68101 atgtgtttgc aaagtcgaag ttttcgtaga gggtgagtat ctgcagtcaa cataacctgc
    68161 acgaaatatc ctgtagctga tggattgctc aaagattttg cagagctcta tctctctgtt
    68221 ataagtacgg tcacaatcgc cgtctagcag taagtaattg tttatgagcc tttcatcaaa
    68281 ctataagtaa tagtagtgag cgctaaactt atataaacgc ctacagagaa acgtcgcatg
    68341 tatggctcac ttccccaatc ctggcctttt gcactgtaaa gctgattaca aggtgcagaa
    68401 gagcgaggca accagggcaa gccaataaca acacgtcaaa tcagcaaaat cactcattct
    68461 atttaacctt cgtttgggtg atgaacgttg tgcagaccat tgtatctgca gtgtatgcca
    68521 ttgtaggacg ccatgagcca acatgcaggc ctgtatattt agccttaatc ggtgagtctt
    68581 ccagctcaac tcgaaagaat tgcagacgaa tacaaattga atgcaattta gctgttacac
    68641 accggacaaa cagtaatttc atcccgctct actattctgg gggcgacccg ctgacaggta
    68701 tttgctgtag cattgacttg ctaatctggg gcagaaagta tttgttcagc tacatctata
    68761 tggccgacaa accgtcaaat gttacagtga agatcgtttt ccctggtgat agtgagtaga
    68821 atagtgattc gttgtaactg agtcgaacaa ggaatgctta tgcggactaa agccgtcgtc
    68881 ccagcaaatt tctctgctga ggtttgggca aagtgttcgg atggcaaatt tatggaatcc
    68941 ttggccgggt gagtccggac tcctttatgg ctgagcaaca ttgactgagg gcgctgtact
    69001 acgtagagta acccatactg gaaccggcga tttcgtttgg ccccatgtgg actgcggact
    69061 cgaaaagcca ttgcttggca tcctcaccgc gcaaggccct ccctaaaggc aaaccccaag
    69121 cctagaggta cgcatcagat ttgtcttgtg gtgattgtaa tcattggtac atgatagtaa
    69181 taagcatggc gtagaatccg gcatggcagc atgtcgagat gtcctggact ttctcaacac
    69241 tcaaggcatg gatgctataa ttggcaccat gatctgcagc ctacgagaca aacggcaagt
    69301 catcgatcac tcctcgttcc gtggtcaaca ttcaacagtc ctccgcctgc cctcactacc
    69361 atcgctatcg tcactattgc cattgtattg ctaccaccat catcaccgac catcgcttgc
    69421 tcatcgactg cttctctcct attacgacta tcgtcccgac tttccggcat caaaattacg
    69481 ctctagaagg ttccataaca gatttcccca gcttctgtac acgtatatag gcgggtgtta
    69541 aacggattat gaaatttacg gaatatgaaa tttatgaaat tgttgttagt gcctccagtt
    69601 gtaatgtcat gcattccggt ctttagttgc gagatcccct tactttcata gtttgctcat
    69661 gcaataataa ccagattttg ctccccccac ctcttacctc cttctgattg ccctgtccag
    69721 cctctgcctc cctcttccac cttgacagct tatcctaatg ctaaaggata tttgggtcta
    69781 ttcaaggtct cgttaaccct cgataaacaa gtatcacgaa atgcgagaaa tagggaccct
    69841 ccctaataaa gctttatgct ctctctctct ttctctctct ctctcttctc tgggccgcgg
    69901 tcaattgatg agaataatca ggcgcacctg ttattggttg ctatttagta tgtattaaat
    69961 gtagctatgc atttctttat acttatatcg ttgtcctcct cttgtcctcc gttgttccta
    70021 atatgctaga tatgcaggtg ctgctgatta ccccttaatc tctcagcacc atgctcccca
    70081 tatcgctaca cgttgcacgc tgactttcga gctcaggttc tagtaatacc catccatgtc
    70141 gttgtcatgt ctgctcgcgc ccaatcattc gcagatgctc atgatgttct tcttcccaga
    70201 caccgagatt gcctaaaagt cagggctatt cgcctcctcg agcaaggtat catcaatgaa
    70261 atagaacaaa gctgcagcaa tacctatact gcagtcaagg ctagctacat ggtcctctag
    70321 cacaaactaa tggaggtcaa ccttgcggcg gggaacaaac tgacagtagc aattgccgga
    70381 tcatacgtac gtagcccgaa aagaagatct cgtcaaaatg agagtgcgta tcacaacgta
    70441 acagcgaaat gtcatgggaa atattcacaa taaataagac cagtcataat gtaacgaacg
    70501 ccatcaagct attaccataa tctcggtgtc tctcttgctc agcatctatg ctatatcaca
    70561 tcaacagtca tgtcacttcc caagcatatc tccacatctc tttcgcagat cgatcaggta
    70621 cgtgatagga cttttcctcc ttccatccgt cggtcccgcg tctcgcgctg tcccttatga
    70681 gctgactact gtgtctgaaa gctatatgat accgttaaca aacgcttcaa ttctggtgtc
    70741 acccttcccc tcgcttacag gctctataac cttaagcagc tcgcatacct tatcaaagat
    70801 aatgaaaccc ttattcaagc ggctatcgag aaggataatg gtaaaggccc gttcgatgca
    70861 actcttggcg acgtaagcta cctcattatc aacgattatt gttaatggaa cttgagctta
    70921 cccactcgag aatagatatg gccaacactg aatgagattg atctcgctgt aaaaaatgta
    70981 aagaaatgga tgaaagatga gagtcgaacg ggagatgcga tacttgcaat gaaatcgatg
    71041 cgtgagttat tctcgaggaa gaagaagatg catacactga cttcaatacg gtttagcctc
    71101 acgagtgaag aagcagccca agggtgttgc attggtaagc tacccttgac atcctgagcc
    71161 tcatcgacag cgctgatatt tgaattcaga tcctggcaac atgggtacgt tcttagccat
    71221 atccccattg atatccccat tacaacacaa ttgtttacca tgacctgtcc tcagaactac
    71281 ccctggcagc tcgctctctg tccgctggta ggagccatct cagcaggctg cacagccgtt
    71341 atcaaaggct ccgaacacgc acctacttcc tctgccctct tggccgacct cttgccaaag
    71401 tacctcgacc cggaagggta tgctgtggtg cttggggagg tcgagcaggc tcaagctttg
    71461 ttggcgaaac cttgggggca tagtaagtgc taactccaga gagatgacag tggatgaagc
    71521 agaagactga tgtactatag ttctttatac cggatccgct gttgtaggca agatcgtggc
    71581 tgaagctgct gctaagacgc ttacaccgac aactcttgaa gtaagctttt cacccaccag
    71641 ctttcccctt gcctgaatct tactgacaag gtatcttagc ttggagggaa gagtcccgtg
    71701 attgttgcat cggatgccga cctcaagata gcggcaagaa ggatgttcag tatcaaacag
    71761 atgacgggtg gtcagatatg cggtaagccc tccatgaaca cccactcgta tcaagccacc
    71821 acctgacata tcactatttc cagttgctcc cgattatgtg ctatgtgtga aagataaagt
    71881 ggacgaattt atctccatat gcaagaccac gtaggttccc tttccccgct ttctttttct
    71941 actcctccca actctacgtc aactgtagac tcgacgagtt cttccctcct tctccttcgc
    72001 ctcaatctct cctcaacaat caatccgcat cttccttcct ccgctctccc gccgattttt
    72061 cccgccaact ttcttacata caaaccgccg aaaaggctgg taaactagta tacaagggcg
    72121 agatggatga gcagacgaaa agaatgggga tttcgttgat taggctcaat gaaaatggtg
    72181 aaggagagga aggtggtgta atggtggatg aaatctttgg gccggtttta actatcatac
    72241 cagttgatgt gagccttatg ccctcccatt tttcttactt gtgagaatac ccaagctaat
    72301 gaagtgaata gagcattgaa gcggctatcg cgtacgttaa cgcccgtccc aaacctctct
    72361 ctttgtatgt ctgctccagc aaacgatccg tcttcgagga tagtaagctt tcttgaacat
    72421 tatcgcttgt ctgttgccct tggaattgac agccgatgct ttatcagtca ttactaagac
    72481 gactagcggt tcagccacat ggaatgactt tgggatagcg accttatcac gtaacatccc
    72541 gttcgggggt gtaggcgaaa gtgggtgggg atcgtatcat gggaaagacg gtttcaatac
    72601 ctttacccac cataaaggtg agcgctctct ccaacaccct tgtcacccaa cgtgcattac
    72661 tgaactgtac tttttgtcct cctaataaca gccgtgttag agataccata cttgtaagcc
    72721 atcccctctt ccttcatcct tccttcttcc cttctaacaa gccgcatatt aaccctcgtc
    72781 tcaggtttga acccctcatg tccctccgtt acccaccaat gtccattctc gcgaagcgta
    72841 tcatgccatt cctcatgttc agtggcattc atttctcgcg acccaagtct gtcgagcacg
    72901 agcaacgagc attgagaagg aggaagtggg ggtcaaggct ggtttggttt ggggtgattt
    72961 tggttggggc tttggtaggg gggaaactga tagtgggaaa ggggtattga tcatccccta
    73021 ttttttgatg agccctgctc gttcccctcc ccaaaaaatc tagctaatgg taatccagtg
    73081 gtaatctctt tcaatgtatg catactcagg ctgttgatta ttgattgtcg atctcaaaac
    73141 atttcgcaat tctaagacga gagcaaagta tggcttgtcg atcgatgcag gaaatgatag
    73201 ctgagcgtta cagcgacgag cggacgtcga acctggaacc tgagcgagtg cctcaactgc
    73261 atcgattgct tacgtaaatg taaattaggt aatatcggtc ggtgccgcgt tttctatgca
    73321 tggcccacaa caacaataac acgagaacca gtgagatgct gccagcagtt gtttaattac
    73381 tttcattacc actaccgtca ttgttctatt tatcattccc aaagtggcct acagcttgcg
    73441 gcaactgctc acagctacat ggagagcagg atgtcccagg aagggggcca gcctggcgcg
    73501 atggggtcca cgtcggtccc ccgctccgta tccgtctcgg atgccatcac attgttcgaa
    73561 caaaaatctc gatcctcatc gacatcaatg tcaagatcat catcccgttc agtcatctac
    73621 atgaacacaa catcaagccc ttctgggtct ggtaatgcgg tcaagtctga atcacggata
    73681 aaacaccccc cgagatcccc gtccaacaca gcggtatcaa tatcgggtga tgcgcagccg
    73741 cagttggcgg aagtcagtgt gtcgagcaaa tcccgtagca tggatgttgc cagtgatact
    73801 ggagaggcga atgagatcgg tgtaaggggt gtgccgacta tccgaccaca acgttcggcg
    73861 tctcgcccaa tggtccccaa gagggtagca tcaaatacat ctgccacgac atccgcatca
    73921 cggactcctc cagcatctcc cagaaatcat ccaggaagat caatatcaaa cgtatcgtcc
    73981 agctcttctc gagcatcgct ggcaaatggt agtgcatcaa acaaggccat aggaataggt
    74041 ataggtgtcc cgagcacagt taggagcaga gatgctcgga gagcaagcga tactgccagc
    74101 attcgacctc gtagcccgcg cacctcctac attgcaccca atcggcagcc attcccacat
    74161 agtataagcg ctccacgcag cctcagctct caatcgtatg gcgtcgaaca tgacgatttc
    74221 tccccccgct ccgagcgatc acagtctccc ttccatctcc aacctgccat atctgtatcg
    74281 caagctaccc ctgagaagct tctcccacct ctgtacatgc aatcctcaag gtcagacttg
    74341 ccgaggcgta ctaatgggat acccatcccg ttatctcgac ataccagtat ctcatcgact
    74401 cccagcgcgt attacacgcc accatcatca aaatccccca tgtcatcaga attagaacaa
    74461 aagggggagg atgtgactaa aagctcgatt ctggatggat actttcgcaa ctcattcgga
    74521 agagactctt cattcggacc tgaacccata acattagcaa caacacttga gcagacgaga
    74581 tccgatctgt cgatcgctcc agatatggat cgcagatcta gtgccatgga attgtataga
    74641 cgtaaagatt cttctggatc aataagtgag tccttatctg attatcttcg aacggtcctt
    74701 gaaaagcaac tggctgataa tagcatcctt tgtagcctcc cagaggtctt ccaaaccact
    74761 tccgtcttta gatgtacctt tgggtgatcc tattaccatt gcttcacctc agcaaatacc
    74821 ggcagcccct gctttgcacc acgccagcct gacgtcgtca ttgaatgttg gcacaatggc
    74881 gagtaaccct gaattgacgc aacctcttcg cagtacaaca cctaccgaat cgcaatcgca
    74941 accacctccc cgcaaatcac cacgtaaacc gcctcctccc aatctcggta taacacctcc
    75001 aaatccagct tctctacttt ccacccccaa tccgtcagga tcagctacac ctgcagcaac
    75061 accacctgtc ccactcaaga gtccattgag gagtatcagc ggaggatcct cggtgacttc
    75121 ttacaattca tattcgtctg ttgagattcc gggagaaatt tctgtcgaaa ctggaatagg
    75181 gctaggcttc gaagggaaac tgggacttga agtggaaggc aaggtggaga aagtgaggag
    75241 agtgaagaag cttgcttcga tggattccat cattgccaat gctggtacac cgctcacaag
    75301 ccaaactcga atgacacgcc tcgtgtccgc cacagcagat gatcatacgt cccaatcgcc
    75361 ctctcaaaaa gacgtgaatg cactgaagaa gccggacgac gcacgtttca ccatgctcac
    75421 agcaccttcc atttactcgc aagactcggc tccatcttca gctacgagct cggctgggtt
    75481 gactgatagt ccgacagaat ctacctccac ggcagggaag gctggaagtg gaaacgcgtc
    75541 ggagagtact aaaggaagtg gaaggaggag gccgatgtcg ggagtgttca cacaaatggc
    75601 ggttggatgg ggaaagatga aagaggagag ggaaaagaga aaaagtgttg atctgggcaa
    75661 cagcgggcat cgggtatgtg caacgttttt gtttggacga agtctgacgt gatttacaga
    75721 gatcgtcttc tcttcctcgc ccaaagttag tcttgccaga tgagggattc cttacttctg
    75781 gtattactac cgagtctccg gatactgccc acaccaacgc ttcgagcact acagtggcct
    75841 ctaacttttc aacccgtcca acattaggtc acactcctct gtcgtctgtg cctccgtctt
    75901 cccttggtgc gagaccaaca gaccgatccc atggcaaatc accgtcactc cctatccttc
    75961 gtcgttatcc tacttcgcct acctccactg atccgacctc caaaggcaac tccatccctc
    76021 cacctagtcc tcgacgagct gaaacctcaa ccgccctctc ttctttcctt tctccatctt
    76081 ctacgacgtc ccccgctaca tcaggtgtca gcaaacgatc acaccttttg agagagattg
    76141 ccacatctga acgagcatac gctagagatt tgaagctggt gagagacgcg tatatgtgct
    76201 cacattccca acagtttcga gaaggatcct tatcatccat gtcgagctct gcctccgtat
    76261 caacttccga ctctgacaag tcaaagcggc gatcaatgta catgtcccac actcaaagtc
    76321 tcagtgtcag ccagacgtca agcacgcaac gtgaagcgtt acctaaaagc cccagtgaag
    76381 gaatgaacct tactcttcaa gcggcgccgc ctgttggggc aatgtcccct ccagtaggta
    76441 aacctctttc accggccgat gtcaaagctg tatttttgaa ccttgatcag ttggcggctg
    76501 tggctgagga gctggcaaca aaattcgagg aagctgtggg agaggatgag gaagagggaa
    76561 gggagtgtga gggcgggagt gatcgtatgg gagaagtttt cgtttctatg gtgcgtagtg
    76621 gtatggaaga ggttggatac tgttgacatt ttcgatcagg taccgaaact ccaacccctc
    76681 tatagctact tttgcgctcg ccaatcgtca gcctcgcgcc atttaatgac cctccaatcc
    76741 aatccttctc attttacata cctctcacaa cgctggtcct caatatccac tcaaactcgc
    76801 gcttggaatc tcgactctat gctcatcaag cctgttcagc gaattaccaa gtatccgcta
    76861 ctgtttgaag acctgttgaa aatgacaacc ccagtgcatg cggattattt caagattcgg
    76921 gaggccaagg agatggcaag aggtatggcg gtggagattg atgaagggaa gaggaggaag
    76981 gaagctgtcg agaatgcgat agggaagaag aatatgatgg ctcagccgac agtgaaggat
    77041 acaaaaaatt tagtcagcaa gactcaggga tcaaagctcc ttggcttgaa gaggttccgt
    77101 aaagataaac cgagagcccc ttcgtcatct acacccgacc ttgtatcccc tcagcaaata
    77161 gctcagtctt cgctcaacca actcagcgag ctgtctgcca ggcttactgc tcttgatgaa
    77221 ggagttagga agattggaca ggagattatg ctgtggacgg cggccgcaaa ggagacattt
    77281 gtagcccagg atgatcttgt caaaacgtgg ctgcatgtcg tgcaacttga acctaccgac
    77341 ccgactgacc agaggatgtt ggagatgcga agggttatcg acggtattgt gtcagaagcg
    77401 tggggagggt tggtacgtta atccctgcgc gaaagctccc tgtaaatgct gacggtaaat
    77461 tagaatatgg aggttgaaga cctgataata ccgatcctat ccaatcttct caactccacc
    77521 agcaacccac gcagagtcct ttccaaacgt tccgctaagc accctgatta tactcgctat
    77581 cacgctttca gagtatcgaa gcgtacacca gacagagata ttgtgcaggg cgctctggag
    77641 tttgtagctt tgcatgagca gttgatcgaa gagttaccga cattcttaga aggatgtctg
    77701 agaattttgg atattgctgt tgtcgggttc gcaagagccc aggcaaaata ctttcggacg
    77761 acgcgagacc ggttgagggc gtttgcagag ggatggattc aatcgcctct tggtgccagt
    77821 ttggccacgg gcgggtcaag tggggaaagc aatgtggtag caggggcgga tatagtaaaa
    77881 gcgtggcaag aaagttggga accttatgcg gaagccatgg ataagtttga gtgcaccaag
    77941 gcttgtaatt cctcttcttg tctcaattct ttccaaagtc gctgatatcc gtagcattca
    78001 aaccagccaa gttgaagcac aaagattccg cttatcgagg tgatcttcac cctcctgggc
    78061 ttcgacactc tgcttctacc actagcgcat tttcaccacc atcttctcgg cccgaaagcc
    78121 ctgctttcag cgtacccact cgtgtacggt cgtcctcgct ccgcgattca ttcaccaccg
    78181 ccccaactat catcacacct catacatcat catctacgtt tgcaagttac ggtagtcaag
    78241 cattgagtaa agacagccag agtgcaggcc gtttcaatct ccttcgccga tccagctcaa
    78301 agaacaacac caacgcgcct tccagacccc catcccgccc cactcattcc cgtcgtggct
    78361 caggccttcg tcctgcctct ctcgcatcgg acagcagtag gttgtcttgg ggcctacctc
    78421 agatcccagc cgagggggcg ggcaaaatct ttgactcact tgggttttcg cccactgact
    78481 ccttttcact catgtcagcg acatcaccga cttcagcatc tagcagaatt gaagaaatgg
    78541 ccgagaggtc gcctcatttg ggggcgagtg caccagagtt tagcagttta aggatgtcgc
    78601 cttattcacc caacggtgcg tttgtgggcc aagtgcccat gcctaagcac ccttttgctg
    78661 taagcccggc cagtgaaact tgttctaggt ctggatcaag ggccgatgca agaagaatga
    78721 aagggggaga gattgatgtg gcagaaggct ggagaaatga aaaggttatc tatcaatgtg
    78781 cttgtgttgc cgacttgtaa gtgatttagt cttccctgcc atataagaag ctaaatacgt
    78841 cgacagcgag ccgattgagc tgggaaacaa aaagtacaga ggtctttggt tcttacccat
    78901 gatggtgggt gaccttatcg agtgagtttt tgccctgctg cacgccttgc gtattgagag
    78961 ccgactgacg ggcgttgatc tcagtgtatt ccatgaagtg ggtcgtatcg aagaactgcc
    79021 ttctttcccg tatcccgaag tcggcgttga gaatgatggt atcctcgttg gacgtgcaga
    79081 gaatggcgag attggcttgg tgatctgcag ttttttggag ccgttaaggt gaacggatcc
    79141 tgacttttat tcttcttgag aagatgaaaa acattaaaat cttgtctttt tgatttgtga
    79201 aatagcatag ttgtattgta tacatttgta gcatttgggt ttttgtaccg gataataaga
    79261 cctttagtca ccaaagtggt atgactaaga gcttgttatt agagccatat gcatagtctt
    79321 gaacttgctc ggcattattg ttatcgctcc cgcaggtctt tatcattcgc catagtgctc
    79381 aagaaggccg tagaaagctg tagccatgcc acctaaagat cagagtaata tatgcattta
    79441 ctgtgacatg acgataatgt gaaggaatgg tatagagaac gtaaaaataa cgacaactaa
    79501 gaaatctatg tctatgatct tatatgcgta taatctttca taatctacgc atcaatcgtc
    79561 gtagacgccc acgcagctct tccattactc tgtcggatac cccactgcgt ctgtcccggc
    79621 catgctgccg ccgcccgcct atcatacttt tcgtaccctt cttcatcctc atcctttttc
    79681 gacaatgtgg gcattccgag ggatcgtgag atgaagatgc tgtacaaggt catgtaaaag
    79741 ttgatgaacc aggctactgt gacggccaga catccgacta cttggatgac cctattgaag
    79801 gagctaaacg tcaggctttg tttcctgatg atatatatat attatggata gagagaaggc
    79861 gatgggatgc ttacttgaac gtctcggatg gtagttgagc gcctaattgg gcagtagcca
    79921 tgaagaagcc agtcagggga aaagtaaaac tccaccaccc catcgaccat tcgactttac
    79981 gatcgagtgc ctgcccaaag acccagatgg tcagggtgga gaaaaggata tagagagcaa
    80041 gaccctagac atctttgctg ttgagattca tccttctcat cggtattcaa ataaaacaag
    80101 tgaaacagca tgacgtacga ggagggtaaa gctgtaccat acactgacga cttggaatat
    80161 ctggcctccg tttgaagatg caagaatgtt gctagccgga aacgcgtcga ccgcgagatt
    80221 accgagattt aagaacgcta gaacgaatag ggtcagcatg atgatgatga taaatattat
    80281 cttgaccgaa actgaactca ccaaaggcag taaatcctgg aggcccgaca gcgatcaagt
    80341 acccgggaag ggaagagggc ggtgggttga cgcgaagcat gttcctcgcc atccacacgg
    80401 agcatttcaa tagggagagc atcatcccca ttccttgtag ccagtagctg atgatgatga
    80461 catagccggc ttcctggagg ggcagtttgt tggcaagcgc actgccaatg gttccggaaa
    80521 gcatgagcgg ctatagtgag gctttatttt tcagttttga agaggtgtca aaattatagg
    80581 ctgtatttga tccgactcac gaagaacagc aaacagtctg caggggttat agtatccagc
    80641 ttacgctgat gtccccgcaa tgtacattcg aggatcaatg cgatcgccag actacaccct
    80701 atatacatcc agtacaccac gtacatcgcc ctcgtcaacc agaacccaca gtgaggcact
    80761 gcatagtcca taatcccgac aaagagcgtc gctaccgcca aaaggataca ggggatgtac
    80821 gtcccatccg aatggtcgaa gaaggaatct ttgaaatttg cccagtggaa gactgcacgg
    80881 caagccacgc cgatgacgtt gatgaaaaag acaacgaggt cgatcatgaa gaagacggta
    80941 ccgatctcgc gttggccgtt gaacggaaat tggacgccgc ctacgaggat ggcgacggct
    81001 cctgtaccca tgttgactgt gaagcagctg ataccgtttt tttttttcag tcagcactgg
    81061 atccttcctt ccaagcgatc actggggtgg gcagtgacgg aaaggggcga ggggacgtat
    81121 ggcttacttc caagtccaga attcacttct ggctatccat cccctcggct tgtagttcgg
    81181 atcattgacc ttttgtgtat caaggtcatg acctttactt ttttcaagtg cggaatgatt
    81241 atgatgatgt tcgttggtat gcgttcgctc tggtgacctt gattgtcgag cggacattct
    81301 acgttgggta tatcttgatc ttttcttccc tgtcactttt gccgttggaa ttgattttta
    81361 gactgaagtg atggattcgc atgtatctcc ttgttgtctc tggcgtcaga gttgtctttt
    81421 atacatttcg tttgtaacga catgaaaaaa gtcgagaaaa tgggtaaaaa tgacatcaat
    81481 ctcggcataa aaactgggtt gatctacgct gtgaatgacg tgtggaatgt ccgacggcct
    81541 tgttaaagag gggaggggat aaagtgtgtc gtcatcgctt ggcggacgcg gtggccgcct
    81601 tgttctccac ttgcgacagc tgctcctact cgccaccccc cccccgccac cccccccgcc
    81661 atgtcccccc gccccccccc accaggcaag gcccgcctgc tctactgcaa agcccacgtg
    81721 gccatacacc ccaccgcgtt caagggcgac aacgtccccg gctacctcgc cctcgtagag
    81781 ctggacgctg cggcgaacga cgacgcgcag aggcccggcg tcgcgggcga gggcgtactt
    81841 gtcacctggg tgccggacca ggtgctggcg cggatggacg agcaggacag ggaggggtac
    81901 aggcgcgtcg gcgagcttgc agagggcgac agggaggagg acggtgagtg tgtgggcgtg
    81961 ctgggcatgc gctgactggg acgcagggtt tgtgttcgtg tctgtccccc cgccaaaggg
    82021 cgaaaagtat gcattctccg tcccagtgac cggtatctac agcatcctcg tctatccggt
    82081 gcgtcgcttg ctttgcactg gggagacggc tcaccgcaga cgcagcccag tttgtcccac
    82141 tggtacggct cagccactat caagtaggtt ttatcccaca cgggcacacg ctgaccgcga
    82201 cactccacag tcttaccggc ggcgtctccc tccccacgct ctacttccac gacgacgagt
    82261 ctccgctgct cgcctcgccc aaccccagcc tcgaaaacgc cacacccacc ccccgcgccc
    82321 ggtggggatt cccgcctttc ctatccctgc tcacccaccg tgccgtcctt gtccgctcca
    82381 aactcgtaca ctcgcgccag ggcgcagaac tgtggctcgt caacccgtcc agagccgatc
    82441 gagaagtcca tgaagcaggc gtcgacaacg acgagcccga acccgacgtc gtcccctcgc
    82501 tcaaaaacaa gaaaccttct ccacccacca actacccgcc taaacctgat tacccagccg
    82561 cctacccgca gtttgacagg ctggacacga cgaaccccaa acaggcactc ctcacttccc
    82621 tatccaacct gaccaacctt tcgcgccgca aagcatccca gatcctctcc cacccgctcg
    82681 cccagcccgt cgtaccccac ctcccgccgg ccgtacgttc cctcgtcaac gtccccggcg
    82741 aatgggaacg taacggtcaa tcgaacagca aatccctttt gcaaaaggga aacgatgtgg
    82801 cgagcgaatt cgaaagcgcg agattgtact tggcgaaatg ggcaagggtc gtggccgaag
    82861 aaggcgaacg tgcccgtcga tctgagcttg ccgcccaagc ccgtatccgc ggatcgcgct
    82921 ccggacttac ccctattcca agggacgacg acgacgtgga agacctcggc tcatcgctcg
    82981 gcgtcttctc cctcctccct tccaaagcat actccaaacg gcccgttccc tcgcctacac
    83041 gaaccccaca agaccccatc acattccccg aatgggaaaa atgggcaaaa gaaggcaaag
    83101 acgagctgtt tgtgcgacaa cagatattta ggagggggtt ctccgatatg gagggtgata
    83161 agctggcgag gagggagggg tgggaggttt tgttgggcgt tgtgccctgg tcggtcggtg
    83221 ggtttggacc gggtgaacaa gctgtggaga agagaaaaag ggagagggag gaaatgaggc
    83281 agggaaggag gagggtgtat gaagggctga agagtaagtg gagggcagag tttggggacg
    83341 ggagtgggaa tgaaacttgg aaggaggaat ggcatcggat cgacgtacgt cccatgtctt
    83401 tttcacaaac caaaacgcta acggcgggac acaggtcgat tgtaggagga cagatcggaa
    83461 tcaaccgatc tacgcagtcc ctactacgcc gactgtacct cgagcgttgg gggaagagga
    83521 aaacgggaga aagagtgaga agggtgaatg ggaggatgat gaagaggaag gaggtatggc
    83581 gagtctgaac cgtgagtcct tccctccatc acagattagt atgtatcagg gactgatgag
    83641 ctttttcgct ggatatatca acaaaacagc acatatcgcc gcactccgta ccatcctcat
    83701 gacataccac accttttccc ccgagctggg ctacgtccaa ggtcagtttt ttcataaacc
    83761 ttcccgctta acccctaacg gtttatctta ttttacaggc atgtcagatt tgttgagccc
    83821 gatatacgtc gtgttcgatg ccaatgaggg tgatgccttt tggggtttgg taggtgtgat
    83881 gaagatgatg gtacgtccca aaagtctagc aaggcgatga aagagagaga gctaacatga
    83941 gagggaacgg caggagagca actttctgcg cgaccaaagt gggatgaaga aacagctctc
    84001 caccctccaa caactcatct ccatcctcga ccctgtgcta tacacccacc tcgaacgcac
    84061 cgactcgctc aacctcttct tcacctttcg ctggatcctc atcgctttca aacgtgaatt
    84121 cccattcgac gccgttatcc atctctggga agtcctctgg acggggtatt attccgagaa
    84181 attcgtcttg tttgtggcga tggcggtgct ggagagccat agggaggtga tcataaggta
    84241 tctcggagag tttgacgagg tgttaaagta tgcgaatgat cttagcggta ccgtacgtct
    84301 ttttcgtccc cccccccctc ttccgttttc ctagccccgt gataatggct gatggcacta
    84361 ttagatcgac cttgatacaa cactggccca agccgaggtc ctcttcctca gttaccgagc
    84421 gcttgtggag gatcttgata aagagaataa tgagatggtt gggtcggatg atgggttacg
    84481 acgccgcacg acgacgacga cgacgattga tctggctgcc gatggtcagg gtaaaggcaa
    84541 agacaaggtt cctgcaaaaa gtgaagatgg gctcgacgag ggactcggcg agggagatgg
    84601 aggggaaagg aaagaaaaaa tggaaacaag ggcgatttca gaagaattga gagagttgct
    84661 ggtcagttgg aaaccggagc attgatctag tgttttacga tactttacat gtatttagtc
    84721 accaagtcat taaaaagaag aaaactacta cgtttcagaa catgacacta gaaaaagctc
    84781 ttgagactag acattcttct tgatcatcat caacaccaac ggccaagcta catcaaaact
    84841 ccctttccca tctctatcca ccaccccttc tttttcaaac gcttctttaa tcaccgccat
    84901 aaaccgatct accacatccc cttctcccgt cttcactttt agctccacct tcccctttgc
    84961 ttcgtcttgg gggttcgccc tccaatactc gtgtgtcgcg gaaaacgtac ggagataggc
    85021 ttcaagttgc gcgagcgtcc aatgttggcg cataaggaat ggggatgaag gggtatgtcg
    85081 gattcggacg gctgtttccg gtgcccactc tgcctcatac cattcaagcg tatctgaaaa
    85141 gggctttgga tccagcgccg gctcgtcaat catcatcacc ggtcgtctcc ctactaccct
    85201 ctccacctcc tccacctccg cccgcctcgg ccccggcccg ggtttgacag gaaatggaac
    85261 tcgatccaat agcccttcta caatccccct ccccggctgg gaccagtagg gcccaatccc
    85321 gtggggcgga ggggaagagg aaaagcgagt gaaaagatga gtgaggtggg ggtgcgatgg
    85381 gaagaggagt tcggcgtagc cctgtttccc agaatttcca tatccaatca gagaataaaa
    85441 gggcagggag gggaggggaa ggagcgttag tacagattaa agggcggtac ataaagaggg
    85501 cggggggggc gggaaacata cgaggtaagc gacagtccca cctggtctga catgtttagt
    85561 cagctggggc catacttttg aatggtcaaa ccaatgcgcc gcttgtccta cgccgccatt
    85621 catcagctca caaggtgcag ttcaaaaaaa caagtaagaa caagcaagaa gacagagggc
    85681 atagtaaaaa gtgaacatac cggcaacgac cagatccaca ccgtgatcac ctacacccac
    85741 acccgcatta tccagatcct ccgcattccc tactctatat tctacctttc cacctcgcac
    85801 aggctgcaag ccaacttgaa ccatcttctg ggacggatcc aaccccaagg tatgctcgaa
    85861 atggggtgcc aaggtggacg ctatgaagcc tggtccacag cctaggtcga ggagacgggt
    85921 gttaccacct ttaaggccgg agcggttggg tgggaagtgg aaatggtagg cgagaatgat
    85981 gtcgtatgct tcttgtgggt atgatctgta aacattaaaa aaaaatcatg aatatgtcag
    86041 ctgcatgcct actgcgggga gaagagagag gaggagaaat gcgacgaacg gtcgacagct
    86101 gagatatctc tcgacgtcga atgaggaatc tgcaaagctc ttcatggtga ttgatctctt
    86161 gctatagcag agtgtagtgg tgataaccga ctttgtggat gtcttgagga ggtgcatatc
    86221 aactgagagg atggtgcatg gagaatagtt ggaagatgga caagggaatg tatggttcgt
    86281 cgtggacaca gcggaaagca gcgagctgtg gccgattata ccgatatatc cgtactcaca
    86341 tccattctgt ccctataatc catactctcc agccatagat ggacattgga taaagctttc
    86401 gactgtcgtg ccggaagtac agagctgaac gagacgaaga acgccagtgt cggggcaaca
    86461 acatccagcg acattttctt tacacctcca catccatctc gcattctact cttttcccca
    86521 tcaccatcgc aaccgcaaac atggccccac gcgagagagg tctcaccaaa catcagtact
    86581 ccgctggact cacatacgtc gctcaaaaac cctctttcct ccaaaacttt ggtaaacccc
    86641 aagctccccc tccgtcgtct gcctcttctc gaggggggcg ggagcctctg ccagaacgcc
    86701 cggacaaagg tcagtgggcg actggtagcg gcgacgaagc gggggaacgg gaagatgacg
    86761 acgatgatga tgaatgggga gatgtattcg ggggaggagg ggaagaagga ccccaggtgg
    86821 ttgttttgaa ggagggaagg catttgacgg ccgaggagat taagagggaa agaagaaaag
    86881 gtgagttcta acctcctttt tcgtgttggt atgatgctca gtgaggtcgc ttttgtctag
    86941 ctgctgggca ggactcgcct cctcccgaag atcagaacaa ggagaaaaaa gacaagaatg
    87001 aggagcaagt tacatccaac gccaatgccc aacaaaaaga aacctccaag accaggataa
    87061 tacctaaacc caatccgaac aaacgcagac ttgtaggcaa cggaggcgct gaagatgaca
    87121 agcaaggaca agagaaagag acagctgcga cgggagggga gaagaagaag aagaaaaagg
    87181 caaagaaggg gttattgagc tttgatgaag cagagggcga ggcttgatga gtgtgttccg
    87241 cctgtataat gtataacatt ggtagcttat ggcatgatgt actattacca ccactagatg
    87301 tacaagtaca actttccact tactccccct tacccttctt ccacttactc ccctttaccc
    87361 ttcttccact tacacttcct tatcgttccc tttgcccgtt tccgaggtat cctccccgct
    87421 tccgctcccg ctcgtgctag tactatcact tgaagtatgg gccgtattgg taggaggagg
    87481 cgcaggaggt gccatctgcc aagcgggtat cccagctttc ccacccgccc tcgggcctag
    87541 aagggcgttc gcagcagctg cagttggtgt cggtgccggg ctaccaacgt cgcttctact
    87601 tcccgagcca gagccagcgg cagaaccggt aggagggagt tgggatcgag aagcaagaag
    87661 cgttttgagt gaccggattt cagattggag gtctgcgaga gcagaagatt gtgattgcat
    87721 gtgcttctca atcatctatt cccttgttgt tagcctctcc cagatttcta cctcatcttt
    87781 ctccagcaaa gaggatgaag acatacccta ggaaccaact ctttcaaact ctccacctct
    87841 cccctcatat ccctcatctc atccctccac ctctcttccc ccgcctttaa cccctttacc
    87901 gcgccttcca cctcttccac cacctgattc actttctccc gatcttcttc gatactcacc
    87961 tggaccttgg tcgtttcctc cgtcaactcg ttcagtagac gcgtggcttc gtcatatttg
    88021 gacgtgagtt cggaagaggt ggattggaat gcagtagtag acgggggtcg caagtgcggg
    88081 agaaggtatt tctatatccc attcaatcac aatcatggga caaggggtag gagatggtgt
    88141 gagtcacatg gctgggattt gaaaaaatga caagggacgt acgcgggcaa gagctgtgag
    88201 accatatacc acaccacccg agaccatcgc cataatctac acccaaccat cccatatcag
    88261 ctctcccgtc ctgatgccca tagacttgac catggtgtgc tagcatagtg tgtatagact
    88321 tacgaataaa tctctccaat ccctctttgg cggctcgggc ggggcataag tgtagccgta
    88381 cccatagttc ggagcaggta cacgcggtct ttcgggtggt cgttcgtaca cggaagacgg
    88441 tcctgtcctt tccccttccg cttccccttc ccccaccgca ccttgcttcc cagagccagc
    88501 ggaagaccca tacccactgc ccgcttcccg tatagcctgc tcaatttcct tctctgtaag
    88561 ccctttggac tcgaggaact ggacacgcga agtaagcgac gagttttggg ttttggggtc
    88621 gttgaggaag aggatggcat tctggatgag ttgcactctg tccggtgagg ttgggtcggg
    88681 cattgtattg aagcgtgata gaaaagagga gagaggacaa gtgaagatgc gccgggcaag
    88741 taaacaaccg gtaaatattt ttttaaaggg gggggagcgc tctgaacatt cgtttcttgt
    88801 ttcttagata gagcatcgtt gccaaatatt cgatacgttt ttccggcata tagaaagttc
    88861 actggataaa gataaaccat gataacgtag gcatagaaat gttatcgatg caaatgttat
    88921 gcatcttcac tcatctctca cctcaacagc tctttgctta aaaccgcacc cttcctacca
    88981 aacaaaaaac aaatgtgcga actatttatt gcttccatga ttggaaggag atgaagttgt
    89041 caactgacga agaagcgggc gctatcagct cagagaaacg acttggcctc ttcaacctcc
    89101 tcttgagaaa acactttgct ttcgaatgaa gcaatgcgcg ctatatcgtc cccacctcca
    89161 tatgtctggg agccttcttg aggccaaaag aaagagatga catggcggag tacgtattca
    89221 ataatcacag aggttcgaga aactcactgc cgatccattc atatccaagg ccctcggaga
    89281 tcaagcgacc tgggtcttcg tattatcgca atcatttcac ttcccgatga tctccatagg
    89341 gtgtcaggaa tagaagccat ccatttgcct ttcgaataga cctccaaaga agactttcga
    89401 cactcatact tctgccccaa tgaaaaggag aaagatgaac gaatggatct actacagctt
    89461 gccggtttct cccgtccagc ggagaagacg tcattacgta agcaccggtt atatcccctg
    89521 aaccccgtgg gaccgacgtc ggcaactgga aagcgacgag tcaaccaagc atctgtttcc
    89581 ccggtctttc cttcagcttg ttttggttct gcatttcttt cctgctcctg ttctatagac
    89641 tatacagcaa ccacatctta caaaatgagt gagtcagcgc ttctgagggt taatcctctt
    89701 tttggtcgtg cgctggtgcg cccggaatgt gccgagcagc ttggccatta gacggtactg
    89761 acgagacaca aaacaggttt taccaacttc tgggctggtg ttcccgaggg gtatgtttgt
    89821 caacaacctt ccagcatgca cagattgctg acagtcatgg aaaatttagt cctcccgacc
    89881 ccatcctcgg tatgcgaatt tctaccatga cgatccacat cggaccgagc gcccggcagc
    89941 tgattgacaa tgtggatagg tgtgactgat gcattcaaga aggacacatc tccaaaaaag
    90001 gttaaccttg gtgtcggtga ggaccagtct ctatgatgtg ctgcgccaat tgctgattca
    90061 agttgttgct cttgctctgt tgcattaatc atctttgccc tcgttccccg ttctgccccg
    90121 attcgctccg taacattatc tccggtcgct cttatcgcca aactatgaat acccacccct
    90181 acctttgata aacttatcta aatatgttga ataggcgcct atgtaagtct tacttacagc
    90241 ttccctactt attttgaaat ggactgacaa cgccttagcg tgacgaggat ggcaagcctt
    90301 acgttctcga ctctgtcttg aaggccgaag acatcttgca caagaagagg ctcgataagg
    90361 agtaccttcc tatcaccgta catctcatct taatggcata gtgtgctaca ctgacgcgac
    90421 ttttatctgt atagggtgct gccgacttta tcaagctcgc ttctgaactc gcctatggca
    90481 aagactccaa gcctctgcgg gagggtagag taagtcattt ctattgacct atcccatatt
    90541 tattctaatc agtttgatca ggtcgctgtc tctcaatcca tctctggtac aggcgccctc
    90601 cggatcgcta ctggtttcct ctccagtttc tactctggcc ccaaggtcat ctacttgccc
    90661 aaccccactt ggggtaacca cgttcctttg gccgaatctg tcggtatcaa ggtcgaaaga
    90721 tataggtatt ttgacaagaa gacagtcggt cttgactttg agggcatgaa ggaggacatc
    90781 aaggtaagcc gagatctttt tatccgatag atacagtcac tgacgttgac tgtatagaac
    90841 gccgaatccg gctctattgt atgtttatcg caatactcat actcttagta gactgacgca
    90901 atgtctacag attcttctcc atgcctgtgc ccaaaaccct actggtatcg accctacgca
    90961 ggagcaatgg aaggagttga gcgatttgct caaagccaag aagcatcttc ccttgttcga
    91021 catggcttac caaggtttcg catctggcga cattatccgt gacgcttttg ccgtacgata
    91081 ctttgttgag cagggtcacc agatcatcct ctgccaatct ttcgccaagg tgagtatcaa
    91141 tcatctccgt ttctgtagct ttgctgatga atgatcagaa cctgggtctc tacgctgagc
    91201 gtgccggtac cttctccatg gtctgcgctt cccccgagga gaaggaacgg gtcatgtccc
    91261 agatcaagcg tgtcgtccga cctctctact cttctccccc catccatggt gctcagctgg
    91321 ttgctaccat cctcggtact cctgagcttt acgacgagtg gtatgtcaca gcagctgata
    91381 atgcacgcag tactgacgtt tacacaggct taccgaggtg aagaagatgg ctgaccgtat
    91441 catcgccatg cgagaaaagc tttacaacct cctcattgag ctcaagactc ctggagaatg
    91501 gggccacatc aagtctcaaa tcggtacgtc cattacaccg ctgttttttt aatttttctt
    91561 catcatactg acaacagagt gtttaggcat gttctctttc accggtatct ccaaagaaca
    91621 agtcgacgac cttgccgagt acgctcacgt gtatatgacc aaggacggcc gtatctccat
    91681 ggctggtttg aacgaacata acattcagta ctttgctgag agcttgtcca aggctgtcaa
    91741 aggcgaattg aggaccaagt cggcacttta gaaggatgat gatggatttg taagaagtta
    91801 tgacaagaag cttaaatatg cactgtgatg tggaaaatac ttcttttaac atgctggtta
    91861 tctagcatat atctaactaa tgattttttt tttacttctt ctgattttgg ttcgttacta
    91921 gcggagttca tatctcccaa gtcaaagcag tttttaagga agttgagtgt acttcaagtg
    91981 cgcagcctac gacaatcata gtcagttatg tggttgcggg catattgtga tagaaactga
    92041 ctgtcgtaag caaaccatta tctggcttac cctcaggaag gtaatgaggg tctctaccaa
    92101 agcggttgta agggaatcca tagtcaaatt tataagcgtt gttgagcctg tccatttgct
    92161 tatcggtgag ggtgattttg agagcctaaa atcattgtga gcttgtcggc ctttggttca
    92221 ctggaaagaa tgtgaaagaa aacacacctc aatgttagcc ttgaggtgct cggggttggt
    92281 accgccaacg atagggtaac agtcggtaac tgtctgcctg gcccatgcca ttgcaactac
    92341 acataactca tcagtccttg cactcgtaac agctcagcag aggcttgact cactactggc
    92401 aggtttgaca tcgtcaccga tctctttggc aacctcggat agagcttcag agatcttgat
    92461 gtcctgctcg gtgggaggtg cattagctcg ccacttgtcc ttgttctgga gttcctcggg
    92521 cgatttgaat ttgccctgac cgagaacacc ccaaggcgct atgaaggaga aaataacgta
    92581 ttagtgaact ggtacttggg aaaaaacagg aaacgatagg tcttaccgat gctcataccg
    92641 ttggcacgag ccatagggat gatgtcccgc tccaaatccc taacaccgag gttccacaaa
    92701 ccttggtaga caacaaattg ggcgaggccg tggtgacggg catactcgtt ggcctgggag
    92761 acgatccagg ctacaaatcc gccatagtca gcaaacagac aatactgaac aaggtcgatg
    92821 tgaaatgaat gaagacgtac caggggtatc agagatacca aggtagagaa ccttgccgct
    92881 cttgacgagg tcgtttaaac tctgcatcaa ctcgggaatg gacgtggagt agtcccacca
    92941 gtggacgtag agaaggtcga tgtagtcggt acggagcttc ttgagagagt cttctacctg
    93001 gcaagcaaga gtcagttcaa gatctaaaac aggcataata ggtgattaac agagtggcga
    93061 agactcttcc tgtggttacc aacgaagttg gcaccgatac cctggaactt gccctctttc
    93121 ctgtcaaggc agaaggtggt gtacttgcta tttacggtac gagaggagct gtcagggaga
    93181 ggttatgtca ggaaagaaaa tagcgacgaa cgtagcaaga acaatttcat cccgaatgcc
    93241 tcgcttctcc atccattcac caataatcat ctcagactgc tcatgttggt agttgttggc
    93301 agtgtcgata aagttacccc cagcctcata gaaagtgtcg aggagtttgc aagcctcctc
    93361 aaagttaagg gcgccaccca tgaaaggggt ccactggtca ccgatggaca tcgcacccaa
    93421 gcagagagga gagactcgga ctagaggaaa gacattagta ttgggctgat atgagagatg
    93481 cctcatgatc tacttaccag cggcagtagg agaaagaagc ctgtatcgct caagctccgt
    93541 tctgggctcg gggacaggag caaaaagatc ggccatgcct acataacttg taagctgttg
    93601 tcgactttga ttctttatcg cctgatcgac gtactgaact tggcattggg gtcagcgggg
    93661 gtgaagtcag tagaagaggt gagggcaggt cgaggcatat tgattggact tgactgttca
    93721 gttagagtta gattagaata gaaacggaag tgctcatggt tattctgacg agatctagaa
    93781 tatatatcat ttccgatctc atggaccacg tcacctgaga ggtacccctc ccggccagcc
    93841 agtccgcacc atggcgctgc tgccctgtct gtcgttatcg agatcgagca tgacacattc
    93901 tgcatttgcg atctcgttgg taaggtggag gagtggaggt cgagtggagg ttaaatgatt
    93961 ggaatatgcg ggaaagaggt ggaggcggag aggaaagtgg agacaaaata gtggaggctg
    94021 gtggaggtct catgttactt cctccgtcag gactccctca aatcccaaaa atagaaaatt
    94081 ggccgtcggc tggtgagaaa tgcgtgcggc cgacctcgtt ttgatcggtg cagtacccat
    94141 ccttaaataa agagaaaatg aactgcttgc agttatcatc gcgtcaatca tcgcgcagtg
    94201 tcgaagtcaa cagcaaggtc tctctgttcg agcttgatgg gatgataaaa acctggattc
    94261 gagatccaaa gtcggtttaa agaaggttat ctaaggattc gagatctgcc caaatatgcg
    94321 gaccaccact gtctgtaagg aaggtgactg gcaacctaaa taaatgcatt caaaagggtt
    94381 ccggatctgc ccaatagtcc tgatttgtag taaagttccc tggatctcag gaacatgact
    94441 gtagcaaaca aaagctcctt gaagtccttc ccttcgtata ttttccaccg ctagactcta
    94501 tgcatggttt taagcttgtg tccaccatgt tttatatggc cgagatgcat attgtaccat
    94561 gacagtaaag cacgaagaag ccaaccgact gccatcctcc ttcaatagtg ggtggcagcc
    94621 aatggccgat cgaaccactt caatcggaaa accgtcgtct gtttgagcat gatgatgaca
    94681 acttcaggcg ccccctcttc gcctcaagag aaagaaacta ccttcaggga ccaataccag
    94741 acagcaacaa ggcaagacaa tctattcaat cttcatgcca cgcaaaccgg gtccaacaga
    94801 acacgtctcg ccatctacgt accgcatcat tttcccaatg gggattatga tgggcggttg
    94861 agggacgctg acgcgcaatg tagtaatggt ggtggtataa gaataggcat tgcatatggg
    94921 tggtaacatg atctggatta agaaatgtaa tcgactgtgg tttgttagcg tctctcctta
    94981 ttgtcgttga cagtccctag cttgagcaca gtgattctca atgtcattta tcttcgtaga
    95041 tgcgtaaaaa tgcatggccg ggtacccata atccttattc gtagtacatt tgctgccgcg
    95101 tcacttcgtc ctccatgcct tcctcttctc ccgagctctt cctgatcact ccttccacca
    95161 tacgccaaaa tccttgctct tcttccgcct cattcaataa ttcgtacata tctttcagca
    95221 cttccagctt tgccaccacc ctttcactat tgagacttct gttgattgct atagggcatg
    95281 ctaagggatc gacaaccggt tgagcaaggc gcaaccacgc catagctttc tcttctttct
    95341 cttctccttc actttgacca acaaattgtc gccaaatatt attgagaccg ctcccaattt
    95401 tgcccgctat cttggccctc acatcatcac cggtctctct ccatatacct ttcggctcca
    95461 agctcaagct ggcaagagca aggccaccgt tttgagggtg caaccctaac tgagtaagag
    95521 actcatggag cttcacagcc gtttcgtcga tactcttcaa ctgctcttgg gaaacatcag
    95581 ggcgtgtctt ttggaaatac gacgcaagtc cgttgtgtgc atgaggatgg ggcacgttgt
    95641 ggggattcga ctcggaatgg gcatgatata aacctggagt atgggtacca ggtgtgattg
    95701 gtgccgtggc ggggcgagag tattgagccc agtaggcatc ttcggcgcca acgtggtcgc
    95761 tttcataatc aggttctttg gtgtcgaaca agggttcgtc gtcaaacgct gaccaatagc
    95821 ctgctggggc agcatacgga tcgtcggctt cgtcgtgtga tggttctggc atgtggtgta
    95881 ctggtggagg taataatgct ggtgaggaga accagatatg ctcgcttgtt gatggaatac
    95941 gggcggagtg atagacccac cctctacctt cgctcccttc actcccccct tcccattcaa
    96001 accagacttc gactccttca ccgccttctt ctcgctcgac gatcatcctc gcaaagacat
    96061 cttcgccctc cctggcatat tgcttctccg accacctatg acctcttgac aactctctca
    96121 accgactaga tataggctgt tcctcagacg aaggaaaagg cgagagatga gcgtcgagat
    96181 cagaaggtga tgggggaaga tacgtgaggc gttgtaaaag agattttgag agcagaggtt
    96241 gggggagagg ggagggaggc agcaggtgcg gtagaagctc ctgaatgaca gctggagaga
    96301 gctcagggac ggacattggc gtatgcaggt cactggaagt tatgttcaat ttgtaagtcg
    96361 acgatgcgat cggagatggc ccaccattct ttttttgtac tcggacactc ggatgtagcc
    96421 aactgccggg ccaagaccac attacgtaag ttacgggaac caataaccgg ccggcaaaac
    96481 cagaatagca gttcaaagtc atggcgtaga cggtaattgt ttgtcttatt tttgataagc
    96541 cgaacaaacg cgaaaacgag atttacaaac gcactacaag tgattgggga ttgggaacaa
    96601 atatcaaagc ttcaaattac agagagctgt ctggccgaca gacatatgcg gagtataagc
    96661 agaaagacgc cgcaatagat caaaccaggt actatcggtg ccgccatgag gagtattcgt
    96721 cgtttgctct ctcgtcgact attatctact acggcttgcc ttgccgccaa acctccagta
    96781 aagctccttc atatcccaaa gcttggctca gaatctgaac atctactggc aagacaatgg
    96841 gtggatgcgt ttacgccaga agatataccg aaggaaggct gggtggccac aaggagtcgg
    96901 tccagcggtc ccggtggtca ggtaagatcc tctgcattga cgggcctttc cacaatgggc
    96961 tgatgtagtc attagcatgt aaataagacg gaatcaaagg ttactataag atgtgatcta
    97021 gatcaggctg tcggtcggtg gttacccaag ttcatcatgt cagctttaac gaaatctgta
    97081 cgtctctccc tgcgctcggc aacacaccat caatttacct tggagaagac gcattaccat
    97141 cactccccac cgtcactcct catcacctct cagacaacac ggtcggcttc tcaaaatcaa
    97201 gctaatgctc tgagtctctt acatcaaact atcgtctcgt cagccaactc tctcatcata
    97261 aatcccacca gtccggaaca gaaagaacga gtcaaggaac tggagaagaa agaaaaagaa
    97321 agaagaatgg agatgaaaaa gagaagaagc atgaaaaaag ctagtcgaag ggaataagct
    97381 tgcttcaaca gcagagattt gagcatctgc atcgatagaa acggtgtgtt tgtatgtaca
    97441 tgcatgtata agtatgacaa ggcaaatccc agatacgaca gatacaacgg tgaacgagaa
    97501 ggtacaatag tctatttgct catacgatac ccctttttca ttcagtcaca agtgcttcat
    97561 cgtccacgtc gggcgccata tgcgacccac gacccagatt ctgcaagccc aaactattct
    97621 ctttttgccc tccctgcgtt gatattcgcg tcttcgaccc ttcccttgaa gggctttcaa
    97681 caacgtactc actggccctg tatgccgttt caacagtttc aacattaata gctgtctcga
    97741 tcatttcttc tctttttggt aagatgcttc gtacgacgat atcacccaac acgctcgaaa
    97801 caatgccggt cagagatctt gttaaccagc cgaaccgctt ggcaaatggc acaaaagttt
    97861 cgacggcatc gcgtaggtct actatatctc tgatatatgt cgccttgcct attgagaagc
    97921 caggataagc ttctggggga attactagga gaagtagaca taccgacttc attcatttct
    97981 actactgtcg tcatcggcaa cttccacttc aaaaccagat ctaattcact tgctaatgtg
    98041 cctaccaaac gtctcacgaa agtcggagct ggaagactat gcaaggctcc ggggagatga
    98101 gcagaagatg gtgaaggggt agataatggc gatggggagg agaatgaagg agtggtgggt
    98161 tcgcttggaa gagggcgcgt taatgatggg agcaggtgaa gagatattat gctgggagtt
    98221 gtcagcttgc ggttgaatgt cagtgaaaga agtgtcttac tggtctatca tagccaagcg
    98281 atatccgtct acttcgtgtc agagagtaat cccataatag taataatgaa tttaccataa
    98341 cattccattt cgccaatctc actacattca gccctgactt cccacacctt ccaccaacca
    98401 tcttctccat ctctttcagt gggcgcacac atagttgcca atgataacca tgctgcttcg
    98461 attccaaaag cccctccctg gcctataccg cccctacttc ttgctccaaa ccttctttct
    98521 ccaaatgtat ccctcttacg aaacctagga atgggatcag cttctctggg agtgacattc
    98581 actagtctga gcataaaggc cgatgtcaat gatcgagcgt gtcgaattac cgcggaagga
    98641 gtcagacttg gaagagttag ggtagaaagg aggtgcagta ggctgaagtg ggaaagaagt
    98701 gatgagcgtg aggtcagtcg gacaagtggg gtgtcataaa ctaaagtttg ttatcagcta
    98761 tagcgatgag gtccggaatt tttatgggaa aggtactaac cgcaatcacc ctcaaaatac
    98821 tgctctatta cctttctcag actccctacc ttttgttccc agcttttatt acccccctct
    98881 tggtccaaag gttcctctcc aaggtaaaga ccacggtgta tatctgcaag agcgtccatt
    98941 atgtccattt cagttggatt gggcgatggc gtccgagctc ttccttgaaa tcgaggttga
    99001 aacgcaacaa cctgttgatc tttgtccaaa attattgaag tcgagagtgc ttcttgaatc
    99061 tggagctctg tgccgtcgga actcaaagat cctgtagagt tcgtctcgcc gccaaagagt
    99121 atcccacttc ttgacctgga gtgcagatgc tcacgcccat acgcgactct acgccgatgt
    99181 tcacttccct cactttgtcc atggccatgc cgagaagatc tcgaagtctg tctggaaagc
    99241 gctaagctcg ttcccaagtt aagcgtcgcc ggtgacgatg cgacagaagt tggtgggaag
    99301 aagaagcggg gttgctgaac ttgccggttg ctgggagtag acatatctct ggaaaggggt
    99361 ttcgtcgaac aaatagtgct gttgtgatga gtgatggttg gtgattaatg tttgtcaatc
    99421 gcagagcagt gcggaaggag caagaatgtc cccaaacttg gtgatcttct ttgggatttg
    99481 accttgtgat gacgctggcg gccgccggtg acttacctct tcttctgcca catcatctcg
    99541 gcgtcggcta cagcctaata acttttgttg tacatatttt tgcacaagta cgcctttact
    99601 ttcccgccat gctgaagatt gcttggtggt taggataccc gtaattataa tgaaaaatga
    99661 agaaaaagaa taaaatattt catgcttggt tgttcatcat cgcgcgcatt ttggacgaag
    99721 ccatcttcag tagttatata ggggctgttg ttgtctatta gtcatattta tccgatactc
    99781 gaggccgcgg attcgatact tttgcttttg taaccacctg tctgctggtc ggcgtctggc
    99841 tttgacttgc ggcttgtttg tttgttatct catttcgggg gacgaactga aaggagaatg
    99901 aagggtgaag tacgacccct gatttatcgg atgagcatca tcgacaaatg atattgattt
    99961 gataagcagt caggggtgaa aaatatggtt gcggataaaa cctacccttc atactcgact
   100021 tccgctgatt gctccctcgg aatatcttcg gacaacacaa tacctacagt acacacacac
   100081 gacttacaca caccccccag aaccaacccc ctttcccttg cgtcctcatc attgcaacat
   100141 acatttacca atttgccata tcgatggcca cggccgaaga ccgagtgacg agtgattgta
   100201 cagcgattat ttgtctgtcg atcccatccg ccgcttcctg atgaacgatt tatccgtaaa
   100261 ccgtttgtcc gacccgttgc ctacctatta gtacattttt ggaccttcgt ggcctcaact
   100321 gttcacctcc accatggcag gccttaaaaa gctgcgtcat cgattgccga actccacttt
   100381 tttttaagtt ttgctgtagg gtttagaggg agacgaacga taaaaggtaa acatggcagc
   100441 gaacagtgga cggcgaagcg atgatagctt agcgttgtcc gcaacttgcg acctgcaagc
   100501 cgttacagac aaactcatag ggcactggta ctgcatcgca ttcggttatt atagcagcag
   100561 ctcatctgaa gaaaacacga tacaattgtt gagcaaatgt caaggaacgc cccaaacgtc
   100621 acaaacctcg tgctgggctc ctttttccgg tccattctgt atatggtttt tgtatctgac
   100681 atccgctaaa gagccaacca ttggaaatgg gcgctttgca ctggtccgta ctcattattc
   100741 ggagattaat tactgaagga agactacaac aacacagtgc gtatctatag actgcacaac
   100801 aaagttgata ttcaatgatt ttcccagttt gccttttcat ttcgtctctt ctaccattag
   100861 tacctgttga tcttgattgt gttcgttaaa catctctttc acatctgcat ctccgtcagc
   100921 tgccggtgca ttcacccacc ccgtccggcc acgaaccttt ttgagcaaac agtaaaacac
   100981 ctggtatttt acaacgcttt acaacagttt cttctcattc ctcccttgat tatattcctc
   101041 ttttgatgtc tcaccgatta acttcttcta cttcggccaa ttggggtcca agaggatcaa
   101101 tctcttcatt tgcgtcagta tcaacagcca accgatatgg gccttcagca actccaacta
   101161 gtactttgtc gacagttccc ctcaatgtac actcacctca tcaagcagca cttccaacag
   101221 acgatgatga cgatttagac gatagtctcc acacattcac cccgaaagaa tacagagagc
   101281 attacatctc ctctcgtttc aacttgaagt cttggcgagg ttggactaat gctttgactc
   101341 tagtggtctt agcaggtggg gctgtaatgc tttttgccgg ttacccgatt atatcttttt
   101401 attatggtga cagcaactcg tcgggcggga atacatctgg cttcaatctc ggcggtatca
   101461 atgcaagtgg gcagtatcca gaaataccag gactaccgtc tttgatcgac cctgatacgc
   101521 cgtcttgggc ctattccaga aaggggtcag atgacgagga ctgggaattg gtgttttcag
   101581 acgagtttga gaaggaggat aggacctttt ttgagggaga cgatccattc tggacaggca
   101641 tggatattca ttattgggta actgggtacg tgcattattt tcaacaaaga gatgtttact
   101701 cgattaatat gggttcagtg attatgaatg gcttgatccc tccgctgtga cgacaaaaga
   101761 cggtcacctg gttatcacta tgactcaaga accaattcac gatctcaact tcaggtcggg
   101821 aatgattcaa tcttggaaca agttgtgttt caacaagaat gctatcttcg aagtttcagc
   101881 cagtttcccc ggtacatctg aaattggagg gttctggccc ggtatttgga cgatgggtaa
   101941 cttgggcaga ccaggatatg ccgggacgac ggacggaaca tggccgtgag tatcactcgg
   102001 atcgtaccat aaatccgaaa tgcttaattt gccaaaggta ttcttatgac tcttgcgatg
   102061 tcggcacatt acccaatcaa acatgggtga atgggacagg tcctatagca gccctcacga
   102121 ccggatccaa cggcggagct ctatcatatt tgcctggcca acgactttcg gcttgtacct
   102181 gccctggtga agaccatccc ggacccgata ttaccgttgg tcgagcagct cctgagatcg
   102241 atatggtcga agcccagatc gccatcgcag aaggagaagg acaagtatct gcaagcctac
   102301 agcttgcccc cttcgatgat tattaccagt tcgacaattc aacccgatat gccacgatct
   102361 acgacaatga tctgacctat ttcaacacgt atctgggtgg tactacacag caatcagcct
   102421 ctggcctcac taccgtccct tccaaaatct actacgatca agatggtgaa agcaaacagt
   102481 ttgtaatgtt tgccatggag taccaggcat tcccggatga tcgagataat gcatatatca
   102541 cttggtgggc ggataataaa acgtcttgga cacttcgttc gggcgctatt ggtcccaacg
   102601 agaggactga ggtcagtagg cgacttatac ctgaagaacc tatggctatg gtacgtacac
   102661 ttcggaacgt gggctacgcg tgcacagact gacattcata acctaaaggt catgaatctt
   102721 catttggtac actaattcgt atgagactac atgtggcctg tgctgatatc ttatcttatg
   102781 tagtcgaatg gcttccaggc tgtcgacttt aatcacctca cctggccaaa ctatcttcga
   102841 atcgattacg ttcgaatcta ccaaaaggcc gaccatatct ctcttacttg cgaccctgaa
   102901 ggttggtaat atcaattgct aggagtcaaa gtttagtatt gatatcttta ttccccagat
   102961 tatccgacgg ccgattacat cgaagatcat attgaagtgt acagcaaccc aaacatcacc
   103021 acgtggaagg aaggcggcta ttcattcccc aaaaacagat tgaaggatga gtgctaaaga
   103081 agcacactct ttctcttgtc gatcattgat atcgactcgc ttcgcatata tataccctca
   103141 tttttgatct ctgacatgga caatggacaa caattgttag ttcggacaac ataacggaca
   103201 gtggttcagt tcgggcaaca aaacggacaa tcaaggttaa tctaggtaga ctttttaaaa
   103261 gaccattttt tgcattgtga catggctatg catttggatg acctcttgaa gataagaagg
   103321 taaatatttg ccataattca acgtttgtta ttcgttcttc tgagaataga gtgtcacggg
   103381 cgtcacgtca gtcagcgtag ctgcccggcg ctcaactcgg atgatgtaga actcgacgaa
   103441 tgaaagtgaa ggattcacgc ctagcagagc cggacggaag aattgccagg ctgacggaac
   103501 agaagctgga cttagaggga ggaatagcca gggcctgaag gagcaggagc tggactaagg
   103561 gctgactgaa gcgacttaaa agaaaagaat gctcggaggc aaggtagtga gaaaggacaa
   103621 cagtattgat tttctgggga ctatgaaaac tacgaaaagc tatcttctta tatacctttc
   103681 cttccttctg cttactcatc tctctcggga gaaagttacc gctaactcgt ggcggggacg
   103741 gagctgtcgg accgggggga aatgaacact gaccaagtgt tggggaagaa gaggagagtg
   103801 ctgaccaggc gaaacgaaag aagaggcaag ccgaaagatg cctcggttga ttttgcaaga
   103861 atcgggcgat aaatcgcggt cgtctgaggt ggaggtttgt ttggttactt cggggacgag
   103921 gtggaataat atcccgttgc ccggttaaag acgccgcaga gtgcgattct tgcataacat
   103981 cgtgacatag aggcttacga tacaccacga tcgagttcag tttatggcac ggtgcgtgcg
   104041 tgggtgggtc aagaatccgg ccgccgagtg ttcttgttat ttatttatat cttatttatc
   104101 atcaaaaagc ggatattgcc gccatatatt tcggcgcgtc agtcgcgtct ttaaacgaag
   104161 accagtacaa tgaaggtagt cgattctcaa accgcgtctc gggacaaatc ccaacgaaaa
   104221 actggaacaa tcgactgacc cttgatgaag tcacatgacg gtcgtcccga ctggtttgat
   104281 tccgctcatg ttcgcgtttt cagcagtggg acatcgaagg acgcactgga atttggagca
   104341 tgagtctctt ctctgtgatc acaagtcgct ttaaagagta atacaaggcc aagtgaatct
   104401 cgtcgcacca taccatcatg cctcacctca gcaagaaaca ggaagctttg catgaaatcg
   104461 acaatcgtat ctctagtttg ttaccttacg tatccaactc cctcattcga caccaaaccg
   104521 gacttcttct ttccttacgc aaaatacacg aaaacagccg ttactatcaa cggattcctc
   104581 atagttctca ttatgagaac cacgattatc tttttctgag atcctccctt ctaccatcta
   104641 ccgatgacaa gataatcaag accctacgta tgaatcgcgc agagttcacg agccttgtcg
   104701 ctttgttcgg aggtcacgaa attttcaagt cgcaggggag gaagcctcag gcaccgccgg
   104761 aggtgcagct ggcgacatgc atctacagaa tggcaggagg cgagagaatg agcaccgtgg
   104821 agaatcattt taacctgtct cgtaagttga gggggccttc aatcgttatt cttcgagttc
   104881 acattcagga ttgatacgca tactcggatg acagatggca gcgtatccct ctatacggac
   104941 cgatcgttaa tagccatcgt atcctctttg aagcagtacg ttttttggcc ctctgaggca
   105001 gaacgcggtg tccttgcccg tgaattgtac gcgcaatatg gaataccgtc atgtatcggc
   105061 ttcatcgacg gaaccgatat tgtcttgcac caagcaccat caattggacg cgaaaaggca
   105121 catactatgc acagctacaa ggaaagatat ggttataaaa tgatcgctgt ggtcgatcat
   105181 ctgaagagat ttagatacgc ctggttcggc ttctctgcag ctaccaacga tcagatggcc
   105241 caagatctct cagatctaca caggaatccc catcgcttct tctctccaaa ggaatatgtg
   105301 ttgggtgatg ctggtatgaa atcatcagac acagttatac ctctattcaa gcgagagaga
   105361 aggatgcagg tcacagtcgg acccaaggtg cgtcttttcc cacccaaatt tctactgact
   105421 catctcatgc caggcctact ttaaccacaa atgtgccaaa gctcgagtga tgattgaaca
   105481 ggcattcggt atcctaaaaa accgatggca aattttacaa gattgtcgtc ttacttgccg
   105541 gacagtaacg gatgaggctc gcctttacct agtcatccaa gcctgcatgg ttcttcataa
   105601 cctgttggtt gagacttgga aggattcgct gactacatgt gaagtggaag gggtgatgaa
   105661 tatcaatgaa agtgtcatta acattggtga tgaagcagga aataggagga gggatgaaat
   105721 tgttgcggag atgatcagag aggaagttcg tagagatcct gcttttgacg ttaatgcata
   105781 tgaaatgtga actgccgaag acgagacatg catgcacgaa gacacaagat atcattcgtc
   105841 ttcgccgaag gcccgacttc gtcgaagcac ggtaagcgct tcttgcaagg agatcttcat
   105901 ttgagatgcg atccttgcag cggcttccac ttcctcaatt tgaatttttc gctcataata
   105961 ctctttctta gactggctaa ggtctttttg ttcttcaaaa tacctagcca ccctttccca
   106021 gcgatcatcc tccttctccg ctcgcgcaat ttccctcatt tctttattta tgctgcattg
   106081 cgctgcctcg cgacttaact tcaagtcctc ctccagaatt ttgcggctgt cctcgctcat
   106141 ctccgaggta ggagctccat gaggtcggcg ggctatagaa atgttagcag acataaaaag
   106201 aaagtgaaca ggacgcattt acggtgactg agtcggcttc tgattgattt ctcaagcaga
   106261 ggatgttgtg aacttagatc ccctccacct tccttatgac aagaattccc ttcttcctga
   106321 agatcatcat tatcattatc gccatggatt cttcttgatt gacgttgtag ttcaagatct
   106381 tcgctggtcc cttcatccac ggggcgaggc ccttccagag gagcgttgtc agaggtcgtt
   106441 tctttatgag gacatgggac gtgctccctc atgcagttta gagagaaact gctgtcgttt
   106501 tcggtactcg tcctaaactc aggtcttgca ccttgtcgac tttggaagat ctcgttccag
   106561 aagttgtaat cgggacagta gttttctcgg tgatctatag atgattgtcg gccttcatgt
   106621 catggttgaa tatgatttgg cttctgcgag tgaacttacc accgagctta tcatagggaa
   106681 tacccacatc gcctgtcggt gtatgaattg tgatgatacc tccgtctcca gctccagttt
   106741 gctgagtaag gttataggca gttttccaac cctttctcac agagatatac tatatgaata
   106801 ttgattcgtt gagcatgtgg gatggataga gatggagctt cgttatagac tatccaaggg
   106861 caactcacct tgttttcaat gctcttgaca gaacgcttgg tcggcccctt tttctcgtac
   106921 aagaaccttt ggaactcctt cgctcctctc ttcaaagtat agccccccac ggcaccagac
   106981 atatagctaa tcccagtggg aatccaatct ttgaaataag caaaactcga ctgttggtct
   107041 tcccctccgc agtcattttc ccagtcaatt tttcgatcag cccaccagtt ctcttccgct
   107101 ggtggagttc catctgtccc gtgaccggtt gataccgcag gattcttctt tgaacgtttg
   107161 gaggcgttgg tggtcggttg gagcggaaca gtcgcagatg ctccggtctg agtctgagat
   107221 aactgagccg aagagtggcg acgcttcgaa ggggaagatt gtgcaggctg ggagggttgc
   107281 attggatcca aaattggcag aggaagattt tgtagaagac tagcaaaatg acggacaaga
   107341 gaagatgcat gctgttcaaa tgctgttggg acgtcgggac gctcgatggg atcgcatttt
   107401 gcacgtcccg atcccgatcc caagagtgag cctgatatga gcctgatatt gaccgttcgg
   107461 acaaaatccg gacgcatccc aaagaatcga ctaccctcaa tgaacaggag tacagaatgt
   107521 cggaatgtct tactatcaca acatcaacag aataaccagt catgggtaag tgaagatgta
   107581 cagagctgtg aaagtctaat gatccgtagg ccttttgaca attgttcgca aaaacaaagc
   107641 caagtccaag gagatgaggg tgctattcct gtgtgtctgc tcgcaagaag gacaagtacc
   107701 gtgttgctga ataccagcgc ccagtggact cgataacgct ggaaagacta ccatactgaa
   107761 gaagctgaac aatgagaaca tttcagacat tagcccaact ttgggtttca atattaaaac
   107821 actgattaga gatgggtgag tatcagtacc tgcgccacag gatgaaatag cactaatttt
   107881 gcctatcaag atacactctc aatatttgta agcgtcgtgt agaaggctgg cggataatgg
   107941 accgacgtat ttcctggaat taggggacgt aggaggccaa cgaacgctgc ggccctattg
   108001 gagaaattac tttgaatcta ccgacgccgt cgtctgggtt gtggactctt cagacagaat
   108061 gcgtatggag gactgccggg atgaattaaa ggagctcctg catgaagaag tgagtgtctc
   108121 cctgtcaagg aagccttccg ctcacaaatg gataaaagag acttgccgga gcaaccttat
   108181 tgatcttcgc caataagcag gatcttggtg gttcgatgac actggaggag atacgagatg
   108241 tgagtgagat ttaaccagtc gttggagccg ctaatccctt gtccaggccc tagagctgcg
   108301 gtcaatcatt tctcatcggt ggatcgtcta tccctgttcg gctttcactg gaaaaaacct
   108361 cgacgatgga atgaattggc tggtaaagga agtcgccggg cgactatact ggagcggatt
   108421 gaacgcaaag gaagcagacc ttttctgaga gctagcggat aaccgcgccg gtactgatat
   108481 tggcgctcaa acaaacctga atatgcagta gtcaggtagt tcatttacgt ttgacatacg
   108541 ttgacatgca tattttgtgg atgttacagt tgtattgcta tgacatattc tattaatcaa
   108601 actataatga taccacgagg cttatcacgg tatacaccta atgaacggta tcctaaaaaa
   108661 gtggcagaga aatgtcctga accgatctcg catgatgtgt atatgtaggg aaaacattat
   108721 agtagaccca agcgtcgttt cagttccttc aatcgacgag agggtgtgtc ggcattccaa
   108781 atttcttcgc ccgtcagagg atcggtgcaa tccattagac gtggcagtcc gaactgctct
   108841 acaacgaagg aggatgaaat ggtggcgtat aaaagagcta tggacggaat cagtaggact
   108901 cctgatagtg ttggaaagta tcttaccttc ataagggtca ttagttaggg aaaggcctgc
   108961 tacataacct cccaggaaag agttgccagc tacgacaatg aaaacatcaa tattgacgat
   109021 acatggtttc caatccaacc cacctccagt cacatctttt acattcttca catcatcacc
   109081 ttcccaataa gccggacacc attttaatcc gcctttcttg gtgcctacac atgctccgag
   109141 ccgaccacac ctgacgacca ctataccttg tccattcgcg ccaatgccga catcgtgcag
   109201 aatatgggtc accaggcgtt caactgttgg acgcagcgag atagaagagg tcgccatggt
   109261 agggatagag tagaaagaaa agagctcttc gtgattgggg ctaagggcca atcagcataa
   109321 taggtttcct tcatcaagca acgacttacg agagtacttc gatatcggga agaatgtgtt
   109381 cgagccagtc cttctggcca ggatggcatg aagggggggt aggctcaaag acaatcttag
   109441 gtcgccagct atctttcggc aaagctttca gatcagagac gataacagcc acattttctg
   109501 gagagtatgg aggggaaatg tgaagatatt cagcatagag aagaggtgaa gtagaaagct
   109561 cctgtattgt ccgatatgga gccttcacaa cgggttggaa actgatgata tccattagct
   109621 ataactatca gattcatgac tgtcacgtac tatcggacat cgccctcata ccgtattctt
   109681 gctcttgtca ttctcgttcc ctcacctcta ttccaaaccc atatttcatt acccaatttc
   109741 gccagctttt gctccacatc ttttgggcag tcatcatttt cagccggggc tcgatcgaca
   109801 agagttcgta attggcaagg aggaagccag aatctcgccc cgacgattgc atacagagca
   109861 ccaccgccta gcatttcata aacttcttcc gcattcggaa cagggatatc atcgagggtc
   109921 atctggggag tcgaagggcc cgaggttccg gaagttgccg gggacgacag gggaggggag
   109981 agccgaaggc gacgggcggg aataactaag tgttgaagat gcccctgtgg ttgaggcgcc
   110041 cgctcgtcga tgactgggga cgctggccga gaagaagcct ggctatcgtc cacaataggt
   110101 cgaggcaaac tgtcgaatgc atcaatcagg acggttccta ggaggactga tcagtcgagt
   110161 gaaactaagg aaggagatgt tttgatctca taactaaccg atggacgcca gaatgggggg
   110221 tagccgtgtg gtacatctga cagactcccc gggggccctt gcttcggatg gatggatgta
   110281 ggggctcatt ttccggctat acacagggtc gacgacttaa gtcctttata gctgtaatga
   110341 acaagagaaa ctagccgcac agtggatagg accaacaata tatacgtcgt tggttaaata
   110401 gcgctgaacc gaggtgttat ctgatgaagt aaacaaaagt cccgagccgg cgggggaagt
   110461 gggggaaagg tcggcgagtt ggctgccact cttttcactc gtccttctgc cacgaatagg
   110521 agggcagata attataaaaa atttagaata ccacttgaat caccagtaat aactgcttta
   110581 aagctggaat cagctgatga taaaatggga agaagatgac gagagccaga cgtacggaat
   110641 taatgatgat cactcctgga atcttttggc gttgtggttt tcgaaagatt gactttggtc
   110701 gtcgtcgcaa ggtcgctaga tagcggacgt tcacagtact ttctttgtta ccgcgcgaaa
   110761 agaattggcc accagcgacg gtgaggaagt ctgtcgttcg gactcaaaga gacaatctat
   110821 atgtgagtcc gggacttgat atgacaatcg taacgtttaa taatgttgtc gacaagcgac
   110881 tgatcgctga tcctcttcct ttgcgccggt tgatgacctc cttcgagccg tattgaggct
   110941 tccaaagcaa aacttttggt ggagcgcggc taacgaatcg tcaaaagata atgcttggaa
   111001 ggggggagtc aaaagaggtg gtgaaatttg accgagagca gtgaccagca catgggggaa
   111061 tttgagttgc aaagccgaaa caaggcgaat atcggccttt agaaccgttt acgaagatca
   111121 cctttcgggg gaaggaagtt attaaaaacc tgcgaacttc tgccaaacga gtgacggaca
   111181 ggacatgtcc gaaatgtttg tcggaaataa accggaagct gcccagccgg agggcggaat
   111241 cgctgtttgt tacgaccgcc gttgggaatg tggatacgtg agtggcagtg tttcgaattt
   111301 caacaaaaag aagaggaagg agtttttgcg ttgggttgtc aagttgtgaa gtgtagaagg
   111361 catccgatac ccatctatag aagccctgga gacaaggaac tggtaaataa cccaaccgct
   111421 aacaattttc accgtcctcc cgtcgttaag ctgcagctca aggattaaaa aaggcacggt
   111481 cgcagatctt ccgctgattt ctggaaaggc ggttccggaa cgctacaaac gcacgatcct
   111541 tctattacag caaggcgcgc ggcagtcgac aaatgggaag gaaggcggga aaaatggtaa
   111601 ataaagagaa gcgagcaata agaaaacgat tatggcggag aaggtcaatc ctaaatcgtt
   111661 cacttgcgct ctccactttc gtcgccacag cgctcatagc agctccttcg aatggttcta
   111721 ctatctttac cccgatgatc tgcagaacgg agcttcttga gtgcttgttg cacgctgctg
   111781 ggtcataatg tatgtagtct gactactggt aatgcatctt ttctccacca ctaattcgac
   111841 tgccatactt cctgcttgct ctactatatg aaagtcgtct ttacttctat ggtactgtat
   111901 actcattaaa caagtctcca aatgaatcac ccacagacga cttgaagcta gtttcggcgg
   111961 cagcgcgaat cgacatctgt cttagtagtc tctcccatca tcccgccccc cccgctctct
   112021 catttcttga taccacacaa gggtctacgt caagtcaaat cacgcatggc aaggttgatg
   112081 tattgtaata atgatgagag taccaaccat cccttctatt aacgcacggt ctacctaaaa
   112141 ttagcgaagg tagagagcat tagcaagatg atggtattta ttgcctttgc gcctcgcccc
   112201 acgtgagaat ttatcaaaaa ctttggtaaa tagaggaagg tgtaaaagaa aaaggacaga
   112261 caccgaacag aagatggtgg gaagacttgg gcgaatgcag aagatgggaa gaggcgagat
   112321 ggaccagcgt tctcgtttat acattttatt atgcaagatc gccacaaagt gcaaccgccg
   112381 gccttaataa gcgagcggca agcgatggca ttcccatctg tttatcgtcg cacgcacgct
   112441 tcattcttca tataattttc attaatttaa ctaagttatt taagtaagcg gcttatcaat
   112501 gaccaatact ggtcaatgga ttatcccgat gcgattgtga tcatttgtgg tggaggcttt
   112561 attttgtttg ggcaacttgt aggatcatca tcaccacacc ttcctacgtt tatagtatcc
   112621 gtcggttgtc tgttctactg ctaagttgtt gcgatgaagc aagaggaagg aatcccaagt
   112681 agtaggtagt tgcgtgctga gcggacaagt ctttgtcaaa gaagattgag agtttaagag
   112741 agaatagaga tggcatgttg gtaaataaca aagtgtacgt agtagtatcg atctactcga
   112801 tcgccatctt aggtaccttt tccatccccg tttgtccgtg ggactcgcac tatgaacatt
   112861 gtgtacctaa taggtacatg cctacgtagt atacagcgga ctcggtccgc cccccctcgt
   112921 cccatgaccc atcctccgtc gtccaccact cccgttatcc ttacatcaaa tgctcttttg
   112981 ttctctgcag cgaggcaaat ctcttacgta acgacaaaaa gacaggacgt gaggaacctg
   113041 atgatgatag tagcctataa ataagcgaaa gtaacgaatg gaaagctggg gtgagaatga
   113101 agccacagtc caggcaccag cgatgtttat ctcctaatac ggtatttttc aagctaaaaa
   113161 tttcccctga tctttttgat ctagagtttg acgactgcac ccgaggcccg atacactttt
   113221 cgcagcgctc tttagtgtga ggaacgtcca atctggttca gagtggcttt ttcatcttgt
   113281 tgcatcgcct agacgtctat tacgatcttg ctcgaagaga gaaagtcagt tggcgaggac
   113341 tttataaagt cttcaaaatc caaatatctt cctcgccttc cgaagaaact tgggctaccc
   113401 cttcgaccag gcatcctgat aaggaacgca acaacagagc gctttttgtt ctcttccgtt
   113461 ttgagttctc accggtatca caagaaagaa agtctttcga catttcacac ctattttctg
   113521 tgaggctgtc tcgatcttat attgcttgga agcccttcgc tttgatcttt gagactcata
   113581 gaaaacagtt acatcgggcg ctagtaagtt cacattttcc acatcctcgg ccttaacaac
   113641 tcttcggctt cccgctttgt tctcgttata tcccatccac cctacatcac atcacacaca
   113701 atgccttgtg ttggggccca tctttcctgt atttgctgat ggcctgacat agcctggcat
   113761 tttcaggcgg ttacagtacg gataattttg accgttaaca accccatttg tatcctcgtc
   113821 gcattttttt tcctttttcg tatctctatc cttatatctc gacgctttac gacctctgcc
   113881 gaaagggcaa tctatctgct tttagtatca ggtactgcac ctgacgaccg gccatcaacc
   113941 atcaaagact catcaatcat cacctctcct aatcacgtcg taactcgatt gatcggcgaa
   114001 acaatcagtg agtcagggcc tctgaatgtc gtgaaactct ttgcttcttc aagtgtggct
   114061 tggctatggc tgtgatattt ttcgagcttt agcaatgata cgctacccac ggtcttattt
   114121 gatctaccct tacaaaggaa tggaagccta tcagctccca tggggcatgt gagatccaaa
   114181 accctcgacg ccaccgccca tgcaatcgct cgggagctgt gagcatgctc ttgtctctct
   114241 ttggagctag cgcgctctca tttcgggttt gctctgtttt ccttccttct tcacctccgt
   114301 tttcccttac tgggcaagcg tttcaggtcc taggcgacgg caatcacgag gggacgtgcg
   114361 ttgcgatggg agcttgaaga cattattgcc atcaatcatc aatcacagtt acttaatcat
   114421 cgacggatca tggttttctc cgcttctctt ctacatctta cgtgacggca agccagtgca
   114481 taaatattcg gagcttttca gttgtcatct gctttcccca tccatctttt cgttctcatc
   114541 ctttttttcc atttagtcgt gttattaagg tactttatgc ctggaaccat agccatactg
   114601 catgaccctt agcctacacg acagctaatt cacaaatctt gccgctcaga catttcacat
   114661 catgcctatc aaattctcca agccagacac caaaaagtgg tttacgttgg attattggcg
   114721 actcgacact cctccggcct cctatgcaac tcatgatggt tggagtaacg cggatgtcga
   114781 tgttgttcct gtggagcaac ggaactggcg agcgtgagta tcacgaagta ttatcaaatg
   114841 gcgaagccta atccttcaat agtatcaact acctcttctt gtggttggct gatggtgcca
   114901 atgttggcac tatgcaacaa gccggctcta ttgtctctct tggtttgagt tggagagagg
   114961 cttctgtcgc catgtcagtt caatggcaag ctacaagggt tatcggctga tctatcatct
   115021 agcgccatcg gcaacattat tattgctgtc gcggtcaccc ttaacggtgt gattggctct
   115081 cgacaccatg tccccttttc cattgcctct cgtgcttcac ttggttttta cttttcttat
   115141 tttgccgtca tttcccgtct cgtcctgggt cttatctatt tcgggtgagt tctttccaag
   115201 gtccacgccc atcactttct aatctgcgca gtattaatac attcattggt gcatcttgca
   115261 ccctcatctg tctcgaagct atctggcctc agctcaagac ctacaacaat accatcccca
   115321 cttcccaggg tgttactagc aacaagatga ttgcatactt tgtcttctgg gcaagtgcgt
   115381 atttttaatc tgcgcgccat tgaagtactg tgctgaagat gtcttcagtt caattcccac
   115441 tcgtgatgat cccccctagg aaaatgcgat ggttattctt cgtcaagtct ctctttgcta
   115501 tcgttgctgc tttcgccact ctcggctggg ctgttaagca ggctggcggt ggcggtccca
   115561 tctttcagca acacaccgct ctcacaggct ctgccaagtc ttgggcttgg ttggccggta
   115621 tcaacgttgc tatctccggt aaaaccactc ttgccatcaa cattgtaagt ttaaccgcac
   115681 tctgttggcg acttttgctg atgtttcgta gcctgacttg actcgatatg cgcgaaagac
   115741 tagtgacgcc tactggcaga ttatcttcat ccctatcgtc tactgggtat tttccttcat
   115801 tggtatcgtc attgcttctg ctggccaggt aagtcatatg ttccactcaa tcgccatatg
   115861 ctaatcatat tcaggccatt tacggcaccc tttactggga tcccactagt atcgtcgccc
   115921 tctggacctc tcgagccgga gcctttttcg tcgcttttgc cttcggtttc gccactctcg
   115981 gtactaacat ctctactaat tctatcgcca catctaacga ttttgcattc cttattccca
   116041 agtggctgaa tatcaagcga ggcgccttca ttacctctct tgtgggaggt tgggccactt
   116101 gcccttggaa gatccaagct agtgcgactt gtgagttgca tatcatctca taccttgctt
   116161 tctcattact aattgtatct ttctgtagcc ttgaccacct tcttgtcagg ttacatcatt
   116221 gtcttggctc cattggcagt aagtctgctt ctgtctccac catctacgct cactgacata
   116281 caatgatctt taggccatca tgattgtgga ctactgggtc cttcgtaaga cccacttaca
   116341 cgtccctatg ctctatcaaa atgaaggcat ttacaaatac acctggggca tcaactggcg
   116401 agcttttgta actcttgtgg ttgttatccc cgtcaatctc cctggtctta tccatgccat
   116461 caaccccaaa gttcccatcg gcaacttcag ctacttctgt acgttcgcag gttacttatt
   116521 aataggacaa ggctaactta attatgcaga caaggcctct tggctcacat ctttcttcat
   116581 cgccactgga gtctatctta tcctttcttc catcttccct cctacctcta ctttcgttga
   116641 agccaccgtc gagagcatgg atgaggacat ttcagacccc atgaccgatt ccaagggctg
   116701 ggagaaggaa aacgggcgag agtctgacag gaactacccc atcatcaact ctgtctaagt
   116761 ttcatgtcgc cataccgcac cagaaagaga atagaatatc tttatcaaga ggatttttgt
   116821 gaacagtaaa aatatcgttt acattctttc acattacttg tttttatagc ttttgatcta
   116881 tcagaggata gtgacatttg tgttatatat gggatgtcat gaacttataa ttataactca
   116941 atttatactt cgtttttggg tttttggtat gcactatatg ttttatgatc gacgtattta
   117001 ctcgcgaggc atctctatat gtcctctggt agagagtctt ctggtaggga taaaactaga
   117061 gaggccattt gttcactgcg tgacatgtgt gtcccatggc ttcaaactat tgctctgcat
   117121 tttatgccac actggcgagt tgcatgatga gaagaaaggt tgttactgct tacccagtta
   117181 cttcctatgc gcgctttcgg ttgactagac actgatgata gcatcttatc tacccattat
   117241 tatgccgtgc atgtattctt tcgttgacaa acaagggagg cagaaaggaa gagccggagc
   117301 tgtctgtcac taatcacata attcttctct gccacaaacg ccaaacacct cacgtttcta
   117361 tgccaggaca tttgtacaac gatcgtcttc atctaatttc ttcctcgtcc accatatcaa
   117421 tcaaatgtta ccgctttctc tcttttctac cacctcagtc aaatgttaca accagtttcc
   117481 catgcatatc cggctacacc taaattaaca acgcacagga ttattctcca gcaacttacc
   117541 tggtgataaa cggtgagcaa atcgtttact tcatcgagtg aaaatgtcct aatcttgctt
   117601 ttcacgtttt tcattgacgc tagctcaagg agctccttgg taacttctat agtagcgcag
   117661 aatccaccta cgacccgtat atcccgcaag acaatgtctt tccaatcaat ttcaatcatc
   117721 taaaaggtct ttcagcatag gacctgtgga aagaaaagag atgcttgcgt gttacttaca
   117781 ggctggttgc agcagctcaa agctacaaca acgccatgtt ttgctgtcat cttgaatgca
   117841 taatcaaact catgcgcttg ggggcctgtc atactgtcag cataaagttc agcgaagttg
   117901 gctttgccaa gtctcaccag tcaccagcat tgcatccacg cctctcaata gtttctcagg
   117961 gaacatttct tcgatcgcct tgagaccctc ctcaacagtg tgatcagagg aaagggtgag
   118021 atcaggggac agagagccaa gtgctctgat atgttcaagt ggttgagggc gattgtcgat
   118081 cgcaatgact tggtggccct ttcattcata gtcaatacgc ttccggaggt catttagaca
   118141 gcgaatcgga agacgtgcca tggctttggc gaattgaaca ccaagactac ccagtgcacc
   118201 tattccgtag atgcccacta ccgatttcgg ggggagtttg gcagctttca acctgtgcga
   118261 tttcagtctc ttcgttctgc aggatgtcgc aaatagcccc acccattgta cactctgaag
   118321 gggtggagtt aggtgctggc tttaccgatc aagggtgaaa gttactgacg tagccccaga
   118381 gcacataaaa gctgcagcct gagcaaagtc gatattttcc gggacatgta gtgtgaaacg
   118441 ttggtcaaca atcatgtact ccgcaaaggc gccatcaaca ttgctaatgt gttggcaaag
   118501 tcctcagcat tccgtctagg aaacacttgt caaagtactt tacaatccgt tcattttaat
   118561 gttatcacag aacacggcgc tgttgttctt gcactctcca cacccccctg cgcgtattat
   118621 tgattgacat tccaaactaa agagacaaaa actcaccaca gggctcccta aagaggagag
   118681 ccgcgactct gtctcctacg gtaaagtttg taacatctcc ccccgtagcc tcaactaggc
   118741 cagctccttc atggccacct gtgaggggta ggggggagcc agtgtagccc attttgacag
   118801 cttcatcctg accatctagt tggcactcga ggcaagataa ggcagatgaa cgacatactg
   118861 tgtggcagaa gccggctgcc ttgacgcgaa gcagaatctg attgccttga gggactggct
   118921 ttggtatgtc ggtgaccttg taaggggctt caaatcccac gatttgagct gctttcattg
   118981 attttcgttt cagatggttg atgggctgac ctatgggaga gtagaagatg tggcgggtta
   119041 gaaagcaggt gcggcctcca tcatttatat cagtgtcatt ggggcccggg caaccggcat
   119101 tgggcgagtc accatttcac gttagtgata cacatgacaa ggccaaaaga ttgaagtggt
   119161 gtaggctcga cacaagccct tcgacggaca ttcgccggtc tccggtcaga ggaggggctc
   119221 cactgtcccg ggcgcttgtg tcaagcctac tgtaatgagc cggacccgtt ttgagtgtta
   119281 tcactggtca gacatcaaga agctacttaa ggggcttttg tgtatagtgc taccttcttc
   119341 aacattctga gtcccgcaat gaccgaccat gtttcaagcg tccaacagga cgaacaacaa
   119401 tatgactgta agtgttgcct gctcgtgttc ttgtatctca tctaggagtt cagtgtctga
   119461 ttttttgctt ttcccacagt ctttctctat ggtaccctct gtgtacctgc tgtacttgcc
   119521 aaagtattgg gacataaatg caaaaacatc acttttcagg acgctcttct acctgtacgt
   119581 tttgcaggta atcggcggag agcgactaac gcgctattta tagggctaca ccaggcacaa
   119641 agtcaagaat gagatgtatc cggccgtaat cgataaagcc cgtactgatc aacttctgaa
   119701 agataagtga gtcccgaagt tccgaaaagt ctgtatggga cgctgaagga aatgtagccc
   119761 tccgaacgct aatgaagtca atactcgagg aacctacgta aagggcctct cctacgccga
   119821 tgtccacgct cttgacatgt ttgaaggaga agagtactct cgtctccgcc tgccactgca
   119881 aaccctctca caacccgcca acattcaaga acttcccacc gagctcgtca atcctaccgc
   119941 tcgcgagggg cctgctttca aatcttcctc tgtcgaggac gagcctgtag atgccgagaa
   120001 gaaggatatg gtggaggggt gggtgtacgt ctgggctgga tctttggaga ggcttgtccc
   120061 ccagatatgg cagttcgaag cgttcattag ggcaaaagca tcggagtgga atgatcttcc
   120121 ggaagagtgg tttatcagcc ttcccccgga tggcgagcta cagccccccg ccattgagag
   120181 agaaggattg caaggagaag aagaggagat tgaggatggg gatcaatcga agctcaaagg
   120241 gagaacggct gaagggttcg aggagtttgg caagggaatg ttaaagcact gggcttttcg
   120301 tcctggatgt aagtttcatt tgccaaagct aaagagccga cttgtactaa taagatcaga
   120361 tgtcaatctc aatcacggtt cttatggttc acctcctcgg catgttttaa actatatgcg
   120421 agatctttct gaagaaatcg agtcatgtcc tgacctcttc ctgcgtcgta cctacttgcc
   120481 actcctcaat gaaactcgcc aaaaagtcgc agacatcatt ggtgccgagc aaggagaggt
   120541 ggttttggtt cccaatacga cacatggcgt gttcaatgtg ctgcagaaca tcaaatggga
   120601 tgagggcgat attattgtaa tctgtaagtt atttatcttc tgtttcaaat gttactggaa
   120661 ctccgacgta gattcaacga catatggcgc tgtcgcacag atggcaaagc actttgccga
   120721 tgttctcccc atttccctcc acattgtgtc cctcaccttt ccttgcaccc acgcagagat
   120781 tctcaccgct accgaagacg tattggccca gtataataag gtggcgattc ccaattacac
   120841 cggacaaagt agggccgaag gtaaagatgg gaaccaccag agagttaggg cggtgctgtg
   120901 tgacgtttta gccagtatgc cagggtaagt tggtcttgtt catgttttgt gccattatca
   120961 ctcatgagac ccagcgtgct gtatccatgg gagaaagtag tgaccctttg caagaagtat
   121021 ggtgcactct ccatcatcga tggtgcgcac gccattggtc agattccttt agatgtcaag
   121081 aaggccgatt gtgacttttt cgtttctgta tgtcaaacat cctctacaat gcatcaggat
   121141 gctgacagag gataaagaat tgccataaat ggctcatggc tcatcgcggt gcagcactac
   121201 tttatgtccc cacacataat cagtacctca tgcggacttc catcccgaca tctgcaggat
   121261 atgagtctag caagtatcct actcctgggg gagtgagatg ttgggattgg gcctctcaag
   121321 taggtctttt gttaatgcta ttgttcatac agggatggtc actgatgagc tggaacagta
   121381 tgagtggaca ggtacacaga actggactcc tctcttctcg gttttgtctg ctatagaatt
   121441 tagaaagtca atcggtgggg aacaaaggat aatggattat tgtcaatcgc ttgcaactga
   121501 gtgcgtctcg attgcttctt ctgctgacct gcactgatat catgacagag gaggcaaaag
   121561 gcttaagaaa aaatggggtc ctcttaccag cataatggac accaaacccc cttctcttag
   121621 tgttgctatg gtaaaccttt ctcttcctca catccctgca cccaatgatg ctgccgacca
   121681 agtgaaacaa ctttgttact ttgaagaagg gatgtatgag gcaaactgtt tcgcagcctg
   121741 ttatgtgcat ggtggaaagt ggtgggtcag gttctcagct caggtatgga atgatgtgag
   121801 tgtttttcta tgttggatgc tgggaatgaa agtgctgatg ggagtagttg agtgattttg
   121861 agtatgttgg aaaggtgcta gagaaactat gtctggaaat caagtatgtc tgagacctgg
   121921 tattattttt acatataggc tgatcatgag tagaaatggc aaatatcttg aacaaaagag
   121981 tgtcaaacca gtgagtgatg tgcccaaaca ggacaaatga tcgttttcca caaccagaga
   122041 cacagtgaaa tttgtaaatc ttgtgtcagc aacttgtcta ccattcttct gcctactatc
   122101 tggttcaatc ttatttgctt gtcaagcatg atatctcaag aatcaaatgg gatgaattgc
   122161 tcaaggtgac gccattctgt agcatctcat gcacctgatg tgaaatgtat tttgtatgat
   122221 ttcatgtcta cctggtaatc tgtgaaacta aatctttgtg cagtttatcc aatcaggctt
   122281 ttcttagtag aagaatcgct tatcaggcct cgactatatt ggtgggcatc atgagggtca
   122341 tacattcatg tagccaatcc atctttcatt aacctggtcc caattgcctc tacaatgcat
   122401 cgttaaatct cccctcacac tgtaaagata gtgaataagt acccttcaca cgccacaagc
   122461 acaaaagcat tttggcatct gggaaacagt ggttggtggc attgatttcc gcccaatcct
   122521 tatccaaatg gatttttttg ggcataactg ggacacttgg cagacttctg caaggaagaa
   122581 aaccaaagtc tgtgttcgct gctcaccaga tgagatcaga aggaacaagc cagttaaaat
   122641 caactcacta ctgcagcctc gcaaattgct ctcttcatct ccaagatcag ataaaatgca
   122701 gggacaccag cttcaacatc caaaacaatt gcatagagct cgaggttgtc gttgttagta
   122761 ccaactatta ctatcagctc aaaagtaaca aagcaacaat tgaaactcac aaataatatc
   122821 cagcgatatc tcttccacct taattccctt gctgtgtagt atagtgtcca ggatggttcg
   122881 cagcccaaag cctattgcag tgacaccttc tggcaccatg tgccatgagc ctgcatgaag
   122941 tagaagagat aagagatcat aggagggagt tatgtaatag aggaaggcaa gattgtttca
   123001 gataagaagg cccagctgga cctctgagag aagaactgga cctccaactg gacctctgat
   123061 agaagaactg gacttccagc tggaggtcca gctggacctc gaaggatata aatagatttt
   123121 tgtagaagta tataaagggg agctctgtcc ttgatcttga tcttcttccc ctcgaagatc
   123181 agtatttcat aagttacttt gtgaaaggtc ctcaacctcc cattgctcac tctcgcctta
   123241 cctggaacca ccgtcgactt aaaacatacc tcactagtat ataaaattgt ctgatcttcc
   123301 caagcacata tatgtcacgg gcgtcacgtc agtcagcgta gctgcccggc gctcaactcg
   123361 gatgatgtag aactcgacga atgaaagtga aggattcacg cctagcagag ccggacggaa
   123421 gaattgccag gctgatggaa cagaagctgg acttagaggg aggaatagcc agggcctgaa
   123481 ggagcaggag ctggactaag ggctgattga agcgacttaa aagaaaagaa tgctcggagg
   123541 caaggtagtg agaaaggaca acagtattga ttttctgggg actatgaaaa ctacgaaaag
   123601 ctatcttctt atatatcttt ccttccttct gcttactcat ctctctcggg agaaagttat
   123661 cgctaactcg tggcggggac ggagctgtcg gaccgggggg aaatgaacac tgaccaagtg
   123721 ttggggaaga agaggagagt gctgaccagg cgaaacgaaa gaagaggcaa gccgaaagat
   123781 gcctcggttg attttgcaag aatcgggcga taaatcgcgg tcgtctgagg tggaggtttg
   123841 tttggttact tcggggacga ggtggaataa tatcccgttg cccggttaaa gacgcctgag
   123901 agtgtgattc ttgcataaca tcgtgacacg ttgaataggt ataatgggat caaatcttct
   123961 gttttcgtgg tttgaggtta aaggtctgga caaatctttt gtcgatgaag tttgtagagg
   124021 caccggaatc gattaaagct tgataaacat tgttgtgaaa gagaaagtcg attgtgagtt
   124081 ggtttttgtt gtttttgtta ttatcttcga gagtttggag atattcgcag gagtctgtac
   124141 tggctggttt gatagtacgc tcttgttccc ggctaccttc ttcgactttg gcaggcaaga
   124201 gcatatctag ttttttgaag ggagagtagt attggattgt tgcgagggga ccactgggca
   124261 cttggcgact tgatggtttt tgtcggtgca atagaggcag aggttatgat cctttcgcct
   124321 ctgatattct tctggagtca gacgtccacg tctggttatc ctagctgaac ttgggacaaa
   124381 tgcagccctc agattgactg ccggcgtcac ctctttattg aaggtggtgt tggcagtggt
   124441 agaccttatc ggcatgctat tcgccacaga gaaatgtctg aagttgttgg ggcgattgtt
   124501 attgtaagag gtgcgggtgt agtcgcttcg tgtcacgagc ctgcacaaag aagaagagac
   124561 aaataagata tcataggagg gagttacgta ataggaaggc aagatccgat tcagataaga
   124621 aggtccagct ggacctcaaa ggatataaat agatttctgt agaagtatat aaaggggagc
   124681 tttgtcctcg atcttgatct tcttcccctt gaagatcaat atttcataag ttactttgcg
   124741 aaaggtcctc gagctcccag tgctcactct cgtcttacct cacaccacct tcgacataaa
   124801 cttactccac tagtatataa gcttgcctga tcttcccaag cgaatatacc tccaccctat
   124861 accatacgcc aacagacaag tgtcaagagg tatatcatac atatatctca ttgcttagtt
   124921 aaactacggc tttctatctc gtctccaagg ccggaccttg ttggggacga gtcgtaacag
   124981 gatttgaggt aagaatagtg ggggttaatg tgtgtaatca agagcacata aaaaaaaacg
   125041 cactgaaaca ctttgaaatc atgcatcatg cattctgaag catgaagagc gagtttgaat
   125101 tgtaagtcaa ttaaacagtg tagtacaaaa ccccagtgta taccgtccgc tgccacccta
   125161 cacccctgta tagttataag tatgcttcta aaaaatgtaa aaatggttcc gttaatatgg
   125221 ctaagaagcg tgctcattat gggattagtt ttactaatcg tcgattagat gttgtgtttt
   125281 attactcttg catggagtag aatccaatgc atagagtacc accgctggat agtactgact
   125341 tggggctaca tgtacatata attatcatca aggtcgaaag tcatgcatat ggaccttgta
   125401 gtatatggcc ttttactatg gaggatagga tagtagctct tctagtagta attaacttat
   125461 taagtaatag tggtccgcgg tgagtcccgc tgctggccga atgataataa taataaaatg
   125521 tttatttatc actgcacgtt gtagggaaat acccgggtct cctattggtt aaacgatcca
   125581 gttggttccg ttccactgcc acccacagca gataacagaa tatcgactcc ttggtatcaa
   125641 ttctacagaa tacaaagcct tcctaagttt ggctgttggt ggtcgatcta cctagtaatg
   125701 atactgatga taggtcatta ggttgtgtag tggtataatt gaactcggat ctcatgtcga
   125761 gttgttgtgt gttgtgtgtg tatcaaataa tatagcaata taggctccat gagtgtaact
   125821 aacagttatg tacctatgta cttgggatct ctgtaagctg tttggcagct acccatggaa
   125881 ggggtagtta ctgtcacagg ctctactttg ttctctctcc tccttctccc tgatcccctc
   125941 cgatatatct caaaccatct ctctctcttc tctatctctc ctcactatca ccggcggtag
   126001 cttccgactg tgatgtggca ttagtctatg aggccgaagg ctcattccac tacaacgtcc
   126061 cgccatctta ctgtctatct tttaatttcc ttctatactt ctcagccatc actttcagct
   126121 attagactat acttcttcca tcagaatttc tgagccataa tatttttttg tattctcttg
   126181 acgtctactt atcactttat cagaactcag tcaagacatt ggcccaatac accaaaattg
   126241 cgaagaggca gccatcaggt aaagtattgt agagggcttt gtagctgact cggaaccata
   126301 ggcagtcatg tggtagtcaa ctggtaaaca ctccataacg aatacttttt actccttgga
   126361 tgctctgatg aatgtccatc agcaagctac agcaagtcct gctgtacatc tactacttga
   126421 gctctggacg gagcccttgg acctagatga acatatgttt gtacttggcg aatgcggttg
   126481 agagctatgt tgctactccc catttgtgct gatgtcaaca gaactgtatc gtcaacgagg
   126541 cttacattct ctgatggtga aagcaaatac agctggtgca acattccagg tactggcata
   126601 cagcgctgct ccttcgaatt cgcactgaac gaaaattatg tcctcactgc ttttaccact
   126661 catgtaaaaa tctcaacaat ttggcaattc attatacaat gcagtttata aattcgagag
   126721 ttgacgacat tatagaaaga tggtgatgaa gagccctgga tccacctttt aaaatccctt
   126781 tcctccttcc tcatcaaacg aactgcgatt ttcgaactat tcgacagcat acagtgtcac
   126841 tgttgaagct accctcatgc cccctgttcg acatcatcct tgttcggctt gaatgataag
   126901 ctgttggttt ttgactttca tcagttatga tgggcagttg cttccttatg cccttcattg
   126961 ggcgaaaata tccatcgaca gcaacctcca gaattttgtg agatgataag catggtgaat
   127021 tccacaattt cagtgcggag gtgatgaaca gctgtcctgt ctggctgcca ccatacgctg
   127081 tacgagtcat gaatgtcaag acctctaagt ttctctttat gtattcttca actgaccata
   127141 gctatagact ctttgtaggt gctccatata tttgatcaac cagatacctt tcttcattag
   127201 tctaccaagc attgcccaag accgaccgga ttctcatcgc ctctcaggac aggcaactct
   127261 ccggaagagg aagatgagtt agaatgctca tcatcaaagg gatgaatgtt ttatgctgta
   127321 acttcgagat tggtgactat cgatgggaat gttgaggctt ctaatttcat tgacgttttc
   127381 tggcaaacag ctcattcgta aaataaactc gctcgacaag gtgaagcagg agacgctcgc
   127441 ttgagtgtat cagttggtgt tgtcgagctg tctttatgaa cgagactaat gacctcctac
   127501 taggactata tctctctgcc ttgtccacag tagacgttca tatcagtcgc aacctctgag
   127561 atagataccc ttaacgtcat atcctactct cccttcttca cattaccttt cggacacatg
   127621 atggtagatg tttagtcggg cttggcgtgg tatgcttagc tgatgcatga gggatcggtt
   127681 aagtcgtatc cagggactat gaggagccct ctttatgagc aacaaaggta ggttcagatg
   127741 atgtcgatag tattggaagg gtttgttcct tcacattgtc tcgttgtttc tggtctctta
   127801 ttgtgaaccc taaatgtttc tttcagtctc gctttataat acgaagtgaa aaggcatttc
   127861 tacctctctt acagtgacct cccttacagt tcacattgat tgatacatgg atccatccct
   127921 tatgcttttc tatgctaaca ttagtcaata tcacttcgga cgagcaccga gcccctgcct
   127981 gacctcttcc tatggcctgt cgctgccttt cgtgccttcc tcttcctccc tcgttgaact
   128041 tcaggaactg ctacagcagc tgccagagta gggggtgcag gttgactgat aaaaggagag
   128101 gtggatgtgg acggtatggg tccagttgaa gtcggcacag caaatgatga attagaagtt
   128161 gctaacaagg actcattaag ggaagaagat gaaaagactg agacggcggg tggttcttca
   128221 tcatgtgaga ctgtcgaggg agaaacgctc cgctgagaat ttggcctctg gatgacctca
   128281 aagcggatct tctccatgat aaacccatcc gttaccaagt cgagttcttt cgagttcttg
   128341 gaccttttcg agatgatatc gccagggatg gatgggatca tgactagccg aagaccgtaa
   128401 tcatgaagcc tgctccactc tactcgttgt gggctggtga ccgtcaagcc taatgccttt
   128461 tgggcaatgt tcaatgcttt ggctgacaca aaattagtca acaaccattt ttatcgttgg
   128521 gaagtctgtg tgcactcact gtaataatat aaagttacat ttttgaatcg cagttccttg
   128581 tcgggcttgg tatgcgcggc tattgtcata tggtctgtca gttgaacata tcccggagaa
   128641 gatctgggaa gaacctatgc ttgcgaagct ctggattgag caaagcaccc ccaagcactt
   128701 cgtctcccct taacgctgct cccattttaa ctacctcttg tgtggcatcg aatgtctcca
   128761 cagcatttag atagcttaag gccgagggag tggcaatggc ttcatcatgc cgctcatccc
   128821 caaggtgggc agaggccaca aaaaggatag agctgacctg gtatcaggcc tccatgacat
   128881 gcatctgaga atttgaagtc agcaggaaac tggtcataac aaaaagatac cattaactaa
   128941 cccacttcca ggtctcattc ttcattgctt tgattttctt ttccctttca ctgacagaca
   129001 gggcggtgtc tctcgccgct agctgttgtt ctccataaac atcttcttcg agccgtctcc
   129061 tgagctcaac atcgcccagt ctctccttct gcgctttgta gagggctgag ttccttttaa
   129121 ctcttgtaac tagagcctgt gtcttctcat cctccttaga tgaaaagtct ttcttcttgg
   129181 aaatgcgttg gaaagtggac gtaaagttgt cctcgttgat ggaggctacg gaggccgctt
   129241 tgtcagaagt tactgtatac catagcatga ttcagtcatc gacttcatac atacagcttt
   129301 ggtcgttttc caatgcttcc aacagcctct tggcgatgtt acttctttgc cacagaatcc
   129361 aagtactcat agctcgagtc tgtttcgtct cagccagccg cctctccaaa gcagtgagag
   129421 atattttgtg caggtcgcag aactcctcca taacctcctg gagtttctgt cgaagactgg
   129481 gaatatagga ctgcactttt gcgggaatgg tggatgatcc attctgatga ctgacgaagg
   129541 aacacgcact ccactggagt tcattcgtgt tgttcggatc atctgggtct tggtcataga
   129601 taaacgagga gagatcagct gtgtttaagt ttttggcact gtcgacttgt tggagaaaca
   129661 ttgaacactg gaaattttcc gcaacgaagt gttataaaag aggcgaatga tatgagtgga
   129721 tgtatatggc aatactgatt gaatgatacc agagacagaa gacggaggac actgcaagaa
   129781 gactgagatg cgtgagaacc aaatagatcg cacgcacttt tttaccagat caggcaactc
   129841 catccggaat tttggacttg tggcacccag gccattccag atgtaacgtc tgtcatactt
   129901 gcttgttgct cacgcatctt ctctttcttt gttcgtttct ctagccaaca ttgggacgtc
   129961 ccagagctgc gtatgtctcc aataagcccc ggcttcccaa tcctttatcc ataaatccca
   130021 acactgcctc atacgacgcc agcgtgggct tcgtttggcc accactctta ctccaactcg
   130081 gtgctcaagt tgtgcaatga tggattgtgt aggtggcagg ctatccatga agtaacatca
   130141 tatgtctttc agtatgtaaa tattgagctt atatgctact catgaatgaa ttttatgtct
   130201 caccaatgac aacatacagg gtgagtgtcc gtgatttgcg agctctattt catcgatcac
   130261 tgcaacgaaa ggggactgag ctcttcctgt aaataaggat atatagctag ttaggcatat
   130321 acctgaggag ttcatttgat aggctggaat gacaaggtac tccaaatcac gacgctgaca
   130381 catagcagac aagtttcata gtccatcaag tcgactgacc gtttcgcctt ctgaagctta
   130441 cgttcatctt gttgcaaacg gatcttaaga gtagcccatg atattgtcag aatgattgat
   130501 ccaacctgga tctggaggca tgggaaatgc tggtggaggc atgggaattg ctggtggagg
   130561 catgggaaga agggaagatc aaattacata agctagaaca cttgtggtat tgaaacaaat
   130621 aaagaaaaag gattgtagaa tagttttcat gcaacttaga catctctggc aatcgacacc
   130681 gcgtgctcaa gctctctcta gacaactcta catctgacag gttatgagcc ttgctgctta
   130741 acagcactag actctagcaa acacatcagt caaccaacac aaatcctgca ggtcactatt
   130801 gcattagtac cacaggtact gcttgatacc aacaagtggt gagaaaatct ggtgcccccc
   130861 agtggcaagt cactgcgcct agtgcacaag caaacttgcc ttgcgttagc taagtacaac
   130921 ctggacgtct ctttatctct attacaaaga acacgactct cacttctcct atagagctct
   130981 gaaagctaca cacacatcat gtccaacaat acagacaaca acacatctac cagggggtca
   131041 tcttaactgg cccccagaac tatgctgaat gggagctatc tatcaaaaca tctctcatcc
   131101 tcaaggacct ggagattggt actccagtca gccttgacag catgtcctcc aaagaggaca
   131161 aggagaagta caagaggtcc aggcaagctt ttgcccttct tatcaaatca ctctcaccag
   131221 aagtccaggc atccctccct gccaacatac gatctgtaga gacagcagac agctcagcac
   131281 tctgggagga gctcaaatcc cagtactcag cagcagtggg cgcaagacag gctcaacttt
   131341 tgcaacaaat gtggatatcc cctgtcattg aaggagaaga cccaaacaag cgcatggcag
   131401 aaatcagatc agcccatgct cagatcaaca gcagtggtga gaacctctcg gaccgaatgc
   131461 ttgcctatgc catgacccta gctcttccag aatcattcac cactgtcaag caaactctct
   131521 ggctcaggga accacttacc tctttggctg tgcaggcagc agtccaagct gagtggacaa
   131581 ggaggtccag tgaggaggta gcaatggcta acagggtgca agagagtcac acccaaggca
   131641 acaaaagcaa tagaagggcc aagccaaggg aatggactga gaaatggtgc agtatccata
   131701 aagtgcctac tcacaatacc agagactgct ctctcaggaa gttcagcaat aaccacagcc
   131761 agtcaggtca ggctagggta gatccacctg gccatgccta tcttgttcaa ctggctgata
   131821 ctctctcaga atggcatcat aagctagggc atttggggat tgagaaagtg gttaggcttg
   131881 caaaagaagg gagacttggt cagaataatc aattgaagaa tacaaatgct ggtgatatca
   131941 aagatttcta ttgtgaagcg tgtattaagg ggaaaactgg gcgacttcct tcaccacctg
   132001 aacccaacat cagagcttcc aggccacttg aactattgca tatcgacatc tggggaccag
   132061 caccagtcgc ttccaaggga ggtatgcgat acttcctgac tgtctatgat gattacagcc
   132121 accggatttc cctcaccttg atgagaatga agtctgagac actgcagagt ttcaaaaact
   132181 ttgtcaatca tgctgaaact cagactggtc ataaggttca atctattcgg tctgataggg
   132241 gcggagaatt tacatcagca gcattccaga ggtatatcag ggagaaaggg attgagcatg
   132301 tcatggtgcc acctgatgct catgcacaga atgggagagt ggagagggcg catcttacta
   132361 tcctcaatgg tgtgagaact ttgcttgtgg agactggact gccagctagc ttctggggtg
   132421 aggctgctaa atacattgcc ttctctcgca actgctcctt tgactccaac aatggaattc
   132481 cctttgaacg ctggtatggc aagaaactgt tgttcactca acttcacgca tttggagaaa
   132541 agattttctt tagggattat accaacacca acaaattgaa gcctcgctat cgacaaggaa
   132601 ggtttatggg gtatgccagt gatagcagca cttccagtta tcgaattctg gatgatgaag
   132661 acaagaagat caaggtgtca agggatacca ttttgccaaa gaagctggac attcctcatt
   132721 ccaagatgcc agcaaggggg agtattctta ggctggagga gtgggatgac aacaagaaca
   132781 gagacacatc aacacatgct caagatccat tggcagaaat acctgacaga atcatccctg
   132841 cccccatgga agtgaatcct caggatgaag taagacctag agcagttcca gctgagcatc
   132901 aatcacccat ggagcttctt cgtaggctgg caaggtatga cactggaata cagcaacaac
   132961 ctgaggcatc accatcatcc aacgcatcag aagagacaaa cagtgatgtt tcatccattg
   133021 atcctcttgc cctgactgac aatccagaga cctggggtac tatcgcaaca gctctgaatg
   133081 ctatggcaat caacacaccc aatacctaca gagaagctat tcagtcaggc gagggggagc
   133141 agtggcatca ggctatgatg gaagaattgg aaaagatgga gaagtataat gtgtggaagg
   133201 tggtggatag ggcaccagga cagagggtcc tgaaggcaag atgggtttat accaggaaga
   133261 ttgatgggac aacagggaaa ccagcagcat acaaggcaag atgggttgcc aaaggatttt
   133321 ctcaaaaggc tggaattgat tacaatgagg tcttctctgc tgttgcccac aaagactcga
   133381 ttagggtatt cctctctctg gtcaaccatc ttgacatgga atgtgaccag gtggatatca
   133441 aggcagcctt tctcaatggc gatctcgaag aaaccatcta tcttgaagca ccagaaggaa
   133501 gcgacatccc agcaaacaag atcctactct tgaacaagtc actctatggg ttgcgacagt
   133561 caccaagatg tttcaacaaa gcacttgatc agtggttaaa gtctcaaggg ctgaagccaa
   133621 ccagagctga cccctgcttc tatgttcgac gttgtgaggg ggaattgctc atgctctctg
   133681 tccatgtgga tgatcagctc attgcctgca attcaagaaa gacattggac gaattcaagc
   133741 aggcacttaa cagcaaattt gagtgctctg actctgggcc tgctggctac ttcctgggca
   133801 tcaatatata ccgggacagg ccacagaaga aactctatct ctcccaagag cattatatgg
   133861 agtccctgct tgaccgcttt gacatgtcca attgcaatcc agcaaagacg cctcttcctt
   133921 caggcttcaa accgattcca gcaacagatc aagagcatga gctagcacaa catcgaccat
   133981 atccaaagct agtgggctct attctctatg cagcaacagt gacacggcca gatctagccc
   134041 atgcagcaag tgttctgtca agattcatca gcaaatggaa tgagtcccat tggcttgcag
   134101 cgaaacattg tctgaggtat atcagaggca cttcagatct ttcattgacc tttgatgccc
   134161 actcaagcaa gcgagttgca ctgggatacg ttgatgcaga ttggggagga gaccttgaca
   134221 caaggaggtc caccactggt tatgttttca agatatatgg aggtgtagtt ggctggaagt
   134281 caaagaggca acctactgtg gctctctcaa ccacagaggc cgaatacatg gcctccgctg
   134341 atgcagcaaa gcaggctatt tggctaaggc tgctcttgga tgatatagga cttggcctgg
   134401 gtgatcagcc actccagctg ctcaatgaca atgctggggc cattgccttg tcaaagaatc
   134461 cagtgaacca tgaaaagtct aaacacattg atatgaggca tcatttcatt cgagagaagg
   134521 ttgaggataa ggctatctca cttgcccatg tcccatcagt ggaaaacatt gctgatcttc
   134581 tgacaaagag ccttccagct gaagcttttg tcaagttgtg ccatctcctg ggaatgcaga
   134641 ggttggatca agggggagtg tcagaatgat tgatccaacc tggatctgga gagatcagta
   134701 gggatctgga ggcatgggaa ttgttagtgg aggcatggga attgttggtg gaggcatggg
   134761 aagaagggga gattagatta cataagccag aacacttaca atatcgaaac aaataaagac
   134821 aaaggattgt agaatagttt ccatgcaact tagacatctc tggcaatcga cactgcgtgc
   134881 tcaagctctc tctagacaac tctacatctg acatcgataa cggcaagaca ggggacagta
   134941 ctcaccacgc gtcgagtcgc ttcaaaggct gccttctctg cagggctgaa cgaccatctc
   135001 caaccagtcc atccctcggg gaggtgtccc ttatgcatct tgacagcctt gtagtaagct
   135061 ttctcagccg ccgcattcgg aggaagagtg gcgtgaagca cggcggtgtg gtcggccagg
   135121 tttggtacga aattgcgaag gtaattaacg agaccaagga acgagtggag ttggtgagaa
   135181 ttgaccggga gggggaactg ctcgacacgt gcgattttgg cggggtcagg caggatctgt
   135241 ccggggcgga tgatatggcc taagaacgct acttcgtcga ggaacagctt tgacttctca
   135301 cgcgagcagc gaagaccact tcgacgtagg gcagaaagaa cactcacaat attatcatgc
   135361 aggtccttcg catccttccc cattatgatg atatcgtcca cataagcctc gcaacattcc
   135421 ccagttaaac cttgtaacgc ctcattaatg cgacgctgtt gagcggccgg cgcgttccgg
   135481 atcccttgag gcattaccac ccactctagg agaccgagag gagtggtgat agcggttttc
   135541 gggatgtcct cctccttcat tagcgtttgg aaaaaggcat ccttacagtc aagttttgcg
   135601 aaaatcttgc ccttcctggc ggcacggtgg aggatatcct ggacattccc catagggtac
   135661 atgtcgggga ccgtgatgtt gttcagagcg cggaaatcac agaccattcg gaatttgcca
   135721 ttacctttgg acacgaggaa cgccggggag gcccaagggg aactagagta tcgaagacgt
   135781 cctgcattca gatgttctaa taacatctct cggaaacggg gaagcagggc ttccagtact
   135841 cgatagggtg gcgagcggtg gggagtagca ccatgtttca ggttaatttc gaaacgcacg
   135901 ccagactttg ttttggagat ggtggggaaa tttcgcacgt cgcctaggtc gttgcagaaa
   135961 acatcgtgga attcggtctg aagcttgcgt agaacatccg tcagactgtc ggactcggcg
   136021 gctgcacggg tctgtgaaag attggggcgg gtgtcggcga atgacactgt ggtggtagtc
   136081 gaggcgggat ttgcggcggc gtgggaaact ggcacaccta acttttgcaa gcctaacgca
   136141 gacaagttca caccgcccgc ctccaataac cggacgaaag aatttgattc cgcgagtaat
   136201 ctgtgctgca cgaagaaatt tagtcctaag ataccatcgt aggtaccgtg cagatccatc
   136261 aggacaccat cgactcgata catgcgacca cctagggaaa acgacccgat gaccatatct
   136321 gtgaccaacg gacccgccaa acctccggct agatgcactc gcatccgtac caaccctttt
   136381 ctcacttccc agcccagtct cgccgccaac cttggatcca caaaagttgt ggacaccccc
   136441 gtgtcgagta agaatttagg ggaagggggt tgcgtcacgg gtatcatcat cagctggagg
   136501 aacggtttgg gttaacgtca gataggccga ggtggcatcg cctgccgtca attcagtctc
   136561 gagttggttg accttaggag tcggaacacg tgtacgggta gggcacttgg aatgctgatg
   136621 ccccgtttta cgacaatcgt agcatcggtt ctccttgcgg aagacttcac ggatatggcg
   136681 acccgccggg gagagataat atggcagagc gtgggaaggg tcgtggtagt aggacatcaa
   136741 gtggggtagt tggacggtgt cggaagaaac ctggttggtg ggacgggacc taatccgaga
   136801 ggcggcatcc tcgtgttgaa ttcgttcgac gtggttactg atcaaggccc gcagtgcgtc
   136861 cagatcgtcg acatgaaatt cgggcaagtc aaccaagcga aggaaaaggc gctcgggaca
   136921 ggccgcacgg taaaaactgg tgagttgttg gtcggtcggg tatagcttgc tcccatgaag
   136981 gtgggcacgg tgcaaaatca ccgcgttgtc gaattttttc caaccctccg acgacacctc
   137041 gtggaaggag aggcgaaaaa gagcacggct ttcgcggaac tcccagttgg acggcatggc
   137101 cttagccttg aaggcggctg accacgtctc ccatgtcgtt attccatcgg cctccatacg
   137161 gcgaccgtct tgctcaaccc aaccaacgag accagcgcac tcaatcgaat tgttcgccag
   137221 ctcaatcact gtcacacggc gtctctcttc cacctcctcg tcatccgagg gagtcagaag
   137281 gccgtgcgtt cgcaaaacct gttgaagccg acgcaaatgg gtaagggcgc ggtccgcatc
   137341 gccaagggga ccctcgaaac gagggatgtc tgacgccttg ggcaatggta tacctcgggg
   137401 tgtataacgt tccttggtag ctgatagttt gttttgttta gccagcagct cagtgaggag
   137461 cgccagcgta tcgtcttgtt gttggacgcg gtcgaccaga cgcgcgagta actccgttgg
   137521 agagtcctga gctgatttgg gcatggtgga tatggtgtaa aaaggtaggt gctagtttcg
   137581 aaaaaagtgt aggcactggg gtgtgcctca ctgcgttcgg tgggcgttcg gaaaggatgg
   137641 gcgttcgtgg tataggtcta gagggcgttc ggatgtgttc gaggaagcgt tcggtgtttg
   137701 tttatagtta tagtggtcta ctggatgcga aactagcaat ggttgatatg catgagtttc
   137761 gcttagagaa agagaaaact ataactatgt atgagatcta tatatatata tatatgtatg
   137821 gatgtatgca gaaacaaaca gaagtccatc gaaaaaaagg gacagagatc cggcgaagtc
   137881 cgccgccgcg tctcggcagc aattgccggt cctatgcatg agaataaaat atcatgcata
   137941 ggataaaggc gggacagagc tcgatgccgc gtttcggcga agtccgaaag acgcgtttcg
   138001 gcatcaaatc tcacctacca acatcgacca atgcatagga ataaatccta ccatatggtg
   138061 agaacgagtg gtggtaaggg ctctgcactt acagtggccc aggaaggata ctgagtcgac
   138121 gaaaaatttc gacttgctag gcgagcaaac aaacccgctg ttacgtaaag ctgtgagaac
   138181 cgcgcggata tttttcgcta agtcagagtc agtcgcgccc caaatgatga tatcatcgac
   138241 ataagcttca caacaaacgc tgatgaggtt acgtaaagcc tcgttgaggc ggcgttgttg
   138301 tgttgccggc gagttgcacg cgccttgcgg catcacaacc cattcgtata aacccgaggg
   138361 agtgctgatt gccgttttct cgatatcggg ctcgtgcatg agcgtctgaa aaaatgcatc
   138421 ggtaaggtcg agtttggcga aaaccttgcc acgggcggcg cgttggagaa tgtcgtcaat
   138481 gttgggaacc ggggtgcgat ctttaaccgt gacactgttg aggccgcgaa aatcgcagag
   138541 gaactggaat ttgccatttt ctttcttaat gaggaaagca ggggcggccc aaggggaact
   138601 ggatggacgg aggccgcctg cggtactgta agtgcagagc ccttaccacc attcattctc
   138661 accatatgga aggatttatt cctatgcatt ggtcgatgtt ggtaggtgag atttgatgcc
   138721 gaaacgcgtc tttcggactt cgccgaaacg cggcatggtc gatgttggta ggtgagattt
   138781 gatgccgaaa cgcgtctttc ggacttcgcc gaaacgcggc atcgagctct gtcccgcctt
   138841 tatcctatgc atgatatttt attctcatgc ataggaccga caattgctgc cgagacgcgg
   138901 cggcggactt cgccggatct ctgtcccttt ttttcgatgg acttctgttt gtttctgcat
   138961 acatccatac atatatatat atatatagat ctcatacata gttatagttt tctctttctc
   139021 taagcgaaac tcatgcatat caaccattgc tagtttcgca tccagtagac cactataact
   139081 ataaacaaac accgaacgct tcctcgaacg catctgaacg ccctctagac ctacaccacg
   139141 aacgcccatc cttttcgaac gcccaccgaa cgcagtgagg cacaccccag tgcctacact
   139201 tttttcgaaa ctagcaccta cctttttaca ccatatccac catgcccaaa tcagctcagg
   139261 actctccaac ggagttactc gcgcgtctgg tcgaccgcgt ccaacaacaa gacgatacgc
   139321 tggcgctcct cactgagctg ctggctaaac aaaacaaact atcagctacc aaggaacgtt
   139381 atacaccccg aggtatacca ttgcccaagg cgtcagacat ccctcgtttc gagggtcccc
   139441 ttggcgatgc ggaccgcgcc cttacccatt tgcgtcggct tcaacaggtt ttgcgaacgc
   139501 acggccttct gactccctcg gatgacgagg aggtggaaga gagacgccgt gtgacagtga
   139561 ttgagctggc gaacaattcg attgagtgcg ctggtctcgt tggttgggtt gagcaagacg
   139621 gtcgccgtat ggaggccgat ggaataacga catgggagac gtggtcaacc gccttcaagg
   139681 ccaaggccat gccgtccaac tgggagttcc gcgaaagccg tgctcttttt cgcctctcct
   139741 tccacgaggt gtcgtcggag gggtggaaaa aattcgacaa cgcggtgatt ttgcaccgtg
   139801 cccaccttca tgggagcaag ctatacccga ccgaccaaca actcaccagt ttttaccgtg
   139861 cggcctgtcc cgagcgcctt ttccttcgct tggttgactt gcccgaattt catgtcgacg
   139921 atctggacgc actgcgggcc ttgatcagta accacgtcga acgaattcaa cacgaggatg
   139981 ccgcctctcg gattaggtcc cgtcccacca accaggtttc ttccgacacc gtccaactac
   140041 cccacttgat gtcctactac cacgaccctt cccacgctct gccatattat ctctccccgg
   140101 cgggtcgcca tatccgtgaa gtcttccgca aggagaaccg atgctacgat tgtcgtaaaa
   140161 cggggcatca gcattccaag tgccctaccc gtacacgtgt tccgactcct aaggtcaacc
   140221 aactcgagac tgaactgacg gcaggcgatg ccacctcggc ctatctgacg ttagcccaaa
   140281 ccgttcctcc agccgatgat gatacccgtg acgcgacgta cgctcttttc catcccttgc
   140341 tctccatatc cgttccagtc tccgctgaca gccgtttatc agccccctcc cctaaattct
   140401 tactcgacac gggggcgtcc acaacttttg tggatccgag gttggcggcg agactgggct
   140461 gggaagtgag gaaagggttg gtacggatgc gagtgcgtct agccggaagt ctggcgggtc
   140521 cgttggtcac agatatggtc gtcgggtcgt tttccctagg tggtcgcatg tatcgagtcg
   140581 atggtgtcct gatggatctg cacggtacct acgatggtat cttaggacta aatttcttcg
   140641 cgcggcacgg attactcgcg gaatcaaatt ctttcgtccg gctattggag gcaggcggtg
   140701 tgaacttgtc tgcgttaggc ttgcaaaagt taggtgcgcc agtttcccac ggcgccgcaa
   140761 atcccgcctc gactaccgcc acagtgtcat tcgccgacac ccgcctcaat ctttcgcaga
   140821 cccgcgcggc cgccgaatcc gacagtctga cggatgttct acgcaagctt cagaccgaat
   140881 tccacgatgt tttctgcgac gacctaggcg acgtgcgaaa tttccccacc atctccaaaa
   140941 caaagtctgg cgtgcgcttc gaaattaact tgaaacatgg tgctactccc caccgctcgc
   141001 caccctatcg agtaccggaa gccctgcttc cacgtttccg agagatgtta ttagaacatc
   141061 tgaatgcagg acgtcttcga tactctagtt ccccttgggc ctccccggcg ttcctcgtgt
   141121 ccaaaggtaa tggcaaattc cgaatggtct gcgatttccg cgctctgaac aacgtcacgg
   141181 tccccgacat gtaccctatg gggaatgtcc aggatatcct ccaccgtgcc gccaggaagg
   141241 gcaagatttt cgcaaaactt gactgtaagg atgccttttt ccaaacgcta atgaaggagg
   141301 aggacatccc gaaaactgct atcaccactc ctctcggtct cctggagtgg gtggtcatgc
   141361 ctcaagggat ccggaacgcg ccggccgctc aacagcgtcg cattaatgag gcgttacaag
   141421 gtttaactgg ggaatgttgc gaggcttatg tggacgatat catcatctgg gggaaggatg
   141481 ctaaggacct gcatgataat attgtgagtg ttctttctgc cctacgtcga agtggtcttc
   141541 gttgctcgcg tgagaagtca aagctgttcc tcgacgaagt agcgttctta ggccatatca
   141601 tccgccccgg acagattctg cccgaccccg ccaaaatcgc acgcgtcgag cagttccccc
   141661 tcccggtcaa ttctcaccaa cttcactcgt tcctcggtct cgttaactac cttcgcgatt
   141721 tcgtaccaaa cctggccgac cacaccgccg tgcttcacgc cactcttcct ccgaatgcgg
   141781 cggctgagaa agcttactac aaggctgtta agatgcataa gggacacctc cccgagggat
   141841 ggactggttg gaggtggtcg ttcggccctg cggagaaagc ggcctttgaa gcgactcgac
   141901 gcgcggtgag tactgtcccc tgtcttgccg ttatcgatta tgatgctgtc aaagcgggaa
   141961 cacagcaggt ctttctattc accgacgctt ccaacacagg tactggcgct tggattggtg
   142021 tcggtacctc tcgggagtcc gcccagcctg tggcctacaa ttcgcgcact ttcaatagtg
   142081 cacaacggaa ctatccggta cacgaccgtg agctgctggc gattattaat gccctcgatc
   142141 attggcgccc tctgctatac ggcattccag tccacgtcta ctgcgatcac tttacccttc
   142201 aatggttcct aggtcaacgt aatctctctc cccgtcagct tcggtggctg agtactctga
   142261 aggatttcga cctccgcatc gaatacatca aaggggagtt caatactctc gccgattacc
   142321 tctctcgtca cgccccttcg gatgccgtcg aacctgccga cccctctctg gatcaatcac
   142381 cggtttcagt tcatgccaca atgacatacg agcccacttt ggatccggac acccttcgcg
   142441 cgattgcgca gggttatcaa ggtgatgtat tattcaaaga atggcttgct gatccgtcta
   142501 ctgctccagg tgttaccttc catgatcatg atacccaccg acttctcctc gttgacaacc
   142561 gcttatgcat tccggacgtt aatacacttc gtgaggaact tatgcggcaa gcccatgaag
   142621 gcactgctgg gcatctggga gtggagaaaa ccatggaggt actcaggagt ggatactttt
   142681 gggagacaat gtccaaggat gttcgtgagt ttgtccgtgc gtgccattta tgtcaacagg
   142741 cgaacgcacc cacgacgaag ccggctggtc ccttgcatcc gcttccggtc ccacgcgata
   142801 aattcgatga tatcgctatc gattttgtag gaccactccc ttcttccggt ggacacgact
   142861 atctcctcac gatcacggat agactaaccg ggttcatcga actggtcgcc tgctccacca
   142921 cgatcaatgc gcgggatctc gccatcctgg tttgggagcg atgggtgtct cgttatggtt
   142981 tgccgctctc cattacgtct gatcgtgata ctctgttcac ctcgcgattc tggacaacac
   143041 tatgggagca gcagaacgtc aagctcaaga tgtccacggc cttccatccg cagactgacg
   143101 gcacttcgga acggtccaac aagacagtag tgcaactgct acgtagctgg gtggataggc
   143161 atggcacctc ttgggttaag tacctctctc gtgtttccca agccatgaat aacactgtca
   143221 gacgttccac aggtttctct ccggcacaac tggtctttgg ccgtcggctc cgtaccctac
   143281 ctagtctggc tcgtcctcct ccgttcaccc gggtttccct tcccacacag gccgaatgga
   143341 ctctcgcagc ggatcgcacc gactgtaagg tccggacaat agaccttcac tgaactggtg
   143401 gggctagctc ggagggacaa ggcttggaga gaactggtgg gctcttaggg ctggcagggc
   143461 tcgaggctta acttcggact ggagagaagc aaacaagatc ccaaatgcat atgctgatta
   143521 tgtcctatca gcgactagta aaggagacaa gatgaagaat tgataggaac aagaggagaa
   143581 ggcaaggtac ttgtgactgt aaagtcggaa gaaggaaagg ttgaacacaa caaggataaa
   143641 agaataaagg aatttgtgtg taacccaaag agcccgaagc ttacctgatt atgtcctatc
   143701 agcgactagt aaaggagaca agatgaagaa ttgataggaa cactgatcag gattagccag
   143761 ggggtctgag gggagaaggt gattagtaga gagctctgct tacagaggag aaggcaaggt
   143821 acttgtgact gtaaagtcgg aagaaggaaa ggttgaacac aacaaggata aaagaataaa
   143881 ggaatttgtg tgtcaacctt tccatgcact ttgccttcgc tctcgaaacc agtcgcgacc
   143941 aaagcccggt aaacaccggg gcttgtggca tgaaaaatcg gacaagaaac tcggacttag
   144001 gacgagaaat ggaagagaaa acaagaagag aaaaagcgga agtaaaatga tgcacgtgac
   144061 ctgggaggga gagtgcggat gcaatttgac gcgcgcgact tggaggaaag gagcggaagt
   144121 aaattgagac gcggctcgga gaaacagggg aaaaataagg cacgtgacct gggaaaggga
   144181 gcgcggatgc aatttgacgc gcgcaacttg gaggaagaag cggaagcaaa ttgaaacgcg
   144241 gctcgaaatt agaagctggg gaaagtggtg accgtgggtc actgggtcgg aggctagcct
   144301 cttacaccct ccccctcctg gatgagacgg agtatgtgag ggagaagaag gaaatgagac
   144361 acacacacaa agagggagaa agaaatgagc tagaagactg tagaagctgg gcttcaagga
   144421 ggggccaggc tgagagacaa tccatgaaac atgttgactg agggaaaccc ccaccacgaa
   144481 aaaactccct ggccttttgg cttcttttca gattctttgt ctggggataa aaaaaatggg
   144541 gggtggggga acctcttgtc tgtcttcagg cctgtgagga agggggggag gaaactggag
   144601 gagaaaaaaa cggacgagaa aaaaatgaga aaacacggca cgaaggaaaa aaaagggggg
   144661 gaacgaaatt gaaaacctgg acgggtgggc ttggggcttg atgggggggg ggtggtttgg
   144721 catctgtgtg aaggtgtcag cctggtctga ggggtagatg aggaaaaaaa aggtgttagg
   144781 gagggtgtat acagctcacg acggagtgtg gccatgtcag ggccgttaac cctgggggtg
   144841 taaggcatgc atgccaaaca cggtcattat gatcccaagg tctgtttcac ttcatacata
   144901 gatttgctgc cgcttttctc ttattttgat tccgtttatt ttgcgcgctc ctcacaggcc
   144961 tcaaaggaat ttgcagcaag gaaaagcctc tcttctttat ctttagaaag agagcccttt
   145021 tcctttggtt gtccgcgacc tgctgtagtt cttttgagtg cttgtgagtc ccacttccta
   145081 cttggaatgt ggttttatgc taactgggcg gactttagta attatagctt cgttgacact
   145141 ctgcccaggt atgcttgtaa cttcttcttt atctttagaa agagagccct tttcctttgg
   145201 ttgtccgcga cctgctgtag ttcttttgag tgctttaatt atagcttcgt tgacactctg
   145261 cccagtgatc aacaaacata tgcaaactca tagaccgctt ctgcgcccgg acaatccaac
   145321 tacctctttc cttgccaccg actagacaac agtcgtgttc cagccgtctc tctttcaatc
   145381 aaatcaagcc gaactctttc agtgaacacc ccccctgggt tgttacaggg tgaacatctg
   145441 agaaacatca gtagtaacgt ccagtacgtc gagatgtagc tcatcttcgc caataaagtc
   145501 ttcccaagcc tcctgccaac ctgcatagtc ctgtgccgta tcgcgactga gccaccgagc
   145561 cttggggcct tcaccggcga ggcgggcgcg cacttgatag acctttggat gatttccctt
   145621 gggggtgagg gtgcggtctt caaggatttg gaggatgcgt ggcgaggaaa cagccgggcg
   145681 gtcgagtagg cgaggaaccg cgtgctggtg atactgttcg gactcccggt atggcttgag
   145741 gcgcgaaaca tggcggcgag gcgtcgactg tgttgaggtg acgggaacat ccaattcata
   145801 gagtgattgc tcgggaaagg ccttgaggat ggtgaagggg ccttcccaac ggggcatgaa
   145861 cttcgcagaa cgattagtgg ctgtcttata ttcgtgacgg aactcagctg tgttcaagta
   145921 gactttgtct cccgggcggt agaccgggtc cggccgacga tgcttgttgg cttgaacact
   145981 ttgccgatgc ttagcgagaa gcagttcgtc acgagcgatg ccctcttcga gggccattgt
   146041 aaggtccgga caatagacct tcactgtact gttggggcta gctcggaggg acaaggctcg
   146101 gagagaactg gtgggctctt agggctggca gggctcgagg cttaacttcg gactggagag
   146161 aagcaaacaa gatcccaaat gcatatgctg attatgtcct atcagcgact agtaaaggag
   146221 acaagatgaa gaattgatag gaacaagagg agaaggcaag gtacttgtga ctgtaaagtc
   146281 ggaagaagga aaggttgaac acaacaagga taaaagaata aaggaatttg tgtgtcaacc
   146341 tttccatgca ctttgccttc gctctcgaaa ccagtcgcga ccaaagcccg gtaaacaccg
   146401 gggcttgtgg catgaaaaat cggacaagaa actcggactt aggacgagaa atggaagaga
   146461 aagcaagaag agaaaaagcg gaagtaaaat gatgcacgtg acctgggagg gagagtgcgg
   146521 atgcaatttg acgcgcgcga cttggaggaa aggagcggaa gtaaattgag acgcggctcg
   146581 gagaaacagg ggaaaaataa agcacgtgac ctgggaaagg gagcgcggat gcaatttgac
   146641 gcgctgtaga cactgggtgt ctcactgagt gtcgtagtag tatagtgtgt agttgactag
   146701 caaaacatgc actggttgta atacatgtgg attgagtatt gaagaactac aacaatatgc
   146761 gactactatt ttactaagta ccaactgtgt gtcagaaagt aaagttacac acatcaaatg
   146821 ccacgtcatt actaagtatt tcaaatgtaa cattatacac atggaatgtt acataatctg
   146881 gatgattaca tacacaacaa atatcgctga atattcatac agcttataca tgggaatgca
   146941 tgcatgtaaa tgcactgcat aaattcctgc atgtaaatgc gatgcataaa ttcctgcata
   147001 tgcaatatgc ataggaggat gcatgcacaa agactgcatg catggagaat aaatgagtat
   147061 agtgctctgc acttacactc tcccccatct gtcaaagagc ctatgcctgg aagcaagaac
   147121 agcagttacc aggaggcagg gacaggaaaa agaaatagaa gtaataagag aaggacaaag
   147181 agacaaaaaa gaaaggagaa aaaacagcta taagcatggg ggtcatgggc tgactctgta
   147241 aattcttgtc accagatcca ggatggataa gatggggaag gagaacgcag caggtaacca
   147301 ctccggagcg cagcctttta agatttagtc ttgttgagca caagccaggg gaaaaacaaa
   147361 ccataaaggc caaaaaaata acccaacaga gcagcccaag ccaagccatg acactatgga
   147421 agaaaagaaa agaggagagg aaaccagaaa ataagcaaaa aggaagagaa gaaatgagcc
   147481 cgaaaagaag aagagagaag aagataaaag gaaaaaatga agagagaaaa gaaaatggaa
   147541 aggaagaagg aacaggcgga cgagaaagag aaaataagga gaggaataga ggagaatagg
   147601 aaggaatgat caaatggcaa gatcatcagg acccaagtac tcctcataca gggactggaa
   147661 accagccaga gggcggaggt catccaggta gcgccattgg ccagtgggac cattgccaga
   147721 gaataccaca cgaagctggc ggcgaccacg gaactcacga tcatccagaa tctgtaataa
   147781 ccttgggggg gaactagagg aagggcttga tggcgctgaa gaagtcagag gggaggtctg
   147841 atgaaagcga gaagatgaga ggtagggctt gagaaggttg gcatggaact tggtgtaact
   147901 gccagaggga gagtctggaa gatccaaggt atacactgag cggtcggagt gagcagccag
   147961 taccttgtaa ggaccttgga aacgtgggaa gaacttagca gcacggaaat ccccatcacc
   148021 agacttgaac tctttgagtc tattgcgagt atccaaccag acccaatctc caacattgta
   148081 aatgatctcc gaccgacggt ggcggttagc ttggatagcc atgcgatgct tagccaagac
   148141 caggttgtcc tgagcgtcgg ccaggaagag atcttgttga gcagcagcgg cagtccagtc
   148201 agcacgagta gggatggact cgcgagtgaa gggtggcggg cgggcgatgc caggaagcgt
   148261 gcggaggcgg cggccaaaga caagctgaat gggagagtac cctgtagaac gacggacagt
   148321 attgttcata gcctgagaaa tacgaggaag gaacttagcc catgaagtgc cctgtctgtt
   148381 aacccaactc cgcaacaatt ggcctactgt cttgtttgat ctctctgaag tcccatcagt
   148441 ttgcggatga aaagcagtcg acatcttcaa ccggacaccc tgttcatccc aaagggttgt
   148501 ccaaaagcga gaggtgaaga gagcgtcacg atccgaggtg atggagagcg gtaagccata
   148561 gcgagagacc caacagttcc agaagagaag ggcgaggtcg cgagcgttga gggtggtgga
   148621 gcatgggacg agttcgatga agccagttaa ccggtcggtg atggtgagga gatagtcgtg
   148681 gccgccagcg ctgggtagag gaccaacaaa atccatagcg atatcgtcga atttgtcgcg
   148741 agggaccggc agcggatgca agggaccgac aggttttttg gtggatgcat ttgcctgttg
   148801 acatgagtga caagcacgga cgaactcacg gacatctcca accaagcctt cccagaagta
   148861 gccttcacgt aatacctcca ctgttttctc tatgcccaag tgtgctgcag tgccttcatg
   148921 tgcttgacgc ataagggcct cacgaagagt gccaacgtcg gggatgcaga ggcggttatc
   148981 gagaaggagg agagtatgag tgtcatgggg gatggtagag acgccaggag ctgtggtagg
   149041 atcagcgagc cagtccttga acagattctc acggtcataa ccctgggcaa tggtacgaat
   149101 aatctccggt gctaatgtgg gagcgaaggt gaccacgggg gcgagaatac aattgtcggg
   149161 ctcgggcagg gcgggatcgg tgggcggaag agtgtcggag ccaatgtgtc gtgaaagatg
   149221 gtcggctaag acgttatgtt cacccttgat atactctata cgaacgtcga agtctttgag
   149281 gatgtccagc cagcggattt gtcgagagga caagttgcgt tgacctaaga accatttgag
   149341 cgtaaaatga tctgtgaaag catacacggg aataccataa aggaaagggc gccaatgatc
   149401 aagagaatgg acgatggcca ggagttcgcg ctcgtgtgtg gagtagttgc gttgtgcaga
   149461 gttgaacgag cgggaatcgt aggcgacagg ttgagcgttt tccttggtag taccgacgcc
   149521 tatccaggcg cccatgccga ctttggatgc atctgtggtg aggaaaacct tgagagtacc
   149581 agccttgaca gcatcatagt cgattgtagt caagcaggga acagtactca cggcgcgacg
   149641 caaagcgtca aaggctaccc gttccttagg cccatagttc cacctccaac cctgccatga
   149701 ctcttgcaaa cggcccttat gctccttcaa gtgcctgtag taggctttct cggcggcggt
   149761 gttgggaggg agacatgcgt gcaagaccga agcgtgagta gcaaggctgg gtatgaactc
   149821 acggagatag ttcaataaac caagaaacga gtgtaaagcc ttgggagtcg tggggtgagg
   149881 gaactgttca atgcgtgcga ttttcgtggg gtcggggagt atctgaccag gacggatgac
   149941 atggccgagg aaagaggttt cggtgaggta gaactgtgat ttctcacgag aacagcgcaa
   150001 accactccga cgcagagctg cgagaacact cacacaattt cgacgaagat cctcgctgtc
   150061 cgttccccag atgatgatat cgtccacgta tgcctcgcaa cattctccag cgagaccttg
   150121 cagtgcttca ttgatgcggc gttgttgggc agcaggtgca ttccgaatgc cctgcggcat
   150181 gacgacccat tccagcaacc caagcggtgt tgtaatcgcc gtcttgtgaa tgtcgtcgtc
   150241 cttcatcaac gtctgaaaga aggcatcctt acagtcgagc ttggcgaaaa gattgccgcg
   150301 tcgagcagca cggtgcaaga tgtcctggat gtttcccata ggatacatgt cgggcacggt
   150361 ctggttattg agtgcgcgaa aatcgcagac gagacggtgt tggccattgg gtttcttgac
   150421 gagaaaagca ggtgacgccc aaggagaact agagtagcgt agacgacctg cattcagatg
   150481 ttcagcaatc atctcacgga aacggggcaa aagagtttca ggaacccggt agggagctgc
   150541 atgactgggc gtagcgttag gtttcaagat gatttcgaac ctaacaccac tcttggtctt
   150601 cgtaatgctt gggaaatcgg ctacatcacc cagtttgtca caaaaaactt ctgcaaagtc
   150661 gttcttgagt tgtgcaatga tctcggcgta ggaagcagtt tcggccgcac cgagagagac
   150721 agaatttgat gaaggaatcg ccgaaaattt ggtggttatc gccgaaggct gaggcgcgac
   150781 aggagtttgc gaaacttttg acttgtgaaa aattttggag tgaggcgtgg gaacggtgac
   150841 gtcttcgttt ggcgcggcag cagttgtcga aacttctgac ttgtgaaaaa ttttggagtg
   150901 gcgcatggga acggtgacgt cagtcccggc gagaggagaa attttcgcat catgagcaac
   150961 tggtggggga ctcgtgggaa cggcgacgtc attgccggtg agaactttcc cagagttgct
   151021 caagagacgc cgaaaaagag gactttgatc aagtagatga tagcgcttgc agaaattgag
   151081 acccaagatc ccatcatatg taccgttcaa ctccatgaca actccttcgc ctgaatatat
   151141 tgcatgtcga accctaaacg ttccactcgt cacatctctg actaccggcc caggtttccc
   151201 accagccaac cgcacagtac gctccactgc gtcctttcgg actttccaac ctagtctagc
   151261 taccactgac ggatcaaaga aggatgtacc agcgcccgtg tcgaggagaa atcggagagg
   151321 agggggaggg gcaatcgagg tacgtccgtc agcggcagca gaggcttgaa tgactagagg
   151381 aggatgaaac agtgcgtacg aggtctcgtc tgagtcaata gacgtctcaa gctggagatg
   151441 gtcgtcaagc tgactggtaa gttcttggat gaggatctcg tggttgtcga cgtggcgaga
   151501 gttgacacgc gtaggaccac ggcggttggg acaggttttg aagttgtggc ccaccttgcg
   151561 gcagtcattg catcggtttt ctttggcgaa aagttcgcga atgtgtttgc ccgcaggcga
   151621 gaggtagtag ggtagggggt tgtgggcttg ataataatgg ctgagggggt gtgccaggtg
   151681 cggttggctt tgcggagtgg ccgaagcttg cggtttgata cgagtgtgag tgggttgatc
   151741 ccggttctcc aagtacttga caactgtcag ttctaacagg ttgcgtacct cgtccaagct
   151801 tccattcctg aactccggcg tcgtcatcaa acgaatgaat aatggctcgg gacaagcgcc
   151861 gcggtaaagg gtggccatag aggtgtcact gggatagagg tcagtgccca tcaaattgtg
   151921 tcggtgttgt atggcttggt tatcgaaggt ttcccagtcg ctaacctgat tgaactgtag
   151981 gcggaggagg gaacgaagtt ctttctgatc ccaggcgagc ggcatcgctg cctttttgaa
   152041 agccactgtc catgcgtccc atcccgactc gccatctgct tccatcatcc gaccagtagt
   152101 cctcacccat gctttcagcg cggtacattc gatagagttg ttcgccacct ccaggataat
   152161 gactcgcagt ttctctgtct gggcatcgtc atcttgaggg gaaaaaagcg aattagtccg
   152221 gagaagtttc tctagacgat caatgtgaag aagaacagct ggagcatcac gaatgggacc
   152281 agtaaagttc ggaatgctgg aggcttgtgg gatagttact tctcgaggtt tgtgattccc
   152341 ctgagtaccg aagaggcttt gctgactggt taatttcgac atgtggagga taacagctgc
   152401 cacctgagca ttgatgtctc cttcgacagg agatgcgttt gcctcctccg agggaggagt
   152461 gtctttgagc gtttgaccct tggggggcat gaggggcgtt tgagcgtttg gtgagtgggc
   152521 gtttggcgtt attttgtgtg cgttgttttg aaaaaagtgt agacactggg tgtctcactg
   152581 agtgtcgtag tagtatagtg tgtagttgac tagcaaaaca tgcactggtt gtaatacatg
   152641 tggattgagt attgaagaac tacaacaata tgcgactact attttactaa gtaccaactg
   152701 tgtgtcagaa agtaaagtta cacacatcaa atgccacgtc attactaagt atttcaaatg
   152761 taacattata cacatggaat gttacataat ctggatgatt acatacacaa caaatatcgc
   152821 tgaatattca tacagcttat acatgggaat gcatgcatgt aaatgcactg cataaattcc
   152881 tgcatgtaaa tgcgatgcat aaattcctgc atatgcaata tgcataggag gatgcatgca
   152941 caaagactgc atgcatggag aataaatgag tatagtgctc tgcacttaca cgcgcgcaac
   153001 ttggtggaag aagcggaagc aaattgaaac gcggctcgaa attagaagct ggggaaagtg
   153061 gtgaccgtgg gtcactgggt cggaggctag cctcttacac cctccccctc ctggatgaga
   153121 cggagtatgt gagggagaag aaggaaatga gacacacaca cactagaaaa ctgtagaagc
   153181 tgggcttcaa tgaggggcca ggctgagaga caatccatga aacatgttga ctgagggaaa
   153241 cccccaccac gaaaaaactc cctggccttt tggcttcttt tcagattctt tgtctgggga
   153301 taaaaaaaat ggggggtggg ggaacctctt gtctgtcttc aggcccgtga ggaagggggg
   153361 gaggaaactg aaggagaaat aaacggacga gaaaaaaatg agaaaacacg gcacgaagga
   153421 aaaaaaaggg gggaacggaa ttgaaaacct ggacaggggt gggctgggga cttgaggggg
   153481 gggtggtttg gcatctgtgc gaaggtgtca gcctggtctg aggggtagat gaggaaaaaa
   153541 agggtgttag ggagggtgta tacagctcac gacggagtgt ggccatgtcg ggaccgttaa
   153601 ccctgggtga acatctgagg aacatcagta gtaacgtcca gtacgtcgag atgtagctca
   153661 tcttcgccaa taaagtcttc ccaagcctcc tgccaacctg catagtcctg cgccgtatcg
   153721 cgactgagcc accgagcctt ggggccttca ccggcgaggc gggcgcgcac ttgatagacc
   153781 tttggatgat ttcccttggg ggtgagggtg cggtcttcaa ggatttggag gatgcgtggc
   153841 gaggaaactg ccgggcggtc gagtaggcga ggaaccgcgt gctggtgata ctgttcggac
   153901 tcccggtatg gcttgaggcg cgaaacatgg cggcgaggcg tcgactgtgt tgaggtgacg
   153961 gggacatcca attcatagag tgattgctcg ggaaatgcct ggaggatggt gaaggggcct
   154021 tcccagcggg gcatgaactt cgcagaacgg ttagtggcgg tcttatattc atgacggaac
   154081 tcagctgtgt tcaagtagac tttgtctccc gggtggtaaa cagggtccgg ccgacgatgt
   154141 ttgttggctt gaacactttg ccgatgctta gcgagaagca gttcgtcacg agcgatgccc
   154201 tcttcgaggg ccatgcgttg ggcagcgaga tcccattcgg aagccgtagg ttgagcgagg
   154261 gacgggtccg tagctgatgt tgaggggagg agcggcggag tgagtgacag gcgtttcccg
   154321 aaaacgagct cggcgggggt gtggtgggtt gagcgtcgga tggtgttgtt cattgcgaag
   154381 gcgacccgct gtaggttagc tgcccaattt cggccttggt cgtcagtcca ggtgcgcagg
   154441 atctgaatga ctgtcttgtt agatcgttct gatataccat cggtctgggg gtggtatgct
   154501 gtggacatct ttagcttagt gcccaggagg gaattcaacc gacgccatga cgcagcagtg
   154561 aataacttat cgcggtctga gacgatggat tgtggtaccc catatttaga aacccagtgg
   154621 tcgtagtaga gttgagcaaa agcggaggac gtgagcgtcg tgactgttgg tatgagagcg
   154681 acccagccgg tgaggcgatc ggtaatgacg atgagatagt cgaagctgtg tgattgcggt
   154741 agtggcccca cgaagtctat gcctatgtcg gagaatttgg cgggaggaac tggtaatgag
   154801 tgtagtagtc cgggaggttt ggtggtggta gctttggatg tctgacaggc tgggcaagtg
   154861 ctgacaaagt cctttacgtc actagccata ccatcccaga agtacttaca acgcaatagt
   154921 tcaagtgttt tctccacccc gaaatggccc atcgcatcgt ggcattcctg taggcactgt
   154981 tctcgtaagg tcagtacttc ggggatgcag agccggtcct catatgtcag caccgtcctg
   155041 accccccgtg ctccgttgac ttcggctgtg cggacacccg gagggcagcg gtctacttcc
   155101 ctccaaatgc tcattactgg gtcctgccca tacccttcag ccactgcatc caggaaagct
   155161 gcgtttggtg agagaaccat catggtgagg gcgttgacgt gggcgtcgga gttgcggagc
   155221 cgggagaaag cgtcggcgat gacattagtg gcccctggaa tatgggaaat ctggaggtcg
   155281 taatcggcga gtactagtag ccatcgcttc tgacgttcgg acagatttgg ttgttgaaag
   155341 aaccacttga gagtcgcatg gtccgtcatg acgtgcaccg ggacgccgag aagtagaggc
   155401 cgccactctt tgagggcgtg gatgatggcg cataactctt tttcgtgtac cggataattt
   155461 cgttcagcgg cggtgagaga gcgggaatcg taggcgatag gttgagcgtt gtcgggggat
   155521 agacccgtgc ccaaccaggc accgaggccg gtgttgcttg cgtcggtgaa aaggtagaga
   155581 ttggtttgac ctgcgaggat agcttcatgg gaaagggggg acagacctgt gatacgtgcc
   155641 accatttcct tcagcgcctc aaacgcatct tgcgccgacg ttgtccactt ccatacccaa
   155701 ctcagtgatt ctaatcgctc ggctgggagg cccttggcta gttgacgttt acgggattca
   155761 tacgctttct ctgctgtctt gttcggaggg agaagagccg tgagaacgga cgtcttggtg
   155821 gcgatgtgtg ggatgaattt gcgtaaatac tggagaaggc caagaaaaga tcggaggtct
   155881 ttcacacaac caggagatgg ccatgcgcgt agtgcttcga ctttcttcgg atctggccca
   155941 atgtgattgg gggagattac gtggcccagg aaggatactg agtcgacgaa aaatttcgac
   156001 ttgctaggcg agcaaacaaa cccgctgtta cgtaaagccg tgagaaccgc gcgaatattt
   156061 ttcgctaagt cagagtcggt cgcgccccaa atgatgatat catcgacata tgcttcacaa
   156121 caaacgctga tgaggttacg taaagcctcg ttgaggcggc gttgttgtgt tgccggcgag
   156181 ttgcacgcac cttgcggcat cacaacccat tcgtataaac cccagggagt gctgattgcc
   156241 gttttctcga tatcaggctc atgcatgagc gtctgaaaaa atgcatcggt aaggtcgagt
   156301 ttggcgaaaa ccttgccacg agcggcgcgt tgaagaatgt cgtcaatgtt gggaaccggg
   156361 gttcgatctt taaccgtaac actattgagg ccgcgaaaat cgcagaggaa acggaatttg
   156421 ccattttctt tcttaatgag gaaagcaggg gcggcccaag gggaactgga tggacggagg
   156481 cggcctgcgg tacggtgttt ctcgatttct tgtcgaaggg tgtcgcgcca cgctaacggt
   156541 actcgaaatc cagctcgagc gacaggcatc gcatcaggaa gaatgtttat tcggtggcgg
   156601 acttgggagg tggacgaaca aatgggcggg tagtgggaga cgtcagagat attggctgga
   156661 aggatgtcgg caaattcacg gaggatggcg tcggagtggg agtggtgttc agtgctgaca
   156721 gtcggggatt cgactggtgt gatggagttg agttgtagtt gcacaagcga tgtataggat
   156781 gacccccctg cattgaggag gtgatttaaa cgctccgccc catcaaatag gcggtgttga
   156841 cgacagaact gtaatccgag gataaggcgg tatcgtggac caagggccat ggcgtagaat
   156901 ggggtagcgt tgtaggtagt gtcaccaatg attacatcca ctacatactc ctggtctacg
   156961 actggacccg cccgattgtc tgccattttg gtccccaccg gtataatcgg ccgtccttgc
   157021 catccctgtt gctctgcgta cgcccggtca acgacgttga tgccagcgcc gcaatcaacg
   157081 agtgctggga cagtgtctcc gtcagccttg aaacggcaat tgaccatgat gagaggtact
   157141 gacccagcga gcgcagacga ggcatcctgt actagagtgt ctgtgacagg gtcgacagcg
   157201 aaaacgccgt ggtggtcgga ctcgtcgtcg tcggcaaggg agacgaggtt agcgaccggc
   157261 acggacgcgg aggcgttggg cggggtggag ggggggcggg ttgggcagat aaggcggtga
   157321 tggccgacaa cgcggcatga gaaacacgcg ttgatgcttt gaagataggc gcgggcagat
   157381 cggccggcgt caccgagggg gagccgtttg gcggggtcga gccagtcgag ctgttgtgcg
   157441 gtgtagccct tcgtggtggt ggagggggcg ggggcgagtt tggcaatgag tggaggtgcg
   157501 agggcgggag cgatgacgtt ggcgacggtt ggtgggtggc gggggcgtgt cggcacctga
   157561 aggaaacgcg cctcaagcat ggcgtcatcg atgacgtcca tcatgatctc gtataggtcg
   157621 gccgacgttg cggagagcac cgttttgcca cgtgcgcgga gagcagcttt ggtgcggtga
   157681 gtaaccaagg catcgacacc gtccaatagt cggcggttga cgtccacgtc gctgaggggg
   157741 tcctcgaagt catgaagaat gccttggtaa ctgataacaa ggtgaaagaa tgcatcgaac
   157801 gcggcgggtg tggtgtccaa gcagcggagc tgcatgaatc ggtggcggag tttggactcc
   157861 cagccgcggg cgagaatgtg agacttaagg gagacttgcc atgcatccca agtttcggcg
   157921 tgtttgccat ggagctcgag ccacgtggtg aaccggccgc ccgattggga gatcgaggta
   157981 tttgccaccg aaatcttcca cgcgtgctca gccgggccgg ggctccagtg taggagggcg
   158041 tcacggaaat aggtctccaa ggcgaggaga tgtcgctgga gcgcgaacgg gtcggcggag
   158101 gagtgagtcc caagtcgcgg cggggagatc ttgtccgggc gggacccgcg tgtggagggg
   158161 gggacgtgac gatcgtggcc tgtggtggct tgatcggcta gcgcttgggt ggaacgaagg
   158221 agtccggcaa caatagattt aagctcgtcg atctcaggaa cggccgggcc ggaaaaggca
   158281 gtggtgaggc ccggggtctt tcggtagatt gcacccgtgg tatcgtgtac aggggttgcg
   158341 tagtttacca tcttttcgtc gggtaggtca ggcaccgaag gcaccgcgtt tgaagttgtg
   158401 ggcgaagcca aattttctcc ggagcccgcg gacgataggt ggtcgtccgt gaatgtgccg
   158461 aagatgggaa cgccagtggg gtgatgcccg atgatgggac gggaagtcac ctcgtcgtac
   158521 gcaatgatgg gttggccctg agaatcaaac gccatgatgt atgttggtgt ggtggagtgt
   158581 ggtgtgaatt gatttgggta atgagtttga aaaaaagtgt aaggtccgga caatagacct
   158641 tcactgtact gttggggcta gctcggaggg acaaggctcg gagagaactg gtgggctctt
   158701 agggctggca gggctcgagg cttaacttcg gactggagag aagcaaacaa gatcccaaat
   158761 gcatatgctg attatgtcct atcagcgact agtaaaggag acaagatgaa gaattgatag
   158821 gaacaagagg agaaggcaag gtacttgtga ctgtaaagtc ggaagaagga aaggttgaac
   158881 acaacaagga taaaagaata aaggaatttg tgtgtcaacc tttccatgca ctttgccttc
   158941 gctctcgaaa ccagtcgcga ccaaagcccg gtaaacaccg gggcttgtgg catgaaaaat
   159001 cggacaagaa actcggactt aggacgagaa atggaagaga aagcaagaag agaaaaagcg
   159061 gaagtaaaat gatgcacgtg acctgggagg gagagtgcgg atgcaatttg acgcgcgcga
   159121 cttggaggaa aggagcggaa gtaaattgag acgcggctcg gagaaacagg ggaaaaataa
   159181 agcacgtgac ctgggaaagg gagcgcggat gcaatttgac gcgcgcaact tggtggaaga
   159241 agcggaagca aattgaaacg cggcttgaaa ttagaagctg gggaaagtgg tgaccgtggg
   159301 tcactgggtc ggaggctagc ctcttacatc gccatcgccg tcctgaagta gcctacaagg
   159361 ttggagattg ggtgtggttg gatacccgaa ataggttgaa ggaatttcgt gctggagacg
   159421 gggaatatcg cgctgctaag ttcttccccc gcttccaggg gccttaccag gtacaagaag
   159481 ctaaccctgc cctctcagtt taccgtcttc acatgaatga ccggacatac ccaaaattcc
   159541 atggtcatct ccttaagcct tatctgtcgt cgcctaggtt ccatcaaaca tcaccggtaa
   159601 cccaccaatt tgacactgga cgtcgcagca ttcttcaaat cctggatgat cgagtgtatc
   159661 gcggtcatag acaactccga gtagtactca gcggcgacgg tcctaatggt caatggagga
   159721 atctcgacga cttgcgtaca tacgatggtt tccgggcctt atatgacgaa tatataggcg
   159781 acgacgaact ggccttgtga gtccccttcc tgtttgctcc tgttttcctt tgtatacgtg
   159841 tctggggggg ctgcttgcgt tcctccgtgg gttttttggc cattatttgt aacaacccag
   159901 gggggatgtt cactgaagag ttcggcttga ttttgattga aagagagacg gctggaacac
   159961 gactgttgtc tagtcggtgg caaggaaaga ggtagttgga ttgtccgggc gcagaagcgg
   160021 tctatgagtt tgcatatgtt gttgatcact gggcagagtg tcaacgaagc tataattaaa
   160081 gcactcaaaa gaactacagc aggtcgcgga caaccaaagg aaaagggctc tctttctaaa
   160141 gataaagaag agaggctttt ccttgctgca aattcctttg aggcctgtga ggagcgcgca
   160201 aaataaacgg aatcaaaata agagaaaagc ggcagcaaat ctatgtatga agtgaaacag
   160261 accttgggat cataatgacc gtgtttggca tgcatgcctt acattattgg tttttttccc
   160321 tggcttgcgc tcagcaagac taaattaaca ggactttctc acagagtgtt ctcctgccca
   160381 gtccttccaa cgtggatgga tttggaaagt aacgtgttga caggggggcg ctggcagtcc
   160441 ccacggcctg gtgatcgttc gttcttttgc ccttattctc tccttttcaa ttttatgttc
   160501 cattgcctta tctcttaatt ctttctttta tctttttgat ccggtcgagt cttcccctgg
   160561 ctctcatctg gacgggggag agtgtaagtg cagagccctt accaccattc attctcacca
   160621 tatggtagga tttattccta tgcattggtc gatgttggta aggtgagatt tgatgccgaa
   160681 acgcgtcttt cggacttcgc cgaaacgcgg catcggctct gtccggcctt atcctatgca
   160741 tgatatttta ttctcatgca taggaccggc aattgctgcc gaaacgcggc ggcggacttc
   160801 gccggatctc tgcccctttt tttcgatgga cttctgtttg tttctgcata cgtccataca
   160861 tatatatata tagatctcat acatagttat agttttctct ttctccaagc gaaactcatg
   160921 catatcaacc attgctagtt tcgcatccag tagaccacta taactataaa caaacaccga
   160981 acgcttcctc gaacgcatcc gaacgccctc tagacctata ccacgaacgc ccatccttct
   161041 cgaacgccaa ccgaacgcag tgaggcaccc ccagtgccta cagtgacagg cgtttcccga
   161101 aaacgagctc ggcgggggtg tggtgggttg agcgtcggat ggtgttgttc attgcgaagg
   161161 cgacccgctg taggttggct gcccaatttc ggccttggtc gtcagtccag gttcgcagga
   161221 tctggatgac tgtcttgttt gatcgttctg atataccatc ggtctggggg tggtatgctg
   161281 tggacatctt tagcttagtg cccaggagtg aattcaaccg acgccatgac gcagcagtga
   161341 ataacttatc gcggtctgag acgatcgatt gtggtacccc atatttagaa acccagtggt
   161401 cgtagtagag ttgagcaaaa gcggaggacg tgagcgtcgt gactgttggt atgagagcga
   161461 cccagccggt gaggcgatcg gtaatgacga tgagatagtc gaagctgtgt gattgcggta
   161521 gtggccccac gaaatctatg cctatgtcgg agaatttggc gggaggaact ggtaatgagt
   161581 gtagtagtcc gggaggctta gtggtggtag ctttggatgt ctgacaggct gggcaagagc
   161641 tgacaaagtc ctttacgtca ctagccatac catcccagaa gtacttacaa cgcagtagtt
   161701 caagtgtttt ctccaccccg aaatggccca tcgcatcgtg gcattcctgt aggcactgtt
   161761 ctcgtaaggt cagtacttcg gggatgcaga gccggtcctc gtatgtcagc accgtcctga
   161821 ccccccgtgc tccgttgact tcggctgtgc ggacacccgg agggcagcgg tctacttccc
   161881 tccaaatgct cattactggg tcctgcccat acccttcagc cactgcatcc aggaaagctg
   161941 cgtttggtga gagaaccatc atggtgaggg cgttgacgtg ggcgtcggag ttgcggagcc
   162001 gggagaaagc gtcggcgatg acattagtgg cccctggaat atgggaaatc tggaggtcgt
   162061 aatcggcgag tactagtagc catcgcttct gacgttcgga cagatttggt tgttgaaaga
   162121 accacttgag agtcgcatgg tccgtcatga cgtgcaccgg gacgccgaga agtagaggcc
   162181 gccactcttt gagggcgtgg atgatggcgc ataactcttt ttcgtgtacc ggataatttc
   162241 gttcagcggc ggtgagagag cgggaatcgt aggcgatagg ttgagcgttg tcgggggata
   162301 gacccgtgcc caaccaggca ccgaggccgg tgttgcttgc gtcggtgaaa aggtagagat
   162361 tggtttgacc tgcgaggata gcttcatggg aaagggggga cagacctgtg atacgtgcca
   162421 ccatttcctt cagcgcctca aacgcgtctt gcgccgacgt tgtccacttc catacccaac
   162481 tcagtgattc taatcgctca gctgggaggc ccttagccag ttgacgttta cgggattcat
   162541 acgctttctc tgctgtcttg ttcggaggga gaagagccat gagaactgta acaacccagg
   162601 ggggatgttc actgaaagag ttcggcttga tttgattgaa agagagacgg ctggaacacg
   162661 actgttgtct agtcggtggc aaggaaagag gtagttggat tgtccgggcg cagaagcggt
   162721 ctatgagttt gcatatgttt gttgatcact gggcagagtg tcaacgaagc tataattaaa
   162781 gcactcaaaa gaactacagc aggtcgcgga caaccaaagg aaaagggctc tctttctaaa
   162841 gataaagaag gagttacaag catacctggg cagagtgtca acgaagctat aattactaaa
   162901 gtccgcccag ttagcataaa accacattcc aagtaggaag tgggactcac aagcactcaa
   162961 aagaactaca gcaggtcgcg gacaaccaaa ggaaaagggc tctctttcta aagacaaaga
   163021 agagaggctt ttccttgctg caaattcctt tgaggcctgt gaggagcgcg caaaataaac
   163081 ggaatcaaaa taagagaaaa gcggcagcaa atctatgtat gaagtgaaac agaccttggg
   163141 atcataatga ccgtgtttgg catgcatgcc ttacaagaac ggacgtcttg gtggcgatgt
   163201 gtgggatgaa tttgcgtaaa tattggagaa ggccaagaaa agatcggagg tctttcacac
   163261 aaccaggaga tggccatgcg cgtagtgctt cgactttctt cggatctggc ccaatgtgat
   163321 tgggggagat tacgtggccc aggaaggaga ctgagtcgac gaaaaatttt gacttgctag
   163381 gcgagcaaac aaacccgctg ttatgtaaag ccatgagaac cgcgcgaata tttttcgcta
   163441 agtcagagtc ggtcgcgccc caaatgatga tatcatcgac ataagcttca caacaaacgc
   163501 tgatgaggtt acgtaaagcc tcgttgaggc ggcgttgttg tgttgccggc gagttgcaca
   163561 cgccttgcgg catcacaacc cattcgtata aaccccaggg agtgctaatt gccgttttct
   163621 cgatatcggg ctcgtgcatg agcgtctgaa aaaatgcatc agtaaggtcg agtttggcga
   163681 aaaccttgcc acgggcggcg tgttggagaa tgtcgtcaat gttgggaacc ggggtgcgat
   163741 ctttaaccgt gacactgttg aggccgcgaa aatcgcagag gaaccggaat ttgccatttt
   163801 ctttcttaat gaggaaagca ggggcggccc aaggggaact ggatggacgg aggcggcctg
   163861 cggtacggtg tttctcgatt tcttgtcgaa gggtgtcgcg ccacgctaac ggtactcgaa
   163921 atccagctcg agcgacaggc atcgcatcag gaagaatgtt tattcggtgg cggacttggg
   163981 aggtggacga acaaatgggc gggtagtggg agacgtcaga gatattggct ggaaggatgt
   164041 cggcaaattc acggaggatg gcgtcggagt gggagtggtg ttcagtgctg acggtcgggg
   164101 attcgactgg tgtgatggag ttgagttgta gttgcacaag cgatgtatag gatgaccccc
   164161 ctgcattgag gaggtgattt aaacgctccg ccccatcaaa taggcggtgt tgacgacaga
   164221 actgtaatcc gaggataagg cggtatcgtg gaccaagggc catggcgtag aatggggtag
   164281 cattgtaggt agtgtcacca atgattacat ccactacata ctcctggtct acgactggac
   164341 ccgcccgatt gtctgccatt ttggtcccca ccggtataat cggccgtcct tgccatccct
   164401 gttgctctgc gtacgcccgg tcgacgacgt tgatgccagc gccgcaatca acgagtgctg
   164461 ggacagtgtc tccgtcagcc ttgaaacggc aattgaccat gattgtaaca acccaggggg
   164521 gatgttcact gaaagagttc ggcttgattt gattgaaaga gagacggctg gaacacgact
   164581 gttgtctagt cggtggcaag gaaagaggta gttggattgt ccgggcgcag aagcggtcta
   164641 tgagtttgca tatgtttgtt gatcactggg cagagtgtca acgaagctat aattaaagca
   164701 ctcaaaagaa ctacagcagg tcgcggacaa ccaaaggaaa agggctctct ttctaaagat
   164761 aaagaagaag ttacaagcat acctgggcag agtgtcaacg aagctataat tactaaagtc
   164821 cgcccagtta gcataaaacc acaatccaag taggaagtgg gactcacaag cactcaaaag
   164881 aactacagca ggtcgcggac aaccaaagga aaagggctct ctttctaaag ataaagaaga
   164941 gaggcttttc cttgctgcaa attcctttga ggcctgtgag gagcgcgcaa aataaacgga
   165001 atcaaaataa gagaaaagcg gcagcaaatc tatgtatgaa gtgaaacaga ccttgggatc
   165061 ataatgaccg tgtttggcat gcatgcctta caccctcccc ttcctgaaaa aggccatggt
   165121 cttggaagaa aaggcgagag caggaaaaac taggtaaaaa aataagtggg gtccattggt
   165181 gaaacaacta ggctaaaggg taataagtgg ggtccatgtt tgaaagaaga aagaaaaaaa
   165241 catcaaaatt actccaacaa caactcatct gggccatcat acacctccca cgcggccttg
   165301 aaaccgtccc ataactcgac ttcaactcgg ggtagccact tgccaagggc tggctcacca
   165361 actaactgga ctcggacctc ctcagtgttc ttcctggtgc ggatgtcaag gacctcgagg
   165421 acctgggggc gaggtggagc tgggacttgg ggttggaggg gaagtgacga ggaatgataa
   165481 cgttcagaga ccacgtaagg cttgaggagg gagacatggc gtcgagcggt gtcattggcg
   165541 cgagcaggga catcgagttc ataaagggat tgattgggaa aagctttgac aatagtgtaa
   165601 ggaccatcat aatgtgggat gaacttagca gaatttttga agcctgatga ggacttgtat
   165661 tcatgcctga catgacgggt gttcaccagc acttggtcac cgaccttgta aatgggatca
   165721 ggccggcgat gtttgttggc ttgaactgct tgtcgatgtt tggccatgag gagattgtct
   165781 cgtgcttccc cttcgtcgag ccgcatacgc cgagctgctg cttcccattc gtcttccgaa
   165841 ggtaccatga actgcaaggc ttcggcaatt ttcgctggag tgtcagccac caagggagga
   165901 acatgagaga gacgcttgcc aaaaaccagc tcggcaggag tgtgcttggt tgatgcgcgg
   165961 acatggttgt tgagagcgaa agcaatgcgc tgcaaatggt cagcccatgt acgcccacgg
   166021 atgtcagtga gggttcggag cgactcgatt actgatttgt tggaccgttc agagatacca
   166081 tcagtctggg ggtgatatga tgttgaaagc atagacttgg tgtcgatatg cttggtgaca
   166141 tgacgccaaa ccccagactg gaagatgcta ccgcggtcag agacgatgga gcgagggcag
   166201 ccgaatttgg aaagccagtg gtcgtaaaaa agtcgggcaa cctctcgcgc atttgctgtg
   166261 atggtggtag gaatgaggac cacataaccc gtgaggcggt cagtgatgac aatgagttgg
   166321 tcaaaacctt gcgacgtggg gagagggccc acgaagtcaa tgccaatgtc gagaaacttc
   166381 gcctgtggaa ctggtagaga gtgaaggcgg cctgcgggct tgacagtagt gctcttggaa
   166441 gtctgacagg gtgcacacga gcttacatag tccacaacat cctgcctcat gccctcccag
   166501 taatagctgc ggcgcaccat ctccaatgtc ttcgctacgc cgaaatggcc cacatcatca
   166561 tgacactggc ggatgaaacc ttctcggagc tcactggtat cgggcacaca tagcctgcct
   166621 tcccatcgca acacctgatg tactccttga ccattctcaa cattctccaa cgttactcca
   166681 ggtgccctat cctcctcttg caaccatgct cccatgacct gatcttgagc gtagccttgc
   166741 gcgaccttgg tgatggtgga tgtgtcttgg ccgaggagac cgaggactgc tacactgact
   166801 tcagctgtct ccataccatc ctgctcatcg tcgacgccgc caagccgaga gagggcatct
   166861 gcgatgaagt tattgacacc tgagatgtgg tcaatacgca agtcgaaccg ggataggaca
   166921 cccagccagc gcttttggcg ttcggatagg tcgcgctgtt ggaggaacca tttgagagtg
   166981 aagtggtcgg tctgaacttg aatggggaca tccagaagga gaggccgcca gagtttgagg
   167041 gcacggacga tggccaagag ttctttctca tgtgttggat agttgcgttc ggcggctgat
   167101 aaactgcgag agtcgtaagc aactggaaat gcatgatcgg ggtcagggcc ttgaccaagc
   167161 caggcgccag tgccgtgatt gcttgcatca gtgaaaaggt agatggggca ctcgccggat
   167221 aacgcagctg catagtccaa tggccggagg ccagaaatct ccgccacttt cgccttcaga
   167281 atctcaaacg cggcggtcgc ttcactagac catgcccaga cccatgacag gacatccttg
   167341 ggggactggc ccttccggag tgcacgctgt tgcttctccc aggctttctc ggcagctgga
   167401 gtcggcggga ggagggcagt gagggttcgt gtgtgggtag ctaggctcgg tatgaatttt
   167461 ctgaggtatt gaaggaggcc tagaaaggat cgcagctctt tgacggactg agggagcggc
   167521 caggaggcga tggtgcggag tttggcgggg tctgggccga tgtggttggt ggatatcacg
   167581 tgaccaagaa attttacttt gtggcgaaaa aattcagact tggtgggaga gcacacaagc
   167641 cccgattttc gtaaggcagc cagcactgct cgcaaccgtt tgtcaagatc ctcggcatca
   167701 gcagcccaga caatgatatc atcaacataa gcctcacaag aatcccccag caacccacgg
   167761 agggcctcat ttagtcggcg ttgttgagta gcaggtgagt tgcaagcacc ttgtggcata
   167821 actacccatt caaataggcc gagttcggta gtaatggctg ttttttcgat gtctggttca
   167881 tgcataagtg tttggaagaa ggcatcagac aggtcaattt tggcaaagat tttaccacaa
   167941 gcagctcgat ggaggatgtc gtcgacattg ggaactggtg tggagtctgg agtagtgact
   168001 ttgttaaggc cccgataatc acagataaac cgaaattttc cattctcctt cttaaccaag
   168061 aacgccggtg ctgcccacgg cgaactggag ggtcgcaatc ggccagcctc ccgatgtttc
   168121 tggatctctt caattaactg ctgtcgccac atgtgagggg atcgataact cgcggatttg
   168181 aagggtatcg caccgggggt gaggttgata tggtggcgga cctttgagtt ggcatcacag
   168241 atcggtgggt aatttgcaac ttcaccaata ttgtctggga aaatgtcgtg atactcatgc
   168301 aggattgcta ggcggaagtc atcataccca tcagcgatcg tcactgaggc aaccacgggg
   168361 ccaaggaggt caggagcgag attgcctagc cgagaagcac cgctgaggag cccatgagag
   168421 cggatgaaat ccaggcctag gatgacttta tagcaggcat gtaggggcat gacataacca
   168481 tgtagtgcga agacttgatt ctggatgcat acctctactc ctacatgatg ttgtaaagct
   168541 ggaccccgtg ctcctcctgc taacgatacc acccgccgtt gctctgaggg ataagtttgg
   168601 agttggtggg tggtgatgag ggacagatca actagagtga ctgttgctcc tgtgtcgaag
   168661 agggcgagga agggtgaccc attagtgcct atgcgacatt cgagaaggat gggtgggact
   168721 gacagctccg gcgcaaggtg tgtggctaat acctcggcaa acatctcccc ctcctcctgc
   168781 tcaaattccg cttcctcatg gtcgaaggtg cttacagcag cgattgccgt gggttccttg
   168841 cgctttgggc agtcgggaga cttgtgaccg ggttggcggc agaggaagca tcgctgttca
   168901 ctggcaaggt gagctcgagc gcggcgacca gcaccaccct tggggagcgg aagtcatggg
   168961 ttgagccatt gagcaatgtc gatgggcgaa gacgcttcgg gcgagacagc agcgatcggc
   169021 gtgcgggtgg gcgtgatggg ggcgaaagcg gactggtagc gaaggagtct ggtggcacag
   169081 atttccatat gcttgagaag tttagctaaa ctggcctgac gaagctgatt ctcaccacca
   169141 aagtcccgtt caagctccgc caaaagacca ggtgtcatgt ggtttcgcag ccagtgtgta
   169201 gcaacgtctt cggacatggg gctgtcggaa tccttcagga gggcgaacca ctgtttgaaa
   169261 tccatgatgg ccaatgggat tttgtcaagt cggaggagct ggggttgaag agaatagatt
   169321 ttctgttcgg tctcggatac ccagccgagc ggaagcattg cagacttgaa agcttttgcc
   169381 cagtcatcaa aggtgcgaca ttggaggcca tcaccttcga gaaattgaag atggcggata
   169441 ccagtaagag actgggcggc gtgggcgagc ttgcgggcct caaaagcggt gggttcatag
   169501 cggtaaccag cggccatgag ggtaaagatg ctgcgaagct tcgagatgtg ttggtgaata
   169561 gccgctgcgt cggcatgttc agagaggact ggaaaggaat atttgggttg ggggagagaa
   169621 tcatacataa taggaggatg aggggactct gatttggcag gtaagctgga agtggcagga
   169681 ttgtgcggag ggaggtcgcg cttctcggcc tcgcgtttga gaagacctcg catttgtgct
   169741 tgtagctccg ccatttcgcg cttgtgctcc tctctctccc gctttctctc gtcctctatc
   169801 tgtttgatct tcctctgtag ggattccttg tctgtagggg gtgttgtcat ttcggggaat
   169861 ggtgtatctt gccgaagtcg tggtttggat tgatcttcaa taggtgtaat ggtgtcaaaa
   169921 aaaattttct ggtggctcag cagagctcat gcagttgaga ttcgcttaaa aaaagtgtaa
   169981 caacccaggg gggatgttca ctgaaagagt tcggcttgat ttgattgaaa gagagacggc
   170041 tggaacacga ctgttgtcta gtcggtggca aggaaagagg tagttggatt gtccgggcgc
   170101 agaagcggtc tatgagtttg catatgtttg ttgatcactg ggcagagtgt caacgaagct
   170161 ataattaaag cactcaaaag aactacagca ggtcgcggac aaccaaagga aaagggctct
   170221 ctttctaaag ataaagaaga agttacaagc atacctgggc agagtgtcaa cgaagctata
   170281 attactaaag tccgcccagt tagcataaaa ccacaatcca agtaggaagt gggactcaca
   170341 agcactcaaa agaactacag caggtcgcgg acaaccaaag gaaaagggct ctctttctaa
   170401 agataaagaa gagaggcttt tccttgctgc aaattccttt gaggcctgtg aggagcgcgc
   170461 aaaataaacg gaatcaaaat aagagaaaag cggcagcaaa tctatgtatg aagtgaaaca
   170521 gaccttggga tcataatgac cgtgtttggc atgcatgcct tacaatgatg agaggtactg
   170581 acccagcgag cgcagacgag gcatcctgta ctagagtgtc tgtgacaggg tcgacagcga
   170641 aaatgccgtg gtggtcggac tcgtcgtcgt cggcaaggga gacgaggtta gcgaccggca
   170701 cggacgcgga ggcgttgggc ggggtggagg gggggcgggt tgggcagata aggcggtgat
   170761 ggccgacaac gcggcatgag aaacacgcgt tgatgctttg aagataggcg cgggcggatc
   170821 agccggcgtc accgaggggg agccgtttgg cggggtcgag ccagtcgagc tgttgcgtag
   170881 tgtggccctt cgtggtggtg gagggggcgg gggcgagttt ggcaatgagt ggaggcgcgg
   170941 ggacgggagc gatgacgttg gcgacggttg gtgggtggcg ggggcgtgtc ggcacctgaa
   171001 ggaaacgcgc ctcaagcatg gcgtcatcga tgacgtccat catgatctca tacaggtcgg
   171061 ccgacgttgc ggagagcact gttttgccac gtgcgcggag agcagctttg gtgtggtgag
   171121 taaccaaggc atcgacaccg tccaatagcc ggcggttgac gtccacgtcg ctgagggggt
   171181 cctcgaagtc atgaagaatg ccttggtaac tgataacaag gtgaatgtaa gaggctagcc
   171241 tccgacccag tgacccacgg tcaccacttt tcccagcttc taatttcgag ccgcatttca
   171301 atttgcttcc gcttcttcca ccaagttgcg cgcgtcaaat tgcatccgcg ctccctttcc
   171361 caggtcacgt gctttatttt tcccctgttt ctccgagccg cgtctcaatt tacttccgct
   171421 cctttcctcc aagtcgcgcg cgtcaaattg catccgcact ctccctccca ggtcacgtgc
   171481 atcattttac ttccgctttt tctcttcttg ctttctcttc catttctcgt cctaagtccg
   171541 agtttcttgt ccgatttttc atgccacaag ccccggtgtt taccgggctt tggtcgcgac
   171601 tggtttcgag agcgaaggca aagtgcatgg aaaggttgac acacaaattc ctttattctt
   171661 ttatccttgt tgtgttcaac ctttccttct tccgacttta cagtcacaag taccttgcct
   171721 tctcctctgt aagcagagct ctctactaat caccttctcc cctcagaccc cctggctaat
   171781 cctgatcagt gttcctatca attcttcatc ttgtctcctt tactagtcgc tgataggaca
   171841 taatcaggta agcttcgggc tctttgggtt acacacaaat tcctttattc ttttatcctt
   171901 gttgtgttca acctttcctt cttccgactt tacagtcaca agtaccttgc cttctcctct
   171961 tgttcctatc aattcttcat cttgtctcct ttactagtcg ctgataggac ataatcagca
   172021 tatgcatttg ggatcttgtt tgcttctctc cagtccgaag ttaagcctcg agccctgcca
   172081 gccctaagag cccaccagtt ctctccaagc cttgtccctc cgagctagcc ccaacagtac
   172141 agtgaaggtc tattgtccgg accttacagt gaaagaatgc atcgaacgcg gcgggtgtgg
   172201 tgtccaagca gcggagctgc atgaatcggt ggcggagttt ggactcccag ccgagggcga
   172261 gaatgtgaga cttaagggag acttgccatg catcccaagt ctcggcgtgt ttgccatgga
   172321 gctcgagcca tgtggtaaaa cggccgcccg attgggagat cgaggtgttt gccacagaaa
   172381 tcttccacgc gtgctcagcc gggccggggc tccagtgtag gagggcgtca cggaaatagg
   172441 tctccaaagc gaggaggtgt cgctggagtg cgaacgggtc ggcaggggag tgagtcccaa
   172501 gtcgcggcgg agagatctta tccgggcggg acccacgtgt agaggggggg acgtgacggt
   172561 cgtggccggt ggtggcttga tcggctagcg ctgtccatca aaaaaaaggg ggcagagatc
   172621 cggcgaagtc cgctgccgcg tttcggaagc aattgccggt cctatgcatg ggaataaaat
   172681 atcatgcata gggcaggggc cggacagagc tcgatgccgc gttccagcgt agtccgaaag
   172741 acgcgtttcg gcatcaaatc tcacttacca acatcgacca atgcatagga ataaatccta
   172801 ccatatggtg agaacaagtg gtggtaaggg ctctgcactt acacccttcg gcaagaaatc
   172861 gagaaacacc gtaccgcagg ccgcctccgt ccatccagtt ccccttgggc cgcccctgct
   172921 ttcctcatta agaaagaaaa tggcaaattc cggttcctct gcgatttttg cggcctcaat
   172981 agtgttacgg ttaaagatcg aaccccggtt cccaacattg acgacattct ccaacgcgcc
   173041 gcccgtggca aggttttcgc caaactcgac cttaccgatg cattttttca gatgctcatg
   173101 cacgagcctg atatcgagaa aacggcaatc agcactccct ggggtttata cgaatggtgt
   173161 aagtgcagag cccttaccac tacttgttct caccatatgg taggatttat tcctatgcat
   173221 tggtcgatgt tggtaagtga gatttgatgc cgaaacgcgt ctttcggact acgccggaac
   173281 gcggcatcga gctctgtccg gcccctgccc tatgcatgat attttattcc catgcatagg
   173341 accggcaatt gcttccgaaa cgcggcagcg gacttcgccg gatctctgcc cccttttttt
   173401 cgatggactt ctgtttgttt cctcacacat tcatatatat atatatattg gtacatagtt
   173461 atagttctcc ttttacttag caaacttaat gcatactcca gtgctagttt gcatccatta
   173521 gaccactata actataacca aacctcgaac gcatccgaat gccctcgaac gccctcaaac
   173581 gccctcaaac acctcctcga atgcaaacat cgaacctcat tccctctcga acgctcaatg
   173641 aacgccaatc gaacgcagtg aggcacaccc cagtgcctac aaataatgcc atatgggtca
   173701 tcgagacacc aactgttact catccggcta ggttgaaacg tagatgcagg catgaaggaa
   173761 gatcaaagat aaataggcag acgagatttt ttggcggata gagaaacttc ggtgatcttg
   173821 caccaaatcc caatcctttt atatctcgaa aatcctcctc cccgtctccc ccttaacagc
   173881 caatcttcca gaggacccac agcgcatatc cccaacccaa aaaagggatc ttatcttcac
   173941 atatgaccga taccacatgt tcttggtgat aacacatgtt ctttgcgatc acagacaccc
   174001 cactacttgg aactcaatcc tctgttccgt tttttgccaa ctgttcatag atttcttact
   174061 ccccaatcaa tcttattttt cattctagat agatcaaagc atagccacat ttttcacgac
   174121 cagttcatag aaatatattc catagctcca gcaaatttta gttacaaagt acacaacaga
   174181 acaagccaca gacggcacga cggagcgacc gtcttcgaag gggggggcga ctgtcatgag
   174241 cctgcacaaa gaagaagaga taagatatca taggagggag ttacgtaata ggaaggcaag
   174301 atctgattca gataagaagg tccagtggga cctccagttg gatctccagc tggacctcga
   174361 aggatataaa tagatttctg tagaagtata taaaggggag ctttgtcctc gatcttcatc
   174421 ttcttcccct cgaagatcaa tatttcataa gttactttgc gaaaggtcct cgagctccca
   174481 ttgctcactc tcatcttacc ttgcaccacc ttcgacataa acttactcca ctagtatata
   174541 agcttgcctg atcttcccaa gcgaatatac ctccacccta taccatacgc caacagacaa
   174601 gtgtcaagag gtatatcata catatatctc attgcttagt taaactacgg ctttctatct
   174661 catctccaag gccggacctt gttggggacg agtcgtaaca ggacatgata tgtgtgtagc
   174721 tttcagagct ctatagtaga agtgagagtc gtgttctttg taatagagat aaagagacgt
   174781 ccaagttgta cttagctaac gcaaggcaag tttgcttgtg cactaggcgc agtgacttgc
   174841 cactgggggg caccagattt tctcaccact tgttggtatc aagcagtacc tgtggtacta
   174901 atgcaatagt gacctgcagg atttgtgttg gttgactgat gtgtttgcta gagtctagtg
   174961 ctattaagca gcaaggctca taacctgtca gatgtagagt tgtctagaga gagcttgagc
   175021 atgctgtgtt gattgccaga aatgtctaag ttgcatggaa actattctgc aatccttttt
   175081 tctttattgt tttgatatag tacatttcaa atatggattt tctagttttc tgttgctaat
   175141 tcaggttgaa aatcagacgt cgccaatgct tctaattttc gcctgaaaca ggaattatat
   175201 ttgaacacat gattttgggt ggcagttgct aattttcgag ctgctaattc ctctgatttg
   175261 tggtcatcac cgttatcatt catcatcata ataattaaga taattaagaa tcttgcacac
   175321 cttcattgtg ttgcgttgca atgaaccaag tcacgatagt tcatctttcc ttgctcacat
   175381 attttaccat ccaatggtat cttcagcacc tccagcagcc gccattccct gcaaatgccc
   175441 agcaatatat cccaactcaa tttgaaacat cagatcttat tcagctgtgt ctggcctggt
   175501 cctcgcctgg tacaatgggt catgttgcct tcgcttcctg gatgttgaag ttgactacat
   175561 gcaagaagtt tctctcagta cttagcaagg tttgattgac aggggtatga gtgtggaatg
   175621 gggtggcaag gggttcatat ttatccattt tgcggacttg caaagttgtg ctttttgtgg
   175681 aaagaaatga tgtgtccgtt gtcgatatct tgttgaacat gacataagat ttcaacatgc
   175741 agacatgaat atttgaggca tgaatttatt tgcattttcc ccaagaaact aggattagaa
   175801 taggaaagaa gaactagaac agtgcaaatc gtgggtttct tgttttttgg tgcttgctag
   175861 ttttttctca gccaaaacta ggaaatggaa tcaaaattga aaaacaaatt ggaattagaa
   175921 ttagccatga aaaataagaa atccatattt gaaacgtact attgcaagtg tcctagctta
   175981 tgtaatttaa tctccccttc ttcccatgcc tccaccaaca attcccatgc ctccagatcc
   176041 ctactgatcc ctccagatcc aggttggatc aatcattctg acacagtggc tgataaactg
   176101 tgagagtcgt aagcaactgg aaatgcatga tcggggtcag ggccttgacc aagccaggcg
   176161 ccagtgccat gattgcttgc atcagtgaaa aggtagatgg ggcactcgcc ggataacaca
   176221 gctgcatagt ccaatggcca gaggccagaa atctccgcca ctttcgcctt cagaatctca
   176281 aacgcagtgg tcgcttcact agaccatgcc cagacccatg acaggacatc cttgggggac
   176341 tggcccttct ggagtgcacg ctgttgcttc tcccaggctt tctcggcagc tggagtcagt
   176401 gggaggaggg cggtaagggt tcgtgtgtgg gtagctaggc tcagtatgaa ttttctgagg
   176461 tattgaagga ggcctaggaa ggatcatagc tctttgacgg actgagggag tggccaggag
   176521 gtgatggtgc ggagtttggt agggtctggg ctgatgtgat tggcggagat tgtcgaactg
   176581 gtctttactt agcaccttcg tacaaacagt ctcgtagaac agtgtactag atagtgatac
   176641 atacctggtc tttacttagc accttcgtac aaacagtctc atagaacagt gtactagata
   176701 gtgatgagaa agaccagaaa gttacaaaaa aaggaatatt aataatggta tagagtctga
   176761 ccgaaaatag accacgtagt catctatcta attaaggaac tagactagtg aactctgtca
   176821 gagatcacat gattaagaaa ttttactttg tggcgaaaaa attcggactt ggtgggagag
   176881 cacactagcc ccgatttttg taaggcagcc agcactgctc gcaactgttt gtcaagatcc
   176941 tcagcatcag cagcccagac aatgatgtca tcaacataag cctcacaaga atcccccagg
   177001 tcacagacaa ccaaaggaaa aaggctctct ttctaaagat aaagaagtta caagcatacc
   177061 tgggcagagt gtcaatgaag ctctaattac taaagtccac ccagttagca taaaaccaca
   177121 atccaagtag gaagtgggac tcacaagcac tcaaaagtgt aagactccca gcaagccggt
   177181 ggagccctta cacagtcggt ttgttgattt caaccacatg ctggtttatt ttttattttt
   177241 tttattttct tcattttttt gcctttttgc ttccatcttg catgcgtgcg cccgatgcaa
   177301 atccttgcac gtgacttcca gctgtgacca agttatttgc gtggcaccca tgctggcctc
   177361 agctgcatgc atcaagattt ttcctgtgcc tatttttttt tcattttttt ccttttctca
   177421 cgccgtccca aacacctggg agcttgagac cgtggattct tctggaggtt tctcttcttc
   177481 cccatccatt tgaagagagc cttattttat tgccatggtc tcctggagtg tttgtgcatt
   177541 tgggatttat attaacgccc tgcccagcgt atttgtacat gcacccattg acagttcgct
   177601 tgttctcgct gcttcctgcc attgcatttc attgctgctc tctgctctct cacatttgat
   177661 attttttctt cacttcacag atttatttct ttcactgacc cagtggacaa cacccgctgg
   177721 gcttgttaca agcagcagca gaggcttgaa tgactagagg aggatggaac agtgtgtaca
   177781 tggtttcatc caagtcaata gtcatctcca gctggagatg ttcatcaagc tgactggtga
   177841 gttcttggat gagaaccttg tggttgtcga ctgagcgaga gttgacatgt gtagggccac
   177901 agcagttagg acaggttttg aaattgtgcc ccaccttgcg gcaatcattg cagcagttct
   177961 ccttggtgaa aagctcacgg atgtgtttgc ccgcaggcga gaggtagtaa ggtccagggg
   178021 gttttgagct tgataataat gactgattgg gtgagccagg tgcggttgag tttgcggggt
   178081 gaccgaggct tgaggtttga tgcgagcgtg agtgggttga tcccttgtct cctccaagta
   178141 cttggtaact gccaactcta gcaggttgca tacctcatgc aaacttccat tcctaaactc
   178201 tggtgtcatc atcaaatgaa tgaacaattt ctcaggacaa gcaccacggt atgctgcact
   178261 gggcagcatg gtgcaggatg tcttgaatat tgcccatagg atacatgtcg ggcatggtct
   178321 ggttattgag agtgtgaaag tcacagacaa gatgatgttg gctgttgggt tttttgacaa
   178381 ggaaggtggg tgatgcccaa ggagaactag agtagcatag acagcccacg tttaaatgtt
   178441 caaaaatcat ctcacgaaaa cagggcagaa gagttttggg cacctggtat ggtgctgcat
   178501 gtctgggtgt ggcattaggc ttcaagatga tcttgaacct gacaccactc ttggtcttca
   178561 taacactggg gaaattggct acatcaccca gtttgtcaca aaagactcct gcaaattcac
   178621 tcttgagttg tgaaatgatg tcaacataaa aagcagtctc ggctgcacca agagagacag
   178681 agtttcatgg tgtaactgct gaaagtttgg tggacttcag cactgaaagc tgaggcacag
   178741 caggagttgg tgaaactttt gagtcaggag aaattttgga acggcatgtg ggaacagtga
   178801 tgtcattccc tgtgggaaga taaacttttg ggtcttgaga aactgggggg taacttgtgg
   178861 gattggcaat gtcattgcct gtgggaactt tcccaggact gcccaagaga tgatgaaaaa
   178921 ggggactttg taagacctct gtgaattcag acttgagttg tgcaataaca agcaatcata
   178981 ggtcatcact agagtgattg ccaaaatgaa ttgctatggc ttgaatcacc ttatcgatga
   179041 tgttatgtgg gagggtatgg agattgctgg actgcaaaga tattgtgtag tgtgggtcta
   179101 caggccctat tgctcggatg tagtcagaga tgtggaggaa catgtgtagt tgggagctgc
   179161 agaggtggag acagctgggg ttatcattat aatataacct ttataagtca ttagcttagc
   179221 tgagaccagt gcaagataaa cagctgagct actcacctct caaagcctct cacccacttt
   179281 gcccagtcct tcttcagacc atccagcctg ttccttggta gctcgaattc taaacattct
   179341 tgcaccagct tggagacttg taatactttg taaggatgag ctgtttgagt aggacaggag
   179401 cgagatgctg tatccaaatg gccagctgta atctttgcaa gttgttagct tagttgagac
   179461 caatgcaaca taaacaacta agctactcac ttcttgaagt ccctcaccca ctttgcccaa
   179521 tcctttttca gacagcctgt tccttggcag ctcaaattac aaacattctt gtaccagctt
   179581 ggagaactgc acaaagtgtt tgtgaaactt tgtaaggatg agctgttcaa gaaggacaag
   179641 agtcagatgt tgtatccaga accagctgtc tgccacgcag gcttgctgac actaacgctc
   179701 aacaaagttg ggtggattgg cagcaaagca tgatgggatt gtacaccctg aagcagtgat
   179761 tgcctgtcct tcttaggccc agtcctaatg tcaggtgtga ggttgaggtt gtgggggatg
   179821 aggggccagc atgtggcaga tcgctttttg aagggacaga agccatctga catgaaagct
   179881 agagcaatgt ctctttcatc agagaagtaa ttgatgccaa tctcctcagc ctccacttcc
   179941 acctccttct caagcagtgg cttaatagtg ctaactgtca aaaacgaaaa atgtcaccta
   180001 tcttgtcaga ctgtgcatta tctctggtat attcagcaca gtacattacc ttatgtttgc
   180061 ttgaggggtg gtagtagaaa acttgtaaac aggggataag gtggatgtag aggtagcgag
   180121 cccaaggttt gcttcaccca tcacacctgt ttgctttgca gaagagacag atgagatcat
   180181 ttttgtaggg tccaacaaaa gtatatgcaa gacttcaggc atcggtcata gtatgttgaa
   180241 gggaggttgc tcagctcagc aactcacaac ttgacatgct tgaaagagta atgtgtgcct
   180301 ccccaaacag tatgtgtcat ttgaaacatg ctcggtggtt gatcgtactg gattttatgg
   180361 tggtgccttt tgatcttgac aatgtcttca gcatctagtt catagactgt gacttaatgt
   180421 tagtccaaac taatggcaag agcaagcaag gtgcttacga caggatgcca tttgtttata
   180481 tgtgtttgct agacttctcc cattgtcaac tgactttcgc ctagcaaatc ctcttcctgc
   180541 ctttccgagc tctcaagata actgttgtct tcatcaacta cctcattact gcggtcatcc
   180601 ctgcaacagg tgaaggctcc acttcatctc cttcatcttc agaatctgac actttctctg
   180661 ggttcttgcc ctggatgttg gagcgaaatc gggcattgac aatgagagtt cggtatcagg
   180721 gattggaaat cgaaactcgg cgcttgtaat acgaagattg ggattgctct aaaaataggt
   180781 gttgaaagag tcagtaatta tctccttaga ttccactata gatcccttga cttgcctcct
   180841 gtgttgttga ttcactttct ccagctacat tctgtctggc agcagacagt ctgggatctt
   180901 cattctgtaa tgagttacca aggtgagtat atctgattta cttcaatctc aacagaaagt
   180961 aacttacctc atcatttgcc tcaggcattt ccatgtcacc gtcgtcaccg tcgccactgt
   181021 cgccaccatc aatttcgtca gaacagtcct cattgattgc ttctgtggtg ctaacttgag
   181081 ctgctgtatg gcactctagc atttgcttat catgtcatcc ctgagttgcc caggggatgt
   181141 tcatctttgg acagcgagct aagtcgcagt gacatgcagt tttgcgtgca tgatatttca
   181201 gcggcattgt ggctgatgcg gctctgttgg ttgatggttg atagagatga cacaccaggc
   181261 agggaaatgg cgaggatgtg aggagtctct ggtggagctc agtcttgtcg atgagttcct
   181321 gcgtgcgttc tcggtttcag cttggttggg tggataaatc agtcaaataa taataaaaga
   181381 attaacaagt tatgtaaacc gaaccaaata atcgtcccaa taatcctgaa tctattatgc
   181441 atttcaaatg accttattat tattgctttt cttcattatg attttacaaa taagaaccat
   181501 aaaaaaacaa aatccaccag ctaaaaggct ccttctcact cctaacagca aacctccgtc
   181561 ttctccaatc ttctaatcct ttgcagcacc agagacatct tgttgtcttt tgggggggca
   181621 gagggcattg ttgacatggg agagctattg agacttgaaa tgaaactctc ctattatggc
   181681 agcaggatgg tattgatggg tggtgtctca gatcttggta tatggtatag ggccagaagt
   181741 atatatgctt gggaagatca ggcaagctta tatactagag gtaagtttat gtcgaaggtg
   181801 gtgccaggta agacgagagt gagcagcaat gggagctcat ggacctttgg caaagtaact
   181861 tatgaaatat tgatctttta aggggaagaa gatcaagatc gaggacagag ctccccttta
   181921 tatacttcta cagaaatcaa tttatatccc tcgaggtcca gctggaggtc cacccagtta
   181981 agttcttttt ttggaggtcc agctggacct tctatctgaa gcatgtcttg ccttcctctg
   182041 tcctgtaact tcctatgatc tcttctactt catgcaggct tgtgacaggg tctggcaagg
   182101 taaatcttat gcaaaatatt gactttattt ttaaaccagg ctttattaag gaggctctta
   182161 cacccaattt gaattccctc attagtgaac ttacaataat tcagataaca actgttgatg
   182221 gacactactc aatttccctt gcagttttgg gctttgaaaa attacatcac aatacatgta
   182281 gatgcctaat ggcctgaatc tttatgtcaa gtcactgatt ggatcatgcc ctataacaga
   182341 agttctatct gtcagttcat gtttgtgcta ttttaaactc acccaaagaa gagaatcttg
   182401 atcatgaaag ccatgactgc gtgcatcaca gcgacagcaa taatgagaag gcgagcaaac
   182461 ttattatcag actgttttga tggcaacatt agctctccaa cgttgatcat aggtcgtctg
   182521 aacagtttat atcacttact gcagcaagca caggatatat atttccagtt ctgacattag
   182581 ctctgagtgt tgcacaagag aactcacaaa aagaaccctg aagtaatgcc acctaaccca
   182641 attaacaccc atctcaaaat accaactggt atcaagcata ggaggctcag agggataaaa
   182701 atactcattg catatccata aattcccaaa gcttctgcaa tgccccattc tccaacaccc
   182761 aaccacttcg tagcgctcca gagcaaggaa ggcacaagta aaccatagat ataaattgcc
   182821 gaagtcgcgg tggatagcaa gggaaggttt gaactagcat gtgaagagct catgtattgg
   182881 gcaatggagg ttgtcagagt ggaggtggtg tacaatgtga gaatgagggt tgtcaaggtc
   182941 cagaaagagc ctttgacaga tgggattagc ttgtgatttt acttacgaca cgtttccact
   183001 taccatacat gtcaatctgt ccctcacaga cttcaattat gaacccagga cgagggatca
   183061 tagccatccc tacacgtttc aggactgtgt ttgtatcgac atcaaaatat gtctactcga
   183121 tgtcttagtt tagatagtta cagcagttga atccgctctc acttgatagt atgtcaaatt
   183181 aaaaggactg aaaggaacat ctggaggtga tggagtagaa gaaagtcctc cgtcggtctg
   183241 ggatggaaga aaggctaccg aaaccatgag tttgcaggtt cgataaggca tgacctactt
   183301 tggaattcaa gatcagaacc gtgggatggt cctggttgct gcgtagagtg gtgagtggtg
   183361 ctgcaagggc ttaaaagagc caattactta catcctcgtc aacttcgact atggcgtatc
   183421 cttgttgggc catggtgagg ttaatatgta ttgcagatgt caaatgggag ggcaagaaga
   183481 atgattgcta ttgactgacg cgaggctgcg aaatgcaaat gcgatatgcg acaagagatc
   183541 aagtctcatt acgtaaaata aagtagatgc tgtcagtcgc ctcccgatgt acatgcacgc
   183601 tgtcaatgca gatagttctt gccagtgtat atagctatcc atctcggcag ctttcatcaa
   183661 gtgttcgtat attgccacct gccccctgtc acttagaatc ctgtatcgag acgcacaact
   183721 cctctcatta cccggccatt ttcaacaaca cgatacaata tgtcgaatcc ccagacccct
   183781 tccagcgccg acttctcctc tgccagtaca cctctcaaga agtttaaatt ggtgttcctt
   183841 ggggagcaga gtgtaggaaa gacaagttta attacccgat tcgtaagtcg tggtagatca
   183901 tttacctagc tgatatccag atgtacgata cctttgataa cacgtaccaa gcaacaattg
   183961 gtaagcaaag tatagcaacg gccgagctca tcaacaggta tcgacttctt gtcgaagacc
   184021 atgtatctgg aagatcgcac ggtacgattg caactgtggg atacaggtat gtgatgaatt
   184081 catcattaca ggatctttac taaccgtttg tagctgggta agcttcagtt aagcattgtt
   184141 tgttcgcgat aatgctaatg cgaatgatta tcgaacctct ttagacaagt aagtgcatgg
   184201 cattagtgaa tatcgctaat ttcaggaacg attccgatcc ctcatcccat cctacattcg
   184261 agactcctca gtcgcggtca ttgtgtacga catcactagt acgtccagat agccggtggc
   184321 aacgcataca ccttgctgac attgatgcaa cagaccggac atctttccaa aatacttcaa
   184381 agtgggtcga tgatgtgcga aatgagcgag ggcaggacgt tataattgtg cttgtgggga
   184441 acaagacaga tttgaatgac aagcggtgcg tcatgacaat gattcacgag aagacagttc
   184501 cttaccagtg ttgcttagtc aagttacccc tgaagatctt gacaaacggg cgaaagaact
   184561 cggtgtgatg tcaattgaaa cctctgccaa agccggccat aatgtcaaga cactatttaa
   184621 gaagattgcc atggctcttc ccgggggaag tgaagcaaag gacaacggca cgacaagtac
   184681 gtccatctat tctagcacat tgctgatagg tagaaatcga cgtttcatcc tctcctcaag
   184741 aagtccctca ggcctctggc tgttcatgtt aggcgttgta gcgatcgtca cgtatacgta
   184801 gttgtttggc ttacattgtg tgtttgatac agtaattggg attcatgata cccctctttc
   184861 ttgcctgtag ttgacttata tgcacaactt gaagagcagg catatgttgt tcttgatctc
   184921 gaccatattt tggatttgca ttcaggtggg ttgaccttgc gtttatcgcg taaccgagct
   184981 cgggaaatat gttccaaagc aattgcaatc ttgcaaactt gggccactca atctattgat
   185041 tacgcactcc gcggcgtctt gcaaccatct ctcatctatg ccacatagcc tctgcggcca
   185101 gtgaagattc cgacgatgcc ttagtttcag agtatgcact ctggagctat tgtgaacaag
   185161 aaaaagatga ggtgcttcag gatcactttc actgccattt tctgctggga atcatccctt
   185221 cttggatgtt cccgctttta agggccatgc cagtcgtctg tttggtcggt aatggtaagc
   185281 acgtaagtct tttcggtgcg ggatcctcca acgaagacct tagatttctc ctttggcttc
   185341 gactggattt tggtcaactc agtcgtttct tctttattgg ccattgtgaa ctcaggcgcc
   185401 ttcgtgaatt ggcactctga tctctgagaa agttgtagca ggggttcttc gtccccatta
   185461 actaatctct ttgactatgt acgtgactca tgactggtaa atacttcgcc aaagttgagc
   185521 agtaaggtcc aatggactac ctgtcatgct agctttgctt tcatttccaa tgactgtaag
   185581 caggcgacgt atttggggga gctacggccg atatggcttc agcatcttat gaccaatggc
   185641 aggtcctgaa ttcaaattat ggcctaaaaa acggcttatg atctcagcgt cttacgagtg
   185701 tgaacaacaa ctgaccggat tcgcggacca taatgttgat gtatctgttc tccgccttgg
   185761 atttagagaa cgtttctaat gcgaaaccag accacaagaa gtgagtctga tcgctttcag
   185821 tggtctctga catcgtgctt accgtttcgc acagccaaga tctcggtttc atgggtaacc
   185881 agtggaacct gatgctcaat gttttttata ccatgatgtt gcatgacata tcgaggaact
   185941 tgcttgagca agggatttgg acttgcaaca tctccagttt ctccagctgg agatgttgca
   186001 tgttgccatc tacatgacag gataagtgca aacggaattc ttcgagatgc aaggctgaca
   186061 ttggaggtaa atcaggcctt atggcttgta tgatcaacgt tgtcgttaaa gattttgcat
   186121 ctgtctctct gtttgtcttt tgcgcggttt tgtgagctgt taaccatttg tgataaagaa
   186181 atcgtaatac agtttgaaat gctgcaacca tggtcagact gggacaagaa ggtaggtgac
   186241 tgtatatcca ttgcgtcatt gaaaggaacc ttgtccataa gcctataaat aaaggctcaa
   186301 cgcctatcaa tgggtatttc tgctacacct tcaagacgaa tatccgttaa cgttgctcga
   186361 ctggaatcgc caaagatctt gacacatctc ctgcagacct ctgcgcgcga tgaatccaag
   186421 ctcttcttgc gctagtcgag ggtcggctgt caagtccgga acatcaccgg atctggaacg
   186481 cgcaatttta acttcattcg aaaagggttg actaacctaa cttaccttcg ttccacgatt
   186541 tcgaactggt actcgtatcc tgttgcaatt ttcatctcgt tgatcatctc aagaacggtg
   186601 atgcccttac cccttccgag gttaaatgcg cggaaatacc cttccttttt tgtatcaatc
   186661 gattggaaga tacctgagct ttgagttttg atttccgact tggcgagagc gtcaagcgcg
   186721 aggagatggc cctcagcaag gtccatgatg tgaagataat cccgaaggca tgtgccgtct
   186781 ctgtgattac acatcgtcag aatcgattaa gatcaaacag cacgcataac tcacctggtt
   186841 gggtagtcgt tcccgaaaac cttgagatca gatgacaatc tccccacagc gatctgagct
   186901 agaattggga ggaggttgcc tgggcggccc ttgggctctt ctcctagctt gccggacgga
   186961 tgagccccag ctgggctggg cgtgacgtta gcaaggctca cagcagtggc aagggacatt
   187021 ctctcactta cttgaaatac ctcacgctta tcgctttgag accttgattg tcagccgtgg
   187081 ctgcgccagc ccggcagacg tcccggatca cttcctctgt gatcgccttg gtacgcccgt
   187141 acacggattc aggtatgatc tcggaggtct cggggattgg aatcactgca ggggtgccgt
   187201 agacggtagc ggatgacgag aagacgaggt tgttggtttg ggattgttgc ataatctgaa
   187261 gctgccgatc agctttggcc aatagtctgg acagtatgaa cataccttca gtagcgagat
   187321 tgaaccccca acgttgacct cgtaataatc taacggaatc tcactcgact ctcccactgc
   187381 tttgagtgcg gctaggtgga ttaccgccca tattccgcct tttgactgat attgcttgaa
   187441 caccttgttg atctcttccg cgttacgaat atcgcattgg tggtaaaggg gtttgggagc
   187501 atgtgggcta ttgaggatag aagatcagcc acgccagtcc atgctatgta tgtgaactta
   187561 ccctacttcg ctttgggcta tttgattgca gcgctcgaga gcttgagggt atgcgttgtg
   187621 cgcgttgtca atgacaatag gcaggtagcg accagacatc agaagggaga ggacaacgtg
   187681 agatcctatg tatccgagtc caccggtgac aaggacattc tgtacgacaa ttagctttgc
   187741 ctttgtcgta atagaacgac ctcactttta gaggctctcc agggacagat acacttgatg
   187801 atgatgtttg ggtcatggta actcgagttt gttcaaaaat cacagtgcga atgagcggtt
   187861 gagtatgtta ttgtggttca atgtttgctg tcatagctca aaactgctga aactgcattc
   187921 tgcatctttt atactggatg ctgaatatcc tcttcctaac acctattggg gaaagtcgat
   187981 gcatcagaag tatgaacggg aatacccaga attggccccg agcacgaacg ggaatcttgc
   188041 ccaaataatg cttttcatcg aacgggaatc tcgaggatgg gcaattctgc gaatgggaat
   188101 gtgtagaaga gggagcgatg aaggggcatt ttgcgaacgg gaatgtgttg aaggagggga
   188161 agcgatgaac gggaattcag cgacgaacgg gaattctgtt gcatcgatga tgaaatcaaa
   188221 cgggaataat tgactatttc ttgccagaaa cgggagtccg gagtccggat cgtttgtcgg
   188281 gggagtgtcc gcgtgcattt attcagggac aattcacagc gaaccacaca accttcatgt
   188341 cgatttgtaa atgtctttcg aaatgtagat agaaactttt gcaagtatac gttggcaccg
   188401 ttgccagcgg ggtcggaaag actgcccacc taatccagac aatgaagccg ctatttatat
   188461 cactcacaaa gccgagtcga cggtcttgtt ttccgcccgt ttatcatgct caaaatgggt
   188521 tcggaggagc tacgacctat tcctgctttc cacaatctca gcgagattta taacacagag
   188581 gagactcttg agcgggagag gtacgctgtt acgcagatat aacaaaatcg actgggctga
   188641 cactgtattt gttcatcaca ggcaaaggtg gagcgcccta gttcaaagtt ttgtagaaga
   188701 gtttggcggg caaccgaact atattattcg agcaccgggc agagtgaatg tgttaggaga
   188761 gcatatagat tactctctct ttgtgagcat cgtcaagaat ccccgaacta ccacgctgat
   188821 gcatatacat acgcttagcc tgtactgccc gcggcaatcg aacaggatat tatcgttggg
   188881 attcgcccga ctgcaacgtt tccaaacaag atctccgttg acctcgccaa tgccgtcaag
   188941 tcgtatccaa acgctgagct ccagcttgct cgtgatcaag aattgtggtc attaaaggta
   189001 ccgcttccaa gcaaggcgaa agggtgggag cgatacgttg tcgctgtttt attagagtgt
   189061 ttggagaggt ttgcggagca attgcaagac ggagctgcgg gcatggaagt catggtctct
   189121 ggtacggtgc ctgaaggagc tgggctgagt gtaggtaacc caattctctc caagggtctt
   189181 gctgatagtt tacaattaga gctcggcggc ttttgttgtc ggcatcatcg tggcattcct
   189241 tgtcgccaat ggtttacagg aaggagtgag cagggtgcaa gttgtggata tcgccatggc
   189301 cgcagaacac cgcttggggc tcaaaagcgg tggtatggac gtaagcactt gccattgctc
   189361 tctgccggac gtcagcgttt aatttaaata atatagcaag ccgcttctat cctttctgtc
   189421 cccaacagct tgctccatct ttccttttat ccgtctctca aacccgcaat acttcctctt
   189481 ccttcgtcac tcacattagt cattaccaac tcgatggcac ctcactctct agccgattct
   189541 gctccagacc gctacaatct tcgagtcgtt gaaaatcttt gcgctacccg tatcctgctt
   189601 cacacctttg gtgcggatgc gggtgttctc tccacgacgc agcgaggatc taccggtcga
   189661 ctttggctcc gtgaggcgct tgaacattgg gcagaggatg ctcacatgga tgaggaaact
   189721 gtttatcgga atctgctcgc tcgtattgta ggagtccttg gcaaagaagg tcgcgacaag
   189781 aatggttgga ccaaaaatca gatgattgaa gaaagcggta tgacagcaga agactttgag
   189841 gcgacgttct tggcgttcat tcctagtgag tactctgtta aaagactttg gccggatttt
   189901 ggctgaacct tgcattcaca gtccgtgcca cacggttcta cctgttgcag cgggtacagc
   189961 atacgctcga agagtcactt cgggtctgca gcttcaaaag gctttgcgag gcgtcggtgg
   190021 ccacatctga caacagagtc agcgaaaccg gtcttgtcaa agaattaggc gcgttgatca
   190081 ccgcttctca cgtatcaatg agagatcttt acgaggccac cgtgccagaa gtggacgacc
   190141 ttcaagcact ttgcttgcaa tgcgggtcgt taggatcgcg tcagacaggt gagcagattt
   190201 gccgttgata aagggaaggc tgatgaatgg gactacacca ttaggcggtg gatggggagg
   190261 cgccgtgatt tctcttctcc cgtcgaatcg ggctagtgat ttcctcagag aagtcaggaa
   190321 gatgtatagc ctttataggg gtctttcagt agatgagtta gacaaggctg cgtttataac
   190381 cgttccagga tcaggcgctg gctgtgagtt aatttgctgc tgttctgcct ttctcgccac
   190441 cccgtactga cgctctgatc ctgcacagtc tatccattga tggaaggctg caagatagtg
   190501 tagtgaagtc gtattatctc tgcaatgtaa ttctcaatgc catgcatatg cttgcacctg
   190561 tgccttctct ttagtcgaca gcactgacag tctctcggaa agtgtcgttg cgagagccat
   190621 gcatgtatgt ttccatggtt cgggcgcatg tttcttactt aaatatgata tgcaagtaat
   190681 cacacatttg tccgccggtg gaaagaagca ggtcttgtcg aaccccgggg atgcgacagc
   190741 agaggttcga acacgcaaaa tcgtaatttg atatttatat gcgcgcccac cttcgctgac
   190801 aattcccgtt catgaatcgt ttgtcagtaa ttgacgcgcc gggggtgcct tgggggagtg
   190861 ttgtcaatta acatacaaat attcccgttc gtatcaattt gcatatccat ctcatcacat
   190921 agtagtattc ccgttcgtat ccatttgcat atctcgtcac atagtcttcc cgttcgtatc
   190981 catttcatat cgtaacatca tacagtcttc acaatcttcc cgttcgtcct ctcatcgtca
   191041 agccattgat tgtcaataca cgcctacata ttcccgttct cttgtctgcc acatcgctcg
   191101 tgcgttcttc ccgtttttat gggaagactg gggtcatgtc gtcaatacag cagcagacat
   191161 aatgggtgtt atatatgtcg agtttcacat ctggctgtac taagatatcc gtgacccact
   191221 ttcacaacga tcacttatca gcgctcaatc ccctcttgag aatgacggcg actcataccc
   191281 atagcaatgg ttccaacgat ttcacacctg tgtccataaa tgatcacgtt catcggcgct
   191341 gtaagtcact ctggtttgtt catttataat cgtaggtttt tcctgacgga gtaccgtgat
   191401 ccaccctagt caaccctctc cttggcaagc atgttctagt ctccccacat agatcgctga
   191461 gaccatggaa cgtgagtgtc ttgatcgtct accgatgacc tatccctctg aaccgattct
   191521 cttgttcagg gccagaagga aacccctgct atccccgttg aaacccctca cgactctaaa
   191581 tgctacttgt gtcctggtaa taaacgcacg accgggcaac acaatcctga ttataagggt
   191641 atttatgtga gtcgcgagac tgctttgtag gaaaggcaac agctgacatg gatcaggtct
   191701 tcgagaacga ctttccagcg ttgcttcccg accctctggc tgttgggacc aacaagatct
   191761 ccgatgatcc attattccag tctgaaccag tcagaggacg gtgcaaggtg atttgtttcc
   191821 atccccggca tgacctgacc atggcagcta tgaggatttc agagatcaat catgttttgg
   191881 acgggtggaa agacgtttat gcggaggaag ggaagatcat gcaagaggag agttcagacg
   191941 gctgtgtgca aatctttgag gtacgcaatc aaaaagttct agattcccaa atcaggtcat
   192001 tgctaattcc tagaccagaa ccgaggcgca atgatgggtt gttccgcacc gcatcctcat
   192061 ggtcaagtgt ggaccacttc attgtaagtt agagatagcc gggcggtcga aggctcttcc
   192121 tgacattttt cccctcagtg ttcccgatga acccgctacc gaaatcgaga actttgttcg
   192181 ctatgcctca ggtcgttccg ggtctcatat gctgttggac tatgctcttc gcgaagtaaa
   192241 ggctagagag agagtcgtaa cgttgcacga aagcggctgg gtcgcagtag tgccatactg
   192301 ggctgcgtgg ccatttgaaa tcctgcgtga gtgtgtgtac tttgacactt ttcgatagtt
   192361 cgactaacaa tgcaccagtc atgccttaca aacgccatat cccatcgatc ttacaactga
   192421 cagcggagga acaaactgga ttagcgacga tcttgaaaga tgtactgagt cgctatgaca
   192481 atctgttctc gtgagtagga cctgtgctta ctgtctcttg ccagctcctg ctgattggtt
   192541 gcgcttccta acattcgatt tctcagatgt cctttccctt attccatggg tttgcaccag
   192601 tctcctctgc ctccgacaga cccgacatca aactccgccc aagttcattt ccatttctac
   192661 ccacctctcc tccgaagcgc aacagtgaga aagttcatgg tcggattcga gctcttaggg
   192721 gaggcgcagg tgaatacaag tctgacgtga atcctgtaaa gcaaaacgct gacgttttct
   192781 gccatcaaag cgagatattg taccggaaca agcggctgtt cgtctgcgag agtcccttcc
   192841 tcataaacgt gcaacacttt caaacgacaa gccatacaat ccctaagctc acaatacata
   192901 actcagttgt tgtctcgaag catgtactgt agtttccagt cttcattcaa gttcaaagat
   192961 ccgtactctg tgcagctggt tcctgctggt attggctttc ttctaaatat ttgtaatggc
   193021 ggctggccgc tgtaacgaca ttgtttgaca gagtttcata acaagttgat agctaacggt
   193081 gcctctccta cgtagaacag attgcatctt ggttaaaaaa gaaacagcgt tttaatcctg
   193141 tgcatctgca aagacgaaac aggtccatct ttgtctgcag taccaggttt gcacatcaca
   193201 tggttgcttg agtaactctc attctctctt gtcttccctt ctagggcgtc cattccatat
   193261 tctacgcgcc tcacagcgaa cccgagtaat tgttcgcctt ttaatcgacc cgttgtagtg
   193321 caatgagctt tcggcctcat agactaatgc cacatcacag tcggaagcta ccgccggtga
   193381 cagtgtgaga gagagagaga gagcgagagg agatggatta ggatacaaga aaggactata
   193441 gaagaaacta cgagaggctg tgacagcaac tacctcttcc atgggtagct gccaaacagc
   193501 ttacggagat tctaagtaca taggtacata actgttagtt acgcccatgg agcctatatt
   193561 gctatattgt ttgatacaca cacaacacac aacaacaacg aaactcgaca tgagacccga
   193621 gttcaactat accactacac aacctaacga cctatcgtca gtatcactac taggtagatc
   193681 gaccgccaac agccaaacct aggacagctt tgtattccgt agaattgata ccaaggagtc
   193741 gatattctgt tatctgctgt gggtggaagc ggaacggaac caacaactgg atcgtttaac
   193801 caataggaga cccgggtatt tccctacacc gtcctgaaga ttcggactga cggaacaaga
   193861 ctcaaaacgg gataaacacc caggcattta ctgatcgttc ggatcgttga ctcctcaggg
   193921 tggatatcac tagtaggtta tatcgactac aggcagtatt cggctaggtc ggatcatccc
   193981 gacgacttcg ggacaattgg agttgaggta aagtttggct agtcggtata aggaaaacac
   194041 agacaatttt ggtagagaga atgtatcaaa ctaagatcat cgaggaatcc tttgtcgcat
   194101 ttcatcagag agcaccatat ttattaagga gaaagctgtt tttaaatcgt ttgtggatat
   194161 tcccatgtca gctttttcat aggctttgga ggcgattatt attgatggcg gcagaaatct
   194221 tttcgacaca ttacatggcc gtaatactaa ggcagggcaa gtaaagagcg cctttctgat
   194281 gggccgcctc gcctctctta gtgaatccgg tcagaccctc atggcctcat tgctgcgcgc
   194341 cgtgatgcaa tgctcgctcc tttagattca taatgccaaa taggtccgtt gccaacaaaa
   194401 ccgttcggca ttcgagctga tgagggctac agtgtgacaa gcggaacata cttaatttac
   194461 attcatacaa tactcgtact accggaccga acaattccga tcgtccgcac tccgtttctg
   194521 cttttattgc gttccttcct accttgtttg cacacatgtg atcatactac gcattctcct
   194581 gatattctat ctctcccttc tcagtgtatt tctcttcagt cactgcggaa agctcatcaa
   194641 cgatagtgtg cttgaattgc cgagccggta cttcatttgc tgtaacggtg acgtgatcag
   194701 ccatatccca atattttgaa aaggcctcac tcaccaaaca gcacatccaa ctcgctgaac
   194761 attctacctt tggtctcggg aagtcggaac cataggtaca ccaaggatat gagacaacac
   194821 cccatccaga agaagctgga cttggcaccc cagttccact ctgagacgga gaacattcga
   194881 ggggtgatct gattacaaat gattgatgag atgaggtaga ctcctctgcc gaggaccatg
   194941 gtctttgctc tgacacgagt agcgggaacc tctgccgcaa tcgtgtaggt cacggggaag
   195001 aaagttgcat tggtggaaaa gttgatgatg accattacaa tgccaattgc aagggtggct
   195061 ttggtcgagt tgacagttcc aagacttcca atgatgacgt gccagactac catcagggcg
   195121 actcctgcga tgtaaatgga tcttcgaccg aagtgatgca tagtgtacca gcacgcagca
   195181 gtgcccacga tgtagcagca tgtgatgccg aggaacatgt tgaaagcgcc atcttcagtc
   195241 attccgccgg tctgcaggct gtgtcattga tcagcagggt ttgcaaaatg cgcagtatga
   195301 atcacactta ctactgggtg gcgtagttga tgatgttttg gccggaccag tactggataa
   195361 tccataccag catgacctag atttgtgtaa gggttgatac gctcctttaa tgtgatgtaa
   195421 tgggacactt acaatttcag ttcgacgcag attggaacct ttgaaacagt ctaagaaaga
   195481 agcgccttga gtttctgctt tctccatttc gatggtatgt ttcatgaggg cgatttgttg
   195541 atcaacgagc tgatcggtga ggtattcaga tggtgcaagt cgcttagtag tcgctcgggc
   195601 gtcgtcttcg cggccgactt tgacaaggta ccaaggacct gcagttccat gaaacctgtg
   195661 agcgatcgta tggatccagg ggtggcaatg cactcacttt caggagcgaa acacgcaatg
   195721 acgaacaatg gtactggcca cacccattga atcatgaaag ggattctcca gccccattga
   195781 ctgtctagct cgagagaggc ccgaaccacc ccagcagaga gcaagagtcc aaagccccag
   195841 cacatgttga caaatgcggt gaggtaacct cgcatggcaa gaggacagat ttcggcagcg
   195901 taagcggtgg agagggtttc tatggatggt tagatgagca cataataccc catgtcagtg
   195961 tatatactta cggaagatac cccatgggat accacacagg atttcacctc caaaaagcat
   196021 gggcaacgaa gtcgaaaaca ctggaaggaa gatagtccct accatcacgg ccatggcagt
   196081 caagtaaact tttttggaac caaacttggg ttgtgcccat ccgttgatag ctagaccgat
   196141 catttgtccg atcgaggtcg cgttgttcaa cgcagcttgc caattggcag ggatatactt
   196201 cgttccatcc gcagcggtac tgccgaactt gttcaagaag gaagcctgac cccagaacga
   196261 gttgatctga gtgaggctgt cagtacagta tacaatggtc aagcgatcat aactcacgat
   196321 gccgacatca tagccctcca ttacaagagc aagggaaaga gccatggacc acaaagcagc
   196381 tttgtagtaa agtcggaagg tctttttgaa gcccagttct ttctctgcag ctgccgccga
   196441 gagtgcactc tgcacgagcg ttggatcagc atagaaaagc tgctcggcat gtttgccggc
   196501 aatacgggtt gtcttgtcgc tgtgtgacaa catgaagaaa ataaggactt tgatagacca
   196561 tagaccatgt tggaaaagat cggttttata tgtttctgcc tccaggataa gatagggccg
   196621 atcgggggct ccagcagaac gaactgatag aaatcactga tcatatgatg gtattgttcg
   196681 ggatgtgata aggcagatca ggtactgcag aggaacgaat tgataaaatc actggtgtgg
   196741 aactgtcccc gattggacga gcgtcacatg gacggtgtcg gcaacttttt ttagaaaaat
   196801 aaacagtcgg aatcggggga aaagttgccg accaagtccc tgcgctgcgc gacattcccg
   196861 ttcataaatc ggtgttgtca atataacaca cgggtattcc cgttcgtatc tgacaattcc
   196921 cgttcataaa tcgttgttgt caatataaca cacggatatt cccgttcgta tcccggccat
   196981 ttaatatcgc ctcatcacag tcttcccgtt cgtcgtctca tcatcaagct attgattgtc
   197041 aatacacgcc tacatattcc cgttctcctg tctatcacac catttgtgca ttcttcccgt
   197101 ttttatggga agactaatag cgtcatgtgg ccacttcagc agcagacata atgcgtagta
   197161 gtgtccaagg ctaagtccaa ggctaaggaa gacagctgat cggctggaaa gactccgacg
   197221 cggattgaac gatcgggagc tctttcattt ccgccggaag agtaggccgg tagagagtga
   197281 tcaagactat atatgcccgc actccccccc cacccttgtg tacatttggc tttcacagca
   197341 gacttgcagc gacatgatta gcgtgcgact caatgagtac aaccttcctg agggaaagga
   197401 cgaggacaag gtcagcttcg accttgctga acttgacaac ttatcagact ggtccggctg
   197461 ggcgttttat cgcattgcgt gagtgtttac gaatcattca gaaggttacc tgactataat
   197521 gcacaggccc acttggatcg aagcccgacc gcttgacaat gtcagtctgc tgtctaatca
   197581 gctgacaact catctgctgc tcgtgaagcg taaatctcag cccgatcata ttgcttgcgt
   197641 ttatcctatt tcatcctcct ccgccctcag taacatcgta aacgataatg gcgatatcaa
   197701 agtacagctc agacgagcaa agggaaatag tgatgcgaaa gcagctgttg ttattgggac
   197761 ggcgtcagac gctagccagt tgaactgttt gattggggat gtggtgcgaa cagcaagagg
   197821 ttggctcctt gacgtaccag caaaagaagt tgtcgatttc aagtcttttc cttctggcgg
   197881 accgctcgat ggcgtaggct tctgtacctg gagcagtcta ggagagggtg agtgacataa
   197941 gcctggcgta caactaactc tttggataga tattcgtcct gatagagaaa acatgtcagg
   198001 gttatttaat gcccttacgg atcacaatct gcctatccaa tcgttcatcc ttgacgacgg
   198061 ctggctcaac caaaaaacgt atgagaaagg tgattcctcc cctttcgtat ccacgacagg
   198121 gcccgaggag gagcgaggga catggcagtt gagaggattg tacgattttg acgcttggtc
   198181 cgggttgggt catgatggga tcaaaatgat agtggacgaa gcgacaactc gtctcagtaa
   198241 gattgacggc gttaaagaca ccattcaagt gggagtctgg atgtcgtgag taatggaacc
   198301 tcagatgtcg aacatatgtc tgatatattt ctctagtctt gtcggaggat attgggacgg
   198361 tatctcacca gactctcccc tcattgccaa gtacaagtgt cggccatacc cggcctcgcg
   198421 tgctcgtctc cctggtatat ctaacgaacc tttcaccgtg ggcttcttac ccggtggtaa
   198481 gggaacctac tggcttccac ctccttccga gtcactcagg ttttggcgcg attggttcaa
   198541 ctacctaaag tctcaaggtg tggatttcct caaagtggac aaccagggca gtatgagtct
   198601 tgtggacggg acggaaggtg tcgaatgcca gcatgcgatc tgggagaata tggtcaaagc
   198661 ttcagatgag gtgttcggaa agggcaaagt gatccattgc atgtcgcacc atgaaagtat
   198721 ctggggtggc atacaaggcc tgggaattgt gactgaaggc gaaaaatttg tctggcggtg
   198781 agcacgaata cgttatagtc gcaatagcat ctgtcgctga ctagcaagtc gaccacagaa
   198841 attccgatga tttcggtctg ggacacaaaa aggcgaatgc gcaccaacaa cacatcttca
   198901 ccaatttgtc aaactctctt ctcacttcac atctcgctat gatcctagac gccgatatgt
   198961 tcatgagcgc agagcaagat cccgtcccac acgcctttct tcgagcactt tacccgggac
   199021 ctttgctcct gagcgaccga cctggcatac atgactcccg tctgttaggc agaatgattt
   199081 ccaaggacaa aactggcatc gcgcgggtga ttaagacgca gcatcctgca gttcctttga
   199141 gtcaccgagc tctcgatatc gatgtgattg gtaaaggcga gggttctggt ctctacgcag
   199201 ctgctcctac tgaggcagga gtcattctgg gtgtttggaa tgttcgagag gataacgaca
   199261 atggtcgagt cgtcgacaaa ttgactttta cagatgtcaa atacgcttta aacggaaagg
   199321 atatgtcatc accgtggctt attgtggaaa gtgacttgga aaaggggggc atcagccgaa
   199381 ctggactcct atcctcgtcg gacgcagtca tcaccgacat tgtccttgaa cgaatgaaag
   199441 cggcgagttt ctggctaact cccctcaggc ctgtaaacaa ggtaggggtt gctgtgctcg
   199501 gcttgaccaa acatttcgcc ggtctaatgg cggtgaccga tgtccaaagt aacgacagtg
   199561 agtttgaaaa ttactcttcg agtgaagagt acccgctgaa agatgtctta gcccgagtga
   199621 ctgctcaggt caacggagaa ggtacattcg gatttgtcgt cgtctcgtcc cagcgaccaa
   199681 tgtacaccat ccacgtggat gaccaagtac aggatgccac actcgcctta actccaagtt
   199741 tccacggcgt cgataaggta tggttgatag aaaccgaaat acgggcaaat ggaaccagag
   199801 gagacggatg gacggttgcg atagatatct taggctgatc gtagcaccaa taatgaatgc
   199861 aagagtaata catcgattat aaacctttcc gaggaagcaa ggccatgaca caatgggcga
   199921 tcgaaaatcg ggaatggaag gagtcccact tatccatgag gaattcatga acaaacaacg
   199981 gcaattttgg ttttcatcaa cacggtccgg ataatcctgt gatccttctt tttcccaatt
   200041 ttacgtagtt gctgtttctt ctgataccaa acgagcgcat attaccgatc tgagagcttg
   200101 catgaagacg attacaaagc ttgaactggg cagctgagat cctcagaggt gatagcatcc
   200161 attctgatta tgttaataag gtggctttgc tgtacctctt ccttgttgcg atggatgcca
   200221 tacagtttcg cgatgcgttg aacatgtgcg aacgatatcc gaaccaaggc gctatcggct
   200281 aaactcgccc caaagagtgc gacaagacca ggtgaaccgg cttaaccgca tttatatctg
   200341 ttaggtctcg agggcgctcg gtatagttcc tctccaacgg tcggacacag tacagggcca
   200401 acacggcgaa ggatggaagg ccgcgagaag atatgatgaa ctatacacct cgatcgaaaa
   200461 gccacagtta acttaccaga aaaaaacaaa atctcttgct tctttgccgg gcccagcaat
   200521 gctatggcgc tctgagacca cataaaaccg aatccatctg tagcgagaca gaacgcaaca
   200581 gagataactg caaggacggg aatcccaaca ccaccacaga ctccccgcca tacagagaac
   200641 gaaaacgcac cctagcattg aggcggagcg gagggccatc gttgaagcgg gtttcattcc
   200701 ttaagtagca gcaacatgag cgatataacg cagcaaccgt acttcaagga gtaagagaag
   200761 actcgcctgt cagcgatccc caaagcagtt gcattacgat gcagctgaca ttaaaagcag
   200821 cgaggaaatc tgcacccgat gtcttcacac atattttgac atcatattga cctctagatg
   200881 aatgatttac atgagtcact aattgaccat tatgtgagtc acacacggtt tgggcgtgca
   200941 tgacctgaac gtgataatgc acctataact ggctattacg acatgaccag ttaagttcca
   201001 cgcgaagttg acagatgatt ctttcaaggc cacaccttgt atactgcaaa acctgttgtg
   201061 gtaaagcttc aagtttccca cgtgtacagg ccaaatgtaa cgatcggatg ttatgggtga
   201121 aaatatcact cggaagtgat ctggccacga gagcgaatac ctactattta ggtttgagat
   201181 gtgacacatg cacaacatat atctgtttgc ccaagttcac cggatacatg attaaaacga
   201241 tgaaccgcat gacaatcttc gtcacaacac acaatattat cctctattga cctggtggtc
   201301 cagcaaaagt cactttccct cccgttacag cttcactgac tttatctgta ctttccaaca
   201361 cccaagttgc accttcatca ctacataacc attctccacc ttccaattca tcaggtactc
   201421 cttcttccaa cccagccttt ttcaacccga aaacgtggct tgtaagttga ggaccaacac
   201481 ctcgttgtgc tcgaagacat gttatggcga tgatggaagt taaaatacgg ccgattctgg
   201541 gagaaggaag actaggagga tcggcgagta gagcaccata gtgtgagttg agaatatgta
   201601 cggggagatc aggatgggaa gcagcgagct tggcgagaag tttttcatga tgaggtgtgt
   201661 agatagcgtc ccataatgat cggctgcgag aggtaatctc ggcgatgttg gatgcgtcag
   201721 gttggctaaa agatgcactg gtcagtgacc tgccatcgat ggtgaaagat gcggtggtta
   201781 ggttgtcaaa cggcttagga gcaagctgca acgagctaaa gcccagctca acacagaaga
   201841 agaatggagc gcaggtgtgc aacaaccact atatgaaaga acatgatgga tggctcaccg
   201901 atatgcctgc gtagttaaag catgttttac atcatctggc agatgagctc tcaaagcccc
   201961 gagtccattg atagtacgtg ggatctacag ttaatcagct taaagtcata tcgcaaactt
   202021 tatcaatatt taccccgttg aaagaaatac atttcagtcc gacctccctc attacctcag
   202081 cattctcctt actcctcccg gcgtaatccc ataattgaca gatagcatca ggcgagttga
   202141 cagtgagcaa ggcagcggta ccaagggtta accaagcatg tcgagacaag ttggaaggcg
   202201 ctttcgatcg gattgtatcg aatagttttg aagtgattgc cggtgatgga gctggaattc
   202261 ccgagggtaa cgcgctggat aagttgagaa cggatttcaa agaaggcgat agcttgacag
   202321 aagccgcggc caccttgtag gcctgtgacg atggatacat tgtggatgat gtggaggaag
   202381 atttatgtag gaaaagagaa attacactta ttcaagtgat aaaaccattt aagctatgcg
   202441 atcacgtatt cactttagcc gatatcggcg ttctataacg taacgaactc acgccggatc
   202501 caatccacct ggacgatcag ttgtgcaact acagtgcaat tgatataaat ggataatata
   202561 tcatttcagt gcatgccgtc gttgaatgaa ttcctcgtcg gttcgcgagc gccatgttgg
   202621 tttatattct actgcacgca gatccaccct cctaaaggat gtatggcaag tcgttcaaac
   202681 atctactttt tccctcttct tcggctttct cgcttacaac ctcagtgcac ccctcaatgg
   202741 ctaatagaga cagcctcctg tccacctcct cgtccaccac ctacccctcc accttttcaa
   202801 gtctgtccat gtccgcccta ggcctcacag actcgcctct tcctagcaga tccaaaggtc
   202861 cttcccctgc tggctctatg ccaccaagtc cgagtcgacg cccagccatt cgagcttcag
   202921 cttcgaaatc ctctctcaga caggaagtta ctaccaacgc tgccgcacgc gtagcacaac
   202981 agcattctgc tgagtttgct cgtatgcctc gtcagcgggt ttcgcaagtt aatttgaggg
   203041 agaatgtagc ttctggtcag actcccaaac ctcctatacc ggccaaatca ccgtctaccc
   203101 ggcctccagc agttaaacct gcatctgctc cccaaactgc tcagcatcca aaccagagaa
   203161 aaagtatcca agccacggca cgggcgaatc ttgtcacgag gaaagccgtg ccgtcaccgg
   203221 cgcacaacga ggtcactatg gctgatgaat gggaagcaga gctagtcaaa gatgctcaaa
   203281 aacttaatct tggcccttca tcccgaaaac ccgagattgc cagagaactt gttgagcaaa
   203341 ggcacaatga cggtgaatgg gagaggtttg gagaggaaaa gtcaactgct agagaggaag
   203401 aggataggcg ccggcgagag ccagggaggg aagttggtaa gtgcttgact agattattcc
   203461 aaatatatca ttaagctgac aagagcagcc tttcccccta gtatgccccg tactccaatc
   203521 cgagctgtaa cagctggcgt tacgtctgtt catgtaggtg tccgtcctcg acttcaccct
   203581 tcacgtgcgt cggaatctat gatgcgtaat cagcccgacg tcaacgttcc aaacccactg
   203641 ttttctccag ccatttccaa tcccgaacta ttcggagaag aatctcgccc ttcttccaca
   203701 gccaaccata ccccagactt gctcaaaaag gcacaaaagg aatatgagga ttggcttgct
   203761 aggaaagcag agagagaagg agatatggag tcaagtggaa tgaggaattg ggagcctaga
   203821 gaacgagcta ttgcacgacc ttttggtttc tcgcctcagt ctgccaatag tgtgcatacg
   203881 gcgtcgtctc ttgaatcctc gccaaccgag gtggcgtctt gggcttctgg atatcccgct
   203941 gggcagtctc aaaccgccat gtccgaacag actgcgccac ctcaatcgga agaccaacaa
   204001 gcggcaattg atgttgctca gcgacaagca atggtacctt atggctatga agcgtactat
   204061 gctcatccgg cttattggga cccttcttat tggtggggca tgtacgagga cccgaatgtc
   204121 atggcagtac atgctgcgaa cccttcaacg tgagtgatta atggttacag gatggcatta
   204181 aacagatgca gtcaggatcc aaagactatg aaccaagtgg atatgccgaa ggagggagag
   204241 atgacctctg aggagcaaca agcatacggg ttgtgagtca aagtcccttt cgtcggtctc
   204301 ctttatacaa aggatgtctg tagatttcga tctgcctttg caggaccttg tgccccgcat
   204361 tcatccattg tcctacggaa tatgtgacac gaatatagct tgaaattcgt actcattcgc
   204421 tccattgaat tcccattttc tgtataccaa accatctggt tcctcttttc atcatgtttg
   204481 gaatgtcgcc tcctcttcac ccgacggctt tgcagtccgc cgtgcagtca atcggagggc
   204541 aacagcagta cgacatgtct gcttaccaac agcctatgcc tcaacctacc agctatggtg
   204601 ggatcggctt tggtcttggc ggtgtaggtc ccatgggacc ctcatctcag aatggcatgt
   204661 cgatgatggg tatgccaatg ggtgatatag ctcaacctcg acgaatgggt gtcggtatgc
   204721 cgggaagctt tgggtcccca cagttcgtca tttacttttc gtcttctggt ggttcccctt
   204781 ttgctccttt tcattctttg aataatcaat ggagctcatt tttatgactc gcatggatta
   204841 ctgcttctta ttttattttt ttggctgtgt ggcatcaaca aggtatataa gctgacatta
   204901 tgtctccttt tcccaaccat gtcacggcct caccacatct tgctttcaaa cccacaacat
   204961 cgccgccgtt cacgctctcc cggccgttct tctacgtcac ctactcgccg ataccatcga
   205021 caatgcccta ttactccaat cacctcatcg cttctcaacc caaatccatc ccctaggtca
   205081 aatatgatga tgtataatcc ttatcaatgg ggcggtggta tgggcggtca aggagccggg
   205141 tatccaggga tgcaaaaccc gtatatgatg ggaagggacc cttcagttat gggatcgatg
   205201 cctgctctga gccaatcttc cgggactgaa gataaaaatc tcagaccgtt cgattcgact
   205261 aaaatgaaac agggcagatt gggacattat gggtatctcg aggggagggg tgagtgcgtt
   205321 tggaggaata aattgctgac aagtataaaa cagaactcgc aggtcctcct gtcggccatc
   205381 tccctgctgg tatgcagtct caatactctc aagccggtca cggtactact acagccggtc
   205441 cttcgagcgc aagttatcaa ggcaacggat catggggtga ccttgccagt atccctcgtg
   205501 cgcgatatga cggtggtgtg tatttttatt tgggtggtga gatcgattaa ttgatctttt
   205561 tttcccgact accaaccacc tcttcagccg cttccgccac aggccacgtc caagctgatc
   205621 tcgactctcc gtacccccgg gctcccaacg gcagtgtgac tacagcttgg acgcgatacg
   205681 gggcagacgg ctcggtgatg gaggggatga atgggaacgg tgcgggtcgt aggaggttga
   205741 gagaaggcag ggtgtgattg cattttatac tgtaaacatg cacgtgttac atctcgggat
   205801 taatacaatg gtttctatga tggccgtgga ttaccgtgga gctatgatgg tcgtggatta
   205861 ccgtggagct atgacggtcg tggataccgt ggagtcggtg tccaacctat attcttctgc
   205921 ggcctacttg atcctgatcc cgatcccgac gcagtcctgc tcgcactcac aggcgtcctc
   205981 cccaccgtct tttccaacaa tcttttcgcc gccggcgtca aactgtccgc atgcctcctc
   206041 ggcgtcgccg gcggacccat actgcccggt gcttttccca aagcggaaga cgaactcttc
   206101 gccgatcggg acgtgaaacc cctcgctctg tcgctcatcg ccctactcgc cttttcggcc
   206161 agccgccttc caagctcgtc ccgtcttttc gtctctggca acctgaacgc cggccgttcc
   206221 tctagcggat catcatcgcc tttgctgtcc tccaaggcgc gaggggtggc gaggagggtg
   206281 ccccaggtga ggagggatgg gaggtcgtgt ggggagggcg aggcgtcggg tcggacgagt
   206341 gggtagttgt tcacgcttgg cagttggtct gtgtctcggt ctgtgccatg tcagatgggt
   206401 cagtacaaaa caaaaaaaaa aacctacacg gtgtaccacg cacagcggca tcgatcaaac
   206461 tcctcgaggg actactcccc ctcacactct ttgattttcc tcttccgttt tccccagtca
   206521 taccccccac acccgccgtc catgtgggat catcttcatg caatctcgta tttgaatgct
   206581 ttacgctcgg tcttgcgttg cttatcggga tggacggtgc cgaggcggag agggaggaag
   206641 cgtcggggta tgggttcgtg ttggcgtcgg ggaggaacat gagactgttc cttgcctata
   206701 ccagattagt tttccggtgt acccagccgt aagaagtgac ccactttata cttccacata
   206761 tccacaccgc tgcctgcagc agacaacgtt tcccccttgt cctcccccaa cacatccctc
   206821 tccctcctct ctctctcttt ccgctcgtcc tctcctcgtc ccctatcgcc ctgtggcgca
   206881 gagacggtga gtgcgcccga ggcggtctcg cggtgcggca cgatcatgcc gtcggtggag
   206941 gagatgaggg cggtaggggg aagaccggcg tcggcgagtg cttcggcgag ggggtgtttc
   207001 ggtggcagag ggatttcgga gaggggttgg ggtgggggag aggagggttg ggtgagcgcg
   207061 gtggatgagg ggtgggtcgc ggttgtctcg gtcgtgtcga ccgtctcgac cgcttctacc
   207121 gcttcacccc cctgaatcat cttatccctc cacgcctcgc cctcgggcct gtccctgccg
   207181 ccctcggcga gcgcgccaat caaccgcctg ccgtcgccat cgactctcca cccaccgccc
   207241 tttgctctat cgagaatcat cctccgcctc gtctcgccct caatccgcct cgcctccgcc
   207301 ttgcgctccg cctcaaacgc ccatccatac ttttcttccc gcctgcgtct gttttcctca
   207361 tctaggatgt gcacaaagga ggcgttgtct tcggacgtaa agtggcgctg gaatgcgtcg
   207421 agggagaggt cgtcccgcac ggggggcagc cgccgctgtc ttttgcgagg ctgtccagag
   207481 gagggggcgt cgggtgagcg ccgggcgtgg gtgtcgatat caaaatcatc tgtatcccgc
   207541 cggctggtgc tcccgagggg cgtgtcccac ccccgcgtcc ccaccggcgt ccgcagcggc
   207601 ctgccaccag acccgggcat ggcgatatac ggcgtgcggg ccatgctata ctctgtgcgc
   207661 cgccggagcc gctcgccgtc cgagtcgtcg atgctgtggg cggcgccatc gcggtcgcgg
   207721 gcgagggcgg cgagggcgcg gatggaggcg gcgaggcgct gggggtcgtt ggcgtggagg
   207781 gcggcgaggt actggtttgt ggcgtggagg tgggggaggt gggggaagaa gtcgcgggcg
   207841 atgatgtggg agagggcggc ggtgtaggcg tcttcgtcga ggacgtgctg gtggtacagg
   207901 ctgcgggcgc cggggcgggg gccgtgcgcg atgcgggggg cggcgtcgcg ggggaggagc
   207961 gcgtgcgcgt cggcgccgaa gagtctgtct gcaggcatcg gggggggggg gggagtgaca
   208021 acggggggga gggggagtga gtgacaacgg gaaggccaag agtcaagtaa cagtggcaac
   208081 gccttacgta acactatatc atgcaaaagt cgactaccct tgataacact gtctctgcag
   208141 cacaatggca cgcacggtga gagtcgccct cctcctctgc gacacccccg tgagtccccc
   208201 ccccgagtcc cccccccgcg cctccacccc gctcacactg cccagaacga cgacgtggtc
   208261 agagagtccg gcaactgtac gtccccccgc ccccgccccc gctcacacca cagaccatgc
   208321 catctactcc aaatggctca cagactccct cgccacctac cccgaccccg ccgtcgcccg
   208381 cagcacccgc ctcatcgtcg acccctacga cgtcgtccac aagaaagcgt accccccgcc
   208441 cgagagactg cagcacgccg cacccgacgc atatgactgt gtcatgctca ccggctccag
   208501 tacgtccccc ccacttgcct ctgttgactc gcattagaac acaccgcata cgacacatcc
   208561 aaccccttca tcccccccct cgtccacttt atccgctccc tcgcctcctc gcccgcgtac
   208621 cagcacctca aactcatcgg catctgtttc ggccaccaga tcctctccat cgccctgggc
   208681 ggcgagtgcg tccccggaca caacggctgg gaaattggcg tctacggatg ccagctgaca
   208741 gaccaaggga ggtactggtg gacaggcgac gtagagggcc agggcggtgg ggataaagtg
   208801 tacatcgagc aaatggtaat cttctctcca aaccaatctc caaaccaacc tccatactaa
   208861 caccccacag cacaaagacc acgtgccctc cctcccgccg ggatgcaccc tcctgctctc
   208921 caccccgcgc taccccatcc actcctttct caaaccccac ccgctctcca ccccgtcccg
   208981 cccactcgcc cacatcctca ccgtccaggg ccaccccgaa ttcaccccct ccatcgtcca
   209041 ccacatcatc aacgcccgcg ccgcagccgg cgtctttgac gaccaaaccg cacaagaagc
   209101 gaggagaaga gcgggcggca aggacggtac gggcggagaa gggtttggaa ggatcgggtg
   209161 ggccgtctgg agagtgctct tgcaggatct tcccccggcg tagccccgaa tgaagtgact
   209221 tgactaaaca ttgtacatcc aacatcgtac atcttctaac cttttttact aatcaacatg
   209281 tgaaaactcg taaatcatct aaatcccaaa ctcgcggcga cccgcacctc taacccgata
   209341 aaaacaaacc taatagcccc cgtaataccc ctgcgaccct tgcctcgaca tgtaacccct
   209401 ctcttcccta tcccccgtat cccacctcgt cccgcctgcg cctgcacctg cacccgcgcc
   209461 tgcaaccccc acatcactct ccgacagatc cgacgccgtc cgcctcatgg tcggcgggac
   209521 gtaccccaac ggaggctggg tatacgccga cggcgggtat ggcacatctc caccaccccc
   209581 accatacgca ttgtcgtcct cgttcagcca tggatcctgg gccaacaggg gagaagaagc
   209641 agacaggtcc acatccgaca tttgcgccgc atgcctcgcg ccagccggca tcggcagatg
   209701 cggctgacga taccccctcg cactcgcatt ccctctcgcg ctcggctgcc tagctataaa
   209761 ctgctcggac cggtcgttag tcgataacag ccggtccgtc gacgggttat ccaaaggcaa
   209821 caatggtaaa ctcgcaggcg ccagggaggg agaatccgta agcggcaaca atgggtaatg
   209881 cctgtaggct tcttcgtaat tcggcgcggt ggaagaagcg tattccgatt tggagaggat
   209941 atccgtcgat gcgatcgatt tcgcatccca gtccgcttgg tgcgcttcgt ccgccggtcc
   210001 atcgcgcgaa ggatcgtact cgaggttttc ctgaaaaaat caaaatcaaa atcaaaaact
   210061 ggaccacaca aaagacctct caaactcacc tcgcgcacag ccttgatctt caccccatcg
   210121 ccctcgtgtt tgcccgcaaa ccacggatac gcactcaaca cctccctcgc caacgactct
   210181 tgactcttgt gcaccatcac ggtgaacagc ttgttatgct gcaacgcggg gtgtaaaaac
   210241 cggttttcca cctcggactg cttcgtcggc ttctccgaca tgctatacat tttttcttgc
   210301 tccagttctt ccggagaggc ttcatagtac cggaactgac gctcggcagt gcgcgaaatg
   210361 tagattttga aggcgatgat gagcaatagc ggaggcgcgg cggccacaca gtcgatccat
   210421 cggtcgcgaa taagaccggt ggctatatat aaaaagcagt cagctcggta ctatcacccc
   210481 ggaagagcga aaacaactca ctcagcacca tcaagagctg catcaataca cagcatgcca
   210541 aaagtcgatt gacatacacg ttccacatcc tacccccact ctccgctcgg gaaatgtaca
   210601 catacagcag ctggtacttg tactgtctcc attgtcagcc ctcacacctt tttttctttt
   210661 cggaaaatgc acttacgacg acggaagaga accaaaagac acaacatgca cccatagcca
   210721 ccaaaggcgc aaggggagcg taaatcaatc caacggcggt gatgaacaac aagttgacaa
   210781 tgactagaaa agccaaccca tacgcaatca gtccaatccc tttttttttt tctttcgttc
   210841 cacgactcac caatggcata ttcaaaatac ggcggcttgg tcatctccct gatatcgcga
   210901 ggggtatgag aaaacatgaa tcttcggata gataccatgg ccaacttgat caactggatc
   210961 aattcgaaaa tgaccaagaa gcctcgaagc ggcagccacg tcaaccaatc tttttttcat
   211021 tatccaagtt tatcagcttt ttctcaaatc atccgaaaaa aaaaaaaggt ttggttttaa
   211081 acatacaagt actctgctgg acatatgtcc cctgaatctg atccgggata tcctcaaacc
   211141 ctttcaagat cgtgcccaca ctctggtgtc caccgacttg caccacgatc ctcgctatgg
   211201 cggtgtatac caccccaaga agagagaaaa tgaccaagtt ggaaatgatc atgaagaaaa
   211261 aatatcgagc ggtcaccgca cggtccagac gggaacgtgt gggcgctcct tggtacttgg
   211321 agatcttgcg gatgatgata gggagaaggt agccaaagag ggcagagaca acggatggga
   211381 ggataccaga gaccatggag aactgttcat tgagtaaata tataattaca acaaattttt
   211441 tttaaaaaaa aaaactcaca gtccactggc cccagctacc agcatctttc caatccgcaa
   211501 ggaatgtaac atagaccgtc aatgaactca agtttgcaag caacgaaact acaagcaact
   211561 acgtatctgt cagcgggccc tggtccggaa aaagctaaaa tcttttccat cacttacagg
   211621 caaggtgttg aagaagcaga cgattccaat gatgataaat ccaaacgtat ttttcgatcc
   211681 caactctgcg ggctcctttg agatattctc ccaaacaata tcatggggca ttggcgccag
   211741 ctgcagctcg gccccaaaca actccttgag cttgccccta tgcgtcctcg caatcctatg
   211801 cgcttcggca atcgtcttga atgtcacaaa tccataattc tcgccctcga ctcggttgac
   211861 gaccttgtta ccctttttgc gagcgtgacg ttctttgcgg agaagagagt cgatagcctg
   211921 tcgcttggcg tcaattcggt cacggagaaa cttgatttcc ttggcgtggt agtcaatcgc
   211981 gtcttttttc acacctccga acaatccaag aaaaccgcct tttctaatca taggtctctt
   212041 ctttgccatc tccccacctt tcaaatactt tacaagatgc ttctcgagct cttgaacagc
   212101 ttcattatga tcgtcgacca tttttgggaa atcctcaagt cttcgaccaa tgcaagtaca
   212161 atcgatagaa ggaccgatct tgataccatc taccttgaga agacccataa gagacagtaa
   212221 accggcgtca ctgcggaaat ctttgcggac atgggtgacc tgcaacaacg agtttagaat
   212281 tgtcactgaa caagtaatct caacgtacca tgagtgttcg agagtagatc ttggtctgat
   212341 atgcaggaga tctaaaccat ccttttctca atcgaaccta cgaggcggtc agaaatgaca
   212401 agcggccgac aatttatttg acagaccatt gctttccaat tgaaccagac tacaaacaag
   212461 ccgtagtcag caactgcaac attttcattc tgctcttttt ttaaaaactg ctcactaaag
   212521 tacatcgcca caatatctgc taaatgtcag cgaatggacc ttctcttgca gcgcggagaa
   212581 ctcactgatg acatagctgg ctgccagcgc cggccacatc caatttcccg atacattctg
   212641 aatggttaaa agactcagcg cattcctgtc gctgctatta acgtatttga ggttatagac
   212701 gatatcgatg acgagcaaag cgaccacaat gatcgaggtg attgtaaaaa tgttgcgcag
   212761 catcctcaaa aatcgaagga atgtagcggc atcaagacct gtaatctttg taagctttcg
   212821 agaacctcta aaagtgatag acactgacca atgttcgcaa taatctcctc ttccttcaag
   212881 tggatcatgg ggctcaacca ggcgaaaaag ccattggaaa tcggaggcgg aggcggttca
   212941 taatcgggat cctctatggg gtcgacaggt tttggtaatt ggtacttgat ctataaccag
   213001 ttttaggata attctcagta acaacaacag tcaatctacc ttgggggcat agacctgcag
   213061 tgagaaaacc ttgtcagccc gactatctgt ctcaaacgac cgacaactca ccttcttttc
   213121 tcttggcctg aagaaactga atgcgagcag tgtcgccatt gatatagcag ccattaatgc
   213181 aaactgagat ccgacggctc ggaccgagac ttgggtaagc gtagactcat aggaagccac
   213241 gaaggaggag actgcagctc ctgggtctgt cgtggaggac atggtgtggt gattgaatga
   213301 aagtgtggat tgaaaagaag gtataagtgt ctataaaatt agacaaggtg tgaaatcatc
   213361 gctgtgtggg gatagtgggg tccgggcaag cgattagagg acagggcagg ggaacagaga
   213421 tgagggcaga gtttctagag ataaaatcgc gtcgcgactt ggtggcttgt ctccgaaatc
   213481 gagagctcca cagaggaaca gcactggaat tcctcagggt ttccacgtgg agaaagtcga
   213541 gacaatgcat tttgaaacac cgccacggta agactgcccc cttaaaattg ttgcaaagca
   213601 gtagcaatta aagggccttt ctcctcacgc cgctgatcac ggccatgcac tatccatgac
   213661 gtttgttgca cacgcagcaa aagaacaaaa gagcacataa attcaaacga acaccccgcg
   213721 cataaaacgc agcttcaaca aatccatctg cggtgccttg cagatcattt gtttacgtaa
   213781 tatactactc ggctagttgc gaactgcgac ttgttgcgcc aatggtaaat gatggggtgt
   213841 gtagtatcta gaggacagca tctatggaac cgcagatgac atactactac tgtctccgaa
   213901 ctccaaattc aactgccctt atgtacgcct gtcacaagct atgattcatc atgggcctag
   213961 aacgccaaag cagcttcgga gctgacggtc ttcgctacgt ttatttaaac aagtcgagcg
   214021 aagaaggcat ttttatcgta gaaaagaatg agtgacagac agcgacacag aatgcattcc
   214081 acatacatgc ttaagcgctg gtggcccctt gttgtttgtg gtactgatta ggtaaaagac
   214141 aacaggtgtt ggatgcacag atgaagagga tgaagaaaga agaaagatgg aaagagagaa
   214201 tagaatggtg ccacattgag tgcagtgacg gcgatatgcg gggatatgtt ttggaagtgt
   214261 ccaagtggtt attgtccata gctaacgggt tagggtaata ctgcaaagaa cacctatact
   214321 cctctaaaaa accaaaacaa gatccaaaat ggccgattac gaccttacac aggtgagcat
   214381 acacccttcc tgacatagct gacatacaga aactcatccc ccacctcgac cgacaccttg
   214441 ctatccctct cctcaaccac ctctcagata ttgcaatcta ccctgccgaa caactcgcca
   214501 gagctcagtg agtcatgtta gcttgagagc ctcgctaata acccagatat gatctcgcta
   214561 aaggcaccaa catggtcaac tacgttgaac aattccacgc ccagattgaa aatgccgaac
   214621 ctaccgactt tgctagactg agagatgagg ctactgccaa gtatcaggag ttgcaggaga
   214681 aggctcagcc cgtgacaaag gtgatcgagg acccagatgc ggtggctaaa ttgaggagcg
   214741 gtggtgacaa ggacagaaat ctggatttgc tgagatcaga gtaccaggtg agttgctcac
   214801 aacgcggaat tcattcaaaa cgggcgaaac ttacgtcttg cagattgaca ttgaccaaat
   214861 caatgccctt taccactttg gtcaatacca atactctctt ggtgactacg gttctgccgg
   214921 aaaccttctc taccacttcc tcattctttc tccttcttac gagcttaaca tctctgctca
   214981 atggggtaaa ctcgcctcca acatcctcaa tggtgaatgg gacgctgctt tgatgcaagt
   215041 ccgagacctc cgcgagacca tcgataaccc ccatggtacc tctcttgcca agcctctcgc
   215101 tcagctccag gcccgaacat ggttgcttca ctggtctctc tttgtgtttt tcaacctcgg
   215161 agagaaccaa ggctgccaag gcttgcttga catgttcctt tcccccgcct acctcaacac
   215221 catccaaact tcttgccctc acctcctgcg atacctcgtt gctgccgcca tcatctcacg
   215281 ccgagctccc aaacccgcca atgtccgctc tcgagaccac gtcaaggagc tcacccgtat
   215341 cgttgagact gaagagtacc aatacaccga tcccatcacc agcttcctca aggatgtgtt
   215401 tgccgacttt gatctcaccc aggctcaaca acgattgtca gtcgccgagt ctgtcgtccg
   215461 ttcagacttt ttcttgtcag gctttgcgga tgagtttgtg gagaacgcga ggtggttgat
   215521 ttccgaggtt atctgccgtt tacatcgaag gattgatatt ggacaattgt ccaagaccct
   215581 caacttgtcc aatgaggaag gagagaagtg gattgttaac cttatcaggg actcgaggat
   215641 gggtgttgag gccaagatcg acctgaagga ggtgagaata ttgagatcca tagcgtatca
   215701 taatgtttta ctgatatcaa ttttagaaca tgcttcacat cacacggcct cacgccaccc
   215761 cgaccgccac ccttatcgaa accacccgtg gtcttgcgtt ccgatcccaa gcaatccagt
   215821 ttgccatgca gagcagcgtc ggggaacctc gagagcgagg ggagcgaggg gagcgaggaa
   215881 acaagggagg acgaggaagg ccaaggactc aggaagttgc ggcttagatt tagacgagag
   215941 cttggtttgg gtacaagagg catgtatagg tatatcattc tgctttcgtc ggtgactgct
   216001 tccaattccg acgaccggat actatggctg cttgttctat tgtccatact acagctttta
   216061 tccaattgaa cagttctcta acagtttcgt cctgggcttg gtttagccaa agttgtaaaa
   216121 tcaaggaaat cacacttact agtcgtgccg gatcttcaga cagaggtcgt ttcttttcgt
   216181 gatactcttc ctcctcttca tattcatgat gatcatgagt gcactcgtac tcttcgtacg
   216241 aatggcaatc acacccacaa tcgtcttcac agtcgtaaca ctctggctca gattccggag
   216301 catatgcaag acacctgcat catttcttca gtttaccact ccgacatttt cttttttctt
   216361 actatgatac tcactgtccg caggtacacc cttcctccag cgccggtact gatctagacg
   216421 ccactatcgt atctgctgcc atttggctag tcattctctg tgtgtccatt tgcatttcca
   216481 cctccttgat actctccctc tggcctctta gttccttttg catcctcatc aacttgcctt
   216541 tttccctatc caatgtcaat ttggcttcga aaagagctgc taagcttgca ggcaaatcaa
   216601 tcggtatccc accactatac tgtccttccc ctgcagatcc attatgttgc ccgtttcttg
   216661 accctgacat cccagaaaga aaatttgcct cccctatacc agccgctgca cccgctagaa
   216721 cgctaagctg cgattcagtg agttttggca gaggctccat tcgtcccaag gttttggcgg
   216781 accagcttga aagcgctgct gaaagattgg ctgcagtcgt tgttgctctg gctgctgctg
   216841 cgtctgcact agccaaggtt gacctaggta cggaaaaaat atctggaggc agaggtggga
   216901 aagaaggcgg tggtattgag ggtggagtgg cgtactgatc agaggtggag gggtttgcag
   216961 tgggcgtcgg cgggggagaa ggttgggttg gacgatttgg gcggattttg gggggagggc
   217021 gtttgttcgt acgaggtttt gagcggccca ttttgtctta caaaggggcc gggggtgaga
   217081 aaggtgaaaa aaagaagcgg tggagcaggg aaaagtcttt agaaggagac tgaggaaaag
   217141 acgaagatta accggtccag gggaaacaac tttccaaaca tttacagccg acctcgaggg
   217201 tatggcctgc caatctccga tattatttct ccagctttct tcatatgcat ataataacgc
   217261 acaaaatatg agaagtgata taatgcatca atgcaaagta tgtgaacaac gatagtcatt
   217321 ttatatgtat ggttaagact acactctacg catgtatctg atcatcctgc tgggcttcct
   217381 caaagctcct cccaacgcca taatacaagt caaaagaaca acgctacctg tctgatgcat
   217441 ggaagcgagg gagatgggca caagatacaa aagagtgctg ataccgaggg tgacctgagt
   217501 gacggcggca gcggttgtga gggcagcaag gcgacgggca gcggggaagg gtaatcttcg
   217561 agcggcgaat ggaagagtac agaggatcgt aaaggtggta gtagcctgca atcgacgatc
   217621 agcaatacgt tatgcgacat tttgaatata taaacgtacc agaacacggt ggtcaaactg
   217681 agcggtaaca gggttctcga gcatatttct ccaaatcttg tcagaccctg atctggcata
   217741 tctctggtcg aaaagctcgt ccttgggagg caccaaacca tcacccatca tggggaactc
   217801 gttgtagacc aaaccagcat caaggccagc cacgaaagca ccggtgacag cagtaagggc
   217861 gaccatcata ccggaaaggt gaaccaatcc cctaaatttc ttaacagcgg ggatgttgag
   217921 tgcagaaacg atagcagggt tcttggcgag cttcatgtcg cgctggatac cgatagcagt
   217981 tgagagcata ccaagataaa gagcgacggc agcactgtag tgtgcggcga gacgatattg
   218041 agagacacga ggaacagagt tgtcggtgat aatttgttca tcgagaccag atttcaccat
   218101 ccaccagcca agaacacctt ggaatccgat accaaggccg ataaggagga gcttggtggg
   218161 cagaggacgg ggaagcttgt atcgcgcaag gtagtagacg gtgggaagaa ggaaactaac
   218221 ttttagcgcc tattgacttt gaaagtactc acccaatgcc aagagctcgc ccagcaagac
   218281 ggtgacccca ttccatgtaa aagatcttct taaactcatc cctagaaatg ttcgcgttca
   218341 ttatgatacc ttcgggtgat actttgtact tttcccattc cgcatcccag tcttccttgg
   218401 ttatgggcgg caaaatgcca gtaatagggt tccattccac aatactgaga cctgattcgg
   218461 tcaatcttgt gagaccacca attacaatga tcccgaagac gaccgctgaa cagccataaa
   218521 gccagtatgg caatgaattg ggaatatcag agtaaacttt attcttgggt gcagcagtcg
   218581 ataatgatcg ggggaacttg aaagtatgtg aggggaagaa gaatgaagag cgagtgcaag
   218641 gagtaaagta ggggagtacg attggacgcg gggttgggcg ggtgaaaacg agggaagtgg
   218701 tggaaaatgc acggggtgct ataggggcat ttgagagctc ggctttgatg cctgtctgga
   218761 gagcccgcct gagggacgtg gtaagcattg tgggctgttg ggggaatgtt tctgcaaaca
   218821 gaaaaatggg tggaggacaa ttatttgtat cggaacagat gagatcggga cactttcaag
   218881 aacgcgcacc ggactccggc gcgaatcgga atccgtcaaa tgcacaggtg tatcgtggga
   218941 aaaatcagag tctacgggga cttgttatta ttgcatttgg tacagaagct caaattgact
   219001 gagagtctgc acaagcatcc ctcggcattc gcgaatggtg tctacagtct tggctatccg
   219061 gtcgcctgca acttctcgcg ggagtgggcc tatgggagac gatacattag gttcgtcagg
   219121 tgaaaggagt gatgaaagtg caatgaatgt tccagtgcga ccaacaccgg cagagctaaa
   219181 aacgttacac ggtcaatttg gcacagagca cttgctcgcc aggtacttac cagtgaaccc
   219241 aaacttcaca atcaagctcc ctccttttct cgtcgacttc ctttactaac tctcgcaacg
   219301 cttgcaccgc tgctcccgtg ggcacaccat gatccggcca ggcgtcgaat tggtagtgga
   219361 acaaattcac tcgcctatcc ccttgcaaag caacttcagt cagtgtgctt gatattctgt
   219421 caatgatttc tctccgagaa agatgcaccc ccatgtctgg cattttatgc tccctgtcac
   219481 attagctgct tcctcgaaat atctcgactt acatgtaagg gtctgctttg ggtatcccag
   219541 actcttccca gcctgtaagc tggactaata tcacattatt ggggagtctc cctatggcag
   219601 ctcctgaata gagagccttg aagaaagtgt tgaaggcttg cggtggggga gcctaagttc
   219661 aaataacctt cagtaatgta atatagggat cacttgctga acccctcacc tgagctgcta
   219721 tccaccgtcc accttttcca tctgttacca cattggcatt caagtactcc ccatccacag
   219781 tgacagctgt acggtcatag gcgaggacgt tagaatatcg attgttgcgt ttgtgtttta
   219841 aagagttgtg gacagaatag aaagcttgtt ctgtcgaggg cttgcggagc agcgaatact
   219901 ctagcctggt gacttctctg tctgcaagaa ctctgtatgc tcgctctatg tttgccatgg
   219961 aagccattcc ggacccgaga ctatggtgtg aagaacaaat aaggaccagt tagaagtata
   220021 ccagatttgg gattatcctt gctgtcagtc acttatgacg tctgagatgc tgcctgctcc
   220081 cgtattccga cggaagtgga ggttgttcgt ttattgtcgt ccgactattc tctttcgttc
   220141 cccattgcaa ttttaagaat agagcatata aaaaaaacac tatccatggc gcaaacaact
   220201 tccctacctc ctagattcac agtgccgcct cttccacctc atatttatcg ccgactaaca
   220261 ttaatcgttc atgatgatgg agtcgtcctc tctccagaca acggccagag cattttgatc
   220321 cactggggag tcaagggcaa gattgaacct gttgatggcg acgagcaagg agagttgata
   220381 atcggtggag tattaggtgt tgcaaggcta tgggatggtg agtttgaccc atcaataagt
   220441 gagctaatgt cagcggccta tctgtttgtc ttcttacctc gtaccgggac acctttgttc
   220501 cctcctcatg acgatgatga acctccacat gaacatgaag tattttctct gggtgatgtg
   220561 catgccgtgc cactcactca agaaggtgcc acttcttcta tcaatcgtat gctagccatc
   220621 caggtctctc gtcaacccaa aacgaaaacg aagtggagct tggcgctccc cataacaggt
   220681 gctggtgcca cagcctcaga ggaggatcac ctgtccaact ctgatacctc atctgaggag
   220741 acgcctgaag ccgatgaaac tcctatacct ccgaaatctc ggcaatggag aaagtttatg
   220801 cccaaactac gaaagaagca agatgcatcg accactcctg aacctccaaa gaggcaagag
   220861 ctggaacata agattgttcg ccaaatcgtc agggagtttg gggcaggctt tttcttcagc
   220921 tacgactttg atcttactcg tacgttacag cacaaacgac aggtcgtttc gcagcgaaca
   220981 gctacgggtg cagcttttag cgacctcatt caaaaggaca acaccctttt cccaccgtct
   221041 caatcgagca cctttcagac acctatcaat ccagccctag atgaggactt tattgagcca
   221101 gacatccagg tacccttatg gagaagggtt gataagcgtt tcttttggaa cgaatggctc
   221161 atgaaagatt tcatcgacct cggactccat tcatacgtcc taccagtgat gcaaggatgg
   221221 gtgcaatcag cgacttttag tatacctatc cctcccaatc ctttacagcc tgatgtttca
   221281 cttggggcta tacctgttga ccttgttgtc gtatcgagaa ggagtaaaga tcgcgcggga
   221341 cttaggtatc aaagaagagg aatcgatgat aacggacatg tggcaaacat ggtggagacc
   221401 gaaatgattg tccgagcaaa ggttcgtaat atttttcaac gagcgctgac tcgttaggtt
   221461 gagggtaaat cctctctgtt cagtttcacc caagtcaggg gatctatccc gttacgctgg
   221521 tctcaaagcc cttactcaat gaagccgccc ccaatactca atgagcctgt cgacaagacg
   221581 tacgccgttg ccaacttaca tttcaatgat ttgacatccc gctatgggcc tattgtaagt
   221641 tactcggact atagacaaag ctctcaaatc tgattctccg tagacaatta taaatttgtc
   221701 tgaacaagat ggaaaagaag cagtggtgac caatggctac caagagctag tcaacagcct
   221761 cgaaagagat gatctcaaat acgttggatt cgactttcat gcaaaatgtc acggaatgaa
   221821 atgggagaac atcgtcgaac tcgtcgactc tctcgacttt gagtccatgg gttatctttg
   221881 gaccttgcaa ggagatgcca ttcgagagca aaagggtgct ttcaggacca agtgagcgtc
   221941 ttgttgccca taatgtttga cataaagctg acagtactgc agctgtattg actgtcttga
   222001 tcgaaccaac gtcgtccagt ctgcgatcgc tcgtcgagtt cttaacacga tgctcatgca
   222061 acttggcctc cagatcagcg ctcccactgt ggaaaacatt ttcaacgata tctgggcgaa
   222121 taatggtgac attatcagtc gttgctatgc gcatacttcg gcattgaaag gagatttcgt
   222181 gagaacaggg aaacgagatc tttcgggcat ggtaagtgtc taatcgcaag gtcacattcc
   222241 catactgaac actatagtag ctccatgatg gtgtcagctc gctcagtaga atgttctacg
   222301 gcgccatctc tgattttttt gcgcaagctg tcatatcttt cctgcttggc catcgaaact
   222361 tggcagtctt cagcgagttt ttggagactc ttacaagcga agatgcttcc agtgtagtga
   222421 gattggatag gatcaggagt gttgccagtg agatcttcgc cagcttgata tatatatata
   222481 ttggaaaact gaccaagtgg cagttgaaac ttgctccgct agggttttaa gcgatggaga
   222541 ggagaaaatt ggtggatgga tattactttc gccggaccca aggagtgtta aaataagttc
   222601 cgacctggag gagaagattc tactcctggt acgacttctc ctattcccaa aaaggtacag
   222661 actaattata attatagaca cgaagcgcca tctacgtagt caccttcaat tactctcttg
   222721 aaaaggtcgt gcagtttacc cgcataccct taccatccat cacatctatt caaaagggag
   222781 catatatttt atctaccttg caagaggcaa gtcgggatcc caaagaagtg agttgcacct
   222841 atccatgatc acagctgaca ttgctagaat gccggctttc tcatcaactt ctcccccacc
   222901 gacgagtcta cacgctacag tacatactcc ctacgcaaca agactgctcc cgctactcca
   222961 acaaagaggc cgacagccgc tacaccctcg acgcccacac cttctgtcga acatgccacc
   223021 atcaaccccg atgttaccga atactacgca ttcaaggctc ttccaggaca atcaggtgat
   223081 gcgacttgcg cggagactgt gagtcagata gtggagcaga tcgccgaagc gtgtaaaagg
   223141 aacgatttgg tagttgaaaa agacgtcgtt aggtgagttt tttatgtttc acgtaccggg
   223201 ccttcggttg cctgactctt aatgtagcct tacagaagcc gaatcttcga cgtctctact
   223261 tgcgaaaatg gattacgctt tcaagcgagc attgtggttg taagtcatca tgaggtgaac
   223321 taaatcctcc cgaatgccag cgccctgatt acgatgagat atgggcataa ccagaaattt
   223381 ttgggaggaa aaatatatgt atatagcttg ctgcatagcc taaatttata acttaataag
   223441 catatattat tctccatgaa gtttggcgca cagtaagcag ggttcggacg agtatgaaca
   223501 ataagacatc ttttaggtac attaattact tcttcaagta ctgctagatc agacaattac
   223561 tgagaagcaa aagatgattg cttcaaccaa gtctccaaat ccatcaacca agggaaattc
   223621 ttccggttct cttctatgtc tgcgtcagac tcgttcacat cgaaaaacta gacgattgtc
   223681 aacgttattc tgagttgatg caacagaaag cttaccttca tagcactgtc caaaccaggg
   223741 gggaaattgg gcggttcggt agcattgaga gtttcaccag tcacttcctt ccacatcctg
   223801 acatgttcac caggagtcat agaatcccca gcaatattca aagccttccc agagaacttt
   223861 tcagggtgct cgaaaatctc agcggtaatc ttaccaatgt cctctgaggc aatccatttg
   223921 tagtgaatgg tctcaaccca ggtggtggtg atgatatcct tgtaaatcgg catatagagg
   223981 ttctccatga tggctgtagg gcgaataatt gtccattgga gaggaagagt cataagatag
   224041 tcttcaattg gcttcttagc gtcaaggctg cagacctaaa ttaacgagga ttttgattca
   224101 gaccgaatga taagagctca caatggatgc ctaataccct tctctcgatg accacagaaa
   224161 tctacgcccg agaaaatgac gtgttgtacg cccttggaaa cggcagtgtc aagcatgccc
   224221 ttggctacaa attctatcgg ctctgaagct ccagggatat ttgacaatgt gcacttacct
   224281 cgttcgatgg atgcctcaat gtcgaaaccg accaagaaga aaaagatacc atggacagag
   224341 tctttgaaga gatgagcatg gtccccaacc tcgcctttaa ccactctaac gttgggagtt
   224401 tgagcaagag ctttggccct gtcgctttca gtgtctcgag tagccgcgat gatgttatag
   224461 cctccgatag cgttgagagc ctgaggggcc gtcagtcaag acacgatata tgaaaataca
   224521 tctggtggac ttactttaac cgttgcactt ccttgcttac cggtggatcc gaatacgatg
   224581 atggtcttga atgacatggc gtttgtgcgg tgcgttggtg ggagtaataa gtttgaggtt
   224641 atgagtatat aaatcagtgg gagtcaagca aggccttcgc tcttatcgac aaccgaaact
   224701 tcacccagaa gagcacttat atatcattac aaaacttgtt cctcggcctt tattttcgac
   224761 cgcttagccc agaggtgagt aagcagacct tgggacagcc taccatctga ctgatcatgg
   224821 tagttagccg gtgaccgacc tgctttggct gattcagcca tgcattcaat gggttgtcgg
   224881 cgctatgcga aggaatgagg acggcctatt attatcactg gtttgtacct tttggacttt
   224941 gcttgacatc attggaacaa ccatgacagt tcgttaccaa ttaataactg aaaccaacag
   225001 aactccttca gcatgaacaa tgccgatgac cgagggtggt tgcattacgt aacattcaaa
   225061 tagctaaata acgtcgcgta atcgcgttag tctccccacc agttgagctc ttatttattt
   225121 tatcagcgtt cagccttatt tgtgtcgata tcgatagcta gtttgcataa ttaacttcac
   225181 ctgattgcct tggccaagct cagcatcaat gggcttaaca tacttcttat acgtgaacaa
   225241 cgtcactgca tcaggaagaa aagatgtaac gatgatttca tttacaaaaa tacgctttat
   225301 gtagcttgct tcttgctcca atcctccctg atcttatacg tttgtctggc gtcctagaga
   225361 gatgtcaata tcttatcaag aatatttgga gaaatttagt accttgagga cgtccgtttc
   225421 tacgtcgaca atctgtaaac tggcctcaac tccgcatcca cctactcttc ccctcagggg
   225481 agcccataca ccacttcctc ccatgaagcc ttcaatggca tctccaccgg cattgcacat
   225541 gatccagaca gtttcggttt caaatgctcg ggtaaggcac agagctgaga caacgctagt
   225601 ctcataatcg gtcgggtgcg ggtggttatg gatcaacctg cgtccaataa gcattgaatt
   225661 aagagagata tttggactgt ccacgtacgg ttcactgtcg gtagccatcc aatacgtggg
   225721 agcaaagatg atgtctaccc ccaaatcggc aagctcttga gcagcagaag ggtgagacat
   225781 atcccagcct gagtaagaat ttagcccagt tcttcgagca gcacctgtca tcacttacat
   225841 atcaacagcc ctgctttgcc ccacttggtc tcaaatacct gtcgaggttc tataccagcg
   225901 acgatatact ctctagaaga atgtcagctt ttttcaagat aactacgagt tactcacctc
   225961 tccggatgcc acaagttctg cttcacatac tcgccttgca aaacgccctc ttcgtcaatg
   226021 aaaaaagccg tatttttcac tatcggtgta ctgttctctt cggacgaaag ggggtgttgc
   226081 tcaaggtatt tggcccactc tagttgctga agagtgacct tcgaaggtct aggaccagac
   226141 ttgaggggaa tatgagagaa ggggtccgag gcagggaagg cgggaccatt gttacgcgag
   226201 ccatggacaa ttgttcccac gaggcaaacc ctgtgagcct tggccaagtg gcacaggaag
   226261 gagagcaagt acttggaagg gaatgtgagg tactgataca ttagctccaa tccaccacat
   226321 gctgacttac ttgtcgagct tcgttcacga taccttgcaa gaaatactct gggaagacaa
   226381 caacttctgc tttttcggca gcagcacgtt caacaaagtc aactacatcc acaaggttct
   226441 gatccaaggt tgggaaagga gaggtggaat gggctttctc aagagcgggc gggccagaag
   226501 gggcggaggc tgggctcgtt tgagcgaggg cgatacgcgg cattgtgata tagctcaaaa
   226561 ggtgaacagg ttgcaagaaa ggaaaggaga tgcagtcaaa aactcaggat tcgttgtcgt
   226621 ttgtagtttc aaagtggttc ggttccacat gaatcgtcag taagcgcgat aactcttcaa
   226681 cacttaagcg aggaggggga ctccagcttc tgtagatctt ggatgtggag tctccttaag
   226741 taataaataa ataataatcc gaggcacggc ggtgcccgac tcccagttag ctcgcttatc
   226801 tttatatatt aatattcccc gtgtcacttt tgaaaatttc ctcacttttc gcctccgttc
   226861 tcatccatga cccccacaac cccccattca accgccaccg ttacgtagac gaaaatcgtc
   226921 tctacatgtc tatacccttt tcagatgtgc atgcattgaa ccatggacat gaaaaacgtc
   226981 gccaaaaatc gtgaccgtgc ctgattcgtg cctgaaggca tggattcgtt cgtggccgcc
   227041 atatgcacgg cggatatcac cgccgtttca ttcctcggtc gtcgttcgtg aaagaaccgt
   227101 ccagtttcta gatagaactt tcttatgttt cttcttctgt tatacgtatt ttctcatgcc
   227161 acggcttcct ggaccttcta ctgcactata aacggcttta actgccttta ttcctataaa
   227221 acgcacctat cccgacggct cctctttcta tcccctgtcc ctaaacaccc aggagacccg
   227281 ccttctccaa ctgtccatcc tcagtcacac ccaatcaacc gccaccgtcc tccaatggtc
   227341 ctctccctgg cggtgacgtt cctcccagat ttacggcccc tcgaaccaaa caacaaacag
   227401 caatcgccat aacttggctg cctgtgccca aaatatcatg ctagattttg gatctgatgg
   227461 cgcgactgga agtggcccgg cgaagctctc tagctgctaa ccctacaata catgctgtgc
   227521 caatgaaatt gtacagctac ctctgcctac agatcctgaa cctgaaccct acgagctaag
   227581 ctttcgacaa gtaattccga aggtacgcct cccttctacc cagtcccctt gatcatacct
   227641 ctgtgaaatc acctagaatg cagccggctt cagaagcgac tttcgcaact ataacggcgc
   227701 tttcagacat cgacatcaat ccgtctgggg actcaaaggc attcgatctg ttacccatta
   227761 tttgcagccg agtcttatta tctcatcaga ttcattctgt ctgcgcctgg agacgcctct
   227821 atttatgctc aggtcggtat gtccgaactt aacgaagata gcagagtcca gcaacttaac
   227881 agaattgaaa tgccttcaac tactgtgatc ggccttaacg aagatagcag agtccaccaa
   227941 cttgacagag ttgaaatgcc gtcaactact gtgatcggca atcctcaggc ggattgagca
   228001 gatgtcgctg tgtgtagatt tttatatcaa ataactccta acagttaagg caagactgca
   228061 gcgagagcct catgtaagtg cgttttactt cacagttgtg taatatagct aacgtttccg
   228121 ctgtaggcaa atctgctcac gcctactaaa cccgaaacaa catgatcatc gtcgatacaa
   228181 tctccctaca gtggatgacg tcgcggctac catgcaagct ctgaaataga acctagcagc
   228241 ggccgtggga ccatacagga aacctatgga agtaaaaaat ctcaacgtgt gagcgagaaa
   228301 agccgccact ttttacacct ccatttcatt ctgatttatc accagcgagg gagaatatgg
   228361 atggtattcc tagatcccat ctcgctgaag ggcgtaacta cccatcatca gttatagaac
   228421 ttacatcctc tgctaacatc gtcattttac gatgaggcag gaacggtaca aaaagtccct
   228481 atagagcaat cctatgcctt aaggtctttt tgagcgccca ggcagtttta atgcgctctt
   228541 caatatgggc ctctttttca aaagttgaca gtagacactt actcagctcc aaatcccaat
   228601 gagaatgcct cctcctagcc ttgataatac gtcaaacacc gggcccgagt cacaacacat
   228661 catttattca tctacgccat ctatctcaac aggtaaacta ccgaaacccc ctctcttaaa
   228721 ttgcgcactc cttcaaacta cacaaagtga cattctgatc cattgttcgt catagcacca
   228781 acatataaat cacatgtact gtccaacaaa ccacccaacc taatgagaac tactagaggt
   228841 aacctcatac cccttggagt gctaggtttt gtcccccatt ccaataccga tgggaatact
   228901 ttacagtaac tggtttggga tgacgatcta tgtggtgaat taagacccag cccagcgcat
   228961 cacacgctta catacgtaga acgatagggt cagcgacatg atcatgatct gaacattttc
   229021 aatacaccac ttcgtgtctc cgttgaaaaa gtacaagtct tttgtctttt ccctttcacg
   229081 atggccaatg ggttgaattg tagggcccag ttttaagaaa gatcgatggt ctccatgtca
   229141 cggcactgag cctgccgacg ccgtgtaatt tgtgaatacg ccagacagct caataattaa
   229201 cttacccctc agaaaaggga ggaacatggg tctaggatca aatgagccac tgtacatatg
   229261 taaaatgcat cataatacgt accacacatt tggatgaacg aacacgtcca ttctcattaa
   229321 caaaaccacc caaaaactga acggaattcc caaaattaac ttggtgcaat tgaattattt
   229381 acccgaaaaa ccgcgaagtc tttcgtgggt catcacttgt ttattattat ataaaaccgc
   229441 ctaccgccca atcgctttga agcgtttcaa tgggttcgtt ctcctatgcg tacgaaatat
   229501 ccttcaagca attatgcaag atacagtagc ataacaatac tatatagcca gaatgtaata
   229561 tattccacca tgcccaaacc gcgaaaaaca tagctttcta tgacttgtcc tcaacgagct
   229621 ctcggagact atcaaacacc tcttcactcg actttccttc cgcccaccaa aggttgctga
   229681 ggtcctcatc tggtttttcc acattttgag taccagataa tcccacgact gaccttcggt
   229741 tcgtttttct tggagtccac ttttcgcctc tctttcgctt ggtcagatat tgaaggtact
   229801 cgacggaatg gacaggctgt tgagggatat ggatagcgcc aggagccaac ggtggcccag
   229861 agaaccatag tacttgccct cgggcatcag tggggaagag gcgagctata gcgtgtcagt
   229921 ttgcggatgg aggcctgacc acattgactc acctgtttcc gctggaagcg tctctcgatg
   229981 agccacttgg tccagagctt gctgcccccc catgagagct gcaaatgtcc tgatgggttg
   230041 ttgcgccaca acaggttgtg ttacagggat ctgcggcgcc ggcacgactc ctggagctgc
   230101 ctgaggttga ggaggcggta ccacagctgg tgaggcacga tacactgcgg cagcgggctg
   230161 cgcccgtggc tgggtttgag gcgcaggtgt atgagcggca gaatgtacag agggtctccc
   230221 ccttctcctc cccttgtctt catcgtcatc atcgtcatca tcctgcgcgg cactaccgcc
   230281 aaggaccttc tttggttcgc cgaagaaccc tgggccttga actccttgcg ataatggtga
   230341 cggcaccatg cgagcttcta tgacacgttc aaatgggatg attgacatga agtcagtttg
   230401 tcggagttcc tgtatgtgat cagctggtgc atgataacat ttgacatcta agctcacttc
   230461 gggaatacaa ctattccaat ttttaattct gacaatgtta taatcacggt ggttgaaacg
   230521 tgaattacaa acatctgctt gtcagcaaag cttatgagga cccaacttac aaacaggcca
   230581 tcccggatag aattccccct ctctaggccg cccacggata tacttgacgt agaattgaac
   230641 tgaaattctt tccataatgt cctcaacagg gtggtcacaa aattgtccag tcttgaacac
   230701 ctcatgctca tagaacattt ggtcgggggt gtgaacagtc tgacattcag cgacgccacc
   230761 aattctagac ttacttgttc aggtcgataa taccaacaaa ttgaagcatg atgtgtttgc
   230821 ttcccctttg taggaacgaa ggtcttgaaa atttggccga tgatcggtct tgtagggtca
   230881 tctggattca ttacatgaac gtagtcacct ggttgttagc cctataagtt gaatcaaaac
   230941 ttaccgagtc tgtacgctac ccctttatgt ctagcttcct ctgtgaacac tctatcttta
   231001 gtgccaaccc tgaaagtggt aatgccgtat ccgacttgct cctctgctgc cccggccctg
   231061 agttcttgtg tcgcctcgtg cattgaacga gcgttccctg ggccagcagg aatcgaagca
   231121 aacgctattg atgaaggctc tgggatgcca gaagggggga gttgaagagg atagatggaa
   231181 gttagggcat tgtaaagtct ttgcagcacg agcactcggc cgtactcttc tgatccgtca
   231241 tggaaccatc gtctggcttt ttcgaacagt cgcgccatgt ccatgtcaaa atctcgtaag
   231301 ctcagatatc gtgacgcgtc cgcgatggca ttgattcggg caaaggaaag gggatgctga
   231361 ctgtcagctc agcaactgga cgagttggct cacattaaat gacaggaacg ggatatctac
   231421 cacctcgggc aagatgtcaa ggacctcagc aagcctttgg ccactaaatt tcaatcagcg
   231481 acttgtcata catctacaat ccatcctctc ccaaacttac ctatgatctc tataaccttc
   231541 tacggctctc aacacttctc ttatcttgtg cggccattgc tcaggcccgc caatgtttct
   231601 ttcataatcg gccgtgcctt caccaaacca tccgctccct gggatgccgc ctggtgcggg
   231661 atttccaggt aatacctctt taggtccctc ccattttggc aatgtcgcgt ctctagctgc
   231721 gatgatagcc tggtcagcat cgcgcggtgc catcctcgtt tgatctgacg gggaatttga
   231781 ttgggcagtc gagtaatcgt gactgagagt tagagtaata ttagaagatg atattgggcg
   231841 gctttgagga gatggattgg aacgtgcggg tctgttgagg gatgcagatg tagaggccgg
   231901 cacggacgat ggggtagaag gaccggaagg gggttttgca aaggttggga taggactagg
   231961 ctgtgcgata gagttgagac gtggcacttc cgttaatggg cctggcctcg ttgactttgt
   232021 cgggagcgct gaaaagcctc ggatactctt ccttcctggc ttgactggat tgttgtgata
   232081 cgggttgttg tggaaaaaca cctgagcttc tacctttgct gaccagtccc ggaagatctg
   232141 ctgttcgagt ttgatggcgt caatgtagac ggtggagttt tcctcgttat ctaaaagtca
   232201 gcgcaaagta tggctttact tatgcttaca atgttttgcg ttaagaaaga caagatggag
   232261 ttgcttgaag aatgtttcgg gatttggata cgcttgagac gcgagttgag cctaataaag
   232321 aaaacaggtt gtttctgtca atttcttttt tctttccact tcctttttgg attaactcac
   232381 agcaatatgg tctaaacact caggctctgg tatagcgtta tagtaatctg caaattcttc
   232441 cctgtctgga agctcttgga atatatcgga aagcctacga ctggttggga aagccgtggc
   232501 tcgacattag aagtgacatc cataaaccgg caacaagtag ctcgtgcaca ctcaccttcc
   232561 cgctttagct ccatatactc tactcaaaat atctctgcag gcttcccatt gcttctcgtt
   232621 gaaacccctt ccttccgcat tgcccggaaa atataccggt actgggatct gtagcttctg
   232681 gctgcgcgta gtctttctag gaggcataga ggagatgaag actgatatta cgaaggtgat
   232741 gttgtagaac tattatagta gctaggctat gtttggctac tgttataaca gaaagtatcc
   232801 gtccttagtt ggcttatctt cttccagtga ggagacatat atctagatgc cctgtatagt
   232861 aattccccca gctctgctgg ctgtatttct gctgctctct gcgactgggt tagccaacca
   232921 caactcgaac aaggagccac cactataacc ataacaacag gaagataatt aataataatt
   232981 aataataact gggtggcggc ggggtggcag tgatgattac acaaacagta ccagcaagta
   233041 taatagttag tatgacgggc cacgcggcgc ttatttttat tttgttaatt atttgttgcc
   233101 tgtcgccgat cgccgaggcg gcggtggagg aagaaacccc gagtcgtcat tatcataact
   233161 cgactccggc tttacgcgcc atggtcgaga agatttagaa cagaaaagag caaaacgaca
   233221 gcatctcagc gaccacaacc gcttggcaag actcaagaat cacaatcaac cttcatgttt
   233281 actatgtccc ttctatatcc atagtcggtc caagtctctg atagtaagat gtccttcaac
   233341 tccaaaaacg ctgccggtcc atcacgacct caaaagctgc cccgtaaggt caaccggtca
   233401 caacctcaac tcaaacgcaa tgctgcctgc ctcccatgtc gcagacgacg tatcaagtgt
   233461 gacgctacaa gacctcattg ctcatcctgt gtacgaagct accattttct ggcccgtact
   233521 tatcctgata ctggaaggga cgctcgcgga gtgcaatgta cctatgctga agatgccccg
   233581 gatgtcggcc ataacgagca acaatcccat ggtttgcgat ctcaacctgc acagccgaca
   233641 aaaaggaagc tcagcgaaga agatggagaa gatggggatc caaaagggat gattaaaagg
   233701 cttgaaggta aagtcggtac gtgtttcggg tctatacacc gactgtgaac taatgtcaca
   233761 cattttgccg tcacgtagcc gagctccaaa aagctctgga aaagtctcat tgtacaacgc
   233821 cttcgattac agatcctggg ctgcaaatac catcaagcaa tgtctcggat ggcgaagctc
   233881 gtggtcaacc cgctcaattt gaaaacagtt tttatttatg gacgggaacc tctcaagccg
   233941 cagttgtgga tactttccca ccgcaaaatc ctcataagaa caagcattcc gaccccatga
   234001 atggtttccc ttccgccttg gaaaattttg tacctcatca ttctgccgaa atgtacaaca
   234061 tgggcgatgc tggctttccc cctcttcaac aatcttcaat gcagctgaaa tataatgcta
   234121 aaaaatgtga cagtcatttg gacaattttc gaacgtctgt agaagttccg cccattgacg
   234181 cagaagctgg taagatgggt aacgatattt tggatatatt gtggccggga tggccgccga
   234241 ctctcccttc gccatgtaag tagctttcac taatcccaac tacaatactt aatcggcttg
   234301 tagcaatgct cgagcatctg gtcgaaacct ttttcaccat gaccccatct gtacctcgtg
   234361 ttctccatcg ccaatctttc cttgcccgac ttgcgctgcc gccatcgcac cctgaatttc
   234421 cccaacgagc tctcctacat gccatttgcg ctgctgcttc tcgatattcc gcggcggtct
   234481 ctgttcgatc tgtcgcagat ggaatgatca aagtcaacga tgatgctaga caagcacggg
   234541 gcaagggatt agaccaggac gttgcgagcg agacttgctt ctcagagcga aatgcaatgt
   234601 atgcaataga attcatgaag tataaccata taaacgccag agggctattt gatattttgc
   234661 aggcaacggt aagtgggttg acatcgcgaa actctgaatt gacgtactgt gtgtagatca
   234721 tcctaggtca ttggtgtcaa gccaattcaa ggtgattgaa cgcctgatga ttggggagaa
   234781 tgttagctta cattgttgac agatggatgg agggttgggt tatgatcggt gcggaaacgc
   234841 gccttgctat ctgtcttggc cttctacaaa accaaagtca gcacgatcgc ggcatacctt
   234901 ctatcaaaca atcagtcttg gaccgcccga aagatgatgc cgacagagag gaacgtcgag
   234961 ctacgatgta ttatgcgctg tgctatgatg tgacctcatc agcttcatct ggctgggttg
   235021 ggactatgcc tacggaagag ctggtgagga tttgtcaaat aacatgttat acatgagcta
   235081 aatgagcgta gactgctaat ttacctgcag cgcgagtaga ttttgataaa ggggtgagta
   235141 ttagcggccg tgggcttgta aataattaac aggaagccaa gggcaaaata ccggagaatc
   235201 ctcaaaattt ccattcccca gacatctttt acaagtaagt atctcaatac gtgtctcgcg
   235261 acatccaacc aatactatct agccaccctg ttgccgacag ttttgtcatg atgataaaag
   235321 gcaaaatcct tctaggtcgg gcttgtcgtt ttgtccgtaa atgtaaggct atggagcccg
   235381 aagacaggct tctagcgaaa gatacgcccg agttcaggca aatcgacggc gacattgcca
   235441 tgttcaggtg tgtgatcaat gatctgtcaa ttatattgcg acccatgctg attacgaaag
   235501 tttagtatgt cattcccaaa gtccctccga gatccagttc aatatatgag tgggcatgcc
   235561 aaaggcatag atgccgacct agtcgtaagt tataggaagc ccaccgccag tactttctga
   235621 ttcctccgaa gagcgcccat ctcgttccac acgtcgtcgc catacaactc cacgaaccat
   235681 ttgccgatct aaacgaccca tcctgcagct cggccataag attactgacc gaggctagag
   235741 cttgtttgaa tattgtttac ctgttgattg gcagtagtgc agatatatcc tacgttgttg
   235801 ctcctatcac ttcttgtaag tcgtatcttc gcattacctt ctagtccaaa gtcggctgac
   235861 catcttatac agtgtatgtc ctaactattt aaaaaatgcc tcttgccagc agcttatcca
   235921 atctagctat atattcacag catctagagc tctaatcttg ttctatcaaa aggcactgga
   235981 aagtggcgat caagtgacag ccatgaccat gcacgcggag atcgaagtat tcaagtaagt
   236041 gtcgaacgcc attggtgcga gtgcatggca tccagtcctt attctctctg caggatggca
   236101 tttacatccc tctcagcgcg tttttctatg ggttctcgac acctcaccat ggtggagaag
   236161 ctcatgcaac atgtcgaaaa agacaccctc ggccatcaag tgtttaacga agatttctcc
   236221 ttcctgccgc ccgctcatct ttcttccgag tctgtgcctg gcttcgtgtc tgacctcggt
   236281 caaatggggt taccagacac ccatcctgac agtatgatga tctttgagct cgaaaaagct
   236341 gcagccctgg gacgacatcg acctggattt agctcgcatg ttatgatgga tcaaaagaga
   236401 ggatatgcgg gaggattgaa ttcacggtcc aactccactg ctggatctac tgggccaagt
   236461 cccaatgatc cctcgcgatg gttggatata agtaaaagtc agcaagaggc aagtcttact
   236521 ctcttgagct cggagaatgt tggcggtaac ggaggatcgg cggctgactc cccgagcgtg
   236581 agagggcagc ggattggaac cttgggagtt atgagtaaag cggaagttgg aaattgaggg
   236641 gcccgaactt gtcctttcaa aggattatac acaatcataa tatgctcggc atgcgggcac
   236701 agcgcacaac ggtcctcccg cgcccgtgtt cggcagctta tggcttgcaa acagcgggca
   236761 atgggcgaac gaaagggcgg aaagagcacg ggtcagagac gccaggcgcc aggtgtcagg
   236821 aggattcagg atgtttgctg tttgctcagt gcggatgtgc agtattacag ttttgagggt
   236881 acctcacctg ctgtttatct ccatccctat accatggcta ctatgtattt tctatcgtat
   236941 tatatctttg tgtttttgca ggtgatgctt gcagaaacgt ctgtttacaa gtcttctaaa
   237001 ccatcataaa atgctttaac tgtttttatg cccccgaaac gtagtactat ctatcccaat
   237061 gattcctatc cgaaacctcg aagccttcaa ctatccctaa ccagtcgatc aaccgccagc
   237121 ttccaccacc agtattccct tccctggagg tgacgttcct cgagccttac ctcctttaaa
   237181 ccaaacaaca gcaaacgccg taacaactcg gcggtcagat cttccgccca aaccgccaaa
   237241 gcgcagtcta ccgtaatact gcataccaga acggacatgc ccattcccat ttcccatata
   237301 ttatttgcac ggcaataacg aagactaaaa ctgaacgtaa ttcccaaact taacatcaac
   237361 atgaacctga aatatttgtc cgaaacccca cgcgtaagtc ctttctcggg tcatcactag
   237421 tcaattcaag tttcttcgaa aagctagaca gagaaaagtt tcattatttg agaggaagaa
   237481 ggcttcagtt tcttcggcaa aggtttcaat acattctaac gggagcgaga gagtaaagtt
   237541 agctacagat agtcagaggg agatcaaagg atcatttaca gacaatactg cattacgccc
   237601 gtcacattat tattagacta tagacattct tctgagggag tgttcggcaa caattttcaa
   237661 gtgctggagg attatgaaac aatattcggt tgaggtttca actctcaagc tttgtatggg
   237721 gaattaggtt ctatatactt aaataaaaaa gcgcgtctac caagacctaa aagtggacag
   237781 agaatggcag aaacagccag cgcgtgcggc tctagcaggc taaacaagga atatgcaatg
   237841 tatgacgtta ttagataatt gattgatacc gcatttggaa aaaaatcgca cgcagacatg
   237901 ctgaggataa ggtctccaac caaatatcta aaaaaaacca tcgtaagtca ccaactcttg
   237961 tgatgatgcc cttattagtc attttgcttg ctgtgataag caagggcaca atagatagca
   238021 ccgtttagtt atctgcctct tctctcacct ctcctgcctc tctctccatc cgtcattttg
   238081 attttgatct gccgtatgtg acgccgcacc accgtttacc gcatgcgcgc aaggaacgag
   238141 cacaagatca ttccacaagc cgaacacgca cgattaggta caagtccctg gtgtacgtag
   238201 tttatttaga ctatatttta gactggattt gtctttccga ctgtggtcac ttgattggac
   238261 aaaatgaaaa gactggatgg aagcacgctg cacaaggaac aaagttatcc gcgggcgatt
   238321 ttcaaccaat cagctaaata agttgagggt ttgatctaca agtggagcaa gatcgccttc
   238381 ttttttcgct gctccaagag ataaaccgta caacgtccat catccatatt taactggcat
   238441 cggatgcata cttgtcttac ctttttttca atacttctct ctccagtcgg tcgtctccag
   238501 tggccagcct cttccgatca ctcagtttaa tacgatttaa cgcggaaaac aactaactgc
   238561 ccctcacgtt ctgaccgata agggctataa gtggagccca gaacggttac atctctagtg
   238621 ccaagtagtt acagtttccc acaattgccc catatttgct cctttcagta tcaattcact
   238681 cacttcttct aataacgaca tgtcaagcgc aattgaaaaa gaaggaagta ttagggggag
   238741 aacatcccaa gaggtcgtca gcgcgggata cgacccaaag aaaggtggcg atggtgtaga
   238801 cacagtggtc acccctgcac atgcggaaaa aggcagttat gaaggcggtg agttacatgc
   238861 tcttcggggg acgaagggag tgtatgcttg atatcgtcac aattgtaagt cgctgataac
   238921 aggctttcta tgttgaacag aaggcatcca tgttggcgaa ggaactgttc atcgtcagtt
   238981 gaagcagcgt catatggcca tgatcgctct tggtggagcg attggtactg gtgagttttg
   239041 gctctgtatt tttctgcact tcattgtctt atacattata caggtctctt cgttggttct
   239101 gggtctgctt tggccagcgg tggtcctgtg ggcgtgtggc ttggttatat cttcatggcg
   239161 tctatggtgt aagttgtctc tcgaattgtt cgtcgttttg tagctaatat gattgttgac
   239221 cgtcagatac gcgatgatgg tggcgcttgg agaaatggca gctttatacc cggtttctgg
   239281 tgccttcact cattacgcgt cacgtttcgt cgatccttct cttggtttcg cgcttggttt
   239341 caactactgg tattcttacg ctatcaccat tccgactgag gttgttgctg ccagtattgt
   239401 gatctcatat tgggatacaa caacgaatgt cgccgtttac attaccgtat gccttgtgct
   239461 gatttggttc attaacttct ggggagtacg tataaggaat tgattgtcaa gatgctgagg
   239521 attcgctgat cgaaaatcag gccagagcgt atggtgaagc agaattttgg ttctcttcca
   239581 tcaaggttat caccatcgtg ggcctcatta tcttaggaat cgttttgatg tgtggtggcg
   239641 gtcccgtaag cggaaacttc tttgcaaagc aagtgcttac gtcttcacaa gaaccatgac
   239701 gctattggtt tccgatactg gcgtaaccca ggaccatttg cgcaaatcac aattaataat
   239761 ggtgacggtg ttatccccgg acgatggggt cagttcctcg ccttctggaa tgtctttgta
   239821 caggctgctt tctctttcat cggtactgaa atcattgcta ccactttggg tgaggccgag
   239881 aaccccagga agacggtccc tcgagcgatc aagcgtgttt tcttccggta tgtttctttt
   239941 ctagtcagaa agatagttag attaacgacg atatgatcag tttgctcttc ttctacgtct
   240001 ttggcatttt tatcatctcg gtccttgttc cgtacaccga gcccaatctc ctcaatggaa
   240061 ctggcaccgc tgccgcttct cctttcgtca ttgctattga gaacgcgggt attaaagctc
   240121 ttccttccat tgtcaacgct gtgctcctta tttctgcttg gtcggctggt aactcagatc
   240181 tctatgcttc ttctcgaacc ctatatgctc tcgcgctcga gcgccagatg cctcgtttct
   240241 ttcgacgatg caccaaaagg ggtcttccca tctggtgtgt tgtaatcaca ggtctttttg
   240301 gttttctttc atacatgaac actggcggtg agacggctga gaaggcattt gactggttgt
   240361 acaacttgtc tgccattaca ggtatcatca cgtggtggta agtcatttga aataatgctc
   240421 agaaagaacg cttacatcga tatagggcta ttctgctttc gtatcttcga ttctactatg
   240481 gtttgaagaa gcagggtctc agtcgagacg atttcccata ccgcgctcct ttccagcctt
   240541 ggctttcttg gtatggcttt atcttcttca ctctcatcat tcttgtaagt gcacaggtca
   240601 acgtgaaatt tggcgatggt cattgaactt cccttagttc aacggtttca ctgtcttctt
   240661 gaagggcaac tgggatgcct cttcctttgt tgctgcctat attagtaaat attttttgtt
   240721 tccttaaaat tcgaatgagc tgacaaaatc aagcgctgcc catcttcgct gtctgctgga
   240781 ttggatggaa acttgttaag aagaccaggg tagttccttt ggccgagatc gacttccaca
   240841 gtggacgaag ggaattggat gagcttgaag cattggatgc ggaaaggttt aaggcggaga
   240901 ccaagtacca aaaaattatc agtatcttgt tttaatagaa atcgtaactg gttgtgaggg
   240961 aaatatttag gaaaatgtta aaagagtttc gattgctcta tcctttgtag ttcagtaata
   241021 ttaggctgct tttacgcaag catatcatgt actttaaaat tacacacttt ttgagtttca
   241081 tttggtcaca tcttacctat agaaaaagta acgttaacga taaccagaac cttctgcggc
   241141 accataatca ggggcataca tgacggatga cgaagtgtcg gcgaatgatt gccaaaattc
   241201 tcttatcagg tgatgcagat tcagcttctc tttgtcgttg gtcgctgttt ttgctccttt
   241261 attattgtag caacgactac ccatccctcg ggagggatat aatcccgata gctgggggag
   241321 ttctcgtggt tgggactaac ccacccttaa agctacaacg gatgagatga gtgcgcatgc
   241381 tggaagtgat gtcgcgtcaa aatggagcgt tgcgtgtgct gtggcaatgc agattgtgta
   241441 cattggcttg atgatggata gcatgatgat gaccctttct caacacagtg attcgacaag
   241501 ctcgaaggtg atcgatcttg ttggtcaaag gtgatctgat cagcccaaaa ggacggttct
   241561 tggagtcaac agaggtaaca aaataaaatg cattttcgga gtccttgaag agctatttac
   241621 actttttgaa ttcgcatttg tgttaaactc cacagttttc ccttaaatat tgttgtgtat
   241681 ctctctttga agacgcttca gtcatgccag tgacaccgcg gcccaactat ccctatccag
   241741 tacccaactc agaactcatt gcgactcatt cccttgggaa gcacttcgaa ggtggtttct
   241801 ttgctcagaa tgttgccctc gaatcagaca gcccaaagtc acccgcacct caaaatgccc
   241861 atatatcaca accagacgct ttgggaggga gggtacaata tgcatctggt ccaggagcag
   241921 aattgctcta cggtccacca ggagatgagc gagtgggaga agataaaaga ctagatgcga
   241981 ctttaatcta ctatcttctt acccctgact cataccgatc tgcaatgcac atgaatttac
   242041 actctgtacg tacgagcgtc ttactagtgg atcgatctgc atgaagtatt attttaacaa
   242101 gtaatgactt cagactttcc acctccatca cgctgggcga gcactttaca ctctcataca
   242161 accacctcag aagaatggtg acgagccaac agttcgtcgt gtgatcatgg gacccaattc
   242221 ttctctcgga gaggtcactc agcttttcgt accgggaggt tgttggaaag ctagcgagat
   242281 tcccgaagag gacatgttat tactcggggg gcgcgaggat aacgacttga aagagagaat
   242341 agggtgttta atcagcgagg ttgttgtgcc gggttggaat ccagaccagc accaattcat
   242401 tgatgaggat aaggtgggta actctgaagg ctttacaagt attgttgctg attcattcta
   242461 gttgcgggcc atgtggggca ctaaatcagg atgggaacag tacaccaagt acatccatcc
   242521 tccgcaaggc gtcgaacatc cagataaata ggcttcctat tctccaagcc tggttcacgg
   242581 acccctgcta caacgttact gttgtttaag gaaacagatt atagaaacag aatttagaag
   242641 ttaaactaca tcccctgcct attatgatat tccacctgta tataatctac tggcttttgc
   242701 ccttcatcca aacatcaatt tgagactgag ggacgccgtc caaacgatga ataagatagt
   242761 ccacctttgt aatgtcaagt ctataccatc tgtgaaatct caaagaaaac tcacttcgac
   242821 atccttggta agaggaatga cccaatcctt gtacatgccc accaccgagg cgagatcaat
   242881 cttccctctg gcacccatct cctcgtcagg aacctcaatt aatcgaccgt ccacatccat
   242941 ctcacaccca taaacccttg ctttattagc caatcggaca agcaactttg cttccacagc
   243001 aggcttggta atgagacccg ctaaagcttc ggtatttgga ggggaggcga ggatatgagg
   243061 gatgaagtcg tggggtgcgg tgaggaattt gctctcagaa acaaacatac ctggccgtag
   243121 tcaaatcagt acagtctcta aaccaatgtc agttttcact taccgaagtg tatccttcga
   243181 ctcaaagcct gcaatacctc aacatctcga gtagctgaac tgccgtagtt accatcatct
   243241 tcggattcag tcttcccctt tccagcaccg gtgataccgg ggacgatgtg ctccacatag
   243301 aaccgaagga tcctagaatt gacatttaca gaagggtgag tagcagcggg ttcatacaag
   243361 agagtaggaa atttttgagg tttgaggatg ggctgcggaa gcctgtccag tggggtgaaa
   243421 ggatgttcat cggggctatc cagtaaggtc agctagagta aacatcgaag attgagatca
   243481 tatgccttgt aaagcgtcgg gcctttgcta aaaagagact aaccgtcagc tgtctttgaa
   243541 tgccttcaac gaagtcctaa acctaccatg gaaagtctct gtctcgtaca agaaccattc
   243601 aagccagctt ccttcaaaat caatttcatc cttgaatgct ccggcctcgt agattttctt
   243661 gttgtacgcg aattgagctc gttcaataag cactgagagc caaaaagagt cagtgttgtt
   243721 gatatctgct gcgtgtcacg agagacaaag cactactgac agaaaatgat tgtgtcttcg
   243781 agccgaataa gctgtgacct gatgcgatcg agagagagaa gttctgaagc gttggccccg
   243841 gtagtgaagt tcatcatggc cacgaaaaaa ggctgaatga tacagtgaga ataggaggaa
   243901 taacaaaagg caaagtcacg aacaaccagc gggaaaatcg ataagcggcg cctggcccaa
   243961 tatcggttgg tgagcgcaaa acctcgttcc aattattatt atgactactt cattttatat
   244021 tagctcagtg atcgctttcg taataaataa tcgaattgcc agcacttgta tcatcctatt
   244081 aaagatccat ccagggcggt cagcaaacta atagatcaac cagaacgggc gccttcaacg
   244141 agtcttagct ttccgtctta ccgcgagggc gatcctttct tgaggtcgaa ggcctgttgt
   244201 gattggaatg aaaaatctat gaaggtttct caatgccttt tgtggccgcc catatcaact
   244261 agtcataact atttcaccgt atcagaggcg ctaagatggc agacgacaac gatcaaaatt
   244321 cttcagcaca gtcgaccaaa accaagttgg acgaatcaaa gccggcggat gcaagcaccg
   244381 tgacacagtc gaccgctgtg aaatctcaag cagagagaca attaaacaag tattctttcc
   244441 cgaccatctc ctgcgacgac accgatgacg ataaacactg gtcttttact acagcttgtg
   244501 catgactgaa gaatttaagg agtttgaaca acatgctctc gatgatgcga tcgccaatgg
   244561 agtaaatgca tcagaagtac aagctcgttg ccaggatatg gcccgaaaga tatcatattt
   244621 ttgtctggct atggggaaac atacactgat ttttggacac agatgtccag tccgagctct
   244681 gttgtggccc gcttccccaa gaaccagatc agtccattat tgcagacttc aatgtatatg
   244741 gattaatgga cgacggacat ggcatggctc acatctttca ttgcgctccc tgtcggtttt
   244801 gccgatatga tgcttggtgg tgaatgggac cccaccacca ccgtttctga ggtattcaaa
   244861 gtgatgatcc ctgagagatt tgcgagattg aagcaaaggg caaaatctgg aagcaaaatg
   244921 tttctcgggt gaagagcata ctgatcttgt gggttgtcat ttgaaacgta atctgtggga
   244981 tatgtactta tgtcgtgcag agacgataga caaagatata gaaacagttg gaaaaccact
   245041 atcctggctc ctccgactcc atccagtcct gatctcttgc agttctcctg ccgcacccta
   245101 gctcacgctt tctcgccaca tcaaaaataa tcaatcatgt aatgtacaag ggacttttgg
   245161 tcatgtatat cttgtagaaa acgtcggaga tcgtcccata ttcacatata tgtttacatg
   245221 tatacaactg tgaacaactt cttataagcc cgacgtcgga tctgccgttc accaaggaat
   245281 ctccaaaggt ccaggcttgt caagcacctc cttcccaagg acctcttcgg catttccaat
   245341 gcctttcgca ccaactacta aaatttagcg cccttcctcc gttagctggg tagaaactca
   245401 cgtggagccc aaaactttcc actcatactc aaatcgagtt tgtcaacaaa atcagccaaa
   245461 ggcttggcag cttcctcagg ggtgatggct cccatcttgt cgtagaactc ttccatgcca
   245521 gcgttcttgg tcatatctgc gttcttatca acttggtttc ccaaacctag agattcaaat
   245581 agtataaact tacccgtctt caagaaaccg ggctagacaa tctggtgatc agtatgtcgc
   245641 ctcctaaaca gagtcatgct ggatgaactt acatggatca tagcaatagg gatgcctctc
   245701 tccttgaggt cgtagctcaa gagatgtccc accatgttgg cagcagcctt actgccatgg
   245761 tgaccaaatg ctccacctcc ctctgactcc gttcgtagag ttacagatcc ggcctcagaa
   245821 gttaaaaaga ggatcttggc gctgggcgat agagaagagg caaaaaggct atgtaattga
   245881 caaaattagc ccgatggtga ttattcacac caactcgcaa tgcacttaca gtgatttgac
   245941 gacaaacaca ggtgcaatgg agcagacaga atacatcaag atttcgtctt tccagctaag
   246001 attctcgatc gactgtaata aaatcaacgg tcagtaaagt gttgaagcag attcaaagac
   246061 gcatcgacct gcctctggtt tcaggacacc agcaacatag gcaacaagat cgacgctggc
   246121 cccttgcagc ccatccacca ccttctggcc acaatcctct ttggagcaat ctacactttc
   246181 aatgaccctc acgcccttgg gaaaagtgtc agaaggggcg gatccacgga cagtagcgaa
   246241 gacgttgcag gggtttatga ctgaggagta atgcttgaca agggccagac caagaccacg
   246301 agaggctcca actacgagga ctgattgggg ctgaaaagct tacatattag cgtcagaatc
   246361 gcttgctgac aacagtatct aaacaagacc gacgggcttc ggcggaaacg acgtacagac
   246421 atgggaggtt ctgtatttgc agcgtgatct gtacttcgga gggcctttgg tgaagtggtt
   246481 gttcgatcta aagaggtgaa gcacaattga tggtgatgaa cctttttgaa caggactgag
   246541 tgggtggcca gggtgccctg ccgaacggcg atttcatgct ttttatgacg tagacaactg
   246601 atgacgaaca gaaagcgcgc caagtggaag gtggaggaga ttggctgttg gtctcacgca
   246661 agcacaacat ttccaagacg gtcagcagca taattaagct atttgaagta atctctgtct
   246721 ctagccacat cctttttttt tactgttctt gacccctata tatttcatat tccagtagta
   246781 gaatctggga gatagcactc cctgtagaat catcacacca agcactttga ccacaagtcg
   246841 atgagggtgc cggtaacgaa atggtttgag agttgtcaaa cacgtaaagg cggtctttca
   246901 tcatccacca atacagtata gtaatctgat gattaacgct cttaccagcc aaatgatgct
   246961 atttatgcgt tacatgctaa tattggccag ctttagttat gggtatttaa atatctatta
   247021 actgattggt tgattgcttc tttcttctca ctttacatac ttccccaacc accaacaggc
   247081 tcctgcttat cgagggaagc ccatagcagc acctgaggca ccagtggcac gggtatcgcc
   247141 ggctcctcgg gaagggttca agttgagctt gtagctatgt ctgaagtcac tcttgtgcat
   247201 cttgccattt tgaagtataa tcatgatggc agccctggaa gcctccaagt cagctatatt
   247261 gcccagatac atagtggatg cgattaactc actcaacaga cttgtccttc acgttcttct
   247321 cgtcaccgaa gaaaacgttc tcgatttctt gtttagagat ctccccaagg gagccagtgt
   247381 gtccagaagt agcagacttg tactatagac accacataag tcagtcacag ttttaaaaac
   247441 tccttcgtag cctcatcaag tcatgtgacc tgtgaagcaa cagtattaga aaagatactc
   247501 acaatcgaga attgaccaat aaatcgggaa agagcgatgt ccttggcacc atccttccat
   247561 cgctcgtact acgacaaggt cgtcagcatg agaacatcag cggatggagt gtcatccata
   247621 gtgacaatgt ggagaagaaa cgagactcac gtcggcaaca tcgtcaacga agaccatgta
   247681 ttcatcggca tactcgcttg agaaagggac acaagccgtc aaccatcgtg gaacctgatg
   247741 gaatgagtgc taaagggaac ttacttgggc ttgtaaacaa cagcaacagc aacgctagac
   247801 attgtgaggg atgtgtatgg tttggttgtt gtagaagtgt ttgattaggg tagagataaa
   247861 ttgaatgggt tgtaatagag tgagtggatg aaggagaaag aaagggggat gtgtatcgga
   247921 agggcttttt atagttgaaa tcgactccgt tctggctctg acgatgggcc acaagcgtga
   247981 tcacagggtt ctctaccggt cactgcccag tcagcagatg atgtcatacc cggtctatga
   248041 gcggcttcct ccgtcatcct gtcctgatat tttcttcacg tattaataaa tgacacattt
   248101 tggttctacc aactttagtt aacctatcta cgaacatttt catatatatt taaaagctgc
   248161 attcacgccc gacgatttct tatttccgcc aaccttctca acgtaaagtg tccctggttc
   248221 aaaataccag ttatcgacga cttccggttg actgacctgt ggtatggcga aaataaatgt
   248281 tatggcgaca aaaaatgaag atgaaagatg caaagatagc caagagtctt agcattctag
   248341 gcatatggag caagcgaatg taaccaagag cgagcagatt caggtctgag aggctgtaaa
   248401 ccggctgatc attaggctga taacagatgg gcagcttcca ttccgttgat gctatcgggg
   248461 cattaacagc agaccccagc tatgtgaaaa aaaaatcgct tgccttggca tccatgcctg
   248521 tacgcgatcc tgctagaagg gatctggtac gcccgccgta gctcttgtag acttggggat
   248581 taaactgatc atgaaggagc aggcaaatta caggtgtaat ctccagaaaa gtgaagacag
   248641 tagggctttg tagtgggctc tggagaggag acaaataaca gatcttgggg tcttcccagt
   248701 aatttcgtgt gtcgtcttgt gggtctcaat agataagcaa gacaattgtg gattggccgt
   248761 agacttcctg tgtcaattgt aggactttct aggaagctgt catcatcgct gggtagtttt
   248821 cattctttgt cagatggggg catgaggggt gatgaagatg gcaaacagcg tggtgatacg
   248881 taggccgcag cgtcgagcaa gatctgaagg ttcctggcat catgcataaa aagatcaaaa
   248941 cgcgttaatt cggtatcacc agcgagtccc tctcgaatca cagtattttg tttcttcgct
   249001 acccttgcac cggaccttat aataatgttg tccatgtctc tgtctgtcgt gtgccgtctt
   249061 ttctgccttt tttatcattt cgaatcggat gctgacaagg cgacggagta tactgtggaa
   249121 aataatgatc gatagggcag ataaatttcg ctgaggctaa accaaattaa cgaacaaatt
   249181 tccgtcagct gtagagatag acaaagtcta gtttagaact taatggtgag caataaagac
   249241 agtccaacgt gtcgtcgtgc gtagacaaga tagtagccaa caaaagatcc tgccgtttca
   249301 gaacatatag tccatatcac catgcacatg gtcaaggagc aagcagcacg cctaccgcca
   249361 acaaatacta gcgcatgaac aaacaaccat tcacaatcga caagtatcag gccatgtacg
   249421 ctgtcgcaga cgatcgccga agttacttgt attgctgggt acctgaaccc aaccatatac
   249481 attgccttga aacagcctcc cttctgtctg tcgctatgta taagctcctc tatacatttt
   249541 tgatcttttc acgtcatgga tatccttgaa tggttataat cgcaaggaag ctagtcaata
   249601 tatctaacga tcaaaatgga acgctttaga cctcaacgac atccaattct cccatttctt
   249661 cttcctctcc ttcttgcttg actgcacccc tgacaagctc ttctatatga tcttccttgg
   249721 tatctctact ttcgtcacgt tgtaagagac caacaaatcg ctcaatagag tccttgatct
   249781 accacattgt cagttcgtga atgccgtatg gatgagagtt ttcccgctta cctgttgatc
   249841 tgtctcaacc ttgtggtgct ctcgaacgac gtagtaggca cctcggtttc gaagggcttc
   249901 tcggccagtg aaagcttaat gatacgctta gtgactacta tcaaaagagg tgatgagatc
   249961 acttactagt agcaagcaaa agcagaattt cgacacacat catacggagc actgggtccc
   250021 tctcacgttc cttctcggga ggaaggaact gcagagtagg ggggagcttg tccatttcct
   250081 gatggcggaa atatcagcta aacaatttca tgagcatcat tgccgaagac gtacatcaat
   250141 gtcatattct tcaggaccca tgagaggagc caaaacccaa ggcaaaacat caacgccctt
   250201 gatcattcgc gtagggtctg agggcaatct aactcggtcc tctaagttga tgacttagta
   250261 tgtactatat tcggttcaaa gacaaattat ccctcacctt cactagccaa caaccaaccc
   250321 atactggccc ggtccatagc acagttcttg atacatccca gggcaccacc tcgcctgata
   250381 gtatcagggt gacctgtgta aacaacaatt tttgataaca ggggctcatc gccttctgaa
   250441 ggtgtagcat cggcaggttg cggaaaggga ggacgaggaa tgagaagaag ttgtctggtt
   250501 gcaggggcca ttgagatgtt ggcaaagact gaagccaaaa agttacagtc acccttacgt
   250561 ttaccggtac cctcctttac accatcagaa gcaccatcct caaaagcctg taccaatgct
   250621 cggatcgctt cgatctccct ctcaggttct tgaccggcct cggcattgac aagaccgatt
   250681 gtagggtcac ggaaatcagg gtggatagtc gatgatgctg atccagaagc aggaaggaaa
   250741 tacggtggat agtgtttaga tttggggaga gggattatag ggattgtgag attggcaaga
   250801 ttggagatca aagaagggtg ggaagtgatg ttggacagca acatggaagt aaggggagaa
   250861 agaggggagg tggtgttcta gagaacaata agcatcttgc tgagtagctt ttacagcttt
   250921 ccactcacgg cagtatacga tacaagccag acaagaaatt ccttgtcgga aatgtgtcgg
   250981 gccacaacag gattatccga aaggttgatc aaagcggaaa gggcatcgtg tgcgatgggc
   251041 tgaccaatac atgttaaaaa ggttgaaagc ttccagcaaa atgaataaag cctaccgctt
   251101 ggtccatgca caagtatgtc aagtccttca aagcctttat tttgatttcg tcctcatctg
   251161 acccatcttt ccttttgttg ggcaccagtc cgttgccgct agtagtggtg ccagcaaaag
   251221 aggaagggat gaagatgttt cggttggtcg agttcttggg agtgtggcct acaaggtttt
   251281 ggagagcgag atgcctagct gaggggttag gagagtcgag aaattggaag agctcggtaa
   251341 gggaagccat tatggagacg tgtggatgcg aacaaaagtg tgaaatgtat cagaaatttc
   251401 gttgtgtttc ataatgacga tcgggtggat gtaaaatttc ccacggttgt ctttggactt
   251461 caataagttg tttctttctc gttcgtatga actgtccgag ctatctgctg cttttcgtct
   251521 taactgctat tctcatcttc aatttatacc tatttccagc catagccacg gccccacagg
   251581 gtaactggcc atttccataa ccccttatac ttctccacac tcgttaagca ctacgccccg
   251641 cgcacatcct caaccatgct ctctaccttc cgaaccggcg tcaaggatat tgaactcgcc
   251701 aaccctccta cagactcaat ctctagaatc gaattctctc ccaccgccga catacttgct
   251761 gttgcgagtt gggacaacaa tgtgggttga gcagccggtc aatccattct gctcttatta
   251821 atattgtctg aactttaggt gcggttatac gacgtaaact cgcaagggca gaaccaaggg
   251881 aaggcgatgt actctcatca ggctcctgtg cttgatttaa cttggtcggc agtatgttgc
   251941 ttcctataca acccaattat aggcctaact gatgtctttg atcaggacgg ccaatatgtc
   252001 ttctcctccg gatgcgacaa cgctgctcaa atgtacaacg tccaaacaca gcaagcacaa
   252061 caagtagctc aacatgatgc acccataaag tgtgttgaat ttgccgaagt gccgggaagt
   252121 ggacaggttt tgattacagc gggttgggat aagaaactca aggtgagaga cacaggttct
   252181 ccgttcttaa gcatattggt gacctatctc agtactggga cttgagatca cccaacccta
   252241 ttgcaactat cgacctctct gatagggcct attcgatgag cgttgctcaa caactgttgg
   252301 tctgtgctac cggtgaccgt caactgcatg tcatcaatct ttcaagccct accaccatct
   252361 tcaaggtttg tccgcatatt gatatacaac tgatcgaaag agctaatttt aaggttcaga
   252421 gtatcgagtc accgttgaaa tggcaaacac gagttgtcag ctgttttcct actggagacg
   252481 cattcgctgt tggaagtatt gagggacgag tagctatcca gtgagtgatt ttgttgtata
   252541 ttcaggagaa aagctgatct ccttgtatgt aaagataccc tggagaggat gataagtaag
   252601 ttgatagtgg ataacgcact gcgacaaact aatgataacc acaggcgaaa tttctctttc
   252661 aaatgtcatc gatacgacat ccctactggt agcatgccgc gaactcccgc cgtcagcggc
   252721 tcccagaatg ttttcgctat caactctctc actttccaca aggtgcaggg aactttctgc
   252781 tctggtggca gcgacggtag tttgacattc tgggacggta tctctcgaac aaagcttaag
   252841 agtgagcact tcggagtctt ctgtgccgta gtgtgtggac atggagctga tgaaccaact
   252901 agctttctcc tgcaaggatt tgaacaacgg agacacagat gtacgaccac caagatttgg
   252961 tactcccatc gtgtctactt cctttaaccg aacccaagaa atcatcgcgt agtgggtcat
   253021 gctcgggctg ttgcctcatt tgatcactaa ccaatgactt caagtgccat gtcatatgat
   253081 tggtccaagg gccacagcgg tgtcccacct gcgggacaaa acattaacaa agttatgttg
   253141 caccctgtca agcctgaaga agtcaacaag aagcccaaga ggaattaaaa gtgttgaaat
   253201 gaacaaagcc gtgtaaagtg gcagagacca gcattctggg catggaggag agaggaatta
   253261 gactgtaagc aggaagcatc tgtctagtat taattggtgc tttcttctaa ttcaggttat
   253321 tcgtgaagca tgagtacggt ttttcgtgac ccatcctgtc gttcgccgag tgatgaaggg
   253381 attgtcatat ttggttacca aattcgtata gcctgtgtac cctagtttca tccctttcgt
   253441 caagctcaat tttgttacaa agctttccat ttctaatctg ttaacgatct cacttcaatc
   253501 cggtctggtc cgagaagcta atgcggctga cgtccggagt gtggaggaat caagagtggt
   253561 caataaaact ataaattact atgccggaaa ttcagtgctt agcataaaag ctccaccatc
   253621 ctcttgcatc gtcgatgtgc ttttatcact atcgtcattg gtatactgtc gtgcaatccc
   253681 aaatgatcac aaagtgtacc gtagaagata agcggcctca cattacctta attgtactaa
   253741 ttataaaata tgactatcat ttgaaatccg acaatgcgat gattttcttg ttcaattcat
   253801 cccaaggata cgtgtagaac agattggctt ctttatctct ccgactcggc aaatatctag
   253861 ctgctggcat tttcgcgaac cagtcaaatt atgtagttct cgtacgctgt tgatctacca
   253921 gaagcagact cagaatttgt agctgtgttc ttcaaaaagc gcagtggcat gatctttatt
   253981 tgtattctac ttcctacgag aatactactc ttcaaccatt ataatatcat gtttaatagc
   254041 aattttattc tgattaacca ggcaaactca aaagcccaaa atacccagtc gttcttcctg
   254101 atccttctga tccgggatat caatcgtatc agggagagat gttactagaa attgaatcaa
   254161 gggccaatcc agattatttc gccaagacca ttaaacagct ggtgcgtctt ttgatctcat
   254221 tgatcaaaat ttttcatacc gtgcacgcag acccatgcaa ttcaagccgt ttcaacgtag
   254281 tggccccaag gtttgtccga cacaccctca atccagctca aaacaaattg aagacatccg
   254341 aatagccttg ccgaagatcg tgaaatggga gagatggaga ttgtacattg gccggagcgg
   254401 ggcgccataa caagggaaaa aaggatctga gagtcctgga tggtataata caaggagacg
   254461 tttcaactga cgatgtgctg atgggatcaa gctgcttatg ttcccattat caatgctaac
   254521 aatcgatcac gttgttcctt tatcattatc ccttcccaac cagcggtctt caatgttggc
   254581 agatgatgaa tgcaggcatt caaagacctt ctcctcaatt catggggtga cggagatgtt
   254641 gaaatgataa aagccaagtg atcaccctca tagtgtagca tcatcggaaa caaaatgcga
   254701 tgcatatact tatggaatga attgagaggt ttgtccgcag gtcggaagta agtttaaagc
   254761 tttcctgttt gatatctgta ccagatcttg ggtgcgagtt gccagtcatg cttttgaata
   254821 tcgggatgga atacgtcaaa gtcgtacttt tcgagacgct tgaggtaatt ttccggcgct
   254881 acctggatga ttaccattag ctatggacag tgtcttgagt gttcaagtac gcaccgctga
   254941 aagaaatata ggcataacgc tgctcggtac gaccttgcca ccagtctcct tcaagtctct
   255001 tctcgcagtg attaattcat ccatccctcg agtaccaatc tcccagcaag catccctgaa
   255061 ccctttagct tccgctcctc ttctgaacag ttcctcctca acaatcccgt acttctcgca
   255121 gatatcagca gggatgctga tttgcttctt ttgagaaatc aaaataggga gattgcgaag
   255181 gagcgacaca acagccaaga gggtagaaac gtgagaaaga gtgtgtgaga tatgggctga
   255241 tgaagcatgg gttggaggaa gaaggatcgg cagagggccc aacaaaagag aagttgaaag
   255301 aggggagttg attgatagat gagattcgag agaaactgct gctggcggaa gagaaagagc
   255361 ttttgcctgc atgcttgatt taacgaagtt acggaccgta ataatttgaa ggcttaccct
   255421 gacatcaatc aactggttga ggtagtattt ctgcacaggt ctatgtttct tcatgtcggc
   255481 taataacacg gccacaggat gttgaggaac gatttggttc tgaggatttg cggcaaagat
   255541 acccttgagg gcgtctcgcc agaattgaaa tctaatggat gctaatgcag gctggctaac
   255601 attagcgctt atggagtgca gctccagcta agaattcttc ggttagttca aaaccttctc
   255661 tcgtaaagcg tccagcagga ggagaatcga tagctcacat tgaaagctcg ccaggcgagc
   255721 caccatgctt tttctctcct tggccaaaaa taagagcaca gccaagcctc aggatccatc
   255781 tttttaacaa gggaagagca gtattctaag ggtgcttgtg ggcctcctga tgcagttgaa
   255841 gcagaaggga cggcaggttt ggaattagaa gcgtaagtcc taatgcagct gaccacaggg
   255901 aagcgctggg cagacctgta agagagcgac gatacaggcc tcatccttta tggcttgtag
   255961 taaggcagcg tagttgaagt gggtgattcg gaagtaggaa acaaagaaga gttgatacag
   256021 tttctgagga ttccgagctc gtgtagacag tcgtcattat tcaattttag taatctattt
   256081 cagttaaata ctgaagatag tcatgatgga ccgacgacgg tattgttggc ggtcaccgcc
   256141 gccgcgcgca aaaacggggc acgacggcga caaggggact actaaataac tgtctccatg
   256201 atggtcactg cgtgcgtggt tgtctggcac aagacggaat gaagatatat atataattat
   256261 atatatacaa gtgatgaccc acgaaagact tcgcggggtt tcgggtaaat aattcaattg
   256321 caccaagtta attttgggaa ctctgttcag tttttgggtg gttttgttaa tgagaatgga
   256381 cgttccacca tccatctgac gacaaattaa acgagatcaa gagtgtcgat tccgaagcat
   256441 tagaaatttt tcagtaaggc gaggtggagc ttaaaacctt ggcgaaaatc aggaggctgg
   256501 ctttgtaggt gccttgtcct atcaatacat cagttcctta acggacttct gtgtaggaaa
   256561 tgaggagcgc ggccttaagg aagtgcctac atttgatctg accaatgatg acaacgattt
   256621 gaagagtatt tttgcgaatg aatttcggca cactgatcct tgtcaaaagc cttctgactg
   256681 gtatctgtga taacagtcct accatcccaa aaaagccgta cgcgagatat cttatttgtt
   256741 tgcatgaggg attgaaatct gtacacaatg tttataccaa gagggactat tacaatcaac
   256801 cttattcgtc cgcaatctaa cttcccgtta gtctttgctg ggtcagttaa gtgatcactc
   256861 accttcggcg ccaaaaagaa ttgcaatgtt ccctgttcaa actcaaactg caccagaaga
   256921 ggcacatcgt tactcatatg caaagtgact tctctggcaa gaggagcgga tttggcaaag
   256981 ttggtgaggt attttaaaga aaacgtgaga gaaacttgtc gttcaaggat gatagatact
   257041 ccaggatctt caacgtcctc cttcttggct cgcttattgg cctatgtctg cgtcagaaac
   257101 tgaaatgact accattcagt aagctcacct tgtccttctt gccagccgcc tttcgcttct
   257161 tgggctgctc ctctccttct tgctcttctt cgtcctgaag ttcgtcctct acacgatagg
   257221 ttagccacgt gtatatgtaa agaaaatttt aactgaccgc cctcaatatc cggcttcaca
   257281 tcaacgtcgg acctctggcc gtcctcgtca tcctcgtcag ggtcccgtct ggcttcccgt
   257341 tttgttttgg gcttgatatc caactttcca tcctcatcca tctcattctc atccttgact
   257401 ctgcttctgt cctgaccagc attttgacgg agaagaacag aacccttccc aacttcaccg
   257461 tctgcggaga aggtgacacc ctccttggag cattcgattt tgactgactc gccgaggaca
   257521 gcgagatcgc ggcagatgcg agcaaattca gcagaggaca tggaaacggt ggcatcgtat
   257581 tgagtgtcgg ggatgccaag gtgttcttga tcgatgtcca ttagcttcat ttcgtactcg
   257641 ccaacacgat cctcctctat gcgtcaggtc gttttagccc ttgatctgat ggaaacgtgg
   257701 aatggcttac taggagattc aaatataagg ttgagtgcat cggcatcgtc agaagcctta
   257761 agtgtgacaa catcagtatc tttagcacat ttgagaatct tggtcaaaga ggcaagctac
   257821 ggtctgcgtt aacgccattg agatatcaat tgagggatga atgagactta cattgacacc
   257881 gagtggcatg tttcggtcgc atctgtattc atcaaattcg gaagcttcaa gctttagggc
   257941 gaccaaagcg atatgggaat tgtccatggc ttgaagagac taacaagact ccgtcagact
   258001 cattacaatc aacgcgtcga tgggcgcgac gcgcgccctt gaaagatact cacgatacct
   258061 tcctcagtac aatcgagatt accatcagag acaagttcct tgatagctac agcatattgt
   258121 cagcatcacg ttctccgtag tgttgtggaa gctaacgacg cgaagatatc ttgcaatacc
   258181 gacgcgtagg ctgtgggcct tagtcttcaa ttgaagcgga aatgaggcct accatccaag
   258241 agtttcttga ggactacagc ttgttttacg cgtgcttcaa gcatcttgtg ttttgttgag
   258301 tgaatggaga aatcgatgaa gtgagttttt gacgataatg gaaagagttt agatggataa
   258361 ataaatgact gttgcctctg tctgcgaaat tgatttggag atcgcgtcgt gtacgcgtaa
   258421 cctaatttac gtaatagtaa ttaaaatgcc acatgtagta atgataaata aagcgtcgct
   258481 cgccgttgct cgtcgcgctt gcctgccgcc acgacgacta ccattcatta ttatacttga
   258541 ggtttgcttt cgtcactcaa tacagcgcta cggattaacc ttttgtccgt tgctgattat
   258601 tgttgaccgt cgatattatc tgcgggcaac tgtgtgcgtc acattaggtt taccattgaa
   258661 cagattgtac tgagaggttt gttcaatatg acattcaatg ctctgcctgt atgtgacctt
   258721 agcgaaatga actggctatc gctaacaaga cttagcttca cgaaacctta aacctctacg
   258781 tctctcctac cgcttacatt ttcgagcccg cttcctccag tgctggccat gcgggaatcg
   258841 acggcaccat atttgttgat gagaaaaatg taagggagag tatggttgtg gaccgtcaga
   258901 ccggccagat tagcttgagt agtgagtgac aatcggtggg atgcgtgggg cggaatgtcg
   258961 ctgatgcgat aggacataac agcggcttct catataccat ttggaaagga aaaggttatt
   259021 acatgctacg gtattattgg tattctcagc cttgctacta gtaagtttcg ctactcctca
   259081 gacaccactg tgcccgtgct gattttgtgc tttttaatag ccgatttcct tcttattgtc
   259141 acttctcgca ctccctcatg tcgccttctt tctcacccta tctacctcgc gaatgattat
   259201 cgacttcttc ctgtttcccc tctgtcgact tcttccgcca ttcttgaaca tcctgtagag
   259261 aaggaactca tctctcttgt cgagcagggt ctcaaatcca gcaaactctg gttctcgtat
   259321 ggttgggacc ttaccaattc tttgcagagg caacaagaga tcgatctgaa gctctcacag
   259381 tccggagaac aatggccagt ctggaaacgg gcagatgaac gattcttttg gaataggttt
   259441 ctcatggaca agatgattga cgtgaccgag tccggtgagg cagatctcag ccgatttatc
   259501 cttcccataa tgtacggctc tatcgagctt cggtcatcca ctcttaactc tcgggatctt
   259561 cttttcctac tcatctctcg gcgatctcgt taccgagccg gtaccagata cttcactcga
   259621 ggtatcaacc cctctggcca cgtcgccaat ttcaacgaga ctgagcaaat tgttctgtat
   259681 gaccctatcc cggaggatgg agaagcctac agaaggggaa aggtagaggg tagggaaaga
   259741 ctgagctttg tgcagacaag agggagcgtt ccgctctttt gggcagaggt caacaacttg
   259801 agatacaagc ctgatttgca aattatggat tacactgaga cggtgagtga atgacattga
   259861 aagacgtggc atgttctgac aaagaattag cctcaagccc tcaaagcgca tctcgacagt
   259921 atgattaaga cctatggcca tacatatctt gtgaaccttg taaaccaaaa gggacacgaa
   259981 caacctgtca aggaagcctt tgagcgctac atgtctcttg tcgcctcgtc cgacccgtcc
   260041 atccaggaga aagctcatta cctctacttt gactttcacc acgagtgcaa aggtctaagg
   260101 tttgaccgaa tttccctttt ggtcgagaag cttgcgaccg cacttgagga tatgggctgg
   260161 tatcattcgg tcaaccccga ctcttcaacc tatgctctct tccgaccaaa ctctgcagac
   260221 acccaggtac ttgctaagca aatgggtgtc gtcagaacca actgtatgga ttgtcttgac
   260281 aggaccaatg tcgcacaagc ggctctggct agatgggttt tgaaccggca gttaaggaag
   260341 gttgggatcc tgagcgtcaa ggaaggtgtg gaggaccatg aagagtttat gattatgttc
   260401 cggaatggta cgtgcttttc atttctacta gaaactaggc taacttgaga aaatagtgtg
   260461 ggccgatcat ggtgacaccg tctcccgtgc ttatgcagga accggtgctc ttaaatccga
   260521 ctttactcgt accggtaaac gatccaagga gggtctcctg gaagatggct acaaaagcgt
   260581 ggtgagatac attaggaata acttcttcga cggcgaccgt caggttagtt cccattgttg
   260641 tgagctgaga gagacatctg actgaagagc aggatggttt tgatattcta actggagcat
   260701 ggatagccaa aaggggcggc gttcctccgt tgactgatac aagacctctt atcatgcgct
   260761 cggtaagtcc atgcttttgc ctgaccaatg ctgacccaag aagatgccgt acatactagc
   260821 gtttgctctc actatgatta ccgcagctct cacactccca cgaacctcag agatgtccat
   260881 atattctttc ctcatcctgt ggttctttct tgcattctta tcaggaagct atatttgggg
   260941 caatgtaagt tatttttttc atacatttat ttggccgttg accgccattt atcactctta
   261001 gggtacatca tacgtctcct ggccgcgttt gaaccctcct ctagagattc tctcttactc
   261061 tggaccgggt caccgctctg cggtccgcgg tcgaggtatg tcattcgcag ccgtcgtgcc
   261121 gttattcgac cgtcgacgcc gaaatggtcc tggagctggc ctacttggtg ccaccggggg
   261181 catcggagga aggaacgatg gaaggcctgc aatgtataag atggaggagt cagagttggg
   261241 caggaggaag ggtgcgttga ttgattaagt atagtatgta gcgacatata gaggaatgaa
   261301 gatcaacgaa gaaagtacaa caacatagaa tagacccgga agcaatttca gtttgcggct
   261361 gtgcgcggtg cggggacttt attttgatag aataagtgga ggaatgtgtc gcccaatgag
   261421 gttttctccg cttttacgaa ggagggagga atagtgatga tggacgccgc aggtctcata
   261481 gtgggatgat gttgccaggg ttcttttaat gtttgacgtt tgaatgtaaa tgctgttttt
   261541 gtcattcacg tttgtcagag gcgatgaagc tggcatactc gcgtcttctt tgttgtttct
   261601 gcacgaaaac aagtatctgt tatcccatcg agagaataaa aggacggcgt acgacgcgac
   261661 attattaggc ggtgccttgg cttatgccat agatttttgt tagtcttgga atggttggtg
   261721 tgcctgcctt cttggtttct gttcttcctt accgctggtc atcacgagta tggtcggtgg
   261781 gaaacggttg acgcagttga acgctgtcag ttaacatacc acataattac atggacatgt
   261841 caaggatgcg agtttgtgcc ttgctatcta tagagccctt ttgtatatat agcgatttac
   261901 tgccggatac atgaaggctg cgagcgagtc gcgctgccta aaaactatag taacgtgaaa
   261961 acaaggcgcg tttgagttgg caacaaaacg ccgtatctag ggaaaatcaa cagatttcgg
   262021 aaggacacgc actcaggggt tcaggatccc ggacgtggac cctgggaaat aaaggaaacg
   262081 tgtcggcggg tgaatcggtt ttactagtca acaggtagca gaagaggaga gaaaaagaga
   262141 aagggggctt tctttaggta aagaagtctt ggcttggaag ggaagagcga tctgaggcaa
   262201 aggaaggagg gaaaagggag aggaagaatg agacgacagc tcggcacggt atgatccgct
   262261 cccattagtg tactgtattt gccgctggtt cagagacatt ttgcgcaacc gagatgcatg
   262321 ggcagtataa tcacgaacca tcgagcacag cattgcggaa atcaggattt gaatgggctg
   262381 ggaatgatac taatcctcac ggtgaagtaa acgaatttaa taatatcgta cgcatcactg
   262441 gctgctgttt gatcatcgct gttcgcgtcc ccctttttct ttcatttcat ttcttctttc
   262501 acatcatcat caccacaaca agagcatagg ctcagatacc tcaacaagca gcgacatata
   262561 tgcgcatgtc gccttccgtt ccccctcttt ccgacctctt tcgcaccgcc tcttttgcct
   262621 ttgcctttac tgtcaacctc tgttaagacg cccaacactc gacgccgtct gtcaaaggtt
   262681 acaaccaggc agacagagat caattcaact tacagcaatt aattcagcca cagaagcgtt
   262741 cagcattaca tacctggcca ttaatcatgc tcgcacctct cgcattgctc cctttgctct
   262801 ccctgatgct tcctcaggcg tctgcggaca ctcgaccagg gagccttccc cataaccttc
   262861 atcatcccta tcgccgttcc ctcaagcgat ccattacctc ggacgcgtcc tctatcaatg
   262921 gcgaatcgtt cgactttgtg attgctggtg gtggtgttgc tggtttgact ctcgcagcaa
   262981 gattgagtga atggagtaat gtgaccgtct tatgtatcga agccggtgga gacggctcta
   263041 actacgagga tcaaattgat atccctggta agctttgttg gctgcatttc ttagccacat
   263101 cgccatgcta atatatgatg gcttaggcta ctcctatctc aactccctca cgggtactgc
   263161 gtatgactgg gcatacaaca ctgttccaca gacagatgct ctcgacctca cgaagtattg
   263221 gcccagagga aaaggcttgg gtggttcagg tgccatcaac ggtttatttt ggggaagagc
   263281 gagttccatc gagtatgatg cttgggctag taagtagcta cgtagtcatt cagcttgaca
   263341 cagaaactga tggaagtagc tttaaatcct aatggcaatg agacatggaa ttgggaagaa
   263401 gtaaacaagt acatcaagaa ggtatgtagc ccctggtcag gtttctagct atctttaatg
   263461 cctgactcac atacattcag tccgagaatc tcaccgctcc tcccactgat atccaggaaa
   263521 agtttggtat cgtcgttaac gcatctgccc acggcgacga tggacccatt caaatcggtt
   263581 tttccgaata tattttcgac gaggtggcta agtggattcc tacctgggaa actcttgggc
   263641 tctctgggaa agatctcgca ggcggctcaa cacacggtgc catgatttcc acttccacca
   263701 tcaacatgcg gaaccagacg cgatccgatt ccaaggccgg ctacatcgac cctcttcctc
   263761 caaggtccaa ccttgtgatt ttgactgaac aacaggtcac aggtgtcata ttcaatggaa
   263821 gcacagacgc gagtggaaac atcgtcgcca gtggtgttac tttccaagcg aacagcaact
   263881 cggccaatta ttccgttcag gccaataagg aagtactttt ggcgtatgtt aattcgctac
   263941 agtatgaaca ccgaagctga ctcaaactca gcggtggaac tgttggttcc cctcagattc
   264001 ttcagctctc aggtattggg cccaaggacc tactgtccag ccttggcatc gatactaaaa
   264061 ttgacttgcc cgttggatat aaccttcagg atcacgtttc gtactctatg tattggtcca
   264121 ctccgtaagt ttcatgttat attgctttct gccgtccttt gtactgtctt ggctgcgatt
   264181 ggtccagtaa tacaagggga ggctgctcag atttatctcg agggccgttg ctgacgattc
   264241 cccagtcaag gtacccttac atggagcaat ctgagtgcat cctccacgct tcagagcgag
   264301 cagttggctc aatacaagtc aaatttcacc ggcatgtgga cttacgtcaa tgaagccgtt
   264361 ggatgtgagt aaaaaaattc cgttttattt cattgataac tgacattcat ttagacccct
   264421 ctatgtccga tatcatgcag tcaagctcgt cagcatctac ttacgcctcg acagtatcct
   264481 ctgctattga cggcatggtc accaacgtca cttcctggct cgatcttccg gatactgttg
   264541 ctaccggtct tacgtcacag taccagatcc agcaacagtg gcttaccgag gatattgggc
   264601 agctcgaaat tgttcttacc ctgcttggta atggtggcaa cgaattgggt atccaagtcg
   264661 ctttgcaaca tcctttctct cgaggtacca ttttcatcaa ctctaccgac cctttcaccc
   264721 agccgaacat caatccggac tactttggcg ttggttacga cattgatatt atggcctacg
   264781 gctctgaatt cgccaggcgt ttggctgctg cgagtccttt gtccgacgtc atgatcaccg
   264841 agaccgctcc cggatccagc gtcaccggtg actctcttgc tacctacacg aaacagaatt
   264901 gtggaactga gtaccacccc ctcggtactt gctccatgct tcccaagaac agcggtggtg
   264961 tcgtcgacac cactcttact gtctatggta ccagtaactt gcgagtcatt gacacttcta
   265021 ttgctccctt gcagctctcc gcacacttga tggccactac gtatggtatt gccgaaaaag
   265081 gtgctgacat catcaagaag aagtattggt atgttgaccc tgtcaccagc tcgtccgcga
   265141 ctgtagcagc tgccaccacc tcgaccgaag ccacgacggc tgctgtaggc gacgccaccg
   265201 acactgctgt caccaacatt aatcagaaca atgctgagtc tggtagtacc ttgagctcag
   265261 gtgctaaaat cggtattgga gttggtgttg gtgttggcgc cgctgctgtt ctggcaggtc
   265321 tgttgttatt cttcgtgatg aggaagagga accagaagga ggacgaaaag ggatggtacg
   265381 gtgacagaca agagggatgg aacccggatg ctggagatgg tcagtagact ttcacgaaat
   265441 tgtcacgccg atatactgat gcttgttaca gcttacaagg agcctgggtc tgcctatcct
   265501 atggctgatt tcgattctca caattcctat gcttctccca cacctgcttt cattggaaac
   265561 cactctcgga accaatccat aaatactatc gccacggcgg atcttgcttc tcgcacgccc
   265621 atgcgcaact cttcctcctt ctcctacgct gccggtggtc ctggtgtcgg gcggactgca
   265681 agcccgtaca gggatgatat gagcgatgac ggaaatggtc aaggtcatgt gtatcaggct
   265741 cccgaagcgc ccgctggtca acaagccaca aggggcgaac aaaggtatca gcctgttaac
   265801 attagataaa tacagatcaa ataattcacc ttttcccgcc cccctccagc tatgaactct
   265861 caaaacatcc ttcacgacta ccaacgaaca ttatggtttg aaggacaata cttgtcggac
   265921 gttttagctt cttttttcct ttccgttctc atatcttctc ggttctctgt gcctcttatc
   265981 atacattcta tcatacagta acactagtac ctgaccttta gacaatcgtt ttacgccgct
   266041 atcacgcatc atgaccgtac aaaatttccg aacactgtgt ataaggacga ttctttattc
   266101 gtgtctagat acagtctcaa atgccccctc actctttctc ttctgcattt tagttgattc
   266161 cttcatatgt cgtaattaat tgattatgtg aacaataatg caacccctgg tgccgacgaa
   266221 tggtgtacag acagttacaa tcactgcctg aatactttgt gaccaaccaa acgactaaca
   266281 agaggaatat tcttcattgg cgttgttcaa gcaattgatt tcctctaaaa tatcatccct
   266341 tgtagatttg ttgtatgatg ccgcttataa tgggcatgca acaaccaaca tacagtctgg
   266401 ctggcaacct atccgccact ctgcaaaatt atgatgtgtg gtccatagac aagtagtgta
   266461 tatgaaagat gctaaagcag cgacactaaa tgagacgaca cacagaccac aaagcaaaaa
   266521 aggctgtgga aaactgagat gtccttttaa caaaggtggt ttaagctttc gcgactgatt
   266581 caggcgttgc ggcattaaaa atggtaggga ttggatgcac gtaaaatatc gtaacagaaa
   266641 tggttccctg ttgacgcaga atctactcag cgcgagaaat ctgagatgtc aaaaaggtca
   266701 ccaaaactaa gtggtggaag aatagagaca ctacaaatac tggtactgca cactacactt
   266761 catcttcgtt catcagtaca agacaaaaag aacattctcg tgattggcga tgatcacatt
   266821 gtgaaaatga gataacaacc atgagatcag aaatattaat ataatacatt ggcgggcagg
   266881 gtaacttaag gcgcatcccc tggcttccag gttgggcgac actgcgtact tggctaagcg
   266941 aaggcgacgg atctctttcc agacggcgtt gttcagtggg atccactctt cccgaatgtc
   267001 atctgtgagt ggctgttgca ggcggcgtag ctcttgggcg agcatatgcg gaagagaagg
   267061 agagcttgtt gggatgggag aatttggggt ttgaagatcg aaattggggt tagaagatct
   267121 tcgtgatttc ttcgttaact ttgtcttgca agacgattcg gcgcttcgtc gcgctgccga
   267181 ccgttgtacc cagcgatttg aacccatttt cccttatgtc tcttaggctc ttcattgaac
   267241 ggttgtcttc gttgagttta agcgcatggc tcttggagga ttgagaggtc cttcgagcgc
   267301 tgtgtcgtcg ggcgaaagta tgtagacgtc gtcaagatat gtggttattt gacggtggga
   267361 tccgaggtgc acggaaaatt cggttatcgt ggggcgtagg gctaaggaga agaagacaag
   267421 gccgaagggg tcccctcgac gaaccctctt ggaggaggca agtacatgcc cctcctcaca
   267481 gaccagtgtt gacgagttgc tgtaggacaa tctacattct tgagagaatt tgggggcgtg
   267541 ggtagctatt gcgcttgtca tttctccccg gtcgatgcag ttgaaggcat tagatgtgtc
   267601 taaagaggaa agatgggtgt ggtggccgtc caatgcgccc tagattgctc gctcaactgc
   267661 cctgacgatt ggctcgacac cgtctggtga catcgctccc atctggaagg gcaggagaaa
   267721 tcccggtttg aaggtggctt tgagaatgac ctttgcgcag actcggtaga tgaggtcagc
   267781 aactgcgatg gtaggacata cagagccgtc cattttgtgg agaaggacga gctttaaggc
   267841 taggaacgtt ttgttgtctg gaagagcgtt gttggcaatg gtccgactca tttcgttgag
   267901 agtttgcaga atttgtcact cttgcaagtc actttcatga ggtgggggct ccagccggat
   267961 ataccaggcg cgtgtctggg ttcagtttgc taactatttc cttgagtaag tgggggtgag
   268021 agcagggatt gcctggcgac caagggggtt acgggggtga aagagaatac atgtaaaggt
   268081 tgctattgaa aagattggtg gttcctgtgg gtgcttgttg cgaagttgat tgcgaacttc
   268141 gggggcggtc tcggctacgt tcccgtctcc tgtcaatatc ctggctgctg ccccaagtct
   268201 ccccttctca atcttcctaa tggaacttgt cctccctgaa cattccgcta gcccccctgc
   268261 ttggccatgt cggcgcctcc ggccagtcat catgcgataa ataggcccga aggcgagaag
   268321 ctgttagttg tggatggctg aatgcgggga cgattcctcc cttgggaatt tggagaagga
   268381 gggcgaggtt gactgccgag aagccagagt gaattttgta gaggacttgc tcgatcacag
   268441 taataaaggc tcgctgtgta ctgggcaagg gcttgaagcg ggcggggagg tgggagaggt
   268501 ataggaagcg gaagaaccac tcttcacgtg gcgagaggtc ggtcggtacc tctgcgatgt
   268561 tggatagatc tgttctcgct tgcatgccta ggggtaatct tgtaggggtt gcgcctacgt
   268621 ctcccacgac tctatgctag ccgcctagtc cctcctgcta gggcatcgcg atccaagtcg
   268681 ccttgcgtcc ccactctctg cactcctctc tgtcccttgc cacctgtcct cggggtttat
   268741 agtgttcggg gtgtttgccg cgctttgaga cgtctaataa gggtggctgg aggattcaaa
   268801 ggagatctga aaattgttga gaggacactg cagttccatt gctctatgta aagatgtttt
   268861 gatactgtac ctacggaaaa gaatgtaccc ccccatttga tcccgttttc tacctataca
   268921 aacaacatcg attgcatgta tcattttaca gtgcatgttt tcgggcaaac caagtacata
   268981 aacagattct atgcataatt tacaataatt taatactcgg tagacttccc tttcgccttc
   269041 caaactgcta cacgcctctg ttccatctca tctatgagat ccctcacctg ctccaggtcg
   269101 atctcatccc atgccttctg tatttgtttc cagagctcat caagcgacgt ggcgaccctg
   269161 ggaaaagccg cgacctttga ctttaggaga tacatacgtt ctctatggga tttaggtcag
   269221 gagaagaggg gggatggcca agggtttaga ttcccatttc agctctcgct ggtttcgcaa
   269281 cggcagttcg atgtgaggga gctccgccct ccaacacaag gatgttttag aagccggagg
   269341 actttagcca cctaaggata ccaccctcgt cccccaagac gccttcgatc accatctcgg
   269401 ggtacctgag tccgttgagg gactcggcct tggtcctgat accatttttg accgtcgatg
   269461 gagccagagg aaggcgtaaa agagggaatt tttggtagta gctaatcgct ccccaaacca
   269521 tcaggctctg tcgaccagaa tggaaggttg gtaggatgcg ttgtggagcg tacgcttcgc
   269581 ctacgcatcg ggtagccctt gaccacctcg taattccttc ccccagctcc aacacacatt
   269641 catcatcagt gaaaacaacg tcccgccagc ccctcttcat gttgttcctg gtccaatctt
   269701 ccctcttagc tatagttttg ggcgaaagat aaggcttacg cctcataatt ctgcggtaaa
   269761 acccatgctc gtgaacgatc ttgacgatag tcgtcacgct gacattgtat ctcttcgcgt
   269821 ggacgctcca aggttcacgg ggattgcgaa caaagtcctt cacacgattc cttacttgcc
   269881 cctggcccaa cacctttggc cttccaggga ttgagagcag ataagtgtgt ccacggggcg
   269941 catactctcg acaccaacgc ttgatttgta cacttgggac gcttataatg ttttgcaaga
   270001 ctgctgaatg atttccgact ttgtgggctc cctcgatagt tattagtagt gggggtgacc
   270061 tggggtgcca ttatggaaat aaatcaggta gttataagta catgcatgaa caactcaaaa
   270121 tcataattat ggggtatagt caaaaacgcg tcgcgggatc aaatacacat tcttttccgt
   270181 aggtacccgt accaagtcgc gtcgaggaag tgcatgccta caaccgatca ccgcttgccc
   270241 cttcttcagc taaattcaat caaacggcac atgtatttta agtatgcatg aatggcacca
   270301 ttagaaggga ggacctggaa gccactcagc ggcataagtg tcggagctgc aggacgagat
   270361 ttgaccgagt agtatggaat taaaagagac ataaaagggg gtgtttcgcg aatattaact
   270421 gtacagaaac ggcagaaacg cgtgaaaaag tggtaaaaag tgcatgcctg gagcgttttt
   270481 gcgtcttcag ccactttcaa ctaagtgacc cagatgtgta aagaatgcat acacgatact
   270541 gttggatgca agagcctgag ctcagttcaa tggtacaagt ttgaaagccg tacgatgagt
   270601 tttaaccgag taataaatat ggaaatgaaa aacgcgagcc ctgcagggct atgctgcggc
   270661 aggcgattgc cttcttattt tattaaaaca cacaaattat ccgaagagct tacaaattat
   270721 ccggaggcct tacgtcttta ctttatttat accatgtttt tggtttttgg ttcctgattt
   270781 tataactatg cacccgcggc cggataacac gacaagtgca gcagactgct tggcacttaa
   270841 aatttacggc ttttcttttg tttttctttt tgtttgtacg ataccactag aatacccagg
   270901 ttgaagattg cgggcatttc ctgtcctcaa gctgtgtgcc atatactacc catatacact
   270961 gtacatctgc cacctaccac atactatgtg ctatgtgccg tgcgcactgc ataggagcag
   271021 cgactatatc cagttctcaa ggggctttat tagaagtatg agtgaattcg ctcagataaa
   271081 taataaatta ctgctgctga catggtaaat tgctgatcac ctgtcaatat ccaaagtctt
   271141 acgaactaca tattaattat gtatattaaa gtctatgatc tgcggaaaag atacggcgat
   271201 aactctcttt ttttggttcc ttgttcctct ccttcggtga ttggtacccg tctcactttt
   271261 aattgcgaga gtttcagctc ggcattttgt atgtttccga gcttgcagcc gcccaaagat
   271321 cagggtgcat gtgatatcag atacaggggt actatacggg gaatcgacta ccgattacca
   271381 tgtactatat gatctaatta ctgacatccg ttttgccttg ttctttgttt cctgtaatgt
   271441 ttcggcagaa tgaagaaaaa tcctgtactc cgtagtatta ctcccttgga ttcgatgact
   271501 gatggaaggt tacaagacaa tctgatgatg atcggtaatc ataatagcat tggggtttca
   271561 ggtgagaata atggtaccgc ctaggcaagt atcgcttcca tgccgaacat ttcggggtac
   271621 aagaggaaac agcaatgaag tgagttaaat ctcgaccgca aataccactg cggtatcatc
   271681 ttgtcataaa aaaaaatgga aagcaatggc atcttgttgg gcaaaacttc atcatgcatt
   271741 gcagataaca tacataaagt aaatgacccc ctgacctgag aatgacggat tataataaat
   271801 aatctatcgc ctccaccacg aacccattcc aatcctgtac ctcttaaacg ccataagcaa
   271861 taagcaaaag ctgtggcttg taatgtcaga agtccttaaa agccggaaag cagctgcata
   271921 taagaaatga aaaaggaaat aaacagtgga caatagacga ttgatgatcg gcctcgcata
   271981 ggagatagtc atttaaatga aatatgatac ccgtaacagg taactgagac ataaattttg
   272041 agactgatga gctgcgacga gaggaatgga acaagggatt gatttgaatg aacaatggtg
   272101 agaaaaggag ataagcaaag ggcaagctac catttatcat tagtcattca ccggctagat
   272161 ccttcgtctt cggactcgtt actcctaatt taggaaagaa aaaaaaacat tgcagtaaat
   272221 aaatgaagaa gaacgaaaaa acaggatgct tggacaagga atcaaagagt tgaccgaacg
   272281 aaccgtctct cttgcgttct ctaagcagcg cgggcaggcc gaacaataaa tgaccttagg
   272341 aacgaacgat cgccttgaca catgtcgtcc ctggtccctg gttatacttt ttagccgtcc
   272401 gtgcttcagg ctctgattaa atctcgaatg aaggccaagg aaacacttga caccgatgta
   272461 cctgaagatc aaagacaatt tctagggatg aaactcgtga agaacgcgta ggtagtgtct
   272521 tttattcatt tgtattggcc ttctggcaat aaatgatcag gtcgaccgct atcgcaacga
   272581 gaaaggaagc gagaagccag gtaaagactg gagggaatta agacatccga tttcctgatg
   272641 tccgtcaatc gtttgtcgga gcatgaggag tgagacatgt tgtcttcacc gaaagaacaa
   272701 gaaaaaagtc ctatccgata tgtgcacaag tggaaggtct aaatctgaac ccgagtcgcc
   272761 cccattgctg ttgaaagcta taaaagagtg cgcttgtggg ctattcttct ttttttctca
   272821 acgacattaa cagattcatt ttttcctttg tagatactca ctttctttcc gtagatagtg
   272881 tcatagttga gcttttaccc actacactca ttcttttcaa cctcactcct tttcttcgac
   272941 cactatcctt tggcccatat cttcacgatg tactcttccg ccatcatgac tttcctgttc
   273001 ggcgctctcc tctctctccc aggcatctac gccaactcac cttggcttgg ttgcgtcctt
   273061 acaaccgcag cgaccgctgt tggcagtgtg agctcccgac agagttcaag tagcgtgtgc
   273121 tcagtgagtc atttccgcgc atgcatgacc ccctagaacg atgcgctgac attggcatta
   273181 gacatactgt gccggacgaa gctaccctta cgcatattat gtcggcggca tccttcttgg
   273241 taacaactgc tactgtggta gtgaagccaa catcattagc cctgtcaact atgccgcgcc
   273301 cagcacttcc ctcaccacta gttgtcttcc tatccttcaa gctggtgtaa gttaatcagc
   273361 tcaaaggaaa ggtatatgac ttatataaac ttcgataggt ctttgacact tcttccacct
   273421 tctcctacac cggctgctat gccccatctg gtctgctttc cggcttgatc aacactgtta
   273481 ccggtgttct cggcaccact gtctcgtctc cccgagcttg ttttcagatg tgtgccgata
   273541 ccccggcggc ttactatacc ccctatctct tgggactttc aacgctcact cctcgttacg
   273601 gatgtgtttg cggtgacgag actgtcgtct ctggtgttcc taccctctgt ggtctcggcc
   273661 agttctatgc ttatagccac tctgctgcgg cggctgctag ttcccttccc aggaggaagc
   273721 gagctcatga gagaatcctt gctggaaaga ggtctgaggt gattaaggag aggaattggg
   273781 actgccctac cggtatgcaa gcctgtaaca ttgacggggt ggctaactct tgggaagtga
   273841 gcattcgggc tttttgaaga caattgggag gaattaagag ctgacgtata cattagtgca
   273901 ttgaccctac tacggaactt gaatcatgcg gcggctgtcg ttacggtgat tacagtgcca
   273961 gtgctaattc ctccgagccc acgggtgttg agtgagtttt ggagttgctt gctttattgt
   274021 agacagtggg ctgacagctt ttccctttaa cagctgcact gcccttcccg gtgtactacg
   274081 aggttccgta acttgttctg acagcaaatg tgaggccttc gcgtgtaagc gcggatggac
   274141 tcttcgtgac ggagaatgcg tcaaaacctt tacgttccag ttgtaagagt atatctgcga
   274201 aaaaggaaga gaaattgtgt caataattta taatttgcgg gtcttaccgt cgctttctat
   274261 atcgtataat catcgcaggc atttttgggt tttgaggacg gaccgtatat ccctaatttt
   274321 tcttcctttt gtaccagtac ttatgatacc cataccgcat gtcggataga caagactcta
   274381 atttaagatc atgtatctga aagcttctat tgcagggtta cgaggtcaag gaagaataat
   274441 ggggcatata gaagtagttc gttgttatat gttatatgtt atatagtgtg gagggtgttg
   274501 tacaagtaac aacgaacgac ggaagagtac gtaacttgtc cttcagatgt cgatccgaac
   274561 ggacctcgaa agtgagatgc gcgtcgaagg cgggtctggt ctgctttacc tttggagtct
   274621 caagcttacg taaacataag gggctaacga gtctgtttta acgagtactc tgtacagcga
   274681 acgatttttg tgtgtcctca aaggtggcgg gggcgctcct gcagtataaa ggtgcactac
   274741 tgtcagataa atgcctctgt acgacaaata aaagtctgtt ctccatctta ctcgttatat
   274801 aaaggatatt agagatgtgc ttgtacgtat ttcttcaccc tacatgcagc cgacgggcat
   274861 agccaccggt ttgccggcgg tgtacgacat tttttttttg tttttttgtg ctgcgcgttt
   274921 tatttgttga cttggggctg gaattggatc atcatagccc acgaatgccg ccccggcgat
   274981 cgcagtagct gtgatgagag gagtcacggc gacgagctgg aaaataaaaa agacatcatc
   275041 atgcacaggg aaaaaaggac actttggata cataatcgtg gtcaaaagtt gcatgcatat
   275101 gccataatag tacgttgagt aatggtgaag caccagaaat tgaaagtttc ggggcaaaag
   275161 aagtgggcgc agcagcacat acgtttgctc cgatgcagat gaagagttaa catttattat
   275221 attgttatga cagacggggg ccgtttaccc ttctagggcg acgatgtcgt ttatttactt
   275281 ccagtaccaa aactgctttt caccctttcg tcatttgtcg aagtcttttc cttttccctt
   275341 tctatcgcta tatattgcgc aaagtgcttg gtggaaacca tcttaacatt atctcggcat
   275401 atacaccttc aacatccata tttggtcact gctacattat tagcttttcc ggttctcgga
   275461 ctgaaatccc ttttagtaca cctcattaaa cactcggtag cctcagtaat gtcaatcatc
   275521 acgaccgctt tcgcgctctc acttctcgcc accactgctt tcgctgttcc tccagagact
   275581 ccgcggattg agcttcaggc ggagagaggt ttgggtgatc aatcctatgc tccttggcaa
   275641 gtcgattgcc cctccaacgt tacttggatt agaaatgcca ctgtaagctg cagtgtcgtg
   275701 gagcattgct tatgaacatt cctgctagac tggtttaggt accggcgaac gagcctatat
   275761 tgaggctcgt gaaaaacttg tccaacctgc gatcgagcag atgatggctg ctcgagggct
   275821 cgaaactcct ccccggacac ctgtcatcgg tgtcgccttg gccggtggtg gttaccgtgc
   275881 aatgctgtga gtggattaat gctgcaaagg atatgcccat tatttatcgt tgccacagta
   275941 cagggttggg tggtatcatg ggcatgatga atgagagtac ggaagcgtcc caaagcgaga
   276001 ctggtggttg gcttgacggc gtaagctact ggtctggtct gagcggtgga agttgggcaa
   276061 ctgggtcttt catgtcgaat gggggtcagt tgcccacaac tcttcttgaa aacgtgggtt
   276121 atggcatgat gtatttgttc atctactgac ttgcgtgata gctctggaac atcgattcca
   276181 atctcgtctt tccagatgac ggcaaacttt cattctacac taatctttac actgagacca
   276241 acgccaaatc agacctcggt ttcccagttc aaattactga tatttggggt cttgccattg
   276301 gctcccacgt tttacccgag ccttaccagc tctccaacac tcctaatctc actttttcta
   276361 gccttccctc tgtcgtcgct gccttgggca acgcaagctt gcccatgccc atcattgtcg
   276421 cagctgagta agttaatacg ttacctttcg ttttcttttg ctgacagccg gaaaagacga
   276481 gaggctggag agcttgtcat tgccgaaaat gcaactgtct gggagtttac tccatacgag
   276541 tttggttctt gggcttttgg tagccaatac aagagccctg gtgctttcac ccctattgaa
   276601 tatctcggta cttcagtgga cgatggctca cctaacggta cctgttggaa gggctttgac
   276661 cagttgtcgt gagttgattc tcagtgtatt cgagagaaag attccagctg agctcatgtt
   276721 atcttccagc tttgtcatgg gaacttctgc gactcttttc aatggtgcct ttctcgaact
   276781 taacggcaca gacagcggtc ttcttaccaa tttaatcact gccttccttg cggatctggg
   276841 agaggaccaa gctgatattt cccgtatccc caatagtttc tccaattaca actcggggga
   276901 gaaccccatc tacaacctca cttacatcac cctcgtcgat gccggagaaa ccaaccagaa
   276961 catacccctc gaacctttgc tcgttcccac ccgtgatgtt gacgcgattg tggcatttga
   277021 ctcttcctac gattctgact atatttggcc aaacggcact gctttgagga ctacctacga
   277081 gcgagccaag attttagctg agcacgagaa cacaagggtg ttaatgcccg aggtccctag
   277141 catgaacggc tttgtcaatg gtggttacaa ctcaaggcct actttctttg gctgtaacga
   277201 taccaccact cctgtgatca tctacatacc ttcttaccca tggagctttg ctgccaatac
   277261 ttctactgta agccccacat accgcaggac caaaattttc actgattatc gaaacagtac
   277321 caactttcgt acgagaataa tgaagccaac gaaatgttgc tcaacggtat gcgctctctc
   277381 actctcaacc actctgtccc cacctggccc acttgctttg cttgtgctct taccgaccgc
   277441 tccttcatgt acacctccga gaaccgatcc accacctgtc aagagtgttt tgacacttgg
   277501 tgttgggctg gtgacgacaa caccaccgag cctgcgaatt atgagcctgt aatcaacagt
   277561 gttccgccct ggttgatcgc caacaacctg agtatcggca tggccgatgc tcctgggagc
   277621 aacgaatcca ctgctggcac agcgtccagt ggtgcagcga agatgggtgt gggcatgggt
   277681 atggtcgctc tcactgctgg tttgggcttg atgctttaga tcgaataaga gtatcctgta
   277741 attctcgcga gagcatttat ttaaattttt cctctgcttc attttccata tttacttcac
   277801 aagtaaacaa tctacaaatc ggatcttaaa ttataccatt acttcattgt cccataaaag
   277861 ctctggctac tgctgcatgc tccacagcat tgagtcacgt atacatgcgt aataatcatc
   277921 taatgtataa tctgttcata tataatgaga aatgcgcaaa tgggacaaat actcaaaaaa
   277981 tagctgaaca acatttttcg ctacatcggg cgcaaacgtt acagcatttg cacgaaaggg
   278041 tgacgctcaa agccgacgtg gttgaacgtt aaattctcgc cttcttccta gccgccggtt
   278101 gaacaatatt gccgctagcg ggcctaaaat tgctacttga tggcagcctg cctccggcca
   278161 tggattgagg tagactatga aaccatgcat cagtgtccgg agtacatcat gacacagaga
   278221 catgaaaagg acatacgatc ccatcttagc atcaccgtta tcctcgtgcg tcacccttct
   278281 tgtgggatat gtgatcgagc tgccttcgaa cacactccta aattaacgaa tttcagtatc
   278341 tcaccttcga gccatagctt aatcgcctta cttcgtatcg actccccctt cttcctggaa
   278401 ccaaggatgc ctcaacgcat cccttgccgt tatcctacga gctgggtccc attcgaacat
   278461 cttgacgaga atatcgtacc cctcagacga gtttgagcgg gcatgatacc atggtgcaag
   278521 agggttggag tggggataag gacccgtggc ttgataagta cggtattcag gcatgtgaac
   278581 tatacctggc cattgttccg ctgaatagta tcaactatat tagctttaaa aatgaggata
   278641 aacgcaaaat gtggacaaat tacgcttgac aggaccaagt acttcacaga ttttgcccat
   278701 ctggtcgcgc tggaatggta aagacttctt gccgtccatt ttagcctcgt cgcctttgaa
   278761 gatagggcga agagagagca gctccgcgta gatacaacct accgcccata tatctgattc
   278821 aatccaggaa aaagaaaacc agaaaaaaaa tgagaggtca ttcaaacatt gcgaacgcag
   278881 ctgaaactga acccaccgac agcggcagtg tagtgcttgg ctcccaatat taactctggc
   278941 gctctgtacc agatagtaac cacaacctta tcaccaccat aaagaccttg ttgcgctaat
   279001 ggtttatgcc acagtcgtgc caacccgaga tcacctattt taacgacgcc ttgactggta
   279061 accaaaatgt tagccggctt gagatcacgg tgcaggacaa aattagagtg aagaaaatgc
   279121 actccgcaga gaagctggtg aagaaggcgg cgaagtgtgg aaggtggaat agaagctcga
   279181 gcagtttgag aatggtagtg aatgatttgc taagcattat aagcgaaggc ccgacttgaa
   279241 aggtgaagtg tattgacgca ctaggaaatc atgttcagca tactcaaaaa ccatataaat
   279301 ggacttgtct tctaatatga cctcgcgcag cgacaccaga ttgcgatggt ggagttcacg
   279361 attgagctga agaagtaagc ggtggagcgt gatcacttga atcaacacac cataatttct
   279421 ctcgctccac tttgactgat accggcgtag gtcaacacat cgccttcctt atcaggcttg
   279481 aacttcttta tcgcgaaaac gtcacccctt ttggcgggac ggtcgcctgg gcgcatacac
   279541 atttcaggat tattgagagg gtcgctgtct tcggtgaagc taggcgatgg taatttgtct
   279601 ttaggtaatg ataaggctgc tcgagtcgaa ctgggcaagg cgcttttggc agaggctgtt
   279661 ttgggtggtg ggaggagcac agctttgtag actcttccat aagttcctac acacatataa
   279721 gtaaccgatt atcctgcata ggaaatataa ctaaccggaa gatatgaatc ccagaatctt
   279781 atatgtcttc aagacgctga gacagtagtt aaccgggcat tttggagctc atggaagata
   279841 cctaccctct tctttcctta tcccttcttg cacgataaag gtgcattggg tccattatag
   279901 tacctccgcc tggaattgtt gccattttgt tgtatttcag ctttgttacc cacgcacttc
   279961 cattcgaagt tcattatcat taatacgtag gtgggcttca atgaatgagg acagtaggta
   280021 gaatcagtca cgtgatgtta ttttgcaagc tcaggtgtac ggaccaaact aaacaaacaa
   280081 cacaaacaaa acaaaacaaa actgctgcat ctcactgtaa catttcaatt cttcatcata
   280141 cctttctttg tttgaacaac tcatacacaa caagccattt aaagtagaga ctacaaggat
   280201 gtctttagca gctcgctcac cccgatctcg taaatccctc tcggcgttcg atacaaacat
   280261 cagcgccaac ttcacacttc cggttacaaa caagggaaag aagagggttg tcgcaagcat
   280321 ggatggggga gccctcagag acatggatgc tgcatctatc agggcggata gtttcaatat
   280381 gaaaagcaat ccaaggcgtg acgtagtaag tttgattagt acactaatca atcgtcgagt
   280441 cgacattaac gttagatgtt tgttttaagc aacccagaaa atctatcctt aaatcttttt
   280501 cggctccata tattacccat caagcggagg atgagacagc ggattacagc gcttcccatc
   280561 aatatgctca tacagtagct ttcgggcccc tgagcagcaa tgttcgctcc gacccgacct
   280621 ctaggaattc gagacaaagt ctgggaggaa ggcgggtcag tttcgctccc aatgcacatg
   280681 ttcggtaagt cacaactctg tgaatatgcg gtggatccta tgcactaagt atctatcaac
   280741 ttgcagtatg ttcgaacgcc aagttactaa aaatccccgg gcctcgttcg gtttctcctt
   280801 tacagaaact tcaacccctt ctctgaagtc gaatcactcc cgtcgctcat caatccttaa
   280861 tatcggctca gtatcaaaac ccaacatatt tgctccgagc atcttccaag gagaagggga
   280921 agctcagggc gaagagtcga tggagattga agatgataag gagttgagtg ggttcgacac
   280981 gagcgagcga gacgaagcac agcaagagca tggccacgat ggaggtgcag aaggcgagga
   281041 gtccatggaa atggaggagg aggacatgga cattacgcaa catatctatg gtggaatcgt
   281101 ccgacggtca tcaattgctc ctaccgtcgc cgcaccttct gagctagatg ccggcgccga
   281161 caccgaagag gagtccgaca acggccaaga acattcccat ctcgaggacg aggaaaagac
   281221 catggacttt accattgccg tagggggtct cctacctcat gaagctccag ctacagcaac
   281281 tcgaaaccga aactctatcg gttattcgtt ccccaaccct gatggtccag ctctcccaaa
   281341 tctaatgcct ggtcaagctg aagaccatga ggttgaatat cccatggatg agacggaggc
   281401 atatggagcc attattgggc aggacatctc gttcagttct ggaagcgagg ataccatggg
   281461 ctcgaggaac ggtgacaaga ctatgacttt cacatacaat catcacattg cccttcctac
   281521 gcagatcgat ggagacgaca gtatggatat gattacctca gcaggcggaa taatcagttt
   281581 acctcctgtc tcaccaagac ttagtgtccc caataacacg cggcctatca atggcactcc
   281641 ttcttttgcc cgcccaaccg tttcttccgc acagaagact acagcgacca agcgtaacgt
   281701 cttcgctcct tcaccaagtc cacttaagtc aaccacccct aggaaaagcg gtattcagac
   281761 tgctgctgag gtggcaaagc ggttgagctt tggctctgtc acctcaagtg gaggtaagaa
   281821 gcgtgttagg gaggatagtc aagaggcaga gggaagtatg aagaagagta gaatcgaagc
   281881 agcggcggaa gaagtgttcg gtactcctca ccatgtctca ccttttaata aaccagagga
   281941 agcagaacct tctacgctta tcgttcagag caccacacct ccgtctgatc ctcctcaggg
   282001 aactgttatg tccactcgtc gctcgtccct gggcacagcg atgcgtcttt ctttaccgcc
   282061 ccagcgatct ctggcccctc cacagcagga agctgaagaa caaaacaaaa agaatgttac
   282121 tgaaccccag caacgcatgc atgagcaacc tcaggacata tctctggcgg cgttcttgga
   282181 gattgctggt gtgcagttta tggaagggct gcctgggttg aacaggaaga gaagtagtgt
   282241 ggctaaggag atcttggggc agtcctatgc gaatggtatg tcgactacac gttgatatat
   282301 ccatccactg acaatcggat cgcagagagg gacttcgctc ttcacgagta cacggaagcg
   282361 caggtcaaca gcattttcct caacatgtat acttgggcct caaataaact ttttcaagat
   282421 atccagactg gtgatgaaga gctcactgcc gtcgctgcac gatgcgatat tgacagtccc
   282481 cctgtaattc aagaatatct tgccgcgtcg gacgaagata agcagctgtt cgaaatgacc
   282541 ttcaaatcat tcaaaacgaa tactcactta aaggcgaagg agatgtggta cgactggatg
   282601 tggcaattgc tcgagactat caaaccagat gtcgaaacag tgttaatggg catgaaagag
   282661 gtaggaccga agtttgttca gataagagga gcctctgatg aaaatgcagg acaagaaacg
   282721 tttaacggcg tttgaagagc aagctgtcgt tcttctccct caactccgag caaggaagat
   282781 cgaagtagaa tctaagcttg tcgaagagcg aaaagctgta gttgaaattg aatcatgtga
   282841 ccaagcagag ctggctgcat ataaagaagc tatagccgag caaaggtgtg ttcacttaat
   282901 catattgcag gcaattcaaa ttgaccattt tgcagcgcgc aaattacgaa cttcagcacc
   282961 gaagttgcag acctcaagga tgaacttgct actcttacag gcaagttaga ggagttgaat
   283021 gcaaagaagc acgagtatga aacggcgatc gcgcatgcca agggccaatg cgaccaattc
   283081 acaagatcgg acgccatacg tctgcagggt gagtgaaatc attcttcatg gattttagac
   283141 tgctcatcat cggcacagag gagagcattt ctttacaaca tcttcatatg tggcatccaa
   283201 ctaagatact tcccgaacgt atggaactca cctatgatgc ggaaatcctt ctttccatca
   283261 actgctccaa ctatatccct gacatctctt ctgcaacttt ggagtaccta tcagaacgaa
   283321 tgcaatcgtc caagcgaaag tgttcgggca ttagaggcga gtcaccatct agatgtttgt
   283381 tcgaggtttt caaaggtgct gtgggggaca tgattaagca taagacttgg gatcttcctt
   283441 ctgtaagtgg attgaattgg cgcaccgaaa aacaatccta atgcagtttc agttcgttca
   283501 acaaaccggc ctcctctggt ccaacgcgca acgcatccgc gctgaacttc gttacattga
   283561 gtttcaccac ccactcttca ttacatataa ttcctccact tttctcatgt ctgtcagtgc
   283621 cagcatcatg atcccacagg cgaaaagcaa ggtcctcgtg tggtttgacg ttgataagag
   283681 tgttgtgcat ggcttccccg gaagcctggg tggcgtcgtg gtctcagtaa agagtgttta
   283741 cgggcaagcc gagtaggttg cggtcttttc tttgtcaatc tgagatctga aactaactgg
   283801 tgggtagtgt aaacctgctc gagcagaccg cgcgacaaac cattgaaatg tctaggccgg
   283861 aagcatgcct gggcacgttc ctgcaagtct gcgtagaagt cggtgcaaga tactccagtt
   283921 gaagggggtt atgtcgaggc tggaaggata cgagaacagg ttgtatggtt acaagggagt
   283981 ctgggtcttt tgggatggat aaatacagtt ttatttaaat tttgagcaat tttgcttgga
   284041 tgaatactta gtttgtcaat catgcgatat ggtatattca agccacactg tggtacgcgc
   284101 aatgcagctc agacccggat acatgcagcc acgctcgcct gtatcgcttc cgtctttgta
   284161 ttcttctttt cacatcttca caaacatgtt gtaagttcgc tcgccagcca tgttcaaaac
   284221 aactacatcg ttatctcatc ggtcgcttac atgctgctta aagtgtaccc ttaacagcct
   284281 tgctaacgct ctcggcgaag tactaaatgg aggtcaattg gtcatcaaat gggaaattat
   284341 aaacaactca catcaacgtt gttagagttt aatcctgcca tggaaatacg tccgtccctg
   284401 gtcaagtaga tagacgcctt ctccgcaagc ttatcgactt gctcgggctt gagaccggtg
   284461 aatgagaaca tgccaatctg agacttgatg tggccccact ctccaggggt atcaagctcg
   284521 acgagcttgt tgtaaagacg ctcacgcatc tcgatgatac ggtcggccat gcccttgact
   284581 tcgacgagcc attccttggt gagctcgggg gagccaagaa tagtagagac gagacgcgcg
   284641 ccgctgtgat atcgtaagtc aacaagaact ttgaatgtgg aaagcgatgg gggcgtactg
   284701 aacgggaggg ttggagtaca taggtcgaat gataatcttc aactgagaat cgaccctggc
   284761 cttctcctcg gggctttcac agacgaaaga gatggcccca gctctttcac catatagacc
   284821 catgttctat tgccttcatg tcagtatttg atcgggtatt agatcatatg gaatgggagc
   284881 aaacggacct tggcaaaaga ttgacaaagc aagagctggt gaccctgctc gacgaaatat
   284941 cggacggcga aagcgtcctt gagtgtgtca ccagaggcaa agccttggta ggcctgcaag
   285001 cagttgttag tttgtgttga catgatcggt atcaaactga aaagtgacga accatgtcaa
   285061 agaaggggaa atgcttcttc tccttgacaa tatcagaaag ctccttccac tgagcctcgg
   285121 tagggtcgat accagtgggg ttctagagtt ttgttagtga cgtttttgga agagttaaag
   285181 aaggtcaact tgcgtgtgca caagcgtgga gaaggacgat ggagccctca ggagcggcct
   285241 gacatcaacg ttagaagcag tattacatac attatatgat aactaacctt aatgtcggcc
   285301 ttcatacctt caaagtcaag gccgacggtt tttttgtcaa agtatctaat cattcacgtt
   285361 agcaatctct cttcaccagg tgtttcaacc gataggaagc ctacttgtac tgcttgacct
   285421 ccaaaccaga gtccttagca atgggaatat gattacccca agtaggagtg ggaagatata
   285481 tggactttgc gccggggaac cacctggcaa ggaaggcagt accgattcgg agagcaccag
   285541 taccggagat agactgggtg attgcaagct gtcaaaacgg agaatgttag ccttttagct
   285601 atttttccag tttaggcaaa ctcaacgcac tcgattctcg acgagcggct tagagtcctt
   285661 gccatacgcg agctcggcag cgagcttagt aaagtcagag agaccggtga tgggaaggta
   285721 ttccttgtcc tgcatagctt cggcgaggat cttctcggct ttccttacgg taggaaggac
   285781 gtaaggcttg cccgaaccat ctcgctattg atgcatcagc ctaacaccta agctttcggc
   285841 ctttcacgaa aggatggtcc acgcacgtaa gcacctaatc aacgaaaaca tgaatcagcg
   285901 atcaaattcg gtaatgccga gcgatacaga aaaacaagtg aagatgaaga ggaaaggctt
   285961 accgacacca agattgatct tcttgggaga cttgtcggcc ttgaactttt cagtaacacc
   286021 aaggataggg tcaggaggac tacataatgg gcgcaaaaga ttagatcgca cgtcagaagg
   286081 gcaaatggcg ttcatacacc tcggagtact cacccagcag ggacgttagt ccaagtagag
   286141 ccggctcgtc tggcagcgac ggcggggaga accttggaga tggcagcgga ccgggcaagg
   286201 agatatttcg aggagtgaac aagcattttt gtggttgtga agaagaaggg atgagtagtt
   286261 gattgtatcg cacctagtcg gggtaacatg agtagacgtt gttcacgcag ttagtgcagt
   286321 agtcggatcg cgcgtaggca atgaccggaa ttctccggga aacgattatc tcggtccggt
   286381 tgtgtcttac gtaacgtgcc gttttaagga gaattctcgg agaagcacct tggatcttga
   286441 gcgttatgac tatgggggca tctggtgggt ttattcctgg cagggatgcc ggtatgtaat
   286501 acagaagcta gtcgcatcaa catctgttga cattacagta gcgagactgc atgcatggtt
   286561 ggtactgcgg ctccgtacat gggcattggc acagttatta gcaacaacgc gccaatgacc
   286621 aacagccact cgtggtggat tccgacgaat gggattccgt aatagccaat gcgagcggcg
   286681 ggtttcgcca caaaaaagag aggaggaggg aagacttttc atctccctgc tcgtgtctct
   286741 cctttattcc ttgtttattg tctattgtcg actgtctctt tcttttatct atcactgccc
   286801 cattcccagc gaccaccgtc gtcacaagca gcagccaccc gctacaccac cctaccacca
   286861 cttacacaca aacatcgcgc gttccccgtg cccacccctc gatgaagaaa tccaaacttc
   286921 ctaatagtgg ctattacacc aactctttga ccggagggtg agttatcctg ttcaatacgt
   286981 gctatcgctc gccattgacg ccttattcct agttgcaccg ttgcatctcg cctccttaga
   287041 cttccaccac agatcattct tctcttggac agcgcgccta agcccccata atttgaccta
   287101 cacccctgca cataccctcg aaaagccagc aatcgtttgg taccaaatcc acatacatcc
   287161 gctataatcg ctaccgcctc ctaaagcccc gtatgggata acaatcctct cgtgaatatt
   287221 cagtaggttc gcatatacgg cctctcacta ttattcttat tttctgccct ccttcaacga
   287281 gccacaaggc tctataagac agcacacacc acaacgaaac gtttattttg catattgcat
   287341 caatatcatc cgtcgcttcc aatctatatc ggcatagacc tttaaagaat tatcaaagat
   287401 gaacgctctc cgcacccttc ccatcctcaa ccgcccttct cgccccgcct ctcctgcccc
   287461 tcccactgtc cagtctacta ccgcctccgc gcagcctcct tccaatgaaa agccacgttc
   287521 ccgatccctt tcccgtcaag tgaccgataa ggtctcctct ttacaaattt ctactaatgg
   287581 cgccgccatt catcctccag cagttatcac tccatctcag cctttggcca agagatcctc
   287641 ttctcctggg agcagggctg ccacccctcg atctactgcg agtcctcttc ctgcagctgc
   287701 ccctggggag caggctccat cgggtggata tatggatgtc atcggcttaa ggttgaacga
   287761 gacagtgaac aaggcgagcg ccggtgtgga tttcaaggcg aagaaggggt tcaagaaggg
   287821 cagtggattc gctattggcg aggctgttgt caagtgagta gcttacatag tggacaaaga
   287881 ttaacccatg ctgataagtt tatcttgcct tagggaactt cccagccctc cttccgacgc
   287941 gtacctgatg cgcgctgttc ttcgcatttc tgttcgtgca ctcagtattt atgtcacccg
   288001 cctcgaatct cttctccttc cttctctcac ggatgtctcc tttactgcgc ctcttaatat
   288061 tgccacatcc accgcgcatc ctcttaactc tgtgcagtat tttgctcttt ctgtcgcgca
   288121 cactgcatgg gagacttgcg agatccttga gcagactctc gaaactggcc agtggcctag
   288181 attcacgcaa gaggctttga gacctgtgat ggacaagctc gacttagtcg ttagcaaggt
   288241 tgtgcagcca ctgttacttg gtttgaagcg agacttgatt gcaagcttga tgaggacgga
   288301 agggacctcg cctgcaggtg gaaagacagt cgggcttgca tctatccctg cgcctactac
   288361 ttcaaccaac ggcgtacccc ttaccaagga aggttcccat cagcctgttt cccgtcttac
   288421 caaagagttc tcttctagcg gccacgcacg tcagcttgcc atccctcctt gccttcaaca
   288481 ttttgctgct cgtgtcgacg gctctcgcaa ggtctttgag ctcatcgcta aaccttgtgc
   288541 tgacgatggt gaaggttggg tgaccggtat agtcgttgct gttatctgga agggcatgtg
   288601 tatcatctcc gatagggacc taacgcctac tggtatccgg cccccgagcc ccaacagtgt
   288661 cgcccgtgct ctcgccggct tgggcaaaga acgagattct tcgtctaata tcactccatc
   288721 tccttccctt caaggcgtca ctgcaaaact tgcttcatct ctatccatcg tgcccactcg
   288781 ctctcaatcc cgtgcatctt ctcctccgag acaggccagc aagcttgatc cagtcaccca
   288841 cgctcttctt tcccttgagg gactcatcaa acgtctcgtg agtggccttg tccaacctcc
   288901 ttctcctaca gacgacgaag acgaacacct cgcgcgacag gccttgtctg aagccattga
   288961 agcccttcag tccttccgta taatatcgac cgcaatgaac aacggcattt cctcttcaac
   289021 ccgcttgctg gcatctgctc gtcgactacg agacgatgtg gaggacccag cggaagatga
   289081 gctcgacgac gcaatggagg accttcaagc cgttattctc ttctccattc tatgccgcca
   289141 agccaactcc atcctctcct cgcttcctat ttctagcgag aaggaaccca ccctcaagat
   289201 ccgccaccca tccgaagttt ggggttggca aatggctgaa tacgagcgtc aagttctctc
   289261 tggcttttcc gccgccgaag aatggggtcg tcgagtcgct gttgccctca agggcgacat
   289321 tgaaaagctt cttgctcgcc ttgctgagat tatcgcgagt cagggcgtgc ccgagaagac
   289381 ttccaaagag aaggaggctg tggtggaagc tatggagtgg gtcaagctgt tgggcgttgc
   289441 atgtgatgcc aagtgcggac tcaaagtggc aaatgcggct tgactagttc cctgggcgat
   289501 taatgcgttc tgtgaaagct atagatgaga atatgacttc tatggagagg agaaaaaata
   289561 tagggtcata aagtgcaatc gtactggagg aagattcctt tgataatctg aatacacggt
   289621 tttccatttt taaaatgcga tagtgagggt tattattcag aaagacggcg tcggtcagtg
   289681 ttctagtttt ttttctttct tttttctgtt ttttcaatat cgtaggtgag ttaggtccga
   289741 aaatgcatgg tgttagaaat gacagtgtac gaacgtatcg tgatgttgtc aatgtacggt
   289801 ctgctattat tatgctttcc ttcacgatcc tcaatggcat cttccgccgg cattatgaaa
   289861 ataaagataa ctctgcttcg atgttacccc tacaccaatc tatcaccaga tacatagggt
   289921 gcttccatcg tatgtactat gaccaccaca gccaaccttt gggaggctat tattcagtta
   289981 ttccctagca gcctttacag tcgtaaagtc cgtcatcagc cttggaggtc atgggtggag
   290041 gccgacggaa cctaatggat gcacatccgt gggagacttc aggggttcta cgctaacatc
   290101 gcaaaacaaa attcactaat tcctatgggg cttgttctgg actgtctgtc gtcatttcct
   290161 gagcccccac cccaccttga gttttaggtc tctttgcttc cctggttaca gaaataaaaa
   290221 aatacgaatg aatcgcattt tgtctaccct ataaatattt ataaatgtac gtccatcatc
   290281 atagtcacag cactgagttt gatcgtgatt accgcgtgtt caccatgata atttaggtga
   290341 ggagcgtttc ggagacggac ggcggcctaa gcaaatcccc gaatttcctt ttcttcagtt
   290401 ttctgccgcg atccaccacg taaaataata gaacctacta ttataatagg ccattgtcaa
   290461 tctccattgt gactcaggac gctggaggag ttgcacaagc acaagtaatt acgcaacatc
   290521 atgagaaaca cggaaaggaa atgggaaaag cgtgagtaga accaaccacc ttttaccccg
   290581 caaccctagt atttagaaac tatcataaaa ctcagaaaat catcaagagt atttcaaaat
   290641 tgcctataat tttgcttaaa agtaaatttc taaacctcac tcaagccgtc gccaagaagg
   290701 acttaaatct acgaattccg aagactgagg ctgtcaaacc ggaaaccaga aaacaattcg
   290761 agaacggcga agtggtcgtg gttcacatgg cattattctt ttgacacgac cagacagaga
   290821 caagaaggga taagaaaatc tcgaaacaag aaatagtaaa atacaagaat aatatagtaa
   290881 taccgtatga cattactggc gtgccgtgct ggggggggaa cgaggattga ggattattca
   290941 aaagccgacg gatggtccat cagtcataaa acatcaatag gacgagaaac cgcaggtcat
   291001 ctgctggtaa agttttctac agaagacaca tcacagatta cggatctccg cgttggggcc
   291061 actccaaatg tcactccgtt gggacctggt ccgctcgtac ctgaacatcg gatgaaggcc
   291121 gacaagaaga agcatcatgg cgcatgaagc atgatggacc cagcaacaat gaatggtggt
   291181 gcaagcgcag cagtagtacg caaaaacccg tcgtttgtca taagttatct ccatcggctc
   291241 tcttcttcgc ctattggcct acttgaggca tccagtcagc aatatatgca gctgcatgta
   291301 taaggcggga cggatgggcg aaaatgttga gccctagtcg tttcatcacc accacaactt
   291361 tcggactgtt ttaaaacccg ataatcaaat atcggatttg tgtgataggt cggatataaa
   291421 acatgaaccc tgatgagcct cccatcaagg atgggcatca ctaacagctt cgttctcttc
   291481 gagtaatttt gctattatca taaacatcta actgtatact ttaactctgt atcttatatt
   291541 ctttcgtttc ttccgttgac tgcggtgcta acatcgtcaa aagggactgt ctgacgccca
   291601 ctactggctg aagttagatg acaccctcaa tcaagcaatt ccagtttgcg tgatggaagg
   291661 aagacattca gcaacagtga tatacttctt ttgttgtcat aatcctctag tctgttcact
   291721 tgaaacataa ttgaagaagt taatggacgt acgatgacga ctattgagag cgttgatagc
   291781 taggcaagta agcgaataat gaaaggcgaa aactcaataa aataatcagc tattgcagat
   291841 gacgaagaat gtcaatccca tctgcagata agaaagtacg tatgtgatag caggcgaaac
   291901 ataatgaacc atttggctac taactcatcc gttattggtg gatcttgtca cgctgctggc
   291961 atgtcaagtg tcaactgtca aggatcgcta caatattcaa accaccaatc actaatcatt
   292021 atagaactag ttgaaattat ttgccgttgg ctgctagctg ctgactcctg gatgatggtt
   292081 gatgggtgat gatgggagat gggatctttc tcagctactc aagcttcggg caaaaaaaag
   292141 tcagtgtccc cataaaacct gaagtacctg aaacatcata gcttcagtct ttagtcctcc
   292201 attctctatc ctcaaacctc gagtctctag ggaggctgat aaagaacaag atatgatccg
   292261 aacacaacgg aatttcggag ccttcttgcg acttgtgaga tgttagggtg atacgatcgg
   292321 tgatctgtgt attgggtcct gtagagcaga tctatatcaa tcatctgtta ttcttccgac
   292381 tctcgaagca gatacaatct gagatgatga gatgatgaga tggggaagag attagaagaa
   292441 tcttcgaaga agtcagcaaa ttttgatgat agactgatga cgattgggct tttacccttg
   292501 agcaagcctt gaaggtgatc gccatattgg cgggtttcca caagcaacaa ctggatctta
   292561 gataggtttc catcattttg ccatgcacag actcacctac tgtacagtag gcagtattga
   292621 gataattgca cgaccgtagg aacggggtct tgttgatgaa ccgccataaa aaatgctgtc
   292681 catgtccatt gtgcttcagg ttaatgttga cttacattca ctctttcctt gactgctgat
   292741 gagcttcatc atttacgttc cttcacttct ctaccttacg agtgagaata cttgatgaca
   292801 atgtcatcat tatcatctgg cgctttttca gaaaacttgt ggaaacgggg gtaattgaca
   292861 caagcgcaat gcacgtttca catgtcacgg gcgtgaccat cattcctcct ccgaagaaaa
   292921 tagtgcaact agcggttact gttggaaggc ggaacaggcg ggattgaaca cttatgagta
   292981 gaaatgaact gcttgattat ggctgatgga ttggattagg ttcaatgggg gaattccttg
   293041 acatatacac aagctagtcg ggggactgaa tgacggaata gatgccttca tcggcctatc
   293101 cgcattattg gtgtagtagg cagagtggtt ggtatatcaa tgttggggtg catatatgat
   293161 cttcttatct tactgccaca cattcgaaaa cataagcctt catccatcaa aacctaggcc
   293221 gaaaacagga taggccggct agtaagacca ccggtagtat acccttcaca tcatcataca
   293281 tcacagcgcc cctaacatca tcaaggcctc agtcctttct ccatatgccc tcatcaggcc
   293341 tcgctttcac atatagcccc tgtgagttct ttattccctt ggtgtttccc acacaatcaa
   293401 aaaagactcg tcagtctcta taacacatag taacaacagt accattgttg agacagctcg
   293461 agttgcctta taggccttca tctagctgtt cgtatttcca acagatcaag gaccaaagaa
   293521 aggctgggat ttcacactcc taccaacctc ttgcccttta caaattttcc tccacacagt
   293581 acacattact gatatgtggc aattaggaac acgaaaataa cttcgccatc ccctataaaa
   293641 cgcaaaagtc aggtagtaga cacattgttt gtgagtattg cgcacacaac ttggccttat
   293701 acatgatcga tttcctattt ttctctgcca caatagtatc tcggcgacct ctccttactt
   293761 ctacatctat tcttctctgc tccctactcc ccactcgcgg ataccagctg atatacatat
   293821 tcattaatac cagatccttt gaccttcgac agacttgaaa ccttgccctc acacttcaca
   293881 cgtccttgcc tttcctacta gtattcatcg ccttattaat ttactttgcg gtagttttat
   293941 ttcttcctgt tttttcaaca gtcacatctg gtggatacac gacaggcacg atcgacagtc
   294001 tgtgcaagtt gtgttcgcat tcaagttgaa acaccttgcg tgaatgcttc caccttcgaa
   294061 tgtttgtccg cacacacaga agatcgacat ctgaaggcag cttaaagaga tatcctgcag
   294121 taatcagagc ttgaaacgtg agcttactac tctctatccg ccattcgcat cgccttcgcc
   294181 tatgtcatga ccctgctaca atcaagagac gtacgctcat catactctgc cccagctctg
   294241 tataaatcag gtctcttgtg gtcttcacct ctcttcaaat ttttttcaat ccgtcactcc
   294301 cagttatcgc atctcaagac tgtgttaagt actggttcct agaaatataa ctgtaagctt
   294361 cacaatcagt tgacgaatgt gatgtgtacc agctattggg tgctgatccg cacttcataa
   294421 tagcctaaac atcacgtagt agtaattcaa atttactcgc tagtcgccct tgcttcatac
   294481 tatcgtgagt aagaatgact tttgaggatg atgatgaggg cccttcttga tttgtaatcg
   294541 actgtcagta tgctagtgtg gtgatagcct gtacatctgt acagcaacag ctgcgcgcat
   294601 catggaacgt tgtgtgccaa tcatttgatc tgcccatcta caccaggagt ggagcagcgg
   294661 ggagtggaga gcgaactttg aaatgtcact tcggaaagaa tggagagatt gcttcatgct
   294721 ccattctaca tcctacattc tatcagtaaa gaagagcgat ggattgactg ccctttgcgg
   294781 tacaccaatg ctttgccaaa ggatggagtt tgatatctaa cggaggctga cttaatatct
   294841 gatatctgat attttgatat cacctagaca gtttatctct tctggcactc gacgacactc
   294901 aataacaaac tcaaatctca caacgggggt gccttgaccc caatcgggcc gcattaacag
   294961 aatcccggcc ccaataatcc acacatttgg aaggctggag gccagaacga ccaacaaaaa
   295021 cccgccagga cgaagactcc cgccaattct cacggccgcc ggcattagtc cttcctcgtg
   295081 cctcatttac gcgttactac aaggtgcaac gggctttggg cttttgtata tccagcctcc
   295141 aacgtgagtt ttgagttctt ttagccggat gggctctttc ttctccattt tgcttttttg
   295201 cttttgggtt gtccgctgct aggatttccg cccatgcttt aagaaatttt tgaagattgt
   295261 aaattgcaca cctgaacccg agttttgtga tcttttcctt tttcttcctt tgcatcgagt
   295321 atcgaatatc gagaaagata ataagggata ggtcaaaagg gttgcataca aaatgcgaaa
   295381 tatgcagatg gtggctttgc catgcggcac gctggagtcg caccaccaca aatttacttc
   295441 agcagccaat ttgtgtgcac catttcaggc tgtattttga attctgcgtg gtggtccatc
   295501 ctaccgaaca aactatcttc gatggtcggc tctggacggg atggggaacg cgaggctgag
   295561 aaatggtgat aataagtact ccttgctccg ttactcctag gttctcgaat tttagctctg
   295621 tctttggatt ctggatttat tatggtgagt ttttggcgcg tttgaaagtt acgctcgagc
   295681 gtgacatgtc cctgaaccgc gccaaccgta attccgggtc ccgcccgccc gcctctcctt
   295741 aattccctaa aagccttact attagttctg gcttctgaat ggccaatttc atttgaacgc
   295801 gtcctagtca taatagcgct cgcattgcga aatgcgaggg gcagggtttt gactggcgca
   295861 tgaaagagaa ttccgcaagg acaggaacgg acgtgacgtg actgctcact atcgtactgc
   295921 taccgccatc acccaactct cattttggcg cctttttctc cgggagggtt taggtgatag
   295981 tgcacatcta ttataacact tcacaagact gcagtacttc ccctcttgtt cccccttgtt
   296041 cttctgtctc aatccttctc cttgctatct tttgatggct tcaaaataat cttttgagat
   296101 tatcgcgcta gaacggtcga ctacagcctc cctttctgtg gattttggcg cctcttctgt
   296161 cttcaccaca ctctcttttg gctgcttggt cttgcgcgac tgtagaacga cagacgaact
   296221 tacgattgtt cttctaccct gtatcgcatg cttatccctt ccccttaaca cgccaacatc
   296281 tacccatcta cgcactccct atcatcgaaa acccgccgca tcgcattgcc gcgcaacaaa
   296341 attcgacgaa ttccgcacca cacgtcactc gccaaacttc gcttccttca cccaaccgaa
   296401 atccaaatct tccatccttc tctcttcttc atctctttgc catttgttac atcctctttc
   296461 aacgacccac ctcatacacg acctcccctt tcccctctgc ctcttcttca tacattacct
   296521 cgcgttgttt gttatcctgt cgtggtgact ctgcgcttgg ttttcaacga cttgtacgac
   296581 cccgttgcgt gagcaggtct cctcaacgtc ttaccatctc tttacagtcg acagctagca
   296641 tcttggcttc atctttcttt tagtcccctg ttgattcaat atcgcttcac gttaccttac
   296701 gactatcttc acgaccttct ttgtgtttcc ctcgaaaatc tatccaagat gcccgttgct
   296761 cccacagtca aatctgcgcg caccacttcc gtttatgatc gcagctgccg agcctccgct
   296821 tcgcctaagt catctcgacg gctgtcctct caaaccaagg ccaagattca agcagttgca
   296881 gccccagtct ctcaagcgcg tgctgtgccc cagcacagaa aggtcgagga ggtgatgtac
   296941 ttcgaggaag attacagtga ggaaattatt gcctacatga acagtatgga tgtgagtctg
   297001 ttccttttgg aatttagtct ttgactctaa cgtattccct tagaactcca ctcttgcttc
   297061 tgccgaactc atggacatgc agccagaact tcaatggttc atgcgctctt atctaatcga
   297121 ttttatcatt gaggttcacc agcaattccg attacgacca gaagtccttt atctcgccat
   297181 gaacattgtc gaccgctaca tttccaagcg tgttgtctac aagaaacact atcaactcgt
   297241 cggatgtgct gctctctgga ttgctgccaa gttcgaagat gcaaaggaca aggtcccttt
   297301 ggtgcatgag ttatccgaga tgtgttgtaa ggcttacgat gagagtgctt tcattcaaat
   297361 ggaaggtcac gtcctttcca ccattggatg ggttttaggc cacccctccg ctgaggcttg
   297421 gttaagggtg ttcacgactg gaattcgata tgaggatcag aaggttgcga acatggctag
   297481 gtttttgatg gagattacct tgtttcaccg agagtttatt gggatccaat cttcaatcat
   297541 tgctgcaggt gctttgatgc tcgccaggtt catctgcgga aagccctata aggtacgtta
   297601 ttcctgcgaa gatgtgcggg tacatcacta acttgttcca cagccttgct tccccaacgt
   297661 ccctgagacc gtcgctgccc gagtgtccat tgctattgac aagagatttt ctcaagagct
   297721 ggagaaagtg tcagaaatcg tcattcgaaa atatgcgccg acgtactacg accgtgtctc
   297781 taccgtctgc cgggaatggt atctgtcagg ccgacgatac acttacaacc ctgttatgcc
   297841 ttccaccccc gtctccggtc tttcaactcc gggccttgct ccttcatgct catcatcttg
   297901 ggccaagcgt ggttcatggg taacaggctc tcccgcgggt tcttgcgctt cgtcggaagc
   297961 tggcgatgat accccagtca cacctatcac ccctatctac acccatgtta tcgacccatt
   298021 ttccgttgca gcaaaggaga atattgcccc agatgctggg aagccgatgg ctaaggttat
   298081 tccccgagtt cacaatgtga cggctcctcg agttatgaga cggctaagca attagtcttc
   298141 ctcatcgtca catcccttca ttcgcattcc cgtagcattg gtttttctcg catttttcat
   298201 cacgacacgc aacatcattt tgcattacag acatagagct cgatcatggt atgggatgcc
   298261 cgaccaccca tatatccttc tcaccgccaa gcaagaaacg gtcttggaga ggctcgatga
   298321 cctgatgagg gggcacgaac tggacggtga tagttttcgc tgacagctag cttctcttat
   298381 taattttctt cttgcttctt tcctacctta atttagcttt tgtacgtacc cttcattccc
   298441 aaccatgttg aaaggcaaat ttacacatac acatttatac atagcattac ttctggttca
   298501 catttactat tctttttgat acagtagtct gttacttggt tctccagttt agtgttcatc
   298561 acctactatt aacgatcgat gatatgatat aaggatgaat gatatgcatc aggtcccgaa
   298621 atccaaaaat gggttgagca cacgaccaag ctggtgcatt atatttcatg ttgacttcag
   298681 atagcgcgcg cagaagacta ctatccgtcc gtcgtcgtcg gaactccact tccaacaaac
   298741 caccacctac atcctagatg atttatcttc catccttcta tttataacta caccggagga
   298801 agatgaggga gaagaaggag accagcattg tgactgaccg atgacagacg tcaacagagg
   298861 acagaggata acgaacaccg aaaggaaatc ccggccattg atgtcccaac gaacaaacgc
   298921 cggtcggccg gtcttattaa taccatctaa gcgggacgtg taacgtataa cctgggccct
   298981 atttctggtg cctgaaaggc aattagcccg aagataccga ttttgccgac ttttttgagg
   299041 tttcagcctc catttctgcg gcctcttcgt tccttccgtc gtttgtcggt ttaatcgttt
   299101 tctcaccatt tgaaatatat ctataataaa gcaatactta ctaactactc atcattgtac
   299161 cagaaaatgt tacatctgtc cgaaacagag gggccggatt cacaacgtgt tctcctcatc
   299221 tcaactcttc atcccgatag cccggggacg gtgtcctcct cgtggttgga actaactcac
   299281 cttgacgcta caacgtacat gtacatgatc gcagtgcggc gaacaactaa cgaccaacaa
   299341 accaacagcg atgaacggtg ataagactca cgttgaagtg aaactgcatg aggggtggga
   299401 ccaagcaagg cggaatggtg ataattggaa tcataacctg tacacgagcg gcatgagtcc
   299461 cttcaccaag attcactatt atgttccaca agcatcaaaa attatcttca tcccagctct
   299521 cgtagtttaa gtgtctagtg caatttgaac aagacataca cctaatggca catgaaaaga
   299581 tggaatgcag tattctttca tatgataaag gcttggatca attttcatta tctgttgccg
   299641 ctgctttaca gctactgaaa gtaaatgtta gggagtatta agcaatatgt caaagctagt
   299701 gcatggcaat tcgtatgcat gagaaacacc gttgccagta ccagtatcaa cgctatacct
   299761 tatgtctttt gttgacttgt ccctctatgt tcttgaatcg tagaactgat cttagcggta
   299821 ttcacccatt accacggtct ccagctgtcg ccctttccgc cgctgagatc gtttgtgatc
   299881 tccctgtgcg ccgtcattaa atctagagga taatcataag catcaatcat ggcagtcgaa
   299941 atttatccga aaatatgcaa acgtacagtc agtgtaactt agagcatcat tgttgctatc
   300001 ctcaactagc tgattggcaa actccacttc ggccccatcc atattttgcc taacaattat
   300061 gaccggcaac tcctgatcga caaggtgagg ggatgaaaga tgtgtgagga tgttccggat
   300121 ttgagtagac agaagggtcg gcaagttggg taatcgggtt atgcggacgt cgaggtcctc
   300181 aagattgtct acaccgtaaa gatcattgat gatctgggga ctgacggctt ggccgagcca
   300241 gagcatcgca atttctccgt taatcattag ataagcgcct tccgctacca tccaactatg
   300301 gctgttgcgc ataaagcgag gtaatactag acgcccagtg ttagagtcgg caaagccggc
   300361 agcgggtgca aggtcgtgga tagccaacaa tcggggatag aggagcatga ggacacgggt
   300421 tggtgggaga gctttgacgt ggcgagtgta atgcattcga acatcagagg agacgcttcc
   300481 acctagacaa tagtcagata tctgatcgag tccacacagg tagcaaacgc acctttgatg
   300541 ggtttcgact tggtcataca aagtgcgtat aggggcagga gcttgaaacc ttccggtaat
   300601 atgagctagg gaaatattag tacagatagg gctttaaaca aggtgcgttg actcacctgg
   300661 ccgtgctgga cagcaggtgc gcagtgcttt ctgtacatga gtaacactct gttcgcccta
   300721 tccgtcaaag atttccggat atctctcaag cttctctgcg taacctgtga taacccagct
   300781 ttgagaagga cagctacaca cgcttcctgg tcggcaaatt tgaacacatt gccaatcatg
   300841 cttgtaacca caaagctcat attcaaacat cgaacccttc gttctccttc tttactagtg
   300901 taaaggatgg caacttggat gaacgcaggt tgccggtcgt ctagtcgatg ttcgtgtttg
   300961 agcacagcgg tgaacgattt ggcagagtca atcgtagcgt attccaagtc ggtgagcgaa
   301021 cgttgataga aattacccag gtggtcagag acgcgaagac cgttagaaca tctcactcgc
   301081 acagtagcat tgtaagccgt ctcccgagtg agcacctgaa gaagttcgct atgaatcttt
   301141 tccctgtctc tgactacatc aaacctgggg tggaaaaatg tctcacctcc cgttccagca
   301201 gcgagggcac caagactggc aatatcggta taagcgctgg ggaacaagaa gagattaacg
   301261 ccgacacctg cttcggcaag ttggtcggcc gtggtgagat accattgtga aggggtgaag
   301321 agtgtccgtt ctttgtcggt gttgtaataa tcgggattct ctcgtgtcgt aagggtacca
   301381 agaccatgtg tggtcaaaga cgtgaggaag agattgatct ggccaccggt gtgcttctac
   301441 aaagatcatt tagcgatcgt tgtgttgtcc taatttatgt gaacattcac ttacaagacc
   301501 agccaaagct ccaacaatag cagagcccgc ggcgaccctc ccaccctctc ttccttgctc
   301561 cgccaagttc ggcaaaagtt ccaatagatg ttcaatttgc gcgcgggatt cttgcggatc
   301621 aacgaggaag ccagcggtaa aaggtataaa catgtcatcg agatctgaaa cgactgcctg
   301681 tgatggcgca tgcagatgag actaccatgt aatcagcgtc tggcggactt ggagacacga
   301741 tagacttacg gaaaggttcc agaaagatac agtttctccc acagacacga atccaattcg
   301801 ttgtccttct cccagcagct cctcttccac attcccgctt tctttgcttc cgtagatagc
   301861 ctttctgatc ctctcacaaa cttgtctggc aactccattt tctcccgcat gtgcgctgac
   301921 atcaaggaca aaaacacgac tcaacgcgat aggttttctg aatttctttc tctccttttc
   301981 cttttccttt tctttttctc tctgttcttt tccagtagga atatggggtt gactttgtcc
   302041 aagagacgct tgcaggccac ccaaaagatc gtgcgctgtc gaagcgagcg cgtccgagtc
   302101 aatggagtcg agtaaagacc cagaaggagg ttgcagagcc cagtacgaag gaggtacagg
   302161 aaagtcaaca gtgccaaatt gaagttccgg cctttcagca tgatcaagac gttggccatt
   302221 gggagcgaga tggcaaaagt actgcggcgg cactgcaaaa tcgtcagatg tgaaccaaaa
   302281 cggtgaatga acgacgatgt accctcattg agaactccac ataagttaca cgtccacttt
   302341 cttccaccat cgacaaatct aatccatggg ttgatgtacc ctctgcattt gtcacacctc
   302401 ggcgggcctt gttcatctcc ttccccctcc gctccccatg tttcaccctt aaatgctggg
   302461 ggatcgaaag cgctttgccc tgaaacccaa ctggaaacgc atggaacagg agcttcgtcg
   302521 taccgtaacg gtgcaaaagg ttgaaccagg ataccgaaag gaagcgcggt agtgtcgaga
   302581 agctgaccat ttgacggaac gcatggaagc gtagctcgaa gatgacgagg caatgaattg
   302641 cctaggagtc gacattaatt gatatacctt tgcgctagaa gatacaagca taccttggtc
   302701 cacgcccctg taatcagtcc ctaccaatgg aatcagacca cgggtttgac aacttaaaaa
   302761 atcctcgtcc tcgtacaagt tttgatccag ctcctgagct tcaatagggt ttggcacttg
   302821 actcggatct attctaaccc tcatcccgct catagtgggt ccggaagaat gaggtggcgg
   302881 tggaatatgg tttggaggtg gagtagccct cggcgactgc atttcttgtt gctgctgttt
   302941 cggctgtaac tgttgtgaag gatgtatcgc gtgataactg gactgcgtag gagcatatgg
   303001 tccacttggt cgaagatctt tttcggggac attatgcaat tgaggcatcg aatttgggtc
   303061 caagtgcgcc tgctgctggt acctttcagg ctgatagccc ggctgagctg cttgaatgta
   303121 ctctggttgc ggccattgtt gctgctgagg cgctgggacc tgtgggtggc ccgtcaacga
   303181 aggatctatg gcgtatcttg tgcgaggcgc catgtcaatt cgttgctaga aatgtatatc
   303241 gatatatcgg acgcgcgaag tacggagaaa cgtggtggaa agaggacatg gacaaatggt
   303301 gggtcactta agctctaaaa taattacatc attaaattgt gttggacgac caggcagctg
   303361 agagaagacg aggaagcaac aacgaactat acgtaaaagt agaatgtatc ttccttagcc
   303421 aaggagttgc taatagcata gttctcctgc tatataccct caatgcaagt tcattgaatc
   303481 gtcttccatc caagaaactc ggcgcctaga caccccagat attaggacct agcaacccct
   303541 ttttacgtct cctcgtcttt ttctctcttt agtttctctc tcacgactgc cgaacgcaac
   303601 ataaggttga accatgacaa taagcacaat cacaacgcca aattctcaca gccactcatt
   303661 tttctcttcc taccgaatga tgcacagtgg cacgcagagc tgagtatgtt tggggctcca
   303721 attgtggccc tcaaaggaac cacgcttaag ccgctgtacg tacctcaatg acaagcttcc
   303781 attggaagct cttctaagat cggagggaat tgggtctgcc aaattacaag agatttggta
   303841 tatttgactg tgaatgccct tctatccaca cagacaagta tgctgccaat gttttctccg
   303901 acagtggttc tttcgcccgg atgacttgct atcaaaaagt tggagagtta caaggatgtg
   303961 gtatcttatg gtcaggatgt ctgcagtgga tgaaataacg gcgttcccga caccttttgc
   304021 tttgaaattg cattactttt ctttcctttt tcaaataatg acataaatta tctccccagt
   304081 ttttatcaat attgcgttct ctaatttctc gagcgattct gccccatgtt actaatgagg
   304141 tagaaaagag aggacgagag agctgcatga aaggaaaagt tcgacgtgag agaatcgaga
   304201 taatccagcc gttcaatcat ctcaatgaca acagtctcca agctgtccac cattgtctcg
   304261 tctttttgct ttttggtgca ggatagctat tctaaaaagg gatttttaga aggtaatcag
   304321 tctggtcaat cataacttgt gagattgtgg cggatttaag ggagggaaga agaatatggc
   304381 atttgccgag ttagaggtcg gtattaatcg atgagtgatt tggcgtgttt ccggtcgaga
   304441 gccgcctcaa aacggctgta ttagagccta ttgctacaac gtgaggatga cgatgggtga
   304501 ggggggtgaa aatgagggat cgacttatat tattgcgaag cccacactgt cagccaacgt
   304561 ctgtgtcgac attattgagt taagcgcttt tggcaggtct tcataagaag acagatgatt
   304621 gatgagacag cgttctccca gatcaactaa gacaaactaa agtcatatga ttcggaataa
   304681 atgtcactta atgaaatgaa tcttgttgtc atatcactct aaggcggtgc ttaaagaagt
   304741 gaatgatccc atgctggttg gagtgaacaa ggcaatcaca gacgtgaggc agctgaggac
   304801 actgtcaatt tccacactcc agggatgggt aacatccatg tgctcatggt tcacgagact
   304861 ctgtgcgtaa agtcaagtaa tacagaggta agacacaaga tcatggctca caagtctttg
   304921 cgaggtggta gcatatatga gctcgtctga aagtcttgcg acaacgtcgc taataaaggc
   304981 ggttcggaag taggcgcagc gttccactca tcattctctc cgcgcactca agatagcgag
   305041 ccgtttaacc ccttcacccc gacaaccaac taccccgccc tgtcggtcat accaaacttt
   305101 cacctcgtcc ctttcctctt gccctgattt atgaatttgg tcgatttcaa agtattcttc
   305161 gaaaacgcgc ttcgcctctg cttcatcccc gagcgtttcc agcagacgac gagacatgcc
   305221 gagaggtttg agcatccatg ccgatttcgg tgggggatat gtcgtttcct ctttctctac
   305281 tccttccccc tcactcttcc tctcagattg taacagagcc tcctggggga tcttgacgtc
   305341 ctggagatat tcccttttgc cagcgaccac tgccccgctt ctatcgcgaa ggatgacaag
   305401 ttcttcgtgg gtgactttga agtgctgggc gaaaatagta gctgcatggg tattggtgag
   305461 gagtgtgcgg agaagacgtt gggaggtcgg gaggggggtg agggtataag ctcttgtggg
   305521 tgatgggagc attttggatg cgttagaaga cgtattggtt tgttacgaac aaggcaaaat
   305581 attccaacga cagaacgaaa gacaggcggt atcaagaagt acatatatta ttagcaacag
   305641 ttgttgccat ttaggaaaca atctaatgat gggtaccggc tcgctgcagt gtaatgagtc
   305701 ctatgatgaa aattgatgtt tgcaattggt gacatcacca tttttgtaat acgacttgag
   305761 aaaataataa actttcatcg aacggacgac gtaataataa attgttgctg acggtccaca
   305821 gtcgcaaata aagagtaaca attgggatat aaaatgcata agctgccaag tagattttga
   305881 aaagctaaga aagtgattga aggaatgtaa aacaaagatt tggacccccc gccactgtat
   305941 ttcaagcgag cggtccaccc aagtcctgtt ttttatttcg ttctcttcta cgatatgacg
   306001 gcctccttct ccacaattag ggatacgacc tttgtcctaa aacctaggga tccgcagggg
   306061 gagaggaggt gcttttttgt agatttaatt tgcgtttgtt gaagaacaag aagagaatga
   306121 aagagtagat aaattttgcg cgagggggga gagagtgaag cgaggcacgg gcgcgggtaa
   306181 ttgtataagt gggcgtttgg ataaaatgtc aagggtgcca catttgcagc ggagtttcgt
   306241 tgtaagaaat tgccgggtag tttggcgttg gaaggggatg cggcctggtg gaatttgttg
   306301 gtgatttgga cactcgaact tatttttcat ccctcaagta ctaccatagc tggggccgag
   306361 gtaagttgtt acgacccaag caacgacacc agtgctgatt tgtccaactc tcctcctcaa
   306421 atcctcttca ctttttgccc ccgattacac tcgacacttt tacagtagat aaaatggtca
   306481 agcacaacaa ccagctacca aagaaccact tccacaagga ctggcagagg cgtgtcaaga
   306541 cctgggttag ttgattcatc ctgtgctgta gacgaggaga gaatgtatgc ttggcaggat
   306601 gggaggatgt gggaaaactg aaggaaagga tgacatggct gacgtggtgg taacagttcg
   306661 accagcccgg caagaagaag tctcgacgag ttgcaaggag caagaaggcc ctcgcctctg
   306721 gcgctgcccc cctccagcga ctccgacccg ctgtccgatg cccctcccag aggtacaaca
   306781 tccgtgttag gggtgcgtaa ctttttatca aactgcagat tttcttgtaa aaatatgagg
   306841 ttgctgatgg ttcgtcacag agggccgtgg tttcaccacc tctgagctca agctcgctgg
   306901 tatcaggagg aaggaggctt tgtccctcgg tatctccgtc gacccccgac gaaggtccaa
   306961 gtctgaggag ggccagaagc tcaacgttga gaggctcaag gagtacaagt ctaggttggt
   307021 cgtcttcccc aagaaggctg gcaagcccaa ggctggtgac gcaaccgtga gtacactttt
   307081 atattttcct ttgcgacacc attgacagaa agctgtaggg tgacgccctc accgctcaca
   307141 tcacccgtga ctctatccct ctccccgcct cttacaccgc cgaggctcct cgtgccatta
   307201 ccgacgagga gaaggagacc aacgctttca ccaccctccg tcttgctcgt gctgctcaga
   307261 ggaatgaagg tcagaggaag aagaggctcg ctgagaagga ggctgccgag aagaccaagt
   307321 aaattcggtc ttattaggta gttagagggg cttgtacttt tcctggggga tgcacctatg
   307381 atcactgcat tcttgactat ctgagctagt tcgtcgtcgt gataagacat ggtatacgca
   307441 ttatgtgacg actaccctga ttaccctggt taactactga atttggtatc atgtgctact
   307501 tttctgcgta ttcgtagcac cagatcatag ctcaacagaa aacccagcta ctggaattgc
   307561 cgagtgataa gagtgcgtag tggtgcatat acaaagtgtt ttttttttct aagtatagcg
   307621 gaaccccaga atctggaaag tggagtgtct gatgatgccc gagactccat gatgttttca
   307681 ggaagtcgaa ttgcactttc atacacattc tcgcatgctc catcgtcacc cgtctcccct
   307741 tctacctgcc cccttactta ccaaggtgtg cgtacaggtc aggtatgctg agtttgcccc
   307801 agtcaaaccc gataaacccg cgtgatgtat tgctgtcatg actccgaacg aacgaatgtt
   307861 gaatttggga tgtgtgattg ggcagcggga tcaaatgaga gattgtgatt tcgtggggca
   307921 ccctcagggg catggttcga tacgatcact ccccattccc catacaattc aaagcaacta
   307981 tatatacata tcgtccgact caacatatac ctttcttttt tacatatctc attaccccac
   308041 atccgcagat actccactac aatggcccca atggagaaag gtttcagctg gtccaacatc
   308101 gctgttggta agttagcttt tcctttgcat ctcaacgccc atcgggtctt ccgggatgtt
   308161 gcagtctgcg gtcaaccggg acaagtcgtg gtgatgagag cgtagagtac atgatcgtgc
   308221 ccattgacca cgtatttatt gctgtgccat ttccgagctt tcccaagttt tccatcgtga
   308281 ttccatatgc gatctcgcat ctcaattccc acgcgtcgca ttactctctt cagagcatcg
   308341 tactgacacg atacatatag gcgccactat gaacatgttc gaagtcacca ccctcggcca
   308401 acccctcgag gtgctcaaga cccaaatggc cgccaaccga agtcaaacta taggtcaggc
   308461 tttcagtacc gtctggagtc gaggaggtat taaggggttc tatcagggtt tgataccttg
   308521 ggtaagtctg atattctatt tgtatttact ctgttggtgt tgtgtaccct gtgggctatt
   308581 cccgaggagc tctaagagag tatagagcaa tactttggtc tgcgttcagg cgatagacac
   308641 cgctaccgaa taccaccaat acggccaatt tacaatgata taatcagaat gctgacaaat
   308701 ttgtcctgaa caggcctgga tcgaagcttc cactaagggt ggtgtgctta tcttcacttc
   308761 tgccgagatt gagaaggctg ccgtcaaggg cttcaacctg tcccctgctg ccgccggtat
   308821 gcttggtggt atcggtggtg gtgtcgccca ggcgtacgct accatgggtc agtccacttt
   308881 cttgtccata tctcgtaagg gatcaaacta atgtgatggc aaaacaggtt tctgtacttg
   308941 tatgaagaca gttgaaatca cccgacacaa gcaaatgtct gttggtgccc ccgtcgaatc
   309001 tacattcaaa gtcttccttg atatttacaa gcgcgagggt ctcgccggta tcaacaaggg
   309061 cgtcaacgct gtcgctgttc ggcaagctac caattggggg tcccgtttcg gtttcgctcg
   309121 acttgctgaa gcagggttga gaaatatgaa ggggattaaa gaaggagaaa agctgggcgc
   309181 gatggataag attttggcca gtacgcttgg tggtgctctg gccacttgga accagcctat
   309241 tgaggtagtc cgtgtagagg cacgttcttc catttctttc ccgtctttcc atctcacgct
   309301 aatatctctt ctttaaccag atgcaatccg ctcttaaatc ccaagatccc gcccgaccgg
   309361 ccaagaagac tgttctcaac accctctctt acatttacaa gaccaacggt ctcaagggtc
   309421 tttacagggg tgtcacgccc cgaattggct tgggagcctg gcaaactatc tgtatggtca
   309481 gctttgctga ttacgtcaag gctttgtaag ttatatgtag tttgtctgaa tagcgacttt
   309541 gaagctcata gttttccgat cgtagcatcg gcacctccaa gtaaatgagt tcatcgcatc
   309601 cagctcctac cctcccaaca tccaaaacat cgattcgttg tcgataccca agttgtccaa
   309661 tataaccatt tccgtttact tttttcaaaa cgccattatt tagagacgtt gatatgccgg
   309721 tatggccgtg aagttttttt tttccttccg ccttgatgtc gtggggaccg tatccgtcct
   309781 cattatacag agttacaata caagtacata cacttagatg agttcagtag agtttctttt
   309841 ttttgggata cagttgtttt caaggtaaac aagatgcatg tggacgtgga ctttttttcc
   309901 tgaccctgtg gaataatacg gaaggtatta cttgttgatg ttaacaggta ccattaactt
   309961 tacaggctta cgtgcatgct gacagtccac aagagcttag catagcatag gttggcgagg
   310021 cagatagtac tggcgatacc accgcttgtc gattactctc tcatcttctc tctcgggaaa
   310081 accactttaa aaacactatt atctgaccat ctgtaaggaa cggagaagag gagagaatta
   310141 acagaagaag agaggaagac gagagacgga aagaacggag aaactggggt ggaaaagatt
   310201 agccggagag aagagggaga agagaggaag agaaaaggag cgaggagagc ggagcagaag
   310261 aggccctcag aggatcggag acggaaggaa gaagaggaaa agggtgctcg agggggaagc
   310321 gaaattggtt agctgtacaa ctaaggaaaa gatatataaa gagctcttcg gatagacgaa
   310381 atgaatgtaa ccttcatatc cttcctcctt cttcgactac ctttccaaga agaccactcc
   310441 caaaaccctc gcagacttcg ctggctcacg aacctctaag ttccctgact ggactaagcc
   310501 gtggtagaaa caaacaaagt aacatcaggt actctccggc ctctccgagg acaggggtac
   310561 cgttacacca tccgcagcct tctagtaacc ttacccagcg tcttcctctt gaaaaggtcc
   310621 tcctttctct ctccaccaag tatttggccc atcaagtcat caagcaacaa aagcaggagc
   310681 tctgaaggga aatgaaatag tatcctaaat gatcatgtac ttgttttcta accctcccaa
   310741 cttctctggt aagaagtaag ggatgaaaga atgcttcagg ggagcgagtt gacttgtggc
   310801 cattcagacg gaaactagtg agctgaggag ttgataacca ggaatatgga atgatttgga
   310861 ggaggatctc cccctgtttc tattcatctt tggccgtcct tctttttacc tcctgtagct
   310921 agtgagtggg gatgagagca gatgggaaga cttcccaaat gaccgcaaag gccgataatg
   310981 gcagggcatg aaattaggct ggggtcgtga gggcttcagc ttttatcatg atactaaaga
   311041 ttaccgctat cgacaacaac caaacacgat catgaatggt gaagggatcg atcgagaaga
   311101 attgaaaagg gtgagagaca ggtgtgctcc gacgatttac aatcgaagta cgcgacgtaa
   311161 taccttcatt ctcaagaagg ccaatatcgt tgggctaaat gattatttta cggacatcgc
   311221 ggagagaaga aaagataaca tttgttacat atgcggcatg ccagcaggtg actcgcccca
   311281 ggtatccccc tttccccccg cctttcaaaa aaaaggcgaa aaaaaagtcg aaagtcgtta
   311341 aatcgctgta gaaacgggtg aagattacta gtcattcggc taactattat agccataaaa
   311401 agtgctgtat tggtaagaaa cggtagttaa gcacggcaac tagcagatct gatagtaata
   311461 gtaatagaac aatacggcga atcgtctgtc cccaccagga tggccgccga cgaactgcca
   311521 caacaaataa taacaacagc agagaaaaca cgcgcatcaa tttcacgtca cgtcagaatc
   311581 tgctgctgct ggttattaat ataataatta aatggcaaaa aaaattgcac accggaaaga
   311641 acggaagcta atttgcatat gaatcctcga aaagaggaga catgaccgac ggcccgcggt
   311701 gtcttgaatt gtttattggt cagataccct caagagtcgc atatcctttt tgcctcttct
   311761 tctgccccta taacactcca gccaccattc ttacaggtcc taggcgagat tttacatcaa
   311821 cgcatagggc taatataacc gtaactctac accacagggc cgccgctttt ctttgccttt
   311881 tcacgacacc gcttcatact tctctttctt gaccgtagag tcattttcta cctattcggt
   311941 cgcttggtaa gcgtatcggc tggcaaggat ttcaaccata attctgtaac atgaacgggc
   312001 caaccccaca cgacgaaata ctagcggacc agagccttgc gcctctgaaa cgtaaccacg
   312061 catgtcggca atgtaaaaaa cgcaaaacaa aatgtgacgg tgcccatccc gtgtgttcac
   312121 catgtcttcg atcgcatgcg catgccgctc gttctgcgaa tcggaatgga acaagtgtgc
   312181 ctgtgcttgt ttgtacttgg gccgacggcg aaggtgggga gaatgggagt cctcctattc
   312241 aggaacccat gcaacgcctt tctaggcctg ggtctgcatc tggagtgaaa agaccagcag
   312301 tctctcaagg ttcaagacca actcgcgacg aagagaatga gattctcaga cggaggatcg
   312361 gtgagtagct gaaaaggact tttgtgtggt cgacattaac ttttacgtta ctagccgatc
   312421 ttgaagccaa actcgtcaat ctatcatccg ccaccagaca atccgggcct gaacccattg
   312481 gaccagagct ctcgatgcca gaaaacaccc tttcaccacc acgctccgac agtatcgtag
   312541 ataattggat cacagaagtc ggacatatta tcagatatga tctcaatcat ttcgggacct
   312601 ttgggaataa ggaggcgcct tcgagcaaat cttctcagcc ctccgtttct tctttgaagg
   312661 ccccgcctgg gggtaatggg ggtggtatcg gaactaccca gacacgggag agcagcggtt
   312721 ccggcactcg cctcaatatc ggcactatcc ctaaagatgg gttctccagc agctttggat
   312781 tagacgacct tttcgtcata cctgctgatt ggccacgcgg tctgccatca ccttgtcagt
   312841 caaacattct tttttcgaga ccgtatgtcg ctaatacact tccgtagtcc tcctagaaca
   312901 cctcgtcgag accttcttca accacgtccc tcaaactccc cgaatgctcc atcgcccaac
   312961 tcttctcact cgtatcaaac tatcccccac ctctggcaac ttccccttcc ccggtctgct
   313021 ccatgccatc tgtgcaactg cttccagcca taccgcatgg gtgaataatc tctctcctca
   313081 tcagatcgaa gctgctgtgc agaggcatgt catcaccggt atggatttga ctagtatcga
   313141 agatttcggg ttggctcaag ccgaaatggc aaataggtca gttgaccttg ttgcttctgc
   313201 ttgtgtgatg ggtggagggg acctgatctt ccaagtcact caaacctgcg tgagttcatc
   313261 tccaccaatt aactgaaggg tttttactca taatatctat ctgtagatcc ttcttagtga
   313321 tatttacttt tgcaaaggtt tccctctcaa aggatggttg cttggtggcc aaccggcacg
   313381 acttatcaac actctccagc tcagtgaccg caacccgcgg aagtcataca aggagcctct
   313441 cttgccgcgt cctcgaaatt caagagagcg cgaggaacga ttggctactc tgtggatggc
   313501 gtttatcaat gattctggct tggcttgcaa cagcacttgg gtgcctagta tgtctcttgc
   313561 cgatataaaa tgcaatttac ctactaccgg tcaggaatgg tcaaaggtac gcacgtttcg
   313621 atttgcacaa tgacttttta atgctgagca caaaatacag ctggacgata tgctggaaaa
   313681 tccccagagt ccagagtcgg gagatctctt cacatcgtaa atatcttgtg atcctgttgc
   313741 cgactagctt actgaggttt catcttttat ctagtcatcc catggaagac gcattcgtgt
   313801 tggttatcaa gtctactatt ctgctgagcg aagttgcaca gtaagccctg gccgatgaag
   313861 ttgtcccaca agtcggatga tgactaatta cttgtctaga tggcttcgca actggtctca
   313921 acgaacacag gtcccaggag acgaactggc aggacctgaa acggaatcat tcaagactgt
   313981 tgtccgacat attgaggact tcatgtgagt gtaccattat atccatgagt ctaggtctaa
   314041 ttttccatac ttcccagttc aaccatccct aatgcgctga agaacgtatt taaacttgtg
   314101 gactctgcca actctggcgg cctcaacgtt aatcttcttt cactgcatat tttccccaac
   314161 gtcgcgctcg ctctcatgtt cgaacctttc attgaatgga agccgtcgaa tcagtgtctg
   314221 aaagctacgc aacaagcgta tgaagccatc ctcggtgtcc tgcaccttat cccgagtaac
   314281 ttggatgtca ctatggtctt tactcccctg atcgcttggt gagacagtta gatattacaa
   314341 agaggtataa tgtactgaca gacgatgaat agctctttat atactgttgg acgaatcata
   314401 gcggattatg tcaagtatac catgaggtct catcaataca gtctggccgt ccgttaccgt
   314461 gccgatctca ccactatcca gaaccgtgag tagatactct gtccgacgca aacatagtat
   314521 tcagcaaact tatcgcgacc ttgcagtgct cgaacggtat ggccaacgcc actctctcgg
   314581 tagcgccatg tcccatttcc tcgagaacta tgtccagtat ctcggaaacg agtgcatgga
   314641 ccctgcagcg atgtgcagca aactcgaacg tcaattggct taccctacca ataacggtac
   314701 ttatgtcatg ggcgcggcca acgatggtta tgctcatctt aacgaccccg gaagctcttg
   314761 ttcgggaccc aacgaccctc cttcaaccaa atcattctct gattcatggt cagccagcgg
   314821 tcctagtcca agcgtctcta cgcctgctat atcaaaaacg aacgaaccct ctcctgcaca
   314881 agtatattcc acggctgagg ggaaaagtca agatccaata tcgaattggg attggggaag
   314941 agaagccatc aagatgatgg gtgtggatgc gagtagatct gtttcggggc tagcggcgtt
   315001 ggatggtatg ccaatgtata tgggcgagag gtcgagcttg aatatggatg gtcggttacc
   315061 ggttggaccg ttttcggatg tagcagagat tgggggattt gagggcttgc attggaagac
   315121 gggcaatagt gataccattt agaaggagtg ttttggttgt ggagtataga agagtataat
   315181 atcacgggtt ttagtttttc cttttcctct ttttttggag taatccttag acagcggtcc
   315241 ttgaacgtat atatatgtac attttggggt atatgaattg atgatgtatg tggttaccac
   315301 gatttgttcc atcgctgcaa gggtatagaa gacattaaag taatcgtccc tgagcgtaaa
   315361 acacatatcc tccatcatct ctcatctccc attctccttc tcttcgaatt gtattctgcc
   315421 ttatgctgct gtaggacctc tcaatcccaa tcgaacggaa gcaacggggc cgtacttggc
   315481 ctcgacctcg tcttgcactt tttcgataga cttgaagtac ttgacagtct tgactcgaag
   315541 ctcaagggtg gcatcctcac tatcatcatc ccatgtcagc acaaggtcaa actatcaaag
   315601 accgccaaaa aaaaaacctc actcgcaaac aaccaaagcc cagggatgtg tctgcagagc
   315661 actagcagtg accatatggt ttaccgcacc ttcgatcatt tgactcaatg ccaagctctt
   315721 gttctgacca gtaaccacaa gtacaacctc cctagcatcc atgactgtct ggacgccgac
   315781 ggtgagagcc atacggggta cgagggaaag atcattgttg aagaaacggc agttgtcaag
   315841 gatggtctcg taggcaagag tcttaatccg tgtcctggaa gtaagtgagg atccaggcta
   315901 ttattccccg atatttcagt gagatcagta ggtgtctgat aggtaagcgg aaaacaatga
   315961 catacctcgt tgaaagcaat gtgtccatca gcgccgatgc ctcccaaaaa gagatcgata
   316021 ccgccaacag ccttgatgga agcttcgtaa tcttcacatt ccttgtagag atcttcagct
   316081 tcaccgttca aaatgtgtgt gttattagga ctatatgcaa atgagaagat atcgtttggt
   316141 cagcggctcg tccatttaaa agttgaggga gggaagcgaa tggctcactt gatgtcgata
   316201 agggagaaga aatttttaaa catgaaagtg tggtatgact cggaatgatc acggggaatc
   316261 ccaacgtatt cgtccatgtt gactgtgtgc gccactcatg tcaactccca aaccttttaa
   316321 accttttggt tgtcaccaaa gattaggaaa caagctcaca ggtaactaca tccttaaagc
   316381 tcactttctt ctcattgtaa agctcaacca atcgcctata cacgggtaaa ggagatgagc
   316441 ctgtaggaag tccaagaaca aagttcttgt gttctggagt gggtacaaag gagtttacac
   316501 ggttggcgat gtaatcccca acctgattaa tgcgttagcg tgaggctctg gagtatctac
   316561 ctctaagtat ccagcaggca agtcgcagga cgtcgggaca gagagccact cacgtagttg
   316621 ccgacttgct ctttggtgtc tcgaacagtc agtctcatgg tgcaatgtag gtatgaactg
   316681 tgagagagct tagtgaaagt gtatagaata tagaggagta taacagtggt ggcagagatg
   316741 catgaggagc ttgaaaatgt gtggtattta tatgagtaat ggacatggga gaacgttgca
   316801 tctacagatg cgcacaaaac gagacgtcgc ggcaatgacg atagggactt tgcaggcacg
   316861 gagaaataac cgccgctttc cccgatgcgc cgaggcggac ttcggctcga ctgtttttct
   316921 gccagtcctt actcgtccgc taaagatctg cgaaaatact ccgaacgcaa ttcgagcctt
   316981 cgattcgatt ctctcgttaa tgtagccatg tcaactacgg ttgtcccatt cgcaattcaa
   317041 gctcaagtta agccctacca gtcatcatcg cgagatgatt tcgaggattc aactaaatgg
   317101 tcgactaacg aagcctcctt tttcactgat gatctcaggc ttcagcctag ccagtaccag
   317161 caggattcta cacgcgaatc gtcttgggag tcgaaagact gaagttcgac ctttgagaaa
   317221 gttggcagag atccgactgg aaaacaaaga cttcccttcc tttcttctct tcaaaccctt
   317281 cctcagtcct ttatcgcgaa ctccgtgcga tgatcaaaga tccattatga tagtgagtca
   317341 tacggagtga aacggtgact taccttctta agaccttttc tttgtacttt tgagtatgga
   317401 agaagaatat taactgggta ccaatatata ctacgtcttg cagaggcgca gtgaaatctt
   317461 ctatgcgccc ctttcgtcaa taaaccgagt aaaattgaag gaagaagaag gtcacatact
   317521 gaacaagtga acaaatagaa agctactaca gaatcaaccc tattcgatct cgtcatagca
   317581 tgtcattctt tcagccaacc ccagctgtca acggtcctac ctccacacat caagccaacc
   317641 gccctccctc tcctcttcca aatgagcaat tttacttcct ctgtaacccc ccagacttcc
   317701 acaattgcac tcacccctcc caacgtcatc atcgaccaca ccacatttct cattccatcc
   317761 acacccccca acactgtcaa gtgcacatcc cccctgctct gtcacaaact caaatctact
   317821 tcccttgctc gccatcgtta cccgcacatt caccaccgtc atacactgtc cctgcttcac
   317881 cgccgtcata caaacccctt ccttcctctt cagacactac tctcctctta gcgcctcctc
   317941 caccattctc tcaagcaacc tgccctcacg cctcccaacg ggatacgctc ttaccaatac
   318001 attcccattc atgtactcac tgttttgagt accagagggg ctccctctgg ccttatggct
   318061 cgtatgggtg taccattgat tgggcggtgt tcctgcttgt attgttgaat gtactggtat
   318121 ggggatctgt gatctatggg tactggtgtg agtttacggc caaaccaatt ggctagcctt
   318181 cgtggggaag aaggttgggg ttggattcgg gggggcaggc tgtgtgggtg ggcaaggagg
   318241 agcaggatgg ggtcaaattt gttatggaga agattgtagg tggacttttg ttgattgttt
   318301 gatttaggtt ttggtttctt aatacctttc ctgtttcttc ccaaaatgta cactatcaga
   318361 acgtcctccg tatcgtatca gctatctatg catttatatt actacggatt acaacggtgg
   318421 atgaacaaga acattcactg gacaaggaca acaaaaaaac gcaaagtctc aatcaactgt
   318481 cacaatttat tcttcttttc ttgaatctgc cgacggtgtt cttcaacttt catcaaacta
   318541 tccaatacat aatactcatc agccaccttg tctcctctcg acaggagaat cgggagaaaa
   318601 atgaactcac cgccattcac agccatcttc aaattcacaa tacgcacatc tcttcgcttc
   318661 atgtatctct acacccttcg gcggtcgctc tcccatccag aactgcaaga cactttcaag
   318721 atggtccgtc aagaactttg gagagtgtga aaatgcacta cgaccgatta tagatcctgc
   318781 cacaagatca tcttttctct ttgcttttgt ctttattctt tcttgggaga taagaccgga
   318841 gagttgtgag gtatggacat cgctaggctt tttcgatggt gtagaagagg caagcgagct
   318901 ttgagaaagt gagaactctg gatttgaggg cgttgatgtt gaggggactt cggacgtggt
   318961 ggtggtaagg ttattcgtag cagctccttc gggaatgaca tcaacgctcc cgggtacaaa
   319021 cctatcacca cccgcacggt cttcacccag cccattttca ataacgtggg cgtaaaactc
   319081 atcatcagtc gaagtccaat actcctcatc ctcatgaaca gtactttcgt ctctgtcctt
   319141 tttgtgcttc ctggatgtag atgctggggt agtatggggc gctgatcttg tgtaggtggg
   319201 cgtgagaatg ggcgtggtga gataaggtct ggttgatgag gcatttgggt cgatattcaa
   319261 actttcagcg attgctagct ggataagacg ctgttcttcc tctgcttcca aatgcccatg
   319321 acctctgcta agcggcgctt cacctctttg aaattctact tccaacgcat cgtcttgttt
   319381 atttggtgat tctcgattaa aatctctttt ccgccgcttg tgggcttctc tcctttttcg
   319441 cttctttttc cctcctgccc atctatatac caactcaagc ctatcttcag tcttccccag
   319501 attttcccat tgttcccctt tttcccgtac gcctttgagc tttgtctctt tactataccc
   319561 caagccaagg tcctcgacat acttttccca cacctggaca aagtcttgaa ggcacaatgc
   319621 cttggtcgca ccatgtctca gcttgttgcc ttcgataacc atccgcccct ccttaaaaaa
   319681 ttgctcagag aatggttcag ttggggagag cgatagatgg tcgaaaagct tcttccaagc
   319741 aaagggtttt gaagctcgtg agggtaagat cgagaatgtg tcatctaaca gttgctgatc
   319801 agtcgaaggt gtagaagatc gatatggcgc aagcaagatt gcgtccagca tctccttgta
   319861 catcatgact tgtatctttc ccgccttaat gtcatcgtct cgtggcaccg ataatactgc
   319921 gcgtgtcttg gagtcggaaa tgtgcagctt gtgggtacga ggtctagatt gttgtgataa
   319981 tgcggtcgat ggcagatcca ctgaaggaga agtttggtcc acgacctgag aatgttttat
   320041 ggaggtgaag aagttggcaa gcgacgtctg gcgagatgta ttattggggg atttggatgg
   320101 ggtggtcgac tttgaggctt tcaatttggg agactcgact ggagaacgga cgatttcatc
   320161 ctatttttct ttttggtcag agggctttaa acgaaacttg aacatctaca gcatgcttac
   320221 aatgatacca aggaccagaa tatcgttgac aaatcctacg actggcattt ctcgacattt
   320281 accgatggtc aagagcgcct caacagcaga caacatattg aggaaccttg caaggcgatg
   320341 ataaattaaa cacattcgga atgaacatag tgtcaactca cctcagaccc catacatctt
   320401 cccgggtagt cgtatcgaca acgatctcat tagggtgtat ttccctttcc aattgtttat
   320461 gcactttctg tcggataatt atgagcttct gcaagcagca tagataaaga gagaacgctt
   320521 actcggcccc gattcattat cctctcgcca ctttctcttt ttctcttgtc aacaacaatc
   320581 tgctttccag atgtcgcggt gattacgtcg ggtctctcag ccagcggcaa gaacggtaac
   320641 gtccgtagcc gactatccat agctatttca gttcacatag tcgattcgtt gagtaagcac
   320701 caaacgtact agtcatacta caggaaggga actcagccga cattctctca catggccgat
   320761 gagaggaaat cgacccacct gcgtctcaca ccacactggc gcagccagat cagttacatt
   320821 gaagaagcct cgtttcctga actgaaagaa tggggcaaga gaatcatccg cttctcccga
   320881 ctcaatttgc tctgcgtgtt cagcatatac caagggagtt atcgtgcgtt gagagattaa
   320941 agagccatcg tcaccttggt ctgagacaat gtcctcaatg tctctgatta taaatggaga
   321001 ctctgctggc tgcccagcaa tcatgccatc ggtacgtctc actaagctct cagactgagc
   321061 tccatatcga cgttccgcct cacccattgc cttctccaat tcctcacgat cgaagttctc
   321121 ctcaaattcg aattcgtcat agttgtttct gacgctaact tgggctgcag atgaggctcc
   321181 cgtcatccct gggcccgatg gtagtagaga gaacctaagt cgatgctgtt gcccgcggag
   321241 gttgctggat cacaatttgc ttgaggaagt tggaaggtcg caaggcctgt tacaagtaaa
   321301 atgccatgtt tgtgagatgc tggatcggag agaatatttt atgtatagtt tgtaggattt
   321361 tgtaagtgca gtcaccaatc gactcggagg actgaatgaa gacacatcgg tgaataagcg
   321421 gatattctcg ctctctggct gttgttttga ttccgatttg cgagcagcct ccaccgaccg
   321481 ttgacatcga cctgcgcatc atggcaaatc taataatccc aatgtcgcac tttcgccaac
   321541 ttcatcagtc ttttgatccg ggtacaggtc agatttgcca agaccaatgc atcccatact
   321601 gctactaaag caccacaacg aaaaccaaga cttagagaca tcaaagacat gagtatgatc
   321661 aaagcggaat gtatagtaga ctgtacgaat gcaaatggaa atggtttcaa aggaatgtat
   321721 gttctgtacg tgcgaggtga aatcaaggag gattgtatgc attctcggtt taaccggtcg
   321781 tttatccaga accacccttt gacaatcgtc agcggtacgc aatagagatg aaacaattca
   321841 ctcacagagt agaccttgcc gaacatgagc tcctgggcct tgtcgtagag agacaagaca
   321901 ccagcaccag caacaccacg gaggatgttg gcaccggcac ccttgaagag agacttcata
   321961 ccctccttgg caacgatctg agaaccggcg tcgaacatgg acttgtagtg gacggtacca
   322021 ccggaagtca tcatcattcg tcgacggatg gtgtcgagag ggtaagatgc aagaccagcg
   322081 gaggtggtga cagtccaacc gagcaagaag gaagcaagga agttaccctc gagagggccg
   322141 acgagaataa caggcttaat ggagtcatct aagtggcaaa ttagatatca ttgacaagag
   322201 atttaagttt atgcttacag agaccgaagt agagacctcg gtagacaatg ataccgacga
   322261 cagaggggac gaaacctcgg taaagaccgg cgataccgtc ggaagcgagg gtcttcttgt
   322321 agacatcgac caaaccgttg aactgacgag aaccaccctt cttggcggac ttgttgtcgt
   322381 tggcgagacg ggtacgggcg tagtcgagag agtagacgaa gagaagagaa gaagcaccag
   322441 cggcaccacc ctaaatcctt tattagcgtt gacgcctctc aatgaaggga aaacatacgg
   322501 aagcgatgtt accggcgaac cacttccagt aaccctcaga cttcttgaag ccgaacatgg
   322561 acttgaagta gtccttgaag gcgaagttaa gagcctgagt agggaagtat cggatgacgt
   322621 tggcggtgtt acctcgccag agagaggcaa gaccctcgtc cttgtaggtc ctggcgaagc
   322681 agtcgccgac acccttgtaa ggggtagcaa gacggccctg cttgatcctg gcagagggtc
   322741 agcagggtcc ttagatctga attaaccagg tccacttaca tctcgtcctg gttttggacc
   322801 aagagcttaa tacgctcaat gggggcagca gcagtcttag agacagcggc agagacacca
   322861 cccatgagga agtcagtgag gaacgccttg gcgtccttgg gctttcgggc aacttcagac
   322921 atttttacta agacgaaagg tcagcgcctt ggtaaaaaga atgggaagtc tgcgcaaagg
   322981 gtgatgaaag gtcgccggaa caaaaggagc tcgagtttca atgtcgaata aggacgtcgg
   323041 acgtcctata cacgatccaa ttttttttcc tgttcttctt tcctcgtaaa acacggtgtt
   323101 aaacacgcgc attctttttt acctagtact ctcatccaat gccgccatcc gtttgcaggg
   323161 aaaaggggaa gtaagactta cttcgtcaac ctcgtttcga cctcgtacag ggagaatgaa
   323221 aagagcggtg aagtgaagta aaaagaaaaa gaaagaaaga gataggaata aaaagggtgg
   323281 gaaggggacc acggggcgac tggtccaggg tccaaagtgc caacggcagc acggcgcgga
   323341 gatatcggaa cacctcggaa gtggcacccg tattggcccg gcgtttcgct gtaaaaaact
   323401 ccgaatcgtg gcaaagcggt tactgccgtt aagtcatctt cgttctttcg gccccttcgg
   323461 ctatcgacgc gttcgttgct ttcttgcccc gttgatgata actcttgttc attcttaatt
   323521 ctagaagatg cttgtcatct tcttccgttt tcttctgctt ttaccgcgct gtacgactcg
   323581 gtatggtaag tcagaagatc caaggtggta tgcgctgaat aactcaggga tgcctatctt
   323641 tgcatgctga tctgatactc gtgatgtctg cgagtaagta tgacagtaaa tgcagcgaat
   323701 gctgatatag agagccctaa ctgttgtata cggtacatgt cgggcaagcg cttccataac
   323761 gcataaaagt atctttcagc tacatatatc cactgtattc tggtaatcat tttgacttct
   323821 cgtccggaga ccacaaactt cctgcggaac ataccactcg caccgtaacc ctgggaaccg
   323881 tttgttgtct attattgagc ttactaccca gaaccgctct attaatcgtg ttagtcacat
   323941 caccgccatt tatttagagt agtacccaca gaataaacct tgccaaacat gagctcctgt
   324001 gccttgtcat acaaagacaa tacacccgca cttgcgacac ctcgcaagat gttggcaccg
   324061 gcacccttga acaatgatct cgagccttcc ttggcgacga tctgggatgc agcatcgaac
   324121 atggacttgt agtggacggt accacccgaa gtcatcatca tacgacgacg gatagtgtca
   324181 agcgggtagg aaacaaagcc agcagcggta gtgacagtcc agccaagaag gaaggaagcg
   324241 aggaagttgc cttcaagaac accgacgaga acgacaggct tgacagagtc gtctgtaaga
   324301 tataagcgaa ggcttccatt tatttattga agagccttac aaagaccaaa gtaaagacct
   324361 cgatagacaa caataccagc cacagaagga acgaaaccgc ggtacagacc gatgatacca
   324421 tcggaagcca aagtcttctt gtagacgtca agaagtccgt tgaattgacg ggtaccaccc
   324481 ttgcctgcgg acttgttgtc attggcgaga cgagttcgag cataatcaag tgagtacacg
   324541 aaaatgaggg aagaagctcc agcagcggca ccctgtcggt cgcattagta aagacttctt
   324601 ggcttctaat ctggaaccca cccactgagg cgatgttacc agcaaaccat ttccagtacc
   324661 cttcagatct tttgaaaccg aacaaagtct tgaagtagtc cttaaacgca aagttaagtg
   324721 cttgggtagg gaaatatcgg ataacattgg ctgtgtttcc tcgccagaga gagacgaggc
   324781 cttcatcctt gtaagtacga gcaaaagtgt tgatgacgcc tttgtatggt gtcgaaagac
   324841 gaccttgttt aatcctacag aagctcataa atatggctca caggcatctt ttaagaagag
   324901 tatggcctac atctcatctt ggttctgaat caaaagtttg acacgctcaa tcggggcggc
   324961 tgctgttttg gagatggctg cagacactcc acccatcaag aagtttgtta ggaagccaga
   325021 gacatctgtg tcggttggtt ttttgacagt agattcttgc actttggaca tgtttactgt
   325081 ttaaggggcg gctgtctcat tcggtcatga caagtaaatg cattttcaca aggcacttac
   325141 aaggcttgga ggcaatcagt atgagtcact tcttgtcttt caccgagggc tggtaacgtc
   325201 tgcgaaaagt gtcgtcggta ccgtgatcaa caagtcaata tacccgataa cgaattacga
   325261 agggactgtt acaataatta gggcggggta gaagaagaaa taagaatatg atgagagcag
   325321 agatggaaat ggatcactaa tcaacactcc tttttcgtcg ttcttaatac gatagcctca
   325381 cggtggtggt gcacatgatg tatagcggct catacatatt cgccacccag tacgcaaagg
   325441 acaaagccca atcgtctcat cgatgaccgg ctgtatgcat gggcaagcat gtcatttacg
   325501 agatctttcc gttcatttcc catcacaaca gcattttcgg gcaccatgcc tctttccgac
   325561 tcttaatttt cacatggcgt catcaatagc ccactaacac cgccgagcct ttgtttgaca
   325621 tgaactatta ataagtagca cttcagcaga gctcagtaat attcatagaa tcaagcaaat
   325681 cgctttctat cgtgtttcga aagttggatg atgctgacct ttttactcgc aagatcagaa
   325741 cagcatgtta tatgtctaac tctgattcgt tggagatggc aagagctaaa aagatgacgc
   325801 caatacgtaa ataatcagaa tgataacgat tgattgataa aactgcgacc agcgcggcga
   325861 caggtcgacg gatgaaactg attattcgag cctcgcgtaa tcagaggtct taccatcatc
   325921 cattcaggct ccatcctcca cgcaccttcc tccgtcgtct tctccgctat tctttgttcg
   325981 aacttcaatt agttcgcaaa aggtgctatg atagtgtcat aatacttcta ctcacctcca
   326041 tccatatcgc cgttgcacat cagggtgagt catagtagta ctctcagcag tgggcatcgt
   326101 ggatggaagg ttacaataga aacttcccat tcatcacatc aactgtggag cgaaggtagg
   326161 ttgggcaggg gataggggaa gatgtcggag tgtccagccg caatctggcc agcagagggt
   326221 tcattcttgg ctagatgacc tgttgttgat gataaaatcg ggagcttact atgtatcaaa
   326281 ccgttcacaa gtcagcagct catgacggct ttcctatgta atcaacaacg tatgttttct
   326341 catctccgtc atcctaaagc aggagcgaag gatttgattc cacatctgca tgacggcctg
   326401 actatgcctt atgatttggt agcagaacga agtattgagt atttagctgt tggtcgatct
   326461 gaatcagaat gtgcttttag ttgattccta aacaatctca tgggagctct ttatccttag
   326521 actgtgttag gcagttgcga tcaatagcct agccagcatc gggctggcat tatttcgtag
   326581 aaaaggctaa aaacctgaat ttcaagtcac ttccaatatt ggtcgtcatc aggaacttag
   326641 catgcaaacg aaaaacatat ttccaataga agaaaaacaa aagagcgaaa gcgataaaaa
   326701 ctaataaatg tgaataagag attcgagcct ttcgaataaa cttgcgccgc ctacccctaa
   326761 ccttcttttc tcttcgactc agtaatgatt accctgccca tcttcatccc tcacccgcca
   326821 tttcctgtta tctagatgtt gcgaacgacc cctcatagct acatattgac atttgtcata
   326881 aaaacagatt tccaagaacg ggaaaaaggg aaagacaaaa aattaaatga aggtacttga
   326941 tctggccgat gatgggagca gtttacttgg attctttggg tccgggagcg tactcttcct
   327001 gccctggagg gtgggcaatg tccatcttgg ttcgcacgtt gtagaatacc ttgaggaact
   327061 gtacacacaa ccatcagttt gaaactggtc aattgagcgg gaaaaggtga tataccttgg
   327121 tcctcgcacc ttgcgccgag ataccattgt cctgcagatc ctgatctgtc atcaacacca
   327181 tgtcgttcca gttggacttt tcaaagttgg gcgtatattt ctaacggttc ccgtcatcag
   327241 catccaaatc ataccgatag actctcaaat gtggataagt taaagactca catgcaatct
   327301 gagaactctc agccagttgg gcacatcctc caaaatcctc acatccacat cttcgggtcc
   327361 tgccacacca gcgccaccac cagcacctcc accaccagtc tgttgaccag gtgcggggga
   327421 gtgggacttc atagggttgg gacttcgcct tccaagctgg tgctgttgtt gatgttggtt
   327481 gtggtgttgg ttaagatgcg aagactggtc tcgactggcg ccacgtcgag acgggttcaa
   327541 ccccggctga aggctagacg cggagacgtt gaacggcgag tattgggagt tttggagttg
   327601 ttgttgcata gcgagcatct gcgccgcttg ggcttgtgcg gcagtcaaac cgtttaagcc
   327661 agggttcaca cctcccaatc ctgcaaggtt gtagttcagt ccgagattag ccaacgttgc
   327721 gggatcggca ccgataccca agccgcccaa accaaactga tccacaagag gcgagcgtcc
   327781 cgctgttcca aattggttag gaagaaggcc agagggtgta ccaggctggg tagtatgcgg
   327841 attgacaatc tcaccgtcgt cgttgtattg gcctgagacg ttacgagaag tctggccgga
   327901 agagtaaccg ccagtgggcc gtcgatactt gcgagcatca tcaagaggaa ggtaaccagg
   327961 gttgttgagc tggagggtcg ccatgttgag agcctgagag aggtcggcga cgctagcagg
   328021 agcggtgagc ttgccatcat tgaaattctg tacaaggggg gtgttgacca tgctcgccca
   328081 gctggcgtta ttcccaaacg gactggccat aggggactca tgtccgatac ccaagccaat
   328141 accggggcta ccagcagaaa ctcgaggaga gcgagggaag gcagtgctgt cacggtggag
   328201 ggattctcga ggtttacccg aaaagtcagt agacttgggt cggggttcag gagtgggcga
   328261 cttgcttcgg ctacggccag aaatgttact ttccaaaccc ggagatgtac ctcgctcgat
   328321 cacctgatca agctgacctt gccacctgtc gtgcggctgg agtgtaccag gagcggagat
   328381 acggttctgc cttgctttcg cggcctttgt tgcagcatca tctggagcga gatagtgccc
   328441 attaccagaa gagccagtga aaccggctcc gccgcctgcg gagggggact tgaggttcat
   328501 attggacagc ttggactcga cctgagtctg gaaagagttg ttaccggaaa ggctggggga
   328561 gaggagagca gacatggggt cagattggga catgtggtgg agcaccgaaa tgaagaaacg
   328621 gatctggacc ggagtggaat attggagaag agagtacaga gcggcagtac gctcagcctc
   328681 agagagaacg cggaaccctg tgtataatca gcggcggccg taaagctgga ataaatgact
   328741 tacattgctc aatcgcgcca agctcttcgg taaagttttg gtctgtgctc gcagccgcca
   328801 tttcttcaag ggtcgcttcc cagttagcaa ggtgtttaaa ccattgatca atttgctccg
   328861 ctattcttgt gtcagcacaa attcatgatg caataaaaat cgacacacct tcgggagtct
   328921 tggcctcgcg ggtaggaatg aattcactgc tcggcctagg acccgtagtg gcagaaacgg
   328981 cccttccgct gccaacgccg cttggcctgg ggctcaaact gtcccggttt cccataccca
   329041 tagcgacgga cgagctcacg tgtctgggtt ggctagagga gctaggagac gcgagtccag
   329101 ggcccaagcc gagggatcca aaacctttgg agttaccgga tgtgggagga ccaagagatt
   329161 ggcgggtgag tttagccggg ttggcaaggt taacaggagg ttcaggggag ggagaggggg
   329221 aacggtgagg tcgaagagtg tgggaagcca tattgtgcca gttgtgtaga ttgattagat
   329281 cagttgcttc aggagtagta taacacgagt tgatgaccag ccgtcagacg gacctgcacc
   329341 gggactgtgt cgccaaggtt agctaggcat gaatgagtga cgtgcgaccc acagaatata
   329401 aggtctatgc cacgagataa aacagggtgc ggggccaatt aggagcaatt tgtaccaatg
   329461 acaggggaaa catgtagttg aagagggata acaaagaaag acatgccatg ccagcatcag
   329521 cgccacattc tcttctacaa cttcagactc ttcctttgat ggggcgacgc gcttcccttc
   329581 tcagcgggca cgcgtctgct tcaccgaagg agaggcatgg actcactgcg ttggtagaga
   329641 gcgtgagtgg gtgggattat gagactatgt gcaggattgt gaggcctgct cttcgttata
   329701 agtaaagagt ttggacgttt ctgcgtgatg taatatggga ataaaagaga aaatatacgt
   329761 aagtacgctg caccaccacc ccggcggggg accagcagcg acgcgcttcg acaacgcaca
   329821 aatccagtgt ccgtgtggcg aatcagtttt cttaactgtg ctttgttata ttaattactt
   329881 tactaatcga atttttagga atagggcggc cggacctgaa atgctgatta gaagctgtca
   329941 ggacctgggg gttcctcctc cctattaagt ggccgttccg gtgacttaag caccacataa
   330001 gtaatggtct tttattctac atacccaaga acagcagttg attaattgat atgcatgcgt
   330061 ggctccattt ggggggcgca tttccgttgc ccctttattt actcgttgaa atcggcaatc
   330121 ccaaatcgct catcattaat tggtgctgaa tcctttcctt cttctgaaaa aagtctcctc
   330181 cgttgtttac tataatatag ccaatgagta ccaaaaagga ctacagttga gatggtcgag
   330241 tcttcaaaat aaacgaatga gctagagtca acgcaaggaa gagttaagtc acatatataa
   330301 ccgctggttg ccccgccacc accgttgttt gtgttaagaa agacggactt tttcaccacc
   330361 tgtcactcat catagtcctt gttcctcgca cgtgatgctg taatgtgatc ccttagctct
   330421 tgggaacttg aagtttcagg cggcgatgca ctacgcaggc catttcagtc acagctcata
   330481 aaaatgctct acttttcatc ctatcatcat tgttgaccta tgcattttcc ttgggttttt
   330541 atctacaata ggacaacttc aaattccttc ttttataagg tttcgccaag ctaatcgccc
   330601 gttaacctgt tcacctctca tggaggtcca tttcttttct caccggtata taacaacaga
   330661 agagagtaaa agaaagataa tgtccaaatg gtttgtccta tagggaaagg gagtaatggt
   330721 atatcaacca agtaagtgtg tacaatttgc ccaactaaag tgaaaagaga aagagactaa
   330781 atcaaagtta acgaaggggt atcgcgcaag aaggggttta ggtcgtgtaa acatcattca
   330841 caaattgatc aatgactctc aacatccctt agatgttgat ggcccctaac aggagaccca
   330901 atcctaacaa ccctcccatc cactccaccc tctttcctgc agaagtcttg gccccaccct
   330961 tggacgtact tccccctccg gatccttctt ttccgttact agtggacaag gttcccacgt
   331021 ccaccgtggc acttccagag cctattatac tcgtcggata cgtcgatgtc gcatcctccg
   331081 aaacgctgct ttcctcgaga gcctcgtcag tgaggtatac tagggccaca gaaggtgcag
   331141 ggacaggcac aatgcaggca cctccatcgc aggtaatggt aatcgtttca aggtcgccgt
   331201 acagtcttcc gtcagaagcg aacgactgac caagagtttg gttggcccaa taaatatcgt
   331261 attgctcgct cacactggcg gctcggaaat atcggacctg tacctgggtc gggctctggt
   331321 tttggatgtc gatggtaacg tcaagatcgc tgcccccagt ggagtcatcg ataaaattaa
   331381 agagcaccat acgagcgaca gcgtcgttct cgtagatggc atagatgggg tggtaaatgt
   331441 tattggcgtc gtactcgggt aatggagtga gatccaccac ttgcgaagcg ttggatttgc
   331501 caaatgcttc ggcaatgacg agagtagggt agtaaacgga tccgggagtc cactggcgcg
   331561 tactggaaag gttggaaggg ggaggagtga agggctttct cagaaataag ccaaaagtat
   331621 cctgatcgaa gaagtgtagg aaaaagctta cgttgtagta gacattttga ccgccgacgt
   331681 gcattaaggc ggcagaaaag ttggcgtacg ccatttgaag ggcaaaatcg gtcatcctga
   331741 tattctatca gtaattctcc cttattttaa tgttcatcaa acgcaccaca tggcagcacc
   331801 aaagctgtca cttaaaccag caaaaccacc acaactcgcc gtgttcgtct ccaacatcac
   331861 caattccttg ccagcatttt gcaccaggac tgaatccgca aggtattctc ctacaagcgc
   331921 ttgagcacta gtatgattca agaaatcact gaaaatgtct tgagcttcga ttactttacc
   331981 gttgacttta caattgtttg tcgggtagtg ctgcacggta accgctgaca atctgtcaac
   332041 gttttcatcg agccagccgg cattgataag gtctgaaaat tcgaagccgg gaacattgca
   332101 gcatagagaa gggccgagga aagcattgtt attgagcaga gaaccattgg agacaatgga
   332161 cttgactacg tcatcgtact cagtgacgaa atcgctaaca ccccagcctg tagatcggtg
   332221 gttatgattg acatatctgc tacctgtcag cgcgctgtac tcatcttttc tatggagttg
   332281 cttacaaatc aggttcattt cccacactta agcctaaaag actgtcaccc aaaatttctt
   332341 gcgcccaatg agcggcaata gggatgttcc cggtgggcga gtccacatcg gactcgttga
   332401 aggccaatcc aaaataccat tctgctccta caagggatgt aatgttggac atgatgtaaa
   332461 acagttcagg ggaatagttg atgagaggcg tgtcggtcta agctcaaggt cagtcacgct
   332521 actctttcgc cctttcgatg tccgtgtata atgagactta caacgcccga gctgactttt
   332581 atcttttcca tggcaacacc gccctccagc ccatcaacaa atatcgtact tccttcctga
   332641 ctatttcctc caaccctgat aattggtcct gcccccgccc gattttggat gttggccatg
   332701 aaattcaaga aaggcacctt gaggttaccc gatgaacttc ctagcagact agtggcaacg
   332761 gacagttcga tggagaaccc aaggaagtta cctttttgag gtatggacaa tgacaaacct
   332821 tcgcttgcta ctccagcacc atcggacggg atagtgaggg aaagggaagt gactgcaggg
   332881 gacggaggag ccggaggagt gagccgagtt gggtcgtatg ccgctaagcc ggtgtatgtc
   332941 tcgctggcgg ctagagagga tgttgcggta ggcgtagtat cggtgtagag tgtgacttcg
   333001 tcggcaagga cggtgtgaga gaagatggat agaatggaga agagggcgag ggtgaaggag
   333061 aacgggattt gtgataataa gaccatggtg tgatggatga ggatgccaaa ggtgaatgat
   333121 tatatgaaga tatagaatag gcgttggatg ttatggtttt agaacaatga atgtatgggg
   333181 gatagttgta acctggtgtc tggtgtatct ctgatggatt tggatagatt cctgtctccc
   333241 atcaatggct ggggccttgg gaatgctcgg agatgttatc ggatgtcgag tattattggt
   333301 tggatgcttt gggtattata cggcacaaat tatacaaaca acgatcggct aaggtccggg
   333361 ctgaagcgtt gatgaggacg tgcgagatct tgaggcgtcc aggcgctcga cagaaccctg
   333421 gccactatgt atgggaagag gatggaattt aaaacgattt aacaggaaat gcgggcagtt
   333481 gtaaaacggg atgtgcatgt tacagtcatg cttgggtagg tcgcaatcct tcgtatttcc
   333541 cttcctatcg ccctcttcct tcttcctctt cactctttcc atcacaaagg aaaatcgatt
   333601 taccatcttg ggtaaacaga aggtcggctt gcaccgattc acggtcctaa ttaataaata
   333661 ataaatattt atgcaatcaa aacaaacttt gcttccgcgc atccgttccg gtggggcctg
   333721 gacagggacc tccaagtccc tgatgcccta ttccagcgat tactcgctca catgcacccg
   333781 tcatctcctc cgtttcctaa cccccttatt aataggccat gtatgtgcca gttcatgtga
   333841 tgcctccatt gccaagcgtc aaactcaaag agagagctct gaacttaata tctggctatt
   333901 tgattgtgaa cggagaaaaa caagctgaac caaatatgca atgcgaagaa tggagaatga
   333961 aatagaagag cagaagaatg ggcagaagag ccaagcccaa acatcctccc aaagctcatg
   334021 acgccataac ggctttgagc ttgtttgggt catcagggga aaaggtacag attacagggt
   334081 aaactagaaa atcggctcca gaagacaaaa agggcaaaga gcaacattca acagaccaac
   334141 agaaaataaa acaagcaaaa caacgcgtac gaacgcgctc gagcatctgc tgacatttcg
   334201 tggatttcaa gccatgtagg aacatt