GenomeNet

Database: RefSeq
Entry: NC_006684
LinkDB: NC_006684
Original site: NC_006684 
LOCUS       NC_006684            1632307 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 2
            sequence.
ACCESSION   NC_006684
VERSION     NC_006684.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 1632307)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 1632307)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1632307)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 1632307)
  AUTHORS   Donlin,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JUL-2005) Biochemistry and Molecular Biology, Saint
            Louis University, 1402 S Grand, St. Louis, MO 63104, USA
  REMARK    Amino acid sequence updated by submitter
REFERENCE   5  (bases 1 to 1632307)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017342.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1632307
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="2"
                     /note="MAT-alpha"
     gene            <638..>2012
                     /locus_tag="CNB00010"
                     /db_xref="GeneID:3255770"
     mRNA            join(<638..1652,1711..>2012)
                     /locus_tag="CNB00010"
                     /product="hypothetical protein"
                     /transcript_id="XM_568747.1"
                     /db_xref="GeneID:3255770"
     CDS             join(638..1652,1711..2012)
                     /locus_tag="CNB00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568747.1"
                     /db_xref="GeneID:3255770"
                     /translation="MDGAITPDASLIGNVNDPSSPSGWKEMLYAVIEVKWMRLAALLT
                     GEAKSQTDEKALSYLCQEGVFQTMWYVILGYAISRCIFGLSIVNEYFYRIVYLYQDSA
                     SDSPVLALEASNEFLENAGRHFGYPRDGYSVEELAELQDFWSSPPNCLISDRANATLN
                     KEARYHLDATILFFLAHAAALPTQRFLNDLPLPFAHHVPVEATAHSATDMKLKGLEVG
                     RRRHSLRSTKRNKRTLADLYDEEKGEEDKPGDRQDKSGDRKPPGKDNRNNDPRNDGSQ
                     GGNPGSGGDNSRGGGSDPGGDNLHGGGSGPGRGHEGSDSRDVGGNEGSEWKSSIIASL
                     ISNPHTSSSVAPSSPSVNSTASSEDVHFPDLSLDSNDRTLVHGDLSTDPLPKVHKSSP
                     LDLDLEDIDPESGELTLAAYKDRLALLGVRVKLVTREEMDVLLARG"
     gene            3551..4274
                     /locus_tag="CNB00020"
                     /db_xref="GeneID:3256010"
     mRNA            join(3551..3693,3765..3968,4060..4274)
                     /locus_tag="CNB00020"
                     /product="expressed protein"
                     /transcript_id="XM_568748.1"
                     /db_xref="GeneID:3256010"
     CDS             join(3668..3693,3765..3968,4060..4108)
                     /locus_tag="CNB00020"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568748.1"
                     /db_xref="GeneID:3256010"
                     /translation="MAEQVDTATDVIQQNAGAAQSAVDSKRDAALGPLRSHRTPLPNE
                     LAELTPEEQPGGGRKKDDNTLSINIALDLLVEVHLTARVKGDITIGLL"
     gene            complement(4868..6217)
                     /locus_tag="CNB00030"
                     /db_xref="GeneID:3255866"
     mRNA            complement(join(4868..5422,5493..5998,6052..6217))
                     /locus_tag="CNB00030"
                     /product="uroporphyrinogen decarboxylase, putative"
                     /transcript_id="XM_568749.2"
                     /db_xref="GeneID:3255866"
     CDS             complement(join(4943..5422,5493..5998,6052..6208))
                     /locus_tag="CNB00030"
                     /codon_start=1
                     /product="uroporphyrinogen decarboxylase, putative"
                     /protein_id="XP_568749.1"
                     /db_xref="GeneID:3255866"
                     /translation="MPHAIPKLDLVSSWRDIQFPPLKNDLLLRAASGEETPRAPVWVM
                     RQAGRYLPEFLEVRKHHSFFECCQTPSLASALTLQPIDRYPRLDASIIFCDILVVPQA
                     LGLEVLMEPSRGPVLPNPLVTPDDIKRLRKDVDVQKELGYVFEAVTLTRKGLDGRVPL
                     IGFCGAPWTLMAYMCEGGGSKTFEKSKSWLYKYPEASHELLRRIADVCADLLIGQVLA
                     GAQMLQVFDSWAGELTPHQFKTFALPPLLHISSKVHSVLSQLSHPGVRITLFAKGANT
                     PSTFSLLSDPAQTGYATLGLDWTVDPVEVREIVGKKVNLQGNFDPTVLYGGKEGIEKE
                     VERLSARWKEAGGGWIANLGHGITPNVKPEDMGWFLECVHKYSERK"
     STS             5972..6321
                     /standard_name="Taq1"
                     /db_xref="UniSTS:470941"
     gene            6350..8901
                     /locus_tag="CNB00040"
                     /db_xref="GeneID:3255586"
     mRNA            join(6350..6564,6625..7070,7167..7494,7575..8113,
                     8251..8901)
                     /locus_tag="CNB00040"
                     /product="WD-repeat protein, putative"
                     /transcript_id="XM_568750.2"
                     /db_xref="GeneID:3255586"
     CDS             join(6370..6564,6625..7070,7167..7494,7575..8113,
                     8251..8611)
                     /locus_tag="CNB00040"
                     /codon_start=1
                     /product="WD-repeat protein, putative"
                     /protein_id="XP_568750.1"
                     /db_xref="GeneID:3255586"
                     /translation="MPRNKKRSQRQPSPLPQRQEIKHDWKKDDEELELEQALFGRKQK
                     KFKPDNNNDEESGMSEVEDNDLFTVDAPLAPEFQVDLDGDGYEYAGGDGNNDSDSDIS
                     GDENEFRAFSPSPSHDRSIYGGSGSESGSESEDETDRPTITLPDDIIDLPSSHDEELS
                     RSKRVPLWNDPADEMAKVDISASRRLKKIDRGKRKTVEGELVGGKELQARLKEQFERL
                     HPPPEWAKRRTLPGTPSLSSLLTSNKSFISHSSLPSAQDPLARPPLPPGTIDLKRVRN
                     ANHTNPTVSKREAEGGKGGVVDMAWHPSRQVGVLAIGGGDRRVKFFQVDGHTNPTLLT
                     LHVPSLPLSKLTYHPSGTSLLLTGSRPFYYTYDLSSQKCLRSPRNLFGSVASREGDAP
                     NELSRHTFSPDGSLLAVAGRRGAVSILSHSTSGGGVGGMVAELRSGRGGTATALSFSS
                     NGKYLSVLGGRDGAEVEVWDVAQRGVVGKWRDDGMRGGGVMETSRDGGWIAVGSNTGL
                     VNLYSPSLLPPSTPSPSTTLTTQATPLKTLSHLTTPITSLSSHPSSSILCISSSTRKD
                     QLKLYHLPTGNAFSNWPTQGTPLGRVTTTGFSESGEWLGVGNAGGKVLLWSLRHWA"
     gene            complement(8908..15563)
                     /locus_tag="CNB00050"
                     /db_xref="GeneID:3255846"
     mRNA            complement(join(8908..10636,10702..10801,10869..10959,
                     11013..11465,11594..11713,11790..13773,13843..14818,
                     14878..15563))
                     /locus_tag="CNB00050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656419.1"
                     /db_xref="GeneID:3255846"
     CDS             complement(join(8965..10636,10702..10801,10869..10959,
                     11013..11465,11594..11713,11790..13773,13843..14818,
                     14878..15487))
                     /locus_tag="CNB00050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512100.1"
                     /db_xref="GeneID:3255846"
                     /translation="MDDLTPLPTTFDPDNDDFDVEDRRGLGHGGGEVDEDGEGDLLIV
                     HGEEEEEEQEEGNEGEGEGEGEDQTNLMEYIASLQQIGEHDNDGNQDQDQDQDHDTET
                     GDNTHEHGHDAEVELGQEMEEESTGQVVDTELGEADRNRDSPPDPNPDPNPDPITVPS
                     YARLQSEQQGQESNVISGPMEVEMEEEELGESIEVDPGQEPGELHEPEPEPEPEPEIQ
                     REASSPLSDLPDLPDELEFSPPPSPGPFAPSRNGQRHRQPSSNSNNSNMGTGMDMEVD
                     RDSSLTPLYDDYDHEGGGKDGVGLPRPRFRAESSAAGARRSASMSHANATKRGRNTTR
                     NRDSRGREKQGRRSSLSFSSSPPLESIEVAPDIAPGTAGTLGAGRKKRQRERASKGKL
                     PLRHGHERGDGLSDGEGDNEFELVPKSAKRSKSAHPFPASHAASHAASASHPPHHPSR
                     KPLDPISTGLKLPGPRALPPSRPRALNDQSIKKFLVGKTEEVQLGICLRERYKKWGKC
                     TQCVSKLGGDCCRFRDYRVFPINPKTTEITGPGYFKSTTWPEPLTPLPTKFTSPLDGD
                     KVEEIQRTVAGVLLPLITGEARHCFWPFHLQGRGKRDGEGEEVSDPAHSTHRARNPIT
                     LHRGVDTALHRSVCDFCSSTIFGGYYFCKKCGRDYCLQCERYFPESMEAVGESPWELT
                     DAARPRLLKCIKQPWEEMMSGGGGEMGGDSTGNGNGNGSTRTNTTNANTDGGSNTNKN
                     GRKREKAIAWHVRSDLQPVSRFTKEEIEGHWLSLAEFVIGHGYGPDASSGSGSGFDFL
                     FGADDGDEPEGEKKKEEWRLQWERMLRLMGLQMDEEVKSVLEQWSKNARVVREKESGS
                     VTHLGPGANVESNLDTDTNSHPVNQPESSSNNPIDSQAPIDKTSTSVRRSAAMTTKNE
                     NDNKLEPEMDEVEELETGEPKSASEMLKGMMDKENGEETSAAHTGPAASLNSVASAPA
                     AVRSSTQVTKVEIPVAANASPTVSSSSSPQANPPFEKSGLPSASPLRSVPTSGNFRTG
                     SNPMPDQQQDLEKIAFSYTKHTHPNPPSDPASLSDYSLPFIYLPSPEGLDNKAFDELW
                     SKGEPIVVGGVNVYVGGGGGRRRREEGEKMGKEGEEWGPEKFIERFGEEQCSVVDCQS
                     DTPLVSTVGAFFAAFGESVGKPWEREGEDGKRKEKKRQGILKLKDWPPGDEFVDTHPE
                     LYHDFCAALPVPDYTRRDGVLNLYSHFPPGPTRPDIGPKMYAAFAALETPGGFGSTRL
                     HMDVADAINIMLHASPIPDDSSSLEAPISSATCSTSPSSSPEITLGTDSKIPSRPGCA
                     VWDIYPAQDADKIREFLKEKFDKTHNFVDPIHSQMFYLDAKSRKELWERKRVVSWRVY
                     QYPGQAVFIPAGCAHQVCNLSDCIKMALDFVSPHNVPRCQQLTKDFRRENYLKAWKED
                     VLQLYNVLWYAWLSARETIARREKEVAAAEARQKQLQSFQLDDSNSPLFQSKHPTSSP
                     LCSATPTITSTLDLDASSRMGYDRLNMGIGLGERGMGMGLGRVGMGSWGNVSSVRDEP
                     PRGGPLLLMLNDESEKVSRGQLTEGEKSSEPVRGKGEDHEKSDQGKQLSSDPVSFASS
                     LSNSYSLQLAKSLFTLSLQRDETNPSELFVPSAAAMNHRPRGPSLPDSHSSIAHPRTS
                     SRAPSTHTMDNRSSQTSASVRTKDIKEKENKFTPPKKLKNPARPLRTSTLIKLGAKRM
                     DEILELARGDLGEGESLSNALGGLGNFAELGTMESHGGMQGWAGLRAMSESVRSREDG
                     DREGSPLVSINDVHNSNSSPNAETDTSTPPDDAIDRTDAEAAADIAAEILSMDIDHQE
                     DETNIEDDGDLEGLRRIVERGILEQEQGQEQGQEQEREQEREQEDDERDNELGEEGRE
                     AIASIQRLQAVEEAEEEERERENLAKEEEREREMGRPEGVVINDDKEEGEGEEEEDEQ
                     ADREKARQREEEEEEEIEGVDEDAEGEEFEEVSKMSVDFGMFI"
     STS             12454..13285
                     /standard_name="Xho8"
                     /db_xref="UniSTS:470940"
     gene            15736..17408
                     /locus_tag="CNB00060"
                     /db_xref="GeneID:3255858"
     mRNA            join(15736..15816,15876..16073,16127..16258,16331..17408)
                     /locus_tag="CNB00060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568752.2"
                     /db_xref="GeneID:3255858"
     CDS             join(15772..15816,15876..16073,16127..16258,16331..17245)
                     /locus_tag="CNB00060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568752.1"
                     /db_xref="GeneID:3255858"
                     /translation="MADTGMRGTNALQDSRFKDKELASIKSTKFPKHFSEKVDLRKVN
                     ISVLRPWVAEKVTELIKVEDDIVVEYVFGMLEDRDNPTPDPKKMQVSLVGFMDKYGAA
                     AFMDALWKLLLSAQKTVGGVPAEFIEAKKQELQRKQQESSSLPLPPAPPAMASHSQAR
                     SSGPAGRSRAEDYYGREPRGGGGVPRGRDARDGRDGLPTRPYPPARSPRHRSRSRSRS
                     RSRSRSPPPRRPFTNTNSGRYPDRQPDRDRDREWGNRRGYPRGGESFRDRARDEGWGS
                     RGGGSSVNPRERNARRPTPPRRPTPPRRPSPPRRPSPPPTAQIRIRGRGRGRSLSRSL
                     SRSRIPSRSLSPPVRRDRGHGRKYGQDSDRGRSLSQSRSRSRSRSDTPPRTQTRKRPR
                     SVRSRSRSRSRSHSRSRSRSRTPVRQRTRDYTPTPEL"
     gene            17508..18883
                     /locus_tag="CNB00065"
                     /db_xref="GeneID:36392718"
     mRNA            join(17508..17785,17828..17937,17988..18036,18087..18147,
                     18231..18883)
                     /locus_tag="CNB00065"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658428.1"
                     /db_xref="GeneID:36392718"
     CDS             join(17594..17785,17828..17937,17988..18036,18087..18147,
                     18231..18541)
                     /locus_tag="CNB00065"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514196.1"
                     /db_xref="GeneID:36392718"
                     /translation="MRLATALTLPLLALPLARAIITPTSPDGSTVVAVGDSIQALWTI
                     DSTDGWTDVEIQLMTGSNLAMVPLATVATGIDGTSATSFSFAAPDVSPYSKIYFLQFT
                     NGGDMTNVTWTTRFTIAGADGSTTEPTNSTDSVEWGTGQLLSSVSASSGNSSSSETAS
                     TSASAVAAAVTASSSSSSSSSFSSSTSESATSNSATPSASSANASSDSSTSSDSSTSS
                     GSRLHVGLVSIFIASALGIALI"
     gene            complement(18906..19583)
                     /locus_tag="CNB00070"
                     /db_xref="GeneID:3255587"
     mRNA            complement(join(18906..19035,19114..19400,19461..19583))
                     /locus_tag="CNB00070"
                     /product="hypothetical protein"
                     /transcript_id="XM_568753.2"
                     /db_xref="GeneID:3255587"
     CDS             complement(join(19000..19035,19114..19400,19461..19542))
                     /locus_tag="CNB00070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568753.1"
                     /db_xref="GeneID:3255587"
                     /translation="MRPSLLLRATHYKPMIKFLGPRKNIQHSPHKPAPHPCAPTEVQE
                     SFQSFLSKLNSSSSPSSSPSSSPPPSSSSSSGSGGAGLSSLESTFKPTGKKVDYENYW
                     EAPTYLWVQKEVTEREMESVMSGGATDIRTGP"
     gene            complement(19758..23821)
                     /locus_tag="CNB00080"
                     /db_xref="GeneID:3255666"
     mRNA            complement(join(19758..21929,22007..22430,22541..22633,
                     22712..22828,22896..23033,23092..23215,23293..23412,
                     23509..23579,23637..23649,23713..23821))
                     /locus_tag="CNB00080"
                     /product="exonuclease, putative"
                     /transcript_id="XM_024656420.1"
                     /db_xref="GeneID:3255666"
     CDS             complement(join(19846..21929,22007..22430,22541..22633,
                     22712..22828,22896..23033,23092..23215,23293..23412,
                     23509..23579,23637..23649,23713..23789))
                     /locus_tag="CNB00080"
                     /codon_start=1
                     /product="exonuclease, putative"
                     /protein_id="XP_024512101.1"
                     /db_xref="GeneID:3255666"
                     /translation="MGISGLLPLLKEVSVHGHISEFKGKKLAVDGYVWLHKGAFGCAE
                     DLVKGKKSTKFVEYAMYRVRFLRHHGIEPFLVFDGGPLPAKKGTEVSRAKTRLENLEK
                     ARSLEAQGRMKEAKEAYTRCVDVTPEMAYQLIKALRAENVDYVVAPYEADAQLCFLER
                     EGYVDGIITEDSDLLVFGCKKVIFKLDKDGQCVWIHRDRLAMVREFPMHGWTDVHFRR
                     MAMLSGCDYLDSIPGIGIKTAHRLMRRFNSVEKLLQHIRLEGTYLVPPTYLSDFAQAE
                     LAFLYQRVYDPSLGRLVHLNPLPPASTGFQLGDEGEKWVGVDVEEGLARRMARGDVHP
                     ETGMGIVDAWPEFASGAEGAGGAEEKWGSGSGVGNLGEKRQAKAEGVHVQGPMDAFIT
                     RYKKPKHRHPKHDCPDYLDHSNREQQQIKSKLAPIHQPVGTYTSGASRLSDQLALRPL
                     AENVMGDGERGCTAEKVEVMSKFFGGRGKRQQVRKRQKEEVDGDGSEEKIELKWEEEE
                     EEGGGRIHSLSHSLTSTSTPTRIQQGRRSPSPAISSLISSSPPAPPRIASQSCLSSQS
                     CSPCPSPSLSPVISPSFSSCSRQRFISQTQYITSPPAAECSSPPVLDFPFSSLAEGEQ
                     VKQEVNVGRPWKKETETETFEPGSSFGTLVPPTSSPTAPLPLSLSLSSTLPPTHRLSN
                     QRYEAAGHSLAGSSLLAHNEFGLRPRSSAPPCAQSQSLLHSVNAVKGSQPDFEDGNKH
                     DRGSSPDMGGADDDNGQGQIKDADKSEESEKEEERKEKAKIVGGSWRAKWAFGGGLEM
                     NGTPKMGAGARGVRSQTPKTVPVQKVGAGGMRAVSSTLSLVKRREAMSVGGSSRVLKN
                     RPVNVVFPRGEESEAARFGLATPTRAPSVASVSASRKVETGSMAVEGNGMEMKMKVAV
                     KQFGFGRGGREGHEDDKGGAGEEEQVEEEGEGEEIGSFTPSPERKPLFPRFSVGGGAP
                     PRSLSPRNSPNDIPTAVSHPSISRSRLKSNYNTISSIALKDTPQGEQKQRQRQAKQQQ
                     ARPGLCFVRRDQDGSDDVDENTCRRMSQSGREKTPVSGTTLGRLERYRFEKVTVRK"
     gene            23970..25402
                     /locus_tag="CNB00090"
                     /db_xref="GeneID:3255882"
     mRNA            join(23970..24122,24287..24422,24518..24672,24773..24867,
                     24949..25402)
                     /locus_tag="CNB00090"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /transcript_id="XM_024656421.1"
                     /db_xref="GeneID:3255882"
     CDS             join(24009..24122,24287..24422,24518..24672,24773..24867,
                     24949..25012)
                     /locus_tag="CNB00090"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /protein_id="XP_024512102.1"
                     /db_xref="GeneID:3255882"
                     /translation="MSIPHSAYDPRRVFRFNVPHFEIGPKARSVGTYLSGGLFALSYF
                     LLFDAATLSSHAKPPPDAPYDVVPVHMAFVDWIPAICTTLGFIITSLLDKSHLTSAFS
                     SDPWAHEGSAAWRARVVLFIGVALMAGGLAGSLCVLILKYIVPDYTGYTYYGAANVAT
                     NVGIMVSAMILWISQSGSDEYEYQLTV"
     gene            complement(26724..28350)
                     /locus_tag="CNB00100"
                     /db_xref="GeneID:3255838"
     mRNA            complement(join(26724..27072,27132..27386,27441..27496,
                     27558..27632,27689..27735,27797..27883,27980..28036,
                     28114..28350))
                     /locus_tag="CNB00100"
                     /product="expressed protein"
                     /transcript_id="XM_024656422.1"
                     /db_xref="GeneID:3255838"
     CDS             complement(join(26808..27072,27132..27386,27441..27496,
                     27558..27632,27689..27735,27797..27883,27980..28036,
                     28114..28213))
                     /locus_tag="CNB00100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512103.1"
                     /db_xref="GeneID:3255838"
                     /translation="MSSYDPLPDEVITPEQFRQSMKLVRLQIAVPISVLVAMGTNLVC
                     ALALKPGLSGISNLFPTLLTPNSIMIELYWAALFGLQIGFCLVLLLARKEATKEMLVH
                     GVGLRFAVANWLQAAWAVFFTLQFFIGAEVVLLINALNVLSIHMTLLYYPPTLKRPMD
                     AIFIHAPMTMFLAILFQLDWLHSGFIAVGWIIKDESKWGKYTWQAVACVAGVNIVSAL
                     WAGARRLYLLTIASMYLLFSLLFSSPRTNPTLPTTALPKPPPLLITIIACLVLHPITL
                     IVGVAWKRSLERQGRIRLEEDVERAEEGREREERVRA"
     gene            complement(28654..33960)
                     /locus_tag="CNB00110"
                     /db_xref="GeneID:3255805"
     mRNA            complement(join(28654..28918,28983..31001,31103..32248,
                     32332..32865,32962..33960))
                     /locus_tag="CNB00110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568757.2"
                     /db_xref="GeneID:3255805"
     CDS             complement(join(28802..28918,28983..31001,31103..32248,
                     32332..32865,32962..33954))
                     /locus_tag="CNB00110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568757.2"
                     /db_xref="GeneID:3255805"
                     /translation="MEEGEQQHTQDPPRVRDEPVGGEASEQGKQQLETAQSEPEPQTE
                     PQQQAQLEQPSQLQPEATPQQQPQEGSQGAPEPPRPAKRRPLPPKKGILKPPPPPSKP
                     TLGHRLRDMVGGAVTAVGTRVAGGEGDEAVVSGDGTGRAGVNGNGQWTAPGSTSTQQM
                     SAHGQGQQANTPMPTPRVLGGQGGTLASLSGRLAMGIGRLVTNAQNQVQSQSQGQGQE
                     ASHGHGLARQLFSTSMPSPPPPPPSQDDYLSHARGPSLPRKEAPPLPPRDGAASPTPK
                     FITSTPTTNHRNNNDSKKKQPLKKVTFLLPSMSIIYPISSNGEPWSEKVLADRAKIEN
                     TQRSLLITSLHPSYWTPHRLVVLYEQACRGREERPRIGVIRALESLPAVSKSPSLAPE
                     RIIHLTLRPINHATISSSLPPGIHPLDVPLGHHSAEPVADVLATRFGLVGLLLEDGAV
                     EEGGLKSILHALLVSGGPGDKESTGGKERGSDGVERLSLKGCKKIRENGWGLVAEYLK
                     MAKNLKHLDLSETVWNRKSMEALVKALNEPCYSSVSQSTSSHSISTSISASRGGQKIE
                     GMLMISSSPTDTRNGKEKTAASDCEENEEERDEGEWEGEGRKRNLYSTFLPPAPLLKP
                     SSLTDVFSLDPAQQVQQQLHSSTPQPQPQSLQVQTQTQPPPQTQSPSQQQTSLQTLRL
                     DSCSLRPPLLEVLAHGIRTSGLKHLSLRGNRINRDGAVGVAVMVRDYDYDSFSSRLAG
                     VGRSGVASGGGGGGMSGVEGFGRKEKGEEGVVPHITGSRGVTSMTVPKGYTPPRMSVM
                     ERLQMPFDASSSLDSHSESHLYSRSRAQNDKGTDTPEKSKATIDKEKEREKEKSERWV
                     PGPTSRALERSVRALENVQRIGKLQTLDLKGNDIRGGVTYIAQVLKRNRTLRILNLSS
                     NSIPPSGLAALAESLKYNTSLSTLSLSDNPCCNTSSSPVSSNSRGITANTLGANSEGR
                     DAVVSLRNALAVNTTLKRLFLSSVGMGDEGAIALAEFLGENQGLLHLDLTANPIGAAG
                     VHALYGGLRVNRLIRCLDLSMPMSAGGEREDEEEEKEREREAMARVMQGVLSICVRNT
                     EEAAAVLAASYDEAYGVSSGTVQGQHTEHEPYGHKGGEASSDATTHSRAQANDGASMP
                     GEAEADGSKKGESEHKALSAAAEAEVWAPLKRSDLLRSLKAQSTSSPTPTKSGSTSAA
                     PRVNVLSEAERAKIISLPLPALFALGKTSVSLLDQYFTASKVYDDLLKQGNAQNWEGG
                     KEMPTEEYEKVLAKAQMVLERLVEIIQRVVEGAEEGNGVGIEELLEVNDRLTALIKQS
                     EGFTPPPRVLLPSQIMSSSSSTSKYSSNQQSKKQKKDGKQLLTPISRRHAHHAKGSSL
                     EISSPNFSIGDSDDNDSDAEELDMMQLAARHAAHTRSASMQSKASNHGESVGLGIIAK
                     GDEDAESEGKEKDKDEENVEGGPGRGVKEEDEKQKEIERGLMEAQAFSFSLPSFSSVG
                     ILDINTSTSSSNLNGKDSPSSPVEKTSKAWVEEESEIFRKGVQLGVADEDEDDDGEQG
                     QEGVSGEELRKEILDTPVARSTTKRVIPVESEGGEREDDDDDDEEEQGGD"
     gene            34135..36793
                     /locus_tag="CNB00120"
                     /db_xref="GeneID:3255945"
     mRNA            join(34135..34507,34579..34677,34738..36793)
                     /locus_tag="CNB00120"
                     /product="heat shock transcription factor 2, putative"
                     /transcript_id="XM_568758.2"
                     /db_xref="GeneID:3255945"
     CDS             join(34177..34507,34579..34677,34738..36659)
                     /locus_tag="CNB00120"
                     /codon_start=1
                     /product="heat shock transcription factor 2, putative"
                     /protein_id="XP_568758.1"
                     /db_xref="GeneID:3255945"
                     /translation="MTTNLYAIAGPSKPTTPTSTPSPRSEPPSPLKSLTSLPTNPLNS
                     HGTSTPNTLTNQLSSTGIGISKPGLSVDENGEVMKVPAFLNKLYTMVSDPEVDDLIYW
                     GESGDSFFVPNAELFGRELLPRWFKHSNFSSFVRQLNMYGFHKVPHLQSGALKNETPI
                     ELWEFANPYFKRGQPQLLTKVTRKNNRPSNSGVGPSSSVGGSGAGGGMSTRSASAAAA
                     SGSASGQIQQAISQGHEAGNHSTSGKYLITDGTTPGSVPPSHTSAGPLIAPQTLDLSA
                     INSGIAAIRQTQASIATDLRKLQASNEALWRQAYETQEKQRKHEETIDLIVSFLERLF
                     GTEGEGLKGLKEAMRRGVGVRRDRDGREGRDSRDSRFAEDDDGGQKKRRRVGIDRMIE
                     GGTGDGTGEHGEIESPTSDDRLVEIGSNSEYSIPSVKRTSSSSHPISLGQLGSSRFTA
                     LPSEDPSPSASGPGSTSYEGLHTTQTNARGAGADVNVTDPTLGMNHLSPLSDTDPLLP
                     SSSNALAPYSSHLPFPSSNSNQSNSFNPSNPSSAWASNPSQPLLSPTSAAAAAHAYNL
                     DPSLLQTTIGSLLQSPAAAQMFLNSLSASAQGQALASHSHPHNPSPLNPNPNGNASTS
                     ASASAHGMNTGGMGTGSGTKDVDPTLALFSPLPSHSSLTSQSNDLLKSYSDALTVGEG
                     VDNLQESIDSLVRSMGLDLPNGGSSVGVDVGDGAGVGTETGEGDGEFNVDEFLQGLAK
                     EGEEEGEREVEGDGGVSSSGAGAGAENGRKEDVIAQSGLKSES"
     gene            complement(37214..40541)
                     /locus_tag="CNB00130"
                     /db_xref="GeneID:3255637"
     mRNA            complement(join(37214..37372,37423..37540,37604..37651,
                     37708..37938,37992..38088,38140,38195..38245,38300..38361,
                     38407..38636,38688..38886,38941..39123,39175..39267,
                     39318..39344,39402..39872,39933..40541))
                     /locus_tag="CNB00130"
                     /product="caspase, putative"
                     /transcript_id="XM_024656423.1"
                     /db_xref="GeneID:3255637"
     CDS             complement(join(37341..37372,37423..37540,37604..37651,
                     37708..37938,37992..38088,38140,38195..38245,38300..38361,
                     38407..38636,38688..38886,38941..39123,39175..39267,
                     39318..39344,39402..39872,39933..40033))
                     /locus_tag="CNB00130"
                     /codon_start=1
                     /product="caspase, putative"
                     /protein_id="XP_024512200.1"
                     /db_xref="GeneID:3255637"
                     /translation="MKAQRCTVCAGRPPERDFNLFIYLISFWDVCITGLSTHLRCIYS
                     DAFLIEYHLFRCLPHRISVAGVAQRHFGVSVAPSFDAVCPWHIVRLALLYYLPSAYCH
                     SSFQLNLLPSSHSMSDYEDEYYQPEEREVEYRDEDDERGYERYESPPRSPARSSSSSS
                     GGGRESRHSDSSEEDGRHSDGDYRPVQGSVGLGNVAAVGIMTGMMGNLMGGGNGTSNR
                     ETGGNYYQAPSGQYQNGYNGCQNDYQQAGYGQNGYGQEGYGNQQQGYGGNEYRDAGYG
                     SDYPHPGPPPQQYEPTNAGYAPPPPLYAGRQQHYGDYRANEGDDGGPHPQHFGPEFHD
                     SQTGEVAQAYFEYSRCNGRRKALLIGINYIGSSAQLAGCINDVHNVQKFITERYGYQL
                     DDIVMLTDDNNDARTMPTRDNIIKAMKWLVDGAQRDDALFFHYSGHGTQTEDMDGDEQ
                     DGQDEAICPVDYETAGLLIDDDIHELLVRPLPSGCRLTAIFDSCHSATVMDLPYVYAT
                     DGTVKEPDLLAEASQGLLGTGMDILRGDTGGIMTSLFGAAKSAWAANKAEEKTKRTKT
                     SPADVVMWSGCKDNQTSADTQEDGEATGAMSYAFISALNKRPNQSYQELLIAIRDEMK
                     GKYTQKPQLSACHPIDTSLLFAA"
     gene            40730..42115
                     /locus_tag="CNB00135"
                     /db_xref="GeneID:36392719"
     mRNA            join(40730..41668,41720..41906,41956..42115)
                     /locus_tag="CNB00135"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658530.1"
                     /db_xref="GeneID:36392719"
     CDS             join(40770..41668,41720..41885)
                     /locus_tag="CNB00135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514197.1"
                     /db_xref="GeneID:36392719"
                     /translation="MTLAHTELNTLDPLPSEIRELIFQYLLPTRHIPLKCALLQTCRK
                     YYNELLPSLYHAVSLHSTMIGRFFQGLDSGLSAEESSGWYSNRVGDESLPPDTGQSPA
                     SRRLRLLSLVKMVILEDVGAVHGCLRAINILSKLNLPDAPQEWWSQEYPGYSYYPFGH
                     LLALFPSLNMRKHGGSGRLVWSKDLMNQLNEGNYLKLRPRATWSGNDKLEGDYILTHR
                     FASATAVIFMYAPDSPLSPELSSLISIAAASMNRKRCIFADVDPEIFNLIDPLYNIGT
                     ISWHLKPEGKCKQKHFDGLVSLIRRYKHMYNGQNAFTFYVYNYAFKPYDDPRVVAENL
                     ESASYDPNSTVTITIRLICR"
     gene            complement(42103..44040)
                     /locus_tag="CNB00140"
                     /db_xref="GeneID:3255635"
     mRNA            complement(join(42103..43108,43165..44040))
                     /locus_tag="CNB00140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568999.2"
                     /db_xref="GeneID:3255635"
     CDS             complement(join(42318..43108,43165..43633))
                     /locus_tag="CNB00140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568999.1"
                     /db_xref="GeneID:3255635"
                     /translation="MTPVSLPKHVLIVGGGIGGTSLAIALARRNIRSTIYEIRPFAGN
                     EGGALIISPNALCVLDKTLGMKDEVLNAGYQYDNINIYSSDGQWLGAMVNGDEQNWGY
                     RAVRVTRTALHNRLLDQCNAMGGLVNIQYGKVCEKVEEGEHGVKVCFADGTHGEGDIL
                     IGADGIYSKVREQLLGPASPSPFYEGLVGLWATTPRSAIDIPPDMALPAAIYTPPGLL
                     LLFPIDPSGETIGWIAQRSSPERSKEGWKMYETSGDCVKATKADYEGVDYEPVKSLIA
                     SLEEGQGKVWPPYSIPDIPTWHGKRICLIGDAAHAIPPSAGQGASQAIEDAGLLARLL
                     AHEPAVEKGYESLFEYFERTRKMRFQSIRSLTRQSSASRFELKGPLGWWLRKWSIWAF
                     LRVLGSKGYYRDAKLMGYDITQEKIDF"
     gene            complement(44705..49065)
                     /locus_tag="CNB00150"
                     /pseudo
                     /db_xref="GeneID:36392720"
     gene            49212..51174
                     /locus_tag="CNB00160"
                     /db_xref="GeneID:3255576"
     mRNA            join(49212..49378,49446..49479,49542..49662,49718..49801,
                     49858..50136,50192..50626,50691..50876,50928..51174)
                     /locus_tag="CNB00160"
                     /product="dehydrogenase, putative"
                     /transcript_id="XM_024656424.1"
                     /db_xref="GeneID:3255576"
     CDS             join(49612..49662,49718..49801,49858..50136,50192..50626,
                     50691..50876,50928..50972)
                     /locus_tag="CNB00160"
                     /codon_start=1
                     /product="dehydrogenase, putative"
                     /protein_id="XP_024512199.1"
                     /db_xref="GeneID:3255576"
                     /translation="MASTEIPTTMRAWTQNESNWISISNVPVPPVEDNHVLVKVQYVA
                     QNPTDWKSALYISPPGVIVGCDYAGTVIKLGPNLKTPLKIGDKIAGCVKGGSSNAEGS
                     YAQYAVVESDMCFVVPEGIPLEEAATFGIGYMTAAQAVVYSQGKALPPGDTKVSGNSW
                     YIVYGASASVGLFATSLAKALGYRVLGICSPHSFSLVKSYGADATIDYHNQSQAISEA
                     LDLTDGGVEFALDAISEGDSFRNIVKMMGQRGKQLNVMLPVPDDVRKINPELKIEFTG
                     VRTLWGAEFKFGLRDSEKSTWPADPNGRVFGEELFRKTPELVAKYGIKPNPVKIRGGF
                     EDIGAGLEDLKDGKVSGQKLVLKVA"
     gene            52235..54169
                     /locus_tag="CNB00170"
                     /db_xref="GeneID:3255618"
     mRNA            join(52235..52898,52959..53141,53200..53660,53722..54169)
                     /locus_tag="CNB00170"
                     /product="expressed protein"
                     /transcript_id="XM_568759.2"
                     /db_xref="GeneID:3255618"
     CDS             join(52320..52898,52959..53141,53200..53660,53722..54088)
                     /locus_tag="CNB00170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568759.1"
                     /db_xref="GeneID:3255618"
                     /translation="MLRRNYTPTPLGYAILTFFALIALYFLTPADTSISLLPSSWSSQ
                     SDTWATPHEPIGEEEDELDNRPLPLLPEIYSSEFPDLKLPASLLASPKLYPLTSRLVT
                     FLSRPILSHSAASPANLEGCPSELSDKLVNPDQYAGDGPFWRDDVDEAEIVRRRADVV
                     RYLSEAVEKGEQVLGQEGKTGKGRGIVLTGGNQDTTLRTITAIKHLRRLGVKLPIEVF
                     HYSDELHNKQQRKEIESLGATLREAKGLEKVAGVWKNWQIKGLALVQSSFREIIYLDS
                     DNTPLRSPSHLFDAPIYTSSGRAAFWPDLSKDHPDNAIWRLVGETCSLDLWTFESGQI
                     VVDKAGNEGMNLAALIIAAGMMRDRDFWFHMCGGDKDTFRWAWRMLDIEFGVSPRWMS
                     TVGIRNEFQNGRFCGHSVLQYDLATPVGFSRPPPLFVHSNLLKHLGGAGLSKGKLFKF
                     IRRMSEDYSSSPALNHAHSFVYDGIARGMCLDLDWHEDTPQEVKEDVRVETYAVGQEE
                     GGVFDGFEDAWWEEGGRVGGW"
     gene            complement(52554..55223)
                     /locus_tag="CNB00175"
                     /db_xref="GeneID:36392721"
     mRNA            complement(join(52554..54822,54925..55223))
                     /locus_tag="CNB00175"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658631.1"
                     /db_xref="GeneID:36392721"
     CDS             complement(join(54216..54822,54925..55172))
                     /locus_tag="CNB00175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514198.1"
                     /db_xref="GeneID:36392721"
                     /translation="MPTFHTRARHMLTSYRPLLLSFGFTAVLPLRSLALFSTTAGKAT
                     EAKCTRYLYRKPGPMATRESPWPVVFLRAKGLDVEEEGEWADWSGMFAERGYTSIEID
                     ITAPPPQSLPSDESPFRQMTTALSSQVRLSAIPFPPIIFARGISTLLAQAFIEDFPAS
                     GLVLVDPLPDEDPRSAGQGGKKGNGGGLADWAVGDKKGGWEWPKFRYEPHFPILLITS
                     QTRMTALSTSNRLVRDHVGENPNRHGWLGGRSGKGVEVVVTDGLENGGLSEGARLEVE
                     KWMDRSGF"
     gene            55373..58829
                     /locus_tag="CNB00180"
                     /pseudo
                     /db_xref="GeneID:3255642"
     gene            complement(58817..62060)
                     /locus_tag="CNB00200"
                     /db_xref="GeneID:3255741"
     mRNA            complement(join(58817..60924,60990..61778,61834..61910,
                     61974..62060))
                     /locus_tag="CNB00200"
                     /product="1-aminocyclopropane-1-carboxylate deaminase,
                     putative"
                     /transcript_id="XM_024656425.1"
                     /db_xref="GeneID:3255741"
     gene            59737..61311
                     /locus_tag="CNB00190"
                     /db_xref="GeneID:3255867"
     mRNA            join(59737..59864,59931..60056,60116..60236,60300..60483,
                     60534..60907,60958..61311)
                     /locus_tag="CNB00190"
                     /product="1-aminocyclopropane-1-carboxylate deaminase,
                     putative"
                     /transcript_id="XM_568760.1"
                     /db_xref="GeneID:3255867"
     CDS             join(59808..59864,59931..60056,60116..60236,60300..60483,
                     60534..60907,60958..61133)
                     /locus_tag="CNB00190"
                     /codon_start=1
                     /product="1-aminocyclopropane-1-carboxylate deaminase,
                     putative"
                     /protein_id="XP_568760.1"
                     /db_xref="GeneID:3255867"
                     /translation="MSTPAYLTKLESIPKEKFLFGPSPISYLPNLTAVLGGKVKLYAK
                     REDCNSGLAYGGNKVRKLEYLVADAKAKGCNTLVSVGGVQSNHTRAVTAVAVASGLKA
                     VTVQEKWVPIDPPLYSETGNILLSRLMGGDVRLNQETFDIRHKKATEDAFKDVEAKGG
                     KPYYIPAGASDHPLGGLGFTNWVVELAKQEKELGVFFDVVIVCSVTGSSHAGTVVGAV
                     AEGRKRKIIGIDASGKPEATRNQVLKIARNTAALLDERLEIKEEDVILDDRFHAGIYG
                     IPDDETIAAMKLAAQTDAFITDPVYEGKSMAGMIRLVKEGAIKEGSNVLYIHLGGQPA
                     LNAYSSYFPHA"
     CDS             complement(join(61483..61778,61834..61910,61974..61987))
                     /locus_tag="CNB00200"
                     /codon_start=1
                     /product="1-aminocyclopropane-1-carboxylate deaminase,
                     putative"
                     /protein_id="XP_024512104.1"
                     /db_xref="GeneID:3255741"
                     /translation="MKLVRFLMKLNNETVTIELKNGTVIHGTITSVDPQMNTHLKSVK
                     LTLRSQPSSQPPLSLDSIAIRGNNIRYFILPDSLPLDTLLVDDAPKPKKKKEGAAARG
                     ARGAARGARGARGGGRGAPRARGRGF"
     gene            62221..64625
                     /locus_tag="CNB00210"
                     /db_xref="GeneID:3255884"
     mRNA            join(62221..62853,62909..63003,63051..63129,63195..63303,
                     63356..63531,63588..64625)
                     /locus_tag="CNB00210"
                     /product="serine/threonine kinase receptor associated
                     protein, putative"
                     /transcript_id="XM_568762.2"
                     /db_xref="GeneID:3255884"
     CDS             join(62639..62853,62909..63003,63051..63129,63195..63303,
                     63356..63531,63588..64017)
                     /locus_tag="CNB00210"
                     /codon_start=1
                     /product="serine/threonine kinase receptor associated
                     protein, putative"
                     /protein_id="XP_568762.1"
                     /db_xref="GeneID:3255884"
                     /translation="MQGYSNGYSTLPPSLNPNPVIGQYAPSQQVQLSGQPRLGSVPSS
                     QSNETIKVQPLLCSGHTRPVTHLQFSNVLDDGTYLLISACKDGNPMLRSWLGDWIGTF
                     IGHKGAVWSSKISLDTSRAVTGSADFTAKIWDTYSGEALHTFSHNHIVRSVALNPQQT
                     PQYLLTGGHEKKIRLFDLGRPDAEPLVLGTNPDGLSCEGIIKSLVWDEGQNGTMGVSA
                     AEDGKVRWWDLRTLSQIASLDLGEPISSMELAHGGGTLSVTAGKNVHFLDILRQHPPV
                     TIPLPHPVTSASLHPYLRDRFVAGSTSDPWVRVYDLDSGKEREVYKGHHGPVLCASYS
                     PDGEVYASGSEDGTIRLWQTNPGKAYGLWQTSD"
     gene            64973..67162
                     /locus_tag="CNB00220"
                     /db_xref="GeneID:3255778"
     mRNA            join(64973..65578,65622..65780,65834..65943,66000..66159,
                     66209..66315,66371..66405,66460..66733,66799..67162)
                     /locus_tag="CNB00220"
                     /product="fructosyl amino acid oxidase, putative"
                     /transcript_id="XM_568763.2"
                     /db_xref="GeneID:3255778"
     CDS             join(65297..65578,65622..65780,65834..65943,66000..66159,
                     66209..66315,66371..66405,66460..66733,66799..67105)
                     /locus_tag="CNB00220"
                     /codon_start=1
                     /product="fructosyl amino acid oxidase, putative"
                     /protein_id="XP_568763.1"
                     /db_xref="GeneID:3255778"
                     /translation="MPPSRASTKVIVIGGGGTLGSSTALHLLRAGYTPSNITVLDTYP
                     IPSAQSAGNDLNKIMGIRIRNPVDKQLSLEARDMWRNDEVFKPYFHNTGRLDCAHTPE
                     SIASLRKSYEAILKAGSGLEKTHHWLSTEDEILARAPLLDRKQIKGWKAIYSEDGGWL
                     AAAKAINSIGQVLKEKGVTFGFGSAGSFKKPLFDEDGTKAIGIETVDGTQYFADKVVL
                     AAGAWSPTLVDLEGQCCSKAWVYAHMQLTPEEAAEYKECPVVYNSELGFFFEPNEKGV
                     IKVCDEFPGFTRFKQHQPYGASTTKHISFPRSHAKHPTDTIPDESDASIRRAISAFLP
                     RFKEKELFNRALCWCTDTADANLLICEHPKWKNFILATGDSGHSFKILPNIGKHVVEL
                     IEGTLAEDLAESWRWRPGSGDPLISRRAAPARDLADLPGWNHDEPSDDDMDVKDVAVS
                     LASVKIGENIGEKVVEDGARVGVKVLA"
     gene            67651..70175
                     /locus_tag="CNB00230"
                     /db_xref="GeneID:3255894"
     mRNA            join(67651..67871,67955..68283,68362..68393,68447..68571,
                     68622..68785,68840..68923,68983..69159,69213..69296,
                     69353..69636,69719..69821,69907..70175)
                     /locus_tag="CNB00230"
                     /product="expressed protein"
                     /transcript_id="XM_024656426.1"
                     /db_xref="GeneID:3255894"
     CDS             join(68045..68283,68362..68393,68447..68571,68622..68785,
                     68840..68923,68983..69159,69213..69296,69353..69636,
                     69719..69821,69907..70105)
                     /locus_tag="CNB00230"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512105.1"
                     /db_xref="GeneID:3255894"
                     /translation="MSKADTPKEELPQTHFDASNQAVDWDAYKKEVPLWKRIHNHSLT
                     QMLLMSVQAFCGPAMSDAISGLGGGGLASPQTSNIANAINYAFLAITCFLGGPLVNKL
                     GTKWSLVLGAMSFPIQGASYYCNSKFGTQWFLIFGAFVSGIGTGCWYVAEAGTIMSIS
                     PTGARGKYLALWIVSRNLGQLIGGAINLSKNHTAGVDGGVTPDTYIAFLIIESLAFPF
                     AFLISPLHNVVRSDGTRIRVSKPLSTKQEFRQILTTMTSKLVLLSAIWAIWSFFYSGT
                     WSTYLATYFSTRARALSSLVSPFFCIIGCFGLGFILDIKGLSQRRRAQLGLFTVIILN
                     TAVYIWTIIMQVRFNRNNPGAIDWNDSLYPSAFLPYFFVQTTGPLSQSYMYWLISSFA
                     KDAQSNVRNGSLFRCLEAIGQAISFGMNTQISTSPLIGVCVTFGLMAAALIPMLLLVN
                     TTPDKIPADELMEEEQQQGVAAQDMKEKEDTGEKEEDVSVFVSPAH"
     STS             69483..70416
                     /standard_name="Pvu2"
                     /db_xref="UniSTS:470939"
     gene            complement(70138..71524)
                     /locus_tag="CNB00240"
                     /db_xref="GeneID:3255956"
     mRNA            complement(join(70138..70215,70291..70478,70540..71524))
                     /locus_tag="CNB00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656427.1"
                     /db_xref="GeneID:3255956"
     CDS             complement(join(70443..70478,70540..71502))
                     /locus_tag="CNB00240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512106.1"
                     /db_xref="GeneID:3255956"
                     /translation="MLVRRLYSSASSHPAPSALAHIPAPRPHTRGRIRPRLALPKAKK
                     QASTTAASASLAKPLRPVDAAGKGRKPRYSSTYPHSETAHTHAQASSYPTVPEPPSSS
                     IPRTPRLHFTHPVPALNHTNEFRPIYLYPEQFKLYHAFTHPAHPLPLHLGTKIYTSPT
                     FTSRPDGTGDDLFAEPVMKTPSSTVEGEGVNALTEHLRVVSSQPILLNNAEMEHQLFG
                     TPEMEFSSISALLENKSASLKARNEQEWREVLAMMEHKGESLAVEKDNVQAGGSKDAD
                     LNQVVSELAGVLARLETDEKNVSMDSVKRKRRKKISKHKHKKRRKATRALRKRLGK"
     gene            71684..73357
                     /locus_tag="CNB00250"
                     /db_xref="GeneID:3256005"
     mRNA            join(71684..71847,71920..71978,72063..72241,72374..72552,
                     72666..72736,72802..72875,72958..73357)
                     /locus_tag="CNB00250"
                     /product="tRNA (guanine-N7-)-methyltransferase, putative"
                     /transcript_id="XM_568766.2"
                     /db_xref="GeneID:3256005"
     CDS             join(71722..71847,71920..71978,72063..72241,72374..72552,
                     72666..72736,72802..72875,72958..73160)
                     /locus_tag="CNB00250"
                     /codon_start=1
                     /product="tRNA (guanine-N7-)-methyltransferase, putative"
                     /protein_id="XP_568766.2"
                     /db_xref="GeneID:3256005"
                     /translation="MSKRTREESEMEAGPSTASPGVSVSPAPALTAGEVQLLKVPQKR
                     FYRQRAHANVFIDHELDYPKRPELMDWSTHYPAYFSQPNEDGTITQGEKKVEWADVGC
                     GFGGLLMALAPLFPEKLMLGMEIRTSVTKYVTDRIAATRQAQSLLPADSVDTKPGGYQ
                     NVSVIKANSMKHMPNFFAKGQLEKIFFLFPDPHFKNRKHKARIITPALLAEYAYVLRP
                     GGILYTVTDVKDLHEWMAHHLHAHPLFEYIPTETLSDDPILEAARTATEEGQKVERNK
                     GDKWVACFRRKEDPKEEDED"
     gene            complement(73409..77432)
                     /locus_tag="CNB00260"
                     /db_xref="GeneID:3255871"
     mRNA            complement(join(73409..74555,74619..77322,77362..77432))
                     /locus_tag="CNB00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_568767.2"
                     /db_xref="GeneID:3255871"
     mRNA            complement(join(73409..74266,74318..74555,74619..77361))
                     /locus_tag="CNB00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656428.1"
                     /db_xref="GeneID:3255871"
     gene            73419..>74188
                     /locus_tag="CNB00255"
                     /db_xref="GeneID:36392722"
     mRNA            join(73419..73552,73603..73693,73787..74045,74119..>74188)
                     /locus_tag="CNB00255"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658732.1"
                     /db_xref="GeneID:36392722"
     CDS             join(73529..73552,73603..73693,73787..74045,74119..74188)
                     /locus_tag="CNB00255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514199.1"
                     /db_xref="GeneID:36392722"
                     /translation="MPYPRPPHTIQLVIPHLLTDSQFEMVEDLTFMHFESTLEAWPIS
                     LKIITELNESIPLPAPAPHSSPPSSKEPHTTNHKEEAEGQRESETTTTRISVSTSKEW
                     DPASEEAVRRIVRNILVEILGGGDPSQAWISSLYFLNSRQPPHAR"
     CDS             complement(join(74541..74555,74619..77322,77362..77405))
                     /locus_tag="CNB00260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568767.1"
                     /db_xref="GeneID:3255871"
                     /translation="MSQPIMLPQGWEARWDPQANAYIYVDQSTGRSQWEVPLNPTFPT
                     SPTPHAPPQRHGRRAYPSAMYAHAYDTPAPHVGPPQPVAGYAEQGTPQFITPGFEGQQ
                     PVQQPPYAAVDHVAGQFQQMNIAPGAAPVAGAAAGAYQGAGYAEKQLHSTKTKTVNLI
                     GLQPDVAALDNPPPPALLPANASVTSSAHSQPDPSYQRCTLNAMPTTQSLLNKSKLPL
                     ALVMAPYRSIRETDNDPDVPVVEDGVIARCRRCRAYINPFVTFIEGGNRWKCCMCGLS
                     NEVPQLFDWDQRAEKPADRWARKELNHAVVEFVAPTEYMVRPPQPPVYAFVIDVSSAA
                     IQSGMVAVAARTILESLDSLPNADNRTKVAIIAVSTSLHFFSLPADATEAGMLVVPDL
                     TDVFLPKPVDLLVNLTESRPAIESLLAKLSDMFQDSHTVGSALGSGLQAAHQLIGKIG
                     GKIIALGASLPTIGEGVLKARDDPKLLGTSKESQLLNAGNNWYKTFAIECSKNQVSVD
                     MFLFSGTYTDVATLGCLPRYTAGQTYLYPGFNASRSEDAIKFATEFGKVLAMPIGLEA
                     VIRVRASRGIRMSAFHGNFFIRSTDLLALPVVPQDQNYVIELQIEDDIKGSFVVIQTA
                     VLHTTCYGERRIRVITQAMPTTDSIAELYTSADQIALATYLANKAVERSMSHSLDDAR
                     NHVTNRLGEMLTVYKNQVTSAAGGASAQLAVPENLLLLPLLCCALTKHVGLREGASIP
                     PDLRAYAQCLLTTLPCQTLIPYIHPRFYSLHNMPPEAGTIGGDDGAMILPPALNLTSE
                     KLERHGLFLIEDGQNIFLWVGHDAVPRLIQDVFDLASYHELQGGKYTLPRLDNPFSER
                     VCNVVDKTREMRRGVYRPQLYVVKSDAEPALRSWALSLLVEDRMDRMSSYAQYLTTVK
                     SKVNGS"
     CDS             complement(join(74541..74555,74619..77177))
                     /locus_tag="CNB00260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512107.1"
                     /db_xref="GeneID:3255871"
                     /translation="MYAHAYDTPAPHVGPPQPVAGYAEQGTPQFITPGFEGQQPVQQP
                     PYAAVDHVAGQFQQMNIAPGAAPVAGAAAGAYQGAGYAEKQLHSTKTKTVNLIGLQPD
                     VAALDNPPPPALLPANASVTSSAHSQPDPSYQRCTLNAMPTTQSLLNKSKLPLALVMA
                     PYRSIRETDNDPDVPVVEDGVIARCRRCRAYINPFVTFIEGGNRWKCCMCGLSNEVPQ
                     LFDWDQRAEKPADRWARKELNHAVVEFVAPTEYMVRPPQPPVYAFVIDVSSAAIQSGM
                     VAVAARTILESLDSLPNADNRTKVAIIAVSTSLHFFSLPADATEAGMLVVPDLTDVFL
                     PKPVDLLVNLTESRPAIESLLAKLSDMFQDSHTVGSALGSGLQAAHQLIGKIGGKIIA
                     LGASLPTIGEGVLKARDDPKLLGTSKESQLLNAGNNWYKTFAIECSKNQVSVDMFLFS
                     GTYTDVATLGCLPRYTAGQTYLYPGFNASRSEDAIKFATEFGKVLAMPIGLEAVIRVR
                     ASRGIRMSAFHGNFFIRSTDLLALPVVPQDQNYVIELQIEDDIKGSFVVIQTAVLHTT
                     CYGERRIRVITQAMPTTDSIAELYTSADQIALATYLANKAVERSMSHSLDDARNHVTN
                     RLGEMLTVYKNQVTSAAGGASAQLAVPENLLLLPLLCCALTKHVGLREGASIPPDLRA
                     YAQCLLTTLPCQTLIPYIHPRFYSLHNMPPEAGTIGGDDGAMILPPALNLTSEKLERH
                     GLFLIEDGQNIFLWVGHDAVPRLIQDVFDLASYHELQGGKYTLPRLDNPFSERVCNVV
                     DKTREMRRGVYRPQLYVVKSDAEPALRSWALSLLVEDRMDRMSSYAQYLTTVKSKVNG
                     S"
     gene            77600..79104
                     /locus_tag="CNB00270"
                     /db_xref="GeneID:3255975"
     mRNA            join(77600..77657,77711..77823,77862..78752,78812..78875,
                     78929..79104)
                     /locus_tag="CNB00270"
                     /product="nuclear pore protein seh1, putative"
                     /transcript_id="XM_568769.2"
                     /db_xref="GeneID:3255975"
     CDS             join(77609..77657,77711..77823,77862..78752,78812..78875,
                     78929..79011)
                     /locus_tag="CNB00270"
                     /codon_start=1
                     /product="nuclear pore protein seh1, putative"
                     /protein_id="XP_568769.1"
                     /db_xref="GeneID:3255975"
                     /translation="MLQTDLLAPAHADLVTHLTYDYYGERLATCSADQRIKVFRKDEH
                     GKWAEDANWKAHDAPILHLSFSHPIHGSLLASCSHDRTIRIWEEPSFSTSATAPAAST
                     SRAWLERGILTGPTGAIRSVQFGPPDPAHGLRVASIATDGYLRVHTSLDPSLNDWSEV
                     VRIHVPSLPGPSSAPSDDGGTGTASSSAAGTGLTGTLAMASAAGDSGGTSHHPHTSEL
                     ATGGWGLSWCKERWWGPLIAVFAGTSPSLKLVSLSPTPSCVLLLTPSSTPSTTSSGPT
                     QYAPLTCLAWAPNCGRNYHLLATGARDGTIRIWRVEPPGERGRVDYDTGGEVVKEWRG
                     QCTGEFGKGGARIGTVDWNATGTMLSTTDDEGIVRIYKPTYARSWSLLGSLAAEEPPL
                     EDGLNGH"
     gene            79801..81438
                     /locus_tag="CNB00290"
                     /db_xref="GeneID:3255986"
     mRNA            79801..81438
                     /locus_tag="CNB00290"
                     /product="expressed protein"
                     /transcript_id="XM_568770.2"
                     /db_xref="GeneID:3255986"
     CDS             79858..81159
                     /locus_tag="CNB00290"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568770.2"
                     /db_xref="GeneID:3255986"
                     /translation="MTLASTQVGQTPDILQLICSYLPPSTLFSCLLTSSTFFHSSAPE
                     LYRSLHIKHARDCFVGATRQSNGFYTSSSASPTSSSSSSTTTRPRPISPYSKDAVLSF
                     VRKVHIHTHGRNECPFVLHYINPLPHLEYVHLAGGVWPAELAAGDICDPETCQFLAKV
                     CTRAKKAMIRQANLGPLKLLTSLEHVTVKIRPCQLPLYIFHDTAYQWSYPVPISSARI
                     VDLVFWDERHSFRIEWRNVPGGGMRSSLMGLRYQLPSPYLGGESIMLKGCTYCDERGC
                     IRHTPHAAVQLPALMATLGSLMNVKTIRVWNVDHTARRQWKQGMVTVETVKRRMEEAW
                     LKARSEDLDCGGHDEQELDQGQQTGVSFHSASEYFTSAQFDMETDQEEAKYWQNLVEP
                     SQAVLRLRRQVQDMFGGDDEAFDRYSERELEGLVENERWRR"
     gene            81694..83731
                     /locus_tag="CNB00300"
                     /db_xref="GeneID:3256012"
     mRNA            join(81694..81832,81905..81964,82021..82032,82096..82101,
                     82153..82352,82407..82517,82569..82657,82708..82981,
                     83331..83731)
                     /locus_tag="CNB00300"
                     /product="fructose-bisphosphate aldolase, putative"
                     /transcript_id="XM_568771.2"
                     /db_xref="GeneID:3256012"
     CDS             join(81806..81832,81905..81964,82021..82032,82096..82101,
                     82153..82352,82407..82517,82569..82657,82708..82981,
                     83331..83631)
                     /locus_tag="CNB00300"
                     /codon_start=1
                     /product="fructose-bisphosphate aldolase, putative"
                     /protein_id="XP_568771.1"
                     /db_xref="GeneID:3256012"
                     /translation="MSGALSVVPAGVVTGDNVRKLFKYAKDNKFAIPAINVTSSSVVN
                     AVLEAARDINSPIILQVSQGGAAFFAGKGLKNGNQEASIAGAVAAAHFIRSVAPHYGV
                     PVVLHSDHCAKKLLPWFDGMLEADEAYFKEHGEPLFSSHMLDLSEESKEDNIKDCVFY
                     FKRMAKVNLWLEMEIGITGGEEDGVDNTSVDNNSLYTQPEDIWDVYSALNAISPNFSI
                     AAGFGNVHGVYKPGNVKLRPELLGKHQKYTHEKIGGDEEKPLYLVFHGGSGSSKEEIR
                     EAVVNGVVKMNVDTDTQWAYLCGVRDFVLKKKDYLMTQVGNPEGADKPNKKQYDPRVW
                     VREGEKTLVERVKEACVDLGNNNRN"
     gene            84219..88878
                     /locus_tag="CNB00310"
                     /db_xref="GeneID:3255791"
     mRNA            join(84219..84581,84638..84874,84925..86871,86925..88878)
                     /locus_tag="CNB00310"
                     /product="gamma DNA-directed DNA polymerase, putative"
                     /transcript_id="XM_024656429.1"
                     /db_xref="GeneID:3255791"
     CDS             join(84317..84581,84638..84874,84925..86871,86925..88837)
                     /locus_tag="CNB00310"
                     /codon_start=1
                     /product="gamma DNA-directed DNA polymerase, putative"
                     /protein_id="XP_024512108.1"
                     /db_xref="GeneID:3255791"
                     /translation="MRKALDISRLTRPARIRCRPSLFLRNGSLSSSASQSKPSDAPVK
                     VSDVKEKGVEKPLVPAFGARRAEMEDYILAMEMAKLEDGYDQPRVRKIRKSKLPSLHD
                     PQSFLWDSKQASSSKVTSSASPTLQPSRKGKEKEVVANEYETSEPNQEVQTLEDAKPI
                     DSEGRKSSPRRNPVGVQMLSPSLHSQLFPGQPLPKPPQALLDISKSHLKDNDLFPEGA
                     AVLPEISFDLPSLRGNNIRDHFHALGQYTAEPHASMARKFAATRLPAKPDRWEMGRSG
                     WTKYYSDGRMEAVDDLGDETLVSFDVEVLYKLSRFPVMATAVTPNAWYSWLSPVIFQS
                     PPAEIPEPPPPWEASTPTYHPHELIPLFNNKSSIPRIVIGHNVGYDRARVKEEYSLER
                     TQTRWLDTLSLHVSTRGITSVQRPAWMAYKKNKKAKKLREQENLSILQEMAEKSGDDT
                     IMDSLQEFGAASETEEAEALQSRWEDVTSMNSLAEVAALHCGYPVDKSVRDRFGDDSI
                     KHASQIHSELHQLLSYCADDVRVTHDVYAKVFPLFLESCPHPATLSGVLSMGSSFLPV
                     DQSWKEYLRNAEETYREMDVAVKKALRLLAEKLRAEGEPKEGDPWASQLDWSPKNARW
                     SDEDLEATGKHSVQPQESAQPHKPGFNSGASSPTWLTQISSNHSILKSNMSQRYLLPL
                     LLRMSFKGHPVAYLSEHGWCFMVPHDQVGDYFDTHGSPHMLSAKDNRLEKLEESYSFF
                     RIGNAGSPKKTKLVGPSIKPFVKSGDLTSAYPELLIKVMKTDLSDAVEDLWECVVDIG
                     NLKESEWGQQLDWTPATEGSASSNDVPLSSSSSSLRPSSIKKSKTNHGTWPKWYWDLT
                     GPVSRLPVGELDLTCKKTIAPLLLRLQWQGFPLVHSKEHKWLYRLPRKVYEEEDERIA
                     KARGLPVSFREEGPDAVFAKDDDHVYFRLPHKDGEGKNVGNPLSKGFVKAIESGELAS
                     AAAESGDDVAAKAAADATNMNAFCSYWISSRERIMDQMVVYRDQEFGMILPQVITMGT
                     VTRRAVEATWLTASNAKKNRVGSELKAMVRAPPGYSIVGSDVDSEELWISSVMGDSQF
                     GMHGATAIGWMTLEGNKSAGTDLHSKTASILGISRDAAKVFNYSRIYGAGKKHAVQLL
                     LQGDSKLTKETAGKLADNLYKSTKGAKALRARNLPVASVPSLWHGGSESYLFNTLEAI
                     ALSDRPTTPALGCGVTRALRKSYLEESASYLPSRVNWVVQSSGVDYLHLLIVSMEYLI
                     KKYDIKARYLISVHDEVRYLAKEEDRYRTALALQVANAWTRALFCFNLGIDDMPQGIT
                     FFSAVDIDHVLRKEVFLTCETPSHPKVIPAGESLDINSLLEKVPRGDLGTPIPDDLQP
                     PTDIKPPVALFPNIQSAQHRQFLQAQASKGGMGAKKWLDNLPPVQYIDEVNEENGKPY
                     QKSHKKAVLSSSKKPRW"
     gene            89195..90481
                     /locus_tag="CNB00320"
                     /db_xref="GeneID:3255692"
     mRNA            89195..90481
                     /locus_tag="CNB00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_568773.2"
                     /db_xref="GeneID:3255692"
     CDS             89376..90464
                     /locus_tag="CNB00320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568773.1"
                     /db_xref="GeneID:3255692"
                     /translation="MTFSFTTKTPSTTSSDGTATGRQQSPSTKSCRDIITATASAASQ
                     IEDQDWEQPHWLPNGQRALIVRQLEPTDESGSRSKSVDAYTREAAFRGLGLVWGRNIP
                     PSGVPISYPITEITIITPNRKSNGGEGDGDGGDDDDDGGKTEVTRIYRWDGSEMWHDP
                     LCGSSTCIGASGVELSMLPSFKVGTRPSLADIPCNSQLASVTTMFDMFDNFAYLDPFS
                     EVETGIPKDVPLTAVPMTLTTLSGRNDFKHGIGLLGEETFLTRFHHPECHSRFCAGSG
                     TEEQARIELLDPSSFKNGQKEGRRCRPDVYLGFDPEGHKIHQKRFSSRNSEIDSIYDA
                     VRAMAERLQNDYSRHGDDYGRCIALDRR"
     gene            complement(90821..92255)
                     /locus_tag="CNB00330"
                     /db_xref="GeneID:3256003"
     mRNA            complement(join(90821..91008,91092..91180,91587..91743,
                     92035..92171,92234..92255))
                     /locus_tag="CNB00330"
                     /product="ATP synthase delta chain, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_024656430.1"
                     /db_xref="GeneID:3256003"
     CDS             complement(join(90883..91008,91092..91180,91587..91743,
                     92035..92169))
                     /locus_tag="CNB00330"
                     /codon_start=1
                     /product="ATP synthase delta chain, mitochondrial
                     precursor, putative"
                     /protein_id="XP_024512109.1"
                     /db_xref="GeneID:3256003"
                     /translation="MFASRLTPALRALPRQASALRIARRGYAEAATDGKLQLSLVLPH
                     QSLYSSSGVIQVNIPAATGDMGILANHVPSVEALRPGVIEVIEENGQQGKKWFVSAGF
                     ATVHGNNALTINAVEAYSLDKFSPESIKSALADANRVLGSNAPESEKAEARIEVDVYE
                     GLQAALSK"
     gene            92420..95664
                     /locus_tag="CNB00340"
                     /db_xref="GeneID:3255946"
     mRNA            join(92420..92892,92946..93345,93402..94540,94597..95157,
                     95227..95508,95562..95664)
                     /locus_tag="CNB00340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656431.1"
                     /db_xref="GeneID:3255946"
     CDS             join(92464..92892,92946..93345,93402..94540,94597..95157,
                     95227..95508,95562..95600)
                     /locus_tag="CNB00340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512110.1"
                     /db_xref="GeneID:3255946"
                     /translation="MARQSKPFTASTVSQEKPKKQVIKKKRLDPANAYTYLPSLPKRH
                     RTSAFQNSLSYEELQQAKESSKGRHYDGEDDEESMQARVRKVAMMIASEGPQEVDSEE
                     SEVDSDEAWESDGSDEERWGDVFKELEKGKGKKKAKDVVRKPAKPLTVNLDESDGEAP
                     KEIANNSTVPISPESAEEDEDNDDDEDEDEDDDEDEDEDEDEDEDEDEDGLSELSAEE
                     EDPDTLADLDAFVDQLAASDKKRKATETDADSSAEQKKRRVLPVKFRQEIKDDAALKS
                     NQKLDISALISSHPSLASASALIKPSKPSTTKSVLKGGVLAAPLPTVQQERLDREAAY
                     AQTKTEGQKWSTLMKRVKEAEHLSFPLQAKDRGGVKSSSEILAGFKPQNEMESAVEAL
                     LKKANLTEDELTKHEDLQMEAREMTEEEIKARRAELRYQRELLFRAEAKAKRVAKIKS
                     KTFRKLARKRAAKENPGMALEDLERLDPEAAQIEREKIERERAKERATLRHGAKSRWA
                     RGVGGEADDDERMAKEAMLDMKEKLLRKIQGKDEGSSSEEESEDEEEDEETVKAKAFD
                     QLAQLNSDSGAASQAQGKKGLMQMKFMQKAQERRMKEVAEQEKDARMQIELFGEDGER
                     EEESSNESDEEPAVVNVGGNEGRLKFSGPTPGTGASESPALPAPSVQDPVPASKSKSI
                     FTRAPSPPPVDSNPWLTATNSSGPSRKRHAQLGSQLNDETKAVKAIKKASKRREDEEE
                     DERVDIDVEAPIATKSVDISNNKGKTKGKTSIAAIAAVQADEQEEDEEIADLLPASGV
                     KAFKQRDLVAEAFAGDNVVEDFATEKARQIEADAPKVEDTSLPGWGSWGGKGAKKRKA
                     NPKFLVKTAGIEPIARKDFAHSNVIITEKKDRKASQFQLKDLPYPYTSKEQYEKSFEV
                     PVGSEWNSRSGFQRGTLPRVVKKPGAIIEPVRRLF"
     gene            complement(95677..97193)
                     /locus_tag="CNB00345"
                     /db_xref="GeneID:36392723"
     mRNA            complement(join(95677..96301,96360..96648,96717..97069,
                     97121..97193))
                     /locus_tag="CNB00345"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658839.1"
                     /db_xref="GeneID:36392723"
     CDS             complement(join(96237..96301,96360..96624))
                     /locus_tag="CNB00345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514200.1"
                     /db_xref="GeneID:36392723"
                     /translation="MDLITSYYRAGGGLRRRAKYRCWIQHRAQENGEAASASKVLTIP
                     SIRVSTGIQCLIGKPDVSKGRWITRHCGTSCIFQEVLVNSYRRTRYMMMSPSERFHAR
                     VHRDVAS"
     gene            99183..104893
                     /locus_tag="CNB00360"
                     /db_xref="GeneID:3255719"
     mRNA            join(99183..99727,99961..100265,100323..101273,
                     101327..101455,101504..101582,101634..102956,
                     103016..103215,103271..103613,103676..103921,
                     103976..104893)
                     /locus_tag="CNB00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656432.1"
                     /db_xref="GeneID:3255719"
     CDS             join(100330..101273,101327..101455,101504..101582,
                     101634..102956,103016..103215,103271..103613,
                     103676..103921,103976..104512)
                     /locus_tag="CNB00360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512111.1"
                     /db_xref="GeneID:3255719"
                     /translation="MALPHPPQASFHGQSQPPYHIQQNQMMSQHMQQQQIQQAAQVQA
                     QTQQQLPQNPQQFHQYGMVRPVGMNTLALSQQQQHALQQAQARQQQIIQAQAQVQAQA
                     QAQAQAQTRAAQSGQQQANQRVVPPSPHHPSPSPHMDHQFQPDMAYPHPLQQAPGMHV
                     SQMSPRSARAVSGMPQGVQVDNPAHPKNMAGGSAWMQNAMAGPLQHSGQQPQNPQQSQ
                     SQQPQPISHQHQLQPSHLPHSTPTPQHQMPPQILGQPQGSGPGAAPGQGPGQRMAQQM
                     GHAQQMEQAEYGLGMSTGTTMSRATNSNQGPVRWDADHALKAYVHDYLVKHGFSGTAA
                     QFNMEAGLNDGGIPVNAREGVLYEWWNIFLELFSAGRGVQAVIQPSYYTECMTRMRSF
                     RQHQMINNVTYTAQNVQTAANQPPQPAFTSQQIMALRQQAQAMGLSPQQANQYVQQQV
                     QQIQQQHQQQQQQLQQQQQQQQQQQQQQQQQQQQQQQQRQPQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQHAMMQQQQQQRFQFAPTSSPAAIGRPASRQDQQAQPTM
                     YQPQPQMELQPPAVVRTSSHSPINPSPHMVQQPHPGVMPSPSQPMRPPISGLMANGQM
                     RIPSSGPPPGTRRGQPQPQPQTQGHTQGYVDPSQTPTTAPSPAQGHQAHPHQPQPGQT
                     QHPHQHTHHPNAQHMPQPQHPHMTPTQQQQHMIQNQSVNVQTAQQRAQQSLAEMHAQA
                     QVQAQAQQQQQLLHSQQQAQAQAAAQAAQQREQAIQAQQQHIQAVNSQMWEGLGLGHV
                     NHGVMNYSAQSLGLGGKDPQSMDEEEKQRLIHTYKLTLQENQRKAMMGAQQSQQQTPQ
                     MQHQGQGGPGQLHQNQQYTMMPHQQSVHPQGYPDMRPNGTMTRNQSYELSQQQQPQEE
                     NKAAPTPGSLNQSTNNSSSASQSASTPTTSTANKPSPPERKRKRKNSEKENKPSSPFG
                     MSQFGQGQAGQGQQGPNAGAAGPVTSGANATNDPMRSIPGTAPPRPVSASPRNPTRRE
                     KRNQAKEMLPPRTTTPKPASGGGANAETDAREMKERKETTGRGGKVSRTPKMPKEELL
                     REVPTPKSLNLSPNGNVITVTDVNPNSASTHGFTPSPPSASTSTPANGALSLPSTTPA
                     SGQISLPNDLSMSHMDFGMGLGSMGLGGMGMEFAMGMGLGALGGINDNNRQGMGNNNG
                     GPGGNNSLEDNHGGDANAGSDLDALAGIGQDFDFGLYLAALDEEGDNGGSNGGSGGNG
                     EVIV"
     gene            105202..106845
                     /locus_tag="CNB00370"
                     /db_xref="GeneID:3255654"
     mRNA            join(105202..105355,105407..105432,105494..105713,
                     105797..105934,105993..106092,106145..106363,
                     106420..106493,106549..106845)
                     /locus_tag="CNB00370"
                     /product="fatty acid beta-oxidation-related protein,
                     putative"
                     /transcript_id="XM_568778.2"
                     /db_xref="GeneID:3255654"
     CDS             join(105323..105355,105407..105432,105494..105713,
                     105797..105934,105993..106092,106145..106363,
                     106420..106493,106549..106617)
                     /locus_tag="CNB00370"
                     /codon_start=1
                     /product="fatty acid beta-oxidation-related protein,
                     putative"
                     /protein_id="XP_568778.1"
                     /db_xref="GeneID:3255654"
                     /translation="MPAARLRLEHKVAIITGAGSGIGLETALQFAAEGARLVISDINL
                     RNVEAAAQLINTHFPECGAVAIKCDVSKEEEVKAMVDKAVEVFGRLDVLFNNAGIMHP
                     ADDNAITTEEKVWDLTQNINVKGVWFGCKYGILAMKKNKPDPSKGLGIGGSIINVASF
                     VAILGAATPQLAYTASKGAVLAMTRELAMVHAREGIRFNSLCPGPIRTPLLMDFLNTP
                     EKLNRRMVHVPMGRFGEAVEQAKAVVFLASDDSSFINGTDFLVDGGLHKCYVTPEGEP
                     AQPGPTGLLATLSKTA"
     gene            complement(107159..108963)
                     /locus_tag="CNB00380"
                     /db_xref="GeneID:3255620"
     mRNA            complement(join(107159..107566,107631..107724,
                     107791..108838,108886..108963))
                     /locus_tag="CNB00380"
                     /product="seryl-tRNA synthetase, putative"
                     /transcript_id="XM_568779.2"
                     /db_xref="GeneID:3255620"
     CDS             complement(join(107240..107566,107631..107724,
                     107791..108838,108886..108937))
                     /locus_tag="CNB00380"
                     /codon_start=1
                     /product="seryl-tRNA synthetase, putative"
                     /protein_id="XP_568779.1"
                     /db_xref="GeneID:3255620"
                     /translation="MYTAAREMSRTKQIGIAARRFSTCPPLFAPVLPQTTLPKPRFDY
                     TKLLSDPSLTLQNAQLRAFPLVTNHLSELSSLRDTQRELLQKLNATRARQKELGNSIK
                     KLKGLEVEEAKKQAKELKSLIKEFEVSLSTAESSLLDLALSLPNFSHPSTPIGPEENA
                     RTLETFGPTPIPSDPARDHVAFAQYFSLLDTSASAKTTGSSWPYLRGSLAFLEQALIS
                     YALNIANKHGFTPVIPPDVVKTDIAWRCGFQPRDQATNAAASQTYHLQPTSNSAQSLC
                     LAGTSEIPLAGMFADMIIPEENLPQRVVGVGRAFRAEAGARGADTRGLYRVHQFTKVE
                     LFVVSGEKESESMMEEMREVQKEIVQGLGLSVRVLDMPTEELGASAHRKYDMEAWMPG
                     RGKWGEITSTSNCTDYQSRRLSITYRPQPTSPTHAIDPSSGPLPFAHTLNGTAAAIPR
                     LLVALLENGLQYDKTGEGDSEQVIYTGLELPKALQRFYVGSDEIGGRGRKGLIHWV"
     gene            110158..112142
                     /locus_tag="CNB00390"
                     /db_xref="GeneID:3255704"
     mRNA            join(110158..110842,110890..110935,110984..111777,
                     111847..112142)
                     /locus_tag="CNB00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_568780.2"
                     /db_xref="GeneID:3255704"
     CDS             join(110234..110842,110890..110935,110984..111777,
                     111847..111942)
                     /locus_tag="CNB00390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568780.1"
                     /db_xref="GeneID:3255704"
                     /translation="MWPFPLSFQPDHRNNMLQPQPPLPQHHHSHAQPHQHHSPASRHA
                     QRPEYTDQGNYDYSYLFRPEQHHSYDPSGGSSSSSGNQPVSNGRTGASPSSTPWSGGG
                     PYTATSGIETSWDWYARQQSQGSSQQQQRDPRSMANFAQERLTGSFGWPESRNGGNGG
                     DGYGHSLYGSYTGIKKEDKKDGERSAKKPRVDAPFNVENELAQLKMHLNEIINLIKPF
                     APQKGQPAPEQPPPPYLSTRFARLSSVIHESLQNLSPHVHVNLSPEFVPTYQPPEKKV
                     TAANGSEKRSSPALGTAGAEMDGKGLTKTKTAEELAAAEKEMEIIKKRRDALIAKAQA
                     AIARGGTPKANNAKGGKNANKTNGGKSNKSSPLKDNSTKSLPLFTPTSPIPRLPSLLN
                     HNNLEALTGGSEFSSSFLPPITTTISTAMADRLAQAQPVIQQSFPQDSMPFSIFSQDS
                     MAWLRRCHGCGSSVTSEWRTGPDGPDSLCDICGMHYERLSRKKDLLSFPQPGHIDGDT
                     AFVLGS"
     gene            complement(112668..115896)
                     /locus_tag="CNB00400"
                     /db_xref="GeneID:3256111"
     mRNA            complement(join(112668..113062,113117..113469,
                     113526..113659,113719..113776,113856..113893,
                     113955..114070,114197..114488,114540..114596,
                     114652..114729,114783..115054,115110..115165,
                     115216..115896))
                     /locus_tag="CNB00400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568782.2"
                     /db_xref="GeneID:3256111"
     mRNA            complement(join(112668..113469,113526..113659,
                     113719..113776,113856..113893,113955..114070,
                     114197..114488,114540..114596,114652..114729,
                     114783..115054,115110..115165,115216..115896))
                     /locus_tag="CNB00400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568781.2"
                     /db_xref="GeneID:3256111"
     CDS             complement(join(112785..113062,113117..113469,
                     113526..113659,113719..113776,113856..113893,
                     113955..114070,114197..114488,114540..114596,
                     114652..114729,114783..115054,115110..115165,
                     115216..115457))
                     /locus_tag="CNB00400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568782.1"
                     /db_xref="GeneID:3256111"
                     /translation="MSRPSVDAPSVVSAINQRPAFERVATDHKDAKPDPTDLEINHLH
                     QDDDKSSIEIEQSAGVTKIEALYLVFGNGWKLWTLWGSIALISIAYGLSQMTTYYYTA
                     FATSAFGEHTVLGTISVITGIMAGVAKPFLAKLADLFSRPWALALSVLFYTIGYIVVA
                     ASKSVADVAGGEVIYTIGNTGLDFITSILLADITSLQWRGLVIGLYSLPFIPFAFVAG
                     NIADGINAYSANGWRWGYGMFCIMIPCVVIPAILVLFWADWRAKKIGALSLASSTYAR
                     EKLLAGQTVEKRPFIATCLYYARRIDAVGLLLMGFAFGCILSPFTLYTTAKGGYKNPS
                     LIALLVVGGVLFISFCLWEWKVASHPIMPKRVFNRTFVCCLLIDWNYYLSGYLSDTYW
                     SSWLYVVKDYNDKDYTYIMNILTVGLCFFSVLAGLVQRYTHRFKYLQLSGLAIRIIGM
                     GLNYLSVNGNMSDGVIVMSRVLISIGGGISVTSSQVACQGSVAHQDMALAMAILALWT
                     SIGGAIGSAISASVWNRRVPEALTKYLGSTHNSTEIAEIFGSIVIARTTEPRDLVITA
                     YNEAIKPLYLAALIMSMLSLAFGIFTYDIHLGKNHNAIEKRETAIRSEDEVRPEVIAA
                     KAREVEEKIAAEVLRKEQLQAQVERTNVKAGEE"
     CDS             complement(join(112785..113469,113526..113659,
                     113719..113776,113856..113893,113955..114070,
                     114197..114488,114540..114596,114652..114729,
                     114783..115054,115110..115165,115216..115457))
                     /locus_tag="CNB00400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568781.1"
                     /db_xref="GeneID:3256111"
                     /translation="MSRPSVDAPSVVSAINQRPAFERVATDHKDAKPDPTDLEINHLH
                     QDDDKSSIEIEQSAGVTKIEALYLVFGNGWKLWTLWGSIALISIAYGLSQMTTYYYTA
                     FATSAFGEHTVLGTISVITGIMAGVAKPFLAKLADLFSRPWALALSVLFYTIGYIVVA
                     ASKSVADVAGGEVIYTIGNTGLDFITSILLADITSLQWRGLVIGLYSLPFIPFAFVAG
                     NIADGINAYSANGWRWGYGMFCIMIPCVVIPAILVLFWADWRAKKIGALSLASSTYAR
                     EKLLAGQTVEKRPFIATCLYYARRIDAVGLLLMGFAFGCILSPFTLYTTAKGGYKNPS
                     LIALLVVGGVLFISFCLWEWKVASHPIMPKRVFNRTFVCCLLIDWNYYLSGYLSDTYW
                     SSWLYVVKDYNDKDYTYIMNILTVGLCFFSVLAGLVQRYTHRFKYLQLSGLAIRIIGM
                     GLNYLSVNGNMSDGVIVMSRVLISIGGGISVTSSQVACQGSVAHQDMALAMAILALWT
                     SIGGAIGSAISASVWNRRVPEALTKYLGSTHNSTEIAEIFGSIVIARTTEPRDLVITG
                     KTSDLLFLTPAFTNFFLAYNEAIKPLYLAALIMSMLSLAFGIFTYDIHLGKNHNAIEK
                     RETAIRSEDEVRPEVIAAKAREVEEKIAAEVLRKEQLQAQVERTNVKAGEE"
     gene            116220..117849
                     /locus_tag="CNB00410"
                     /db_xref="GeneID:3255891"
     mRNA            join(116220..116610,116903..117849)
                     /locus_tag="CNB00410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568784.2"
                     /db_xref="GeneID:3255891"
     mRNA            join(116220..116610,116903..117176,117298..117849)
                     /locus_tag="CNB00410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568783.2"
                     /db_xref="GeneID:3255891"
     CDS             join(116287..116610,116903..117176,117298..117704)
                     /locus_tag="CNB00410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568783.1"
                     /db_xref="GeneID:3255891"
                     /translation="MNFCRSPRLFQRSSLASRHRARFGRLYSSSPSDLESWISSLTNK
                     KPEITHDFIDADRCSQLLRVLPTRQQGDYIGDVPAGNRLPPAHHLIFFRPKPMLRDLG
                     PDGSSVEMNAPPPFTRRMWAGGSMVWSETNSLQVGSPMTQALSIPRVEHKKGMVFVHQ
                     QRVLYPGIQETASTDGWALKETRIHVFRPAQQAVTPATSGDSSLAHSSDSHLNSHADK
                     DDAPYQFYYTPTSPLLFLYSALTHNPHKIHYDQDWSVAKEGQRGPLVHGPLTATLLVE
                     LAGQVEGKKLKEFNYRATSPMLLDEEIRMTGRWSEGGVLTLEAKQGTKVGMKATASFV
                     "
     CDS             join(116287..116610,116903..117232)
                     /locus_tag="CNB00410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568784.1"
                     /db_xref="GeneID:3255891"
                     /translation="MNFCRSPRLFQRSSLASRHRARFGRLYSSSPSDLESWISSLTNK
                     KPEITHDFIDADRCSQLLRVLPTRQQGDYIGDVPAGNRLPPAHHLIFFRPKPMLRDLG
                     PDGSSVEMNAPPPFTRRMWAGGSMVWSETNSLQVGSPMTQALSIPRVEHKKGMVFVHQ
                     QRVLYPGIQETASTDGWALKETRIHVFRPAQQAVTPATSGMSSWRQDALSRQTPINS"
     gene            120070..121817
                     /locus_tag="CNB00420"
                     /db_xref="GeneID:3255677"
     mRNA            join(120070..120341,120438..120521,120588..120866,
                     120923..120988,121042..121410,121459..121644,
                     121695..121817)
                     /locus_tag="CNB00420"
                     /product="dehydrogenase, putative"
                     /transcript_id="XM_569052.2"
                     /db_xref="GeneID:3255677"
     CDS             join(120276..120341,120438..120521,120588..120866,
                     120923..120988,121042..121410,121459..121644,
                     121695..121739)
                     /locus_tag="CNB00420"
                     /codon_start=1
                     /product="dehydrogenase, putative"
                     /protein_id="XP_569052.1"
                     /db_xref="GeneID:3255677"
                     /translation="MSVHAKSDPQIPQIMRAWTQNESNWLSITEVPIPQPKVNQVLIK
                     VEYAAQNPTDWKHAVGQSLPGVINGCDYAGTVVKLGSQLKTPLKIGDKVAGCVHGGWS
                     KEEGSYAEYAVIDSNMCFIVPERMKMEEAATYGVGWVTAAQTIVLRQGKAFPPGDTKV
                     LGNPWYIIYGASTSVGLFAVPLAKALGYRVLGVCSPHSFDLVKSYGADATVDYHDQDK
                     AIEEALKITDGGVEYALDTISQDDSFRITIKMMGKKGKQLNATLPVPDKAQKLNPNLK
                     TEFTLMYSLFGIEFDWTPRSSEKMMISATKEDRAFGEEVYKRTPELIAKYGIKPNPIV
                     IKGNFDDVAKGLEDLKNGKVSGEKQVIKMA"
     gene            123289..125945
                     /locus_tag="CNB00430"
                     /db_xref="GeneID:3255563"
     mRNA            join(123289..123923,123975..124055,124111..124251,
                     124303..124502,124555..124769,124821..124999,
                     125048..125367,125426..125595,125653..125945)
                     /locus_tag="CNB00430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569053.2"
                     /db_xref="GeneID:3255563"
     CDS             join(123609..123923,123975..124055,124111..124251,
                     124303..124502,124555..124769,124821..124999,
                     125048..125367,125426..125595,125653..125720)
                     /locus_tag="CNB00430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569053.1"
                     /db_xref="GeneID:3255563"
                     /translation="MTGIISEEKYLYLPSSSSTAANTPAATEDKQFVFPASGLSRATS
                     KISETSTDDKEKEKDELQSGQQTPVENYLPTLEYVPSQKVVLSKSKRILLGTVMMSTT
                     FVASATLSSSLLCIPNSAKDLGITELQAQWISSAYSLANGCGLLVSGRLADLYGRKWL
                     YLLGMAAFLILNVISGVVRNYIGICVLRAFAGLAISVALPAAFGIIGVTFDSEPGRTI
                     AFATLALGYPVGSGPGMIIAGVISSISARAWQYVFFILAGLSLFPVVGGVFSIPPEPS
                     KKHNGNRQVDWMGAFLITAGLSLFSFALTQSGLVEKGWRTPYIPVVLVISILLIVLYG
                     FWEHFVEKKTSIPPLSRLAIFSRRQWKVTAILVVSFFAYVPIAGWMYLTTIWFQNYKQ
                     ESALMNAVHILPAPIVGVIACVLVPLLAPKIRAPYLLMFGGFSTAAANWLLAIRPEGE
                     IYWAHEFLSCVFNPFGADFTVGIGSVLISNLVSEDEQSLAGALFQTALQIASTVGVCI
                     CSLMQTEVTSQSGSLLTGLRDTFWMSAAFSWTSAIIAFITLRKVGLAKDVGKKE"
     gene            126687..129572
                     /locus_tag="CNB00440"
                     /pseudo
                     /db_xref="GeneID:3255665"
     gene            complement(129481..131454)
                     /locus_tag="CNB00450"
                     /db_xref="GeneID:3255602"
     mRNA            complement(join(129481..129937,129987..130684,
                     130738..130808,130860..131019,131070..131454))
                     /locus_tag="CNB00450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656433.1"
                     /db_xref="GeneID:3255602"
     CDS             complement(join(130419..130684,130738..130808,
                     130860..131019,131070..131373))
                     /locus_tag="CNB00450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512228.1"
                     /db_xref="GeneID:3255602"
                     /translation="MTTPSKSSNKRFRDNESEVDETGSQIEKQVNATASTSTSRPALS
                     SHESEGSSVMKTKKKKKAQTPGIVFISRVPPGMTPQKIRHLMGRWGDIGKVYAQRRDA
                     PGGYNPNSANQKKQKHASANFTEAWVEFLDKSVAKTVASMLNAQVIGGKKGDRWRDDI
                     WTMRYLSGFKWEMLGEQIAYERQAHQARLRTEITRAKTEQNEYLKNVELARTLEKRKA
                     KKAAAGGPSESAPNQDAHSRSYKQRNVVEKPKTLEGQGMDGVLNNIFG"
     gene            131648..134185
                     /locus_tag="CNB00460"
                     /pseudo
                     /db_xref="GeneID:3255589"
     gene            complement(136345..139191)
                     /locus_tag="CNB00480"
                     /db_xref="GeneID:3255597"
     mRNA            complement(join(136345..136593,136658..137003,
                     137073..137377,137437..137986,138037..138671,
                     138860..139191))
                     /locus_tag="CNB00480"
                     /product="threonine-tRNA ligase, putative"
                     /transcript_id="XM_569057.2"
                     /db_xref="GeneID:3255597"
     CDS             complement(join(136439..136593,136658..137003,
                     137073..137377,137437..137986,138037..138671,
                     138860..139187))
                     /locus_tag="CNB00480"
                     /codon_start=1
                     /product="threonine-tRNA ligase, putative"
                     /protein_id="XP_569057.1"
                     /db_xref="GeneID:3255597"
                     /translation="MLRRLIPHAARFSHRTPTRYTYPLLQAARTMSAEAHPVSSTSKP
                     APPAEGVNPITPAAHEGKKKEKKEKKDKKGGGVSGPLELSPPPEFFAERLKIYDEWKA
                     KYDKFVAEQPREPITITFPDGKTVQATSWETTPLQLAKDISPSLADRVIIAKVNNQQL
                     WDLTRPLEASCSLALLDFDSPDNNYEARQVFWHSSAHVLGEACERRYEGCCLGYGPPL
                     EEGGFFYDMSLANGRTISQDDYKPIEDVCKAAVKEKQPFERLELPKEVLLEMFKYNKY
                     KQHYIQDKVPDGTSSTVYRCGPLIDLCLGPHVPHTGRIKSLAVTKNSSSYFLGDAKND
                     TFQRVYGMSFPDNAQMKEYKKYLEEAAKRDHRKIGKDQELFIFNDLSPGSAFFLPMGM
                     RIYNTLMSFIKDEYFKRGFSEVGSPNIFNANLWKTSGHWQNYAEDMFQLKADEEQLAL
                     KPMNCPGHCLIFDARERSYKELPLRFAEFGVLHRNEASGALSGLTRVRRFVQDDAHIF
                     CTPDQVEAELYSAFEFLDAVYKPFGFTYKVGLSTRNPKKWMGDLELWNKAEGTLREVL
                     EQKVPGNWHVNEEDAAFYGPKLDFQLTDALKRSWQCGTIQLDFNLPERFNLKYHSPEQ
                     NPDGTQFARPVMIHRAILGSLERFIAIITESTGGKWPLWLSPRQVVVIPVAKPFTEYA
                     QKVAKTFQEAGLYAEVDLTDNTLNKKIRNAQTAQWNFIMVVGQDELDAQAVNIRNRDD
                     EVQGREETVALSRAVEQIVKLKESKAAVSKFE"
     gene            139386..143473
                     /locus_tag="CNB00490"
                     /db_xref="GeneID:3255621"
     mRNA            join(139386..139495,139535..139713,139764..139886,
                     139938..140081,140132..142017,142074..142208,
                     142262..143106,143161..143473)
                     /locus_tag="CNB00490"
                     /product="Pol II transcription elongation factor,
                     putative"
                     /transcript_id="XM_569058.2"
                     /db_xref="GeneID:3255621"
     CDS             join(139455..139495,139535..139713,139764..139886,
                     139938..140081,140132..142017,142074..142208,
                     142262..143106,143161..143368)
                     /locus_tag="CNB00490"
                     /codon_start=1
                     /product="Pol II transcription elongation factor,
                     putative"
                     /protein_id="XP_569058.1"
                     /db_xref="GeneID:3255621"
                     /translation="MSNPARVILLVGKGGVQTDVDLDSLAQDEVADIIPVMLADYESE
                     CRDWTLIASEHWREGRWNRVMDLLERAVSFFNGERGRRRDSASLINIHSMLAHLHLHL
                     ARSAPKVILQNAKYDKLDPSIRTKDYHHREAAASLNAATEALRASGGSQEDEPVSLTM
                     GKVIHYLATGQPGLAHPLVERLLQRQPNNLMALTAQARLQFARRSHLQALQTYQKLLT
                     LAPEMSPDPRIGLGLCFWQLGDRAKARTAWERALEREPGSWVCLLLLGLASLNDARQP
                     SIPRTERLKLETEGVGFVQKAFKLNNKSSASALALASVSGQGGQSQLPLASKLAERAV
                     QYADNKRHAVLANSERGRLGFMAGDLADAGTYIAAVKKEDPNAVNIIAELTLGQMAIK
                     SGNLREALNYIEQTAKRLNGQGPLEYTVLHACLLAYPHPGMSHDEVVRNRTLARNMLT
                     EVHNLVASAETEADWAKLRGVGSDADVFVDLAKLWQGENVEKAIGAYQTALSIITDND
                     LDSAQEPGLDPPSFTALRLSDNLGALYHLEGNVETAERMYQEALQKIATQEGKEAETL
                     KTVLAYNLGRAYEEGGDHAKAAQWYRDVLRQHPEHVESKVRLALIATSAGRHFDAHTL
                     LKECLQSDENNLILRSVYTNFLITIGSYREAFAFTTQTLKVDKSDAWTFCALGWLHFT
                     LGREAKSPQELAERPKQYLRSAEAYERALIIDPKCAMAAQGLAIALVEDSLALRGTNY
                     GAEEGKVRARLAGQTLGIFGRIKDSLAEGAVNVNLGHCYFIRGEEEKAIESYMTASNA
                     FDEKDVNVLLYLARAWYALANRESNFSAMNKALDYCQKAMHIHPADRAILYNIAMIQQ
                     KAAEMLFSLDCSKRTLEELTIALKQAQQAVDTFRSLADDRSGSLPYDAELADQRARYG
                     EGLLRRAAGEMTKQEAYQGEALARVEEARRLRAEEQARIQAAEEARQAELRIKAEEIA
                     EQRRKAREEAQAWQEELAARQAEEEARRAAIVEKRKRRKEGIADSGEDGEGEGRKREK
                     KPRKKKTKEGKKGRKVRSKSEVGTTDEEEEARETGDDEDEETSRARKAKSTLAMLKAK
                     RKARRADPDDDEEEDEDEVNQGQAKRGKQFKSKAYISDSDDENDEAPVSASRPGSEEP
                     LHQKDDEREQSEAHTPAKSQNDEDSGMDVDQNGNDEDEDE"
     gene            143622..147038
                     /locus_tag="CNB00500"
                     /db_xref="GeneID:3255547"
     mRNA            join(143622..143746,143803..143918,143976..144332,
                     144392..144547,144599..144757,144805..145035,
                     145086..145546,145603..145790,145840..146439,
                     146491..146750,146810..147038)
                     /locus_tag="CNB00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_569059.2"
                     /db_xref="GeneID:3255547"
     CDS             join(143638..143746,143803..143918,143976..144332,
                     144392..144547,144599..144757,144805..145035,
                     145086..145546,145603..145790,145840..146439,
                     146491..146750,146810..146950)
                     /locus_tag="CNB00500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569059.1"
                     /db_xref="GeneID:3255547"
                     /translation="MNGFGQMPMMPMGFPASPGFGVPGGNYGGRGRGRGRDERRGGGR
                     GRGGHGGGRAPVPETSDNRLRKMVIKLGDDEDFDPIDDPPRLARVLKRGWREGTVGLL
                     EGFRVSVTQQPHKHGYYVGLLVALSRQLEAEPVKKEKEEPTEGETKSGDAEMKDEKPT
                     IVEEPAYGKEIMDDLNRAFRGWVEQREWQNVRLCLQFFSLLVTARVVTANSLLTVYDN
                     LLNVLDEVGGGGDRSERAVRAVGEGLIRSAHTLVETNVGEVEALISKIEGYIIGRRNE
                     PKVLQDPLAPILPAGQEHPTYSDNLDNLLAALRAFQASNWEPSAVLPAYLREIVPTPG
                     PTAPIPYELQEVAMPPELYEVDSDELDVGEGQIGTFSFFADEVVPSPSTLDGWYLRSL
                     VLDIINLYEVNRKECSRLLLELRKFLPRDTFKPIVPLPEDASPPPSTWSLESLVVSTL
                     LGAMLTLPKSHHKLIYYGSVITELCKASPNTVAPPVGRSMRKIFSLLGTEGLDVEIVR
                     RVAEWFSVHLSNFGFQWMWKEWVPDLELPSSHPRRAFMRRVIELEVRLSYYDRILETL
                     PEPMIAEGAGVISPEAPDPFWAYEKDDHPLHAEAAALLSQIRQKLPSTEIIKYITEMP
                     NASSGPGEPLYPAVRQMVFETISHLGSRSFSHFLNATERYSDVLRFLTPDFASRRILL
                     DAVNSYWRRSSEMRLVTLDKYLQYGILEGIDIVEWIFADDEAEGEEGDGWTDGDKWEV
                     LSMCLEKHLGRVKAISRRLKVIEREDEAARARKAGEQLERGEDVNVEDDTNEDSRPET
                     SKEARDAQTSLDIQSTRLEKVLLATFKHFIFALLPWTAEREEGITTSSEGLKGVLTLL
                     DSDEEGLWGVRAKWGWYREFVRRYQAQLMPFSDLINATVISKMSKSEDEGSAEARAEK
                     MVKSVWEVIYL"
     gene            complement(148002..150271)
                     /locus_tag="CNB00510"
                     /db_xref="GeneID:3255599"
     mRNA            complement(join(148002..148263,148320..148468,
                     148538..149506,149560..149936,149995..150271))
                     /locus_tag="CNB00510"
                     /product="expressed protein"
                     /transcript_id="XM_569060.2"
                     /db_xref="GeneID:3255599"
     mRNA            complement(join(148002..148263,148320..149506,
                     149560..149936,149995..150271))
                     /locus_tag="CNB00510"
                     /product="expressed protein"
                     /transcript_id="XM_569061.2"
                     /db_xref="GeneID:3255599"
     CDS             complement(join(148095..148263,148320..148468,
                     148538..149506,149560..149936,149995..150079))
                     /locus_tag="CNB00510"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569060.1"
                     /db_xref="GeneID:3255599"
                     /translation="MAVTPLIDGENRSIDARSIVVLIVFFVVNALVIWPVYIPLPYFI
                     SRPCRKVWAKISLSKNSHDEQCSSKLKQPERRQPVGTLEMNSHELQGGLPNTPIEKDE
                     RYHIPLDLRTAPVVGVLLILASTCIPGGVVRRGIIGSGGVKPYDIMVLFVCFAYISLS
                     LDATGFLRYLAFLVATRSSRGDRLYTAFYLFFTTLGLIFGNDPLILSGTPFLAYFTDH
                     ASITEPTAFLFTHFQVANLVSALLVSSNPTNLVLTSAFGINFLSYSAWLALPTVTSVV
                     LYYPLARWCVYRRKGLIPLAIHPPPINPREALLDPVGAIFGASVFVITILALVGLSAG
                     GLLEGKVGVWTVTAPAAAVIFIRDVGRDFFKHNEESEGVMNVDEKHPEFPASSTQAIA
                     HSSQTTASVAPQPTCSAMFPTVKRIVSHLPLALVPFAFSFFILVEGLQHTGWIALFGR
                     WWGEWERVGGVAGSVWLMGMLSIIGCNIFGTNIGATILLARVIQSWATTQTAVSDRSL
                     YSTVFTLAVGSNFGAYSFVFSASLAGLLWRNILSQKGIRVTLRQFIKWNTLAVMVTML
                     IGCLIVAGEVCVMYKN"
     CDS             complement(join(148469..149506,149560..149936,
                     149995..150079))
                     /locus_tag="CNB00510"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569061.1"
                     /db_xref="GeneID:3255599"
                     /translation="MAVTPLIDGENRSIDARSIVVLIVFFVVNALVIWPVYIPLPYFI
                     SRPCRKVWAKISLSKNSHDEQCSSKLKQPERRQPVGTLEMNSHELQGGLPNTPIEKDE
                     RYHIPLDLRTAPVVGVLLILASTCIPGGVVRRGIIGSGGVKPYDIMVLFVCFAYISLS
                     LDATGFLRYLAFLVATRSSRGDRLYTAFYLFFTTLGLIFGNDPLILSGTPFLAYFTDH
                     ASITEPTAFLFTHFQVANLVSALLVSSNPTNLVLTSAFGINFLSYSAWLALPTVTSVV
                     LYYPLARWCVYRRKGLIPLAIHPPPINPREALLDPVGAIFGASVFVITILALVGLSAG
                     GLLEGKVGVWTVTAPAAAVIFIRDVGRDFFKHNEESEGVMNVDEKHPEFPASSTQAIA
                     HSSQTTASVAPQPTCSAMFPTVKRIVSHLPLALVPFAFSFFILVEGLQHTGWIALFGR
                     WWGEWERVGGVAGSVWLMGMLSIIGCNVSLHLLFISLYYGKIEDGLPVH"
     gene            151400..154470
                     /locus_tag="CNB00520"
                     /db_xref="GeneID:3255625"
     mRNA            join(151400..151966,152020..153493,153551..154470)
                     /locus_tag="CNB00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_569062.2"
                     /db_xref="GeneID:3255625"
     CDS             join(151583..151966,152020..153493,153551..154080)
                     /locus_tag="CNB00520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569062.1"
                     /db_xref="GeneID:3255625"
                     /translation="MIGTMSTSHLNSPSASFPHQEQELFSLDFLALTGLDGSISDTNS
                     PQANSSQSSHRQHDQSGDAEGQTSNERQNSIFFREQRRSSKDLLNSMEVDEHTGNALR
                     GLGHSNDGENQLQDFDSLQAALLQQQLQAIHMQSPLGFDIQNPTYPLGQLLASPAFDE
                     LHSSPNGHSEQQTLSVHNAHPSSRSVYDSPLSHLAFNAHGHRNSFSSMSTRSPLEQLQ
                     RQQQQFQEQLGLLQRQQLKMQATAAAVMAASTSPYIGLNGPSSTGPRPSVTPGMTPSS
                     SNTGMFSPLTSPALEATNYSHQSHVSRHSQQFSPAYGSQHIGTSGILNTALSSPALNP
                     IGSTGGANQTLSPALNPQNEVNRGDSEYLHAFMGMLDSTNSGNSTPGGEPPQPSYQSP
                     SMTSASTAGNSTIISSPALYPQGAGTGPHRQSLPFKSRPSPMLKPTHHRSHHRNSGSG
                     NVSIPSSPAIQKYHPDASMPPAAMNSGLPPPAIEHRQIQSNLSVSSTSTPSPVDLSHI
                     MPPPPVPTGKPKARKGVLPMTPASLMNLGSVEKHGSQSVPLPKSQTSSESNSSIGTVT
                     AATSSGSTSKPAAGKKKTGGQVGKKTAGSKLVPVGTTKRTLAMRPQTTVGVRSATKAA
                     AAAAAAAAIAPAEPENRKISHKAAEQKRRDSLKAGFDELRLLLPPINTEALDPLSGEP
                     IPGSSAPRLLPKSSLVPDDNPNRGVSKVALLRFGNEYIGKLQERVDRRDLYIEKLREE
                     VKRLREGGEEEDVTLDNGEDLLEYDWREGEEDEFGECNGDDYNEDEKEAGEGDEG"
     gene            complement(154393..156075)
                     /locus_tag="CNB00530"
                     /db_xref="GeneID:3255630"
     mRNA            complement(join(154393..154754,154802..154816,
                     154873..154965,155017..155175,155228..155491,
                     155551..155609,155657..155907,155957..156075))
                     /locus_tag="CNB00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656434.1"
                     /db_xref="GeneID:3255630"
     CDS             complement(join(154480..154754,154802..154816,
                     154873..154965,155017..155175,155228..155491,
                     155551..155609,155657..155907,155957..155983))
                     /locus_tag="CNB00530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512229.1"
                     /db_xref="GeneID:3255630"
                     /translation="MGFFSFFSKSSPPDYETLLSRLATDIAEAKTNLSEIRLRERRIA
                     LLVYLYGFAGWVLWVGLWWVQGLGIIGATQDELLGRMIGLAGVLGGPVIIYFFNRVIH
                     FYFSRQRVHEEKHLRELLTEQRKQLEEIKKATNYDSTRKLIERYDDPTSNLGPAVGGG
                     LKTTPQKPGKVTPNPSPKVVGPGGTPRAPGHLIGAGGTPGPLRSETPLPVPAGISPDQ
                     AAALQMQMGAIQPILPTPEKRWYDRLADSILGDDPSQATQNKYALVCEKCFRHNGLVG
                     GKYEWERMQWICPKCNYLNPAPISRLSSSSGPSQLATPSQPSKSQSQPQVTPSHVQRS
                     SASPTASRTRRPPGGEKGTPRTSKLAQEVFNASDEEAEEEMDVDEQ"
     gene            158578..160722
                     /locus_tag="CNB00540"
                     /db_xref="GeneID:3255636"
     mRNA            join(158578..159327,159382..159451,159503..160489,
                     160550..160722)
                     /locus_tag="CNB00540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569064.2"
                     /db_xref="GeneID:3255636"
     CDS             join(158621..159327,159382..159451,159503..160489,
                     160550..160660)
                     /locus_tag="CNB00540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569064.1"
                     /db_xref="GeneID:3255636"
                     /translation="MDALLAAAGPLPQKKGRPGKVHQRTPHPTSHKTVARGDGKDNID
                     SSTQSILSSTRLPHSFHRSNLATGSSSAPIRPDGTLGRIGDKKLRAKIASQDVGNKRA
                     KVERDDVNEWINKAIGGERGGIEVDEDLGEKTWRVKQEEIVKEVAMNVRGKKFDLKME
                     DMGSYKVDYTRNGRHLAIASSRGHVATFDWQAGKLHSEIHLKETVRDIKFLHSEAYYA
                     VAQKKYVFIYDQNGVELHKLKQHIDPTHMEFLPFHYLLSTVGNAGYLKYHDTSTGVML
                     TQIPTRLGSPHSMTQNPHSAIIHLGHANGTMTLWSPNMTTPHVKLLAHRGPVNGVAVD
                     PSEHSAGRYVATSGMDGTVKLWDGRMWGKEVREWKTRNQITSLAFSGMGMLSVGGKSG
                     VTVYQDLYKNTHRPPSPYLTLPLPSLTASATRFCPFDDLLCVGHERGISSLIVPGSGE
                     PNFDSAEADLFETRTRRREREVRGVLEKVRPELITMDANFLGKISEGRGGETHEEREG
                     RSFRQLGRLERLRLTGKADEPEQEGVDDEDAGLEDGEADPNGGERSIREKKERRKMKG
                     KGGSTKRYLRKKAKKNIVDNSLLQMKAKVAAQRASEEKKRKVERGEIVQETGALARFA
                     "
     gene            complement(161409..162123)
                     /locus_tag="CNB00550"
                     /db_xref="GeneID:3255640"
     mRNA            complement(join(161409..161536,161588..161775,
                     161835..161930,161985..162123))
                     /locus_tag="CNB00550"
                     /product="histone H2A-1, putative"
                     /transcript_id="XM_569065.2"
                     /db_xref="GeneID:3255640"
     CDS             complement(join(161501..161536,161588..161775,
                     161835..161930,161985..162060))
                     /locus_tag="CNB00550"
                     /codon_start=1
                     /product="histone H2A-1, putative"
                     /protein_id="XP_569065.1"
                     /db_xref="GeneID:3255640"
                     /translation="MSSGGKGKASSETKSSSRSSKAGLQFPVGRIHRLLKKGNYAQRI
                     GSGAPVYLAAVLEYLAAEILELAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLGSVV
                     ISQGGVLPHIMAELLPVKTKGKAKASQEV"
     gene            162502..163264
                     /locus_tag="CNB00560"
                     /db_xref="GeneID:3255623"
     mRNA            join(162502..162649,162707..162828,162884..163027,
                     163078..163264)
                     /locus_tag="CNB00560"
                     /product="histone h2b, putative"
                     /transcript_id="XM_569066.1"
                     /db_xref="GeneID:3255623"
     CDS             join(162566..162649,162707..162828,162884..163027,
                     163078..163147)
                     /locus_tag="CNB00560"
                     /codon_start=1
                     /product="histone h2b, putative"
                     /protein_id="XP_569066.1"
                     /db_xref="GeneID:3255623"
                     /translation="MAPKSVASKAPASQASKAPAAASKAPAKAAKTSAAPKDGAKKRS
                     KKRVESYSSYIYKVLKQVHPDTGISNKAMAILNSFVSDIFERIATEASKLASYNHRST
                     ISSREIQTSVRLILPGELSKHAISEGTKAVTKYSSSK"
     gene            164825..165649
                     /locus_tag="CNB00570"
                     /db_xref="GeneID:3255680"
     mRNA            join(164825..164963,165026..165140,165196..165265,
                     165327..165649)
                     /locus_tag="CNB00570"
                     /product="histone H3, putative"
                     /transcript_id="XM_569067.1"
                     /db_xref="GeneID:3255680"
     CDS             join(164903..164963,165026..165140,165196..165265,
                     165327..165497)
                     /locus_tag="CNB00570"
                     /codon_start=1
                     /product="histone H3, putative"
                     /protein_id="XP_569067.1"
                     /db_xref="GeneID:3255680"
                     /translation="MARTKQTARKSTGGKAPRKQLATKAARKQTTTSAAGGVKKPHRY
                     RPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAY
                     LVSLFEDTNLAAIHAKRVTIQPKDLQLARRLRGERS"
     gene            166144..168809
                     /locus_tag="CNB00580"
                     /db_xref="GeneID:3255628"
     mRNA            join(166144..167445,167507..167739,167804..168809)
                     /locus_tag="CNB00580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569068.2"
                     /db_xref="GeneID:3255628"
     CDS             join(166202..167445,167507..167739,167804..168525)
                     /locus_tag="CNB00580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569068.1"
                     /db_xref="GeneID:3255628"
                     /translation="MQHHPAVAAQPGRTIAPIPHHRPQQPRITPYTPNVRDLNPGPKN
                     RLILALRSNIPFEVDWALPQLVVASFDQSDGFKLEAWPDSICALKEWPAKWLEGLERE
                     AAVFEMKAGRLDFEGDENDEEGRMAKRRKRDLALGAVVEWENDLKVEQRATNSLLVLR
                     NASFNAPNAKILSSSSFLAFLADFFSLPLPFLQHLCLRTPEPIHHILIIVQSIFPHLR
                     VDMPGIDRIKHIFGVVFPQLFVDTRDIAMMNNLIPLMMMGQTIPNNHPPPPELIPHLL
                     QLLVLRPAGPLLDLTLDILISLSTNPIHSRAILSHTSFPHHLKSITALLEHQARPVVN
                     ALDPPPSTRGKMVRNPAGPSCRAEELNQRRTKEREAALGHMDPMAGGRPVYNEVGDKP
                     PTFSPATKKRLFRMKEPERSIEWMHQAFVYSSTAQVLQVTFWHAYRDFFTNPACVEPM
                     LSASDVIKNVTAAFPGASAKVWTDASGAQKFVIAGVGFRKRSDDDERFTCYWHACTQR
                     YSATNPVQLLEHISNYHLQTFSAPQCQWGSCDHNLCTYSHLLTHIPLGQPPSSISVPD
                     AISCHIADHSSSVLQRKITNRTVPPLSSVRLAVQGAFTPVDARRQPTGAALLAALLIR
                     NLARTLRAEISLAVPELSHAQTQETADEAQARKKHLLEERYGLPIPDSVLKEEEEEQA
                     NVQQGQDLDMSEEERERAKKAFENVEERIMKVMLENVSGITQYLGDALGL"
     gene            complement(168606..169457)
                     /locus_tag="CNB00590"
                     /db_xref="GeneID:3255651"
     mRNA            complement(join(168606..168831,168900..168980,
                     169097..169194,169297..169457))
                     /locus_tag="CNB00590"
                     /product="mitochondrial genome maintenance-related
                     protein, putative"
                     /transcript_id="XM_569069.2"
                     /db_xref="GeneID:3255651"
     CDS             complement(join(168670..168831,168900..168980,
                     169097..169194,169297..169360))
                     /locus_tag="CNB00590"
                     /codon_start=1
                     /product="mitochondrial genome maintenance-related
                     protein, putative"
                     /protein_id="XP_569069.1"
                     /db_xref="GeneID:3255651"
                     /translation="MSTGERIANKVAGIAPPLPVFSPAIISNGFVYTSGQIGAGPDGE
                     LVKGPITNRVNQIMDNLDAVLKAHGTSLEHTVKFTIFITSYETFAELNEAYSKRIPSP
                     APARSCIGVASLPKGTDVEIECVAVLPNKAKL"
     gene            complement(169469..171246)
                     /locus_tag="CNB00600"
                     /db_xref="GeneID:3255664"
     mRNA            complement(join(169469..169776,169829..169846,
                     169907..170910,170975..171246))
                     /locus_tag="CNB00600"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569070.2"
                     /db_xref="GeneID:3255664"
     CDS             complement(join(169769..169776,169829..169846,
                     169907..170910,170975..171186))
                     /locus_tag="CNB00600"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569070.1"
                     /db_xref="GeneID:3255664"
                     /translation="MFTCISCRVAFEAADEQRAHFLTDWHRYNMKRRVANLPPVAAAS
                     FNEKVLERREQNAVRTDPRSLACAACNKQFSSENAFRTHVQSKKHRDREAAAASDERL
                     GKKPVPAPAKVESEDDDGSEDEASEMDVDSEDDEEGDFEQKMANLRRRIKPADCLFCT
                     RHSETVDENVGHMSSIHSFFIPDREILIDLAGLLSYLGEKVAVGNLCIFCPNGGKEFG
                     SLEAVRKHMIDKNHCKLAYETDEDRAELADFYDFQGDDDEEDWEDEDGEEVGSDEEAT
                     DASDRPQRPKKASVALAADGLSLVLPSGRTLGHRSLKVYYDQRYRPSDDTDVDQSALK
                     VALVRKKLADPSLALVPVAGGHGAFGRGQQLMKARNAGEAKWAKKQGRNFQDQSKREQ
                     FKTKVGYIHNSQKHFRDPLLQ"
     gene            171374..174145
                     /locus_tag="CNB00610"
                     /db_xref="GeneID:3255702"
     mRNA            join(171374..171488,171547..171973,172023..173862,
                     173922..174145)
                     /locus_tag="CNB00610"
                     /product="DEAD box RNA helicase, putative"
                     /transcript_id="XM_569071.2"
                     /db_xref="GeneID:3255702"
     CDS             join(171392..171488,171547..171973,172023..173862,
                     173922..173966)
                     /locus_tag="CNB00610"
                     /codon_start=1
                     /product="DEAD box RNA helicase, putative"
                     /protein_id="XP_569071.1"
                     /db_xref="GeneID:3255702"
                     /translation="MAAITPSWALETTADGEVKEKTSGPGGQWRALNVGPDLIRSLLI
                     RKFKTPTPIQRAAIPPALSTPPRDILGMARTGSGKTLAYLIPLLQRTGSTHHGQGPRA
                     LILCPSRELAVQIYTVGKDLARGMNKGKGKGKNKNEDEEDEEGKGKEGLRWALIIGGE
                     GMDAQFEKMSSNPDIVIATPGRFLHLIVEMHMDLRHLQTVIYDEADRLFEMGFDVQLQ
                     EILHRLPSTRQNLLFSATLPSSVAEFAKAGLVNPLLVRLDAEQKISPDLALKFFSVKP
                     GEKEASLLVLLREVIGKPNQPEPADPSSAPQAIVFVATKHHVDYVAELLRTTGYRTSL
                     IYSSLDQVARQQQLAGFRSHQSDVLVVTDVAARGLDIPIMDHVINYDFPAGPRIFVHR
                     VGRTARAGRKGTAYSLIVKEDFPYLCDLHTFLGTERMGEPADVLRSLPIEQLSENVEY
                     VFHNLDETAPHITALRNVMRKGQGMFERSRTKANPTSYRQAKSLASALSNNPPRIDDM
                     FEDAMEVEVNEEKARLLAKVAAFTPSETVFEVGKRESESAIIMKKRRKTVDERQKRVS
                     KAEAEKSTASGMEKAPVKELPAPQLPSKNFKDPSFYLDHTQRGAEAEKGYSLKSGVES
                     LSGAITDMTADEGTGPKAQKASQLSWDRKKHKFIKKNGSADGEKMIKSESGALLPASY
                     SSGKYQEWKSKRRHMPDGPVEALALGGGRRGRHGPPGQKRKAEDGDGGEDAGGKGRKD
                     QGKSKGTGKGKDDFKQKSPGKPGKKGIKQSSGLKSAMDIRKQREIAQKRKEKNARKPQ
                     KFRK"
     gene            complement(173998..177835)
                     /locus_tag="CNB00620"
                     /db_xref="GeneID:3255726"
     mRNA            complement(join(173998..174193,174243..174408,
                     174459..176525,176573..176669,176715..176813,
                     176860..177072,177126..177408,177459..177835))
                     /locus_tag="CNB00620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569072.2"
                     /db_xref="GeneID:3255726"
     CDS             complement(join(174178..174193,174243..174408,
                     174459..176525,176573..176669,176715..176813,
                     176860..177072,177126..177408,177459..177697))
                     /locus_tag="CNB00620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569072.1"
                     /db_xref="GeneID:3255726"
                     /translation="MAQSIEPLRSQSSTSLYKLYNGPNGGINSNQIAEEELQDPRLNY
                     CNAFWGPGDRGFDVIMARLRGAGRTVEELRAFWKERAAIEDEYAKKLNKLSRFSLGKD
                     EIGDLADSLQHLLSETAQQASYHSSLSNEIRQTVENPSAELGMRMSNLKKGLQAAVEK
                     AHKNKGLQEGHVQKARDRYEQDCLKLNSYTAQSSLTQGKELEKLHTKLDRVRQTIGSN
                     ENDFRQFVKVLEVTHQKWEQEWKNFCDHVQDLEEDRMAITKDLMWVYANAVSQVCVED
                     DSSCERIREKLEQFEPINDIVNFAKGWGTGDMIPDPPRFINYSAGESYPTQATFHVAQ
                     FMRISAKPPMPIASRESTREIQREQTPEPELEPQPTTEPQPEIAKEREQPSAKSGVNG
                     ISDGLIRTTLKDGPVSAPTALEPEAPKVPFGGVALPGMSATSPASQGDSSKYNPTPPP
                     PVPAILTMPEPRVPSRQGPPSPRKNINDEEDPMAKALADLRRDPPPPGSVRRNASHRR
                     AESAVSAAGSVRSSMYGHGIKSPVSPAPNRMSFQQNAPAQSRSPPIDSTLSPPPGGHT
                     AAALAKSMDEFRQQSSRGPESKRQSVNYSNFADDVVGSHPTSRPTTPSFHPASPRAPS
                     PAMMQAPKQPATHIADEVLSQYHQAFPGERETRSRSRAGSIMSNVSRNSYIEQQQHQQ
                     APPSPGVQPRRGFVGIGAGNAARSPSPQPPVFHSPDPSPVITSGTLGPQNLGISLDAK
                     GGVAQDTMAEQYRRQYQQQQAQAQAQQPAAQPTQVTAPQMGSYPGQRTSQYGVSASGS
                     SPTPAAAPAGYGPAYGQPSATNSSVMGPPAISGNRPVSGYGQQQQPPSQQAYASQAQS
                     QAPQAFNQTAQPAYNQYSSTTQHQPSPYLQQQNQAPQPNYSQRPPSVYGQSNAYGGRG
                     PSPQPQPPAMQPSQQSYQSGQPYGRSLSPSPAMGQGYGYQASPQQPQGYVQQHQQQRT
                     PSPQPNQPPPNMVPTGQWSTTGLPVMFYVKALYDYSAQTAAEFDFQAGDIIAVTSTPE
                     DGWWSGELLDEARRTPGRTDFPSNFVTLF"
     gene            complement(178687..181842)
                     /locus_tag="CNB00630"
                     /db_xref="GeneID:3255718"
     mRNA            complement(join(178687..178958,179010..179441,
                     179494..180034,180085..180388,180440..180585,
                     180635..181216,181262..181373,181431..181578,
                     181627..181709,181759..181842))
                     /locus_tag="CNB00630"
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     transaminase, putative"
                     /transcript_id="XM_024656435.1"
                     /db_xref="GeneID:3255718"
     CDS             complement(join(178726..178958,179010..179441,
                     179494..180034,180085..180388,180440..180585,
                     180635..181216,181262..181373,181431..181578,
                     181627..181672))
                     /locus_tag="CNB00630"
                     /codon_start=1
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     transaminase, putative"
                     /protein_id="XP_024512230.1"
                     /db_xref="GeneID:3255718"
                     /translation="MPLLFPNFRVHQVFGANTEVGKTLLTTALLRASASRYVSKSEEP
                     RKRVFYLKPVSTGPDSESDTGYVQRNTKPYSSYISTHNLYQYREPMSPHLAAQLAPDL
                     PFPKTNEELVRGIEAHANKCLQQLDGQDGCLFVETAGGVHSPALHPPHTQSTFLRSLR
                     LPSVLVASPHLGGISTTISAYESLLLRGYSLSAVLCLHDSYYRNHTFLEEYFRDRGIG
                     YWTIKPPPEKYGTVEEDGVRLEQWYKEVEKNFEGEQGGGVGDAARWLEEKHKRRIEEL
                     GGMPQRTLESIWWPFTQHQLIDKKEDVMVVDSAFGDNFDSYYAKPESAPSSKSESLLK
                     SYFDGSASWFTQSHGHANEHLTLAAASAAGRYGHVLFPSGTNAPALSLAEKLISTVGE
                     GWASRVFYSDNGSTAIEVALKMALRAAGRRYGWDGEMGGDVGVIGLRGSYHGDTIGSM
                     DATQASTYNKAVDWYKGRGHWFSPPMVQFVNGVPTVLTTGPDSWSPLPSSIASSSKST
                     PDGWALEFPSFKDVYDISSRSSSPLASYYRAHIRSTLERLVKEGKKFGALVMEPTCLG
                     AGGMVFVDPLFQSCMIEVVRASGDLFAGEKWDGGSFEQELEGLKRRSGAEWQGLPVLY
                     DEVFSGLHRFGYNSAATVLGHTPDISAYAKILTGGLLPLSTTLASPSIFSAFLSPDKV
                     DALLHGHSYTANPIGCAVALEAMKLTTNYEAKGGWQGEKNMWGVKKGVEGRWSFWKKE
                     FVEDISRAEGVKGAMAMGTVFAIELQDDENDYSSHAALDFLTALRQVVVTPSSSDAAA
                     EDIVPFSPFQIHSRPLGNVVYIITSLWTKPDVMRAMENVILNKLTKRTQ"
     gene            complement(182242..185252)
                     /locus_tag="CNB00640"
                     /db_xref="GeneID:3255732"
     mRNA            complement(join(182242..182562,182617..182909,
                     182973..183072,183123..183771,183818..184228,
                     184280..184626,184681..184770,184817..184862,
                     184916..185104,185173..185252))
                     /locus_tag="CNB00640"
                     /product="expressed protein"
                     /transcript_id="XM_024656436.1"
                     /db_xref="GeneID:3255732"
     CDS             complement(join(182507..182562,182617..182909,
                     182973..183072,183123..183771,183818..184228,
                     184280..184626,184681..184770,184817..184862,
                     184916..184945))
                     /locus_tag="CNB00640"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512231.1"
                     /db_xref="GeneID:3255732"
                     /translation="MDEETDLALLDQHLLKTNQLGQRMTNILGQLDNRLYRLDKAIVP
                     LGIQPLTRKDANIDALLSYLSGKPVASTPNSRPAANRQASTSSTTKGYSVEPASAIPP
                     HVTASTSSKPPSRSTTPTDDVVLLTRGPDIMALGEYFSALDGVIDDLERMYKGLMEGR
                     GGAREAGVKDLTQLVETGFRSMTQLFLKLSKDGMGRTFDVDTLLNNGPPTPPNLFPSL
                     NTLLPLTTKMTVYLNPANPTPKTLSIIQPIFEDAVSQFARLRGDWMCRSLNALAIKVE
                     EADEGGIWENQGGRGKVGNIMSIWEAIMHAAEGETMLAESLFPNHPPQTILTQTLASP
                     ITLANKALSPTLSTLKKYLSRHTFTALDLYASVSRLLPQWDHIMSSCLSRLGTPQSPA
                     TTELVTALDQSVNTLRSLSLRSFPEMLVDVRSATTEGPPTSVISDITYSTITYLESLM
                     EYEQVVEGLLGKSKSERSWLMGLNELPSNVRSADEEGGIVKFFVADVLGTLLNHLHAK
                     AKGMKRPIGQAFLLNNVSHIRNMLIIQSNSDITGPGAEAMLNKAVRDARTQFISEFQS
                     LTSLLTSAPHSHTQRFAVPQLPTSERHNLKESSIAFFERLGELEGVMARYPLNRQDPE
                     MRDSVGREVEGVVRKGYEAFAARCQSKGAEKYVRSSPDEVSRRVQSMFR"
     gene            185367..188660
                     /locus_tag="CNB00650"
                     /db_xref="GeneID:3255748"
     mRNA            join(185367..185455,185536..185651,185703..186068,
                     186119..186497,186554..186648,186702..186904,
                     186960..187087,187141..187553,187611..187909,
                     187965..188246,188306..188463,188519..188660)
                     /locus_tag="CNB00650"
                     /product="vacuole organization and biogenesis-related
                     protein, putative"
                     /transcript_id="XM_024656437.1"
                     /db_xref="GeneID:3255748"
     CDS             join(185427..185455,185536..185651,185703..186068,
                     186119..186497,186554..186648,186702..186904,
                     186960..187087,187141..187553,187611..187909,
                     187965..188246,188306..188463,188519..188594)
                     /locus_tag="CNB00650"
                     /codon_start=1
                     /product="vacuole organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_024512232.1"
                     /db_xref="GeneID:3255748"
                     /translation="MAAIPPPTATWDTIQDVFYRKDEIYSMGWKVSDLSDYIVTSARN
                     SGPIAMIRDERKIMLLGKHPPGKPKIYVYTSSGILLNTFTWDLTPPILLHFTSQNLIV
                     LSDEGLYRVYDLSNSGEYKQHTLGSDVAEMGLVDAQAWEDGMIVLTGELEYLQVSGWS
                     GGRVIRLSPSGLGELPMSWSLLSPDKSPTGHAQVLFSTSSTIITLDALERIDQRVSRG
                     PFSHIRVSPNGRFLALITVFGSLWVVSSDFSRNLSEVDIGELSDSAGLPEKVEWCGDN
                     AVVLGWGGKVVVVGPAGDSLKYYYSPSAHLIGELDGLRVISATSCDFIQKVPDSSLAV
                     FRPGSTHPASILYDALDNFERKSPKADESIRSIRPELADAVDTCIQAAGREIEVTWQR
                     KLLKAAQFGRAFMDLYNPSEFVEMAQTLKVLNAVRYFEVGIPITYDQYITSSPSYLIS
                     HLISRNLHLFALRISQHLSLRPDPVLKHWATAKITRSNKGVDPSDRGVADDEQVCEAI
                     VEKFEKEGERGVSYAEIAKKAWEAGRTRLATMLLDHEPQAAEQVPLLLQMKQDKIALT
                     KAIDSGDTDLVYQVLLHLRSTLTPGDFFHVLDDSISPNLKPAVNLLQVYARQADRQLL
                     RNFYYQDDRRTESACLEMEEAGQSQDVNDRIEHLKVAAKRFGESKERVFEAKMVEDAQ
                     RLLILQEAYERELAHKFKFTGLSVDEFIHKLLIEGFGKRAERVRADWKVPDRRWWWVK
                     LKALAEVKDWDGLEAFAKSKKSPIGYEPFVTHLLSLKPSQPKHAATFVSRCDAKSRAD
                     LYVRCGEWGKAAEVARERGDRAKLEQLRRMAPNGFAQRDVDEVIQRSGK"
     gene            complement(188593..196209)
                     /locus_tag="CNB00660"
                     /old_locus_tag="CNB00670"
                     /db_xref="GeneID:3255993"
     mRNA            complement(join(188593..188950,189008..189172,
                     189223..189674,189725..190003,190051..190640,
                     190687..190932,190987..191080,191137..191225,
                     191274..191401,191455..191612,191682..192173,
                     192236..192392,192441..192633,192682..192786,
                     192838..193331,193386..194152,194209..195519,
                     195561..196209))
                     /locus_tag="CNB00660"
                     /old_locus_tag="CNB00670"
                     /product="cysteine-type endopeptidase, putative"
                     /transcript_id="XM_024656438.1"
                     /db_xref="GeneID:3255993"
     CDS             complement(join(188698..188950,189008..189172,
                     189223..189674,189725..190003,190051..190640,
                     190687..190932,190987..191080,191137..191225,
                     191274..191401,191455..191612,191682..192173,
                     192236..192392,192441..192633,192682..192786,
                     192838..193331,193386..194152,194209..195519,
                     195561..196160))
                     /locus_tag="CNB00660"
                     /old_locus_tag="CNB00670"
                     /codon_start=1
                     /product="cysteine-type endopeptidase, putative"
                     /protein_id="XP_024512201.1"
                     /db_xref="GeneID:3255993"
                     /translation="MPPRVATTRASSAAPKAPTRATVRSRTQAPTTTTDELADGINKL
                     AISKPEPKVRVTRTQPSTSKAVPSKSAKPTIRRPATTTAEKGKEKATLEDSLPWACST
                     ASERLRPVERAMQAMQATNASIKALGESENSGYRYGSSKGSSGGNEWTDEKVVRLVDT
                     CLVAFRVLRELDGQDVIGDKGVEVERTCQGVVSKCLNMGMVHKAMEALVEARPGLLRL
                     YKGSKVEDPPATAAKLPTTSRATGPSRSTARAASKTTTTSSRSTPATSVAKSSKSSLK
                     SEQPTISVPSKWLELAWFPAPMEGTEMAEPVKNLLFMAMVSAWVGLITTSKGSEEVLV
                     MMPTSSASAKLNPLTIALTLPLTSITPLLYSLYRAIDILNLPPASSLNLRYRQIALYA
                     LSMTISSSPQSRNSPTRLWEATHRAISVYVHTQHSNENLSEVAEVISNLIDWVEKMVE
                     KRAENVKDWQSGKGWLELMEMWIALGRRLNDADIIDKALSLMTSSTSISTLPSAGLSS
                     GESVRSAIKGSPEVEVARIRGNLAKASVMFDKILSGQSPPTPNQQRIDALSLEDINVL
                     GQAVNRLPNDEESKVLIDRVVRAWERVRRGCVKIIDRYGIEESCKVLVGEVERWSRAA
                     LDFVETVADRIEINPSFADYLITGIIDTVCFLSQRYLSSSSILLSRGYDLYRRVKSST
                     KIVDQIDWLRALSIAASNVGGRMFSQARMEEAVHLANLSCEWAVEVVKLGKAGDLDEE
                     GDKKLQQFSEGLAKRWEFLASCYQRHGQKEQVFVAYIQCLAYQPPSLLSNLALAASQS
                     ISKIFEPFADFKNSLLRLSAFILYDPMLCIDFGLSLMKEMTTNSYKPHEVGAIGEKIM
                     DTLEDGAWKEEVARIVLDLGEGLLDVYGAAYPIRRLRVVARMMRIIVSSGQRMSRFDY
                     LIQDADHLFAETNLGHDTSLGMYKKEHYAYTLILRALKAYHFEGDPTPAVLDNHKRSM
                     EALREVLIPSSTSQEIKDEARKRQPLGRTTTTRAVTTGDAPARPIRGTKRTVSEPQKK
                     AAGKATAGVTAAPGLVFDDLKKLTGLLGALASLLALLGQTLAQIETLRLIRAFQRGRD
                     ELIDDYVRRSSQLATEYFKLGKVSRAGNIFSQTYKTVSESKVLVDSGVKVELLLRWSC
                     YLAGTGNIVNAREAYAEAQELNSDLESTKSKSHLLHVQVMNRCDTLERAAWSRTAFGA
                     INAAQDNATGAIIHLSAAFRLWTRASDAICRIAEKQSSPNASILDAEDPFLVVPNPKR
                     PKDADEPAKDESGPTPPQAAHFSGKHLHNLQWHVAHGLLDVTFELASAYAARGSVRDA
                     EYFLKVAGLVSETIKSGGMGARVGAREAELLFRLRKLEAVGTKLESAAGLLCAEEGPE
                     IVDLMRIQGDLYTGQGMIEEAGQMFQSTSSEIAGLDSVFAAAEALLPTPKKSSGLISS
                     NISGRSAKTLSKSTGGKEPLLPATLAHVMRQHAWLLREAGSKEECMQLLAKVKNLPST
                     TQIKAEEFLLQGRIALHEAIQQFKTDLFMSSLTESAVTMPMGIPEKKIKDRQSARLSI
                     QAFLTRAEDAFLSALDLVAAGGKVEGIRQACLALALLKAFQTSLGQGSESVTSAAAST
                     LASSSSITLHRELLHAIETKFIDIDHGDIDWPSFDPPVTGKPNGDDVDLSDDLDDHDG
                     KLRSYWQMIKSKYESKHILAADAISLEDVPANWAVITINVSDDRNTMFISRHQNGYEP
                     IVFCLPVDRQGRREGDDDIWTFDAAVEELETIVKASNEGARRAKHITTSEGKAEWWAE
                     RRALDKRMEELCVNLEFVWLGAFKTILSPRNRFSKADLSDFSDSLDKIFGAALSGGRN
                     SKAKKCATKPHLDDALLESFASLSSKCKEEEVEDLVYFILDVYQFHGVPVALSELDID
                     QIALDVKGALEKVETKQNNTSNALGEEHIFLALDKNVQSFPWESIPILRGRPTSRIPS
                     LSFLLDQVAMGNHLRPSLTQSVVATDNHLDIKRTVNSRRTFYILNPSGDLARTETHFK
                     PWIDEMVEKAGWKGIVGRPPTEMEMRAALRDYDLVLYFGHGGAEQYISSQKIRSLPQC
                     ATTMLWGCSSGHLKDQGDFDRTGTAWHYMVAGCPSLVGNLWDVTDRDIDRISEHVLKH
                     GLHLDAAHQPQSRSRTNTLLPLSELSTVQAVNKARNECKLKYLNGAAPVVYGLPVYLH
                     "
     gene            196368..196970
                     /locus_tag="CNB00680"
                     /db_xref="GeneID:3255974"
     mRNA            join(196368..196412,196469..196560,196616..196639,
                     196711..196748,196801..196833,196893..196970)
                     /locus_tag="CNB00680"
                     /product="DNA-directed RNA polymerases i, ii, and iii 8.3
                     kda polypeptide, putative"
                     /transcript_id="XM_569077.2"
                     /db_xref="GeneID:3255974"
     CDS             join(196410..196412,196469..196560,196616..196639,
                     196711..196748,196801..196833,196893..196912)
                     /locus_tag="CNB00680"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases i, ii, and iii 8.3
                     kda polypeptide, putative"
                     /protein_id="XP_569077.1"
                     /db_xref="GeneID:3255974"
                     /translation="MIIPVRCFSCGKVIGNLWDSYLELLAAGVDEGEAMDKLQLKRYC
                     CRRMVLTHVDLIEKLLMYNPLARDR"
     gene            complement(196998..198624)
                     /locus_tag="CNB00690"
                     /db_xref="GeneID:3255934"
     mRNA            complement(join(196998..197772,197826..198008,
                     198059..198163,198236..198346,198394..198465,
                     198534..198624))
                     /locus_tag="CNB00690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569078.2"
                     /db_xref="GeneID:3255934"
     CDS             complement(join(197017..197772,197826..198008,
                     198059..198163,198236..198346,198394..198465,
                     198534..198581))
                     /locus_tag="CNB00690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569078.1"
                     /db_xref="GeneID:3255934"
                     /translation="MSGSKQVENISYVDIQHDAIDVFDDVEQAVIMKEDIWISGYHHG
                     ETSVHGKAMVEFEDGGSINITARDGVKVERVTKTDFVVDIPALGISKRPVHFPKHVLH
                     PPYEKASDVDPPLQINALSVNPKTPHIIVGGPDGYCMILPTGVMASPKKDGVKLKGHV
                     GDIRAVRWFPSGEVVLTASADLTIRVFGMNGVNPRTFKGHSRAITSLAILGVGKTVLS
                     AAKDGTIRLWDVGSGQQVKQWTTGGEKGTLVIEDFILVEESTAIEALGLQGQERVMLV
                     QDQLAVWVQPWDGEGWLVETDKQIASLAYERETGTIAIGYSSGVVEIRDLASLIPGTT
                     GKRKKIRRNESPIYSLAFGLDVEDGKIDLYLGTAAGLPCRLGVKCVADGYQVVVKDEL
                     AGWDAVSIECMEAVRDGMWCGGGEGGLRKYTV"
     gene            198870..205589
                     /locus_tag="CNB00700"
                     /db_xref="GeneID:3256109"
     mRNA            join(198870..199149,199198..201076,201126..202627,
                     202690..202773,202827..202930,203026..203075,
                     203141..203456,203512..204220,204273..205136,
                     205195..205455,205512..205589)
                     /locus_tag="CNB00700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656439.1"
                     /db_xref="GeneID:3256109"
     CDS             join(198931..199149,199198..201076,201126..202627,
                     202690..202773,202827..202930,203026..203075,
                     203141..203456,203512..204220,204273..205136,
                     205195..205344)
                     /locus_tag="CNB00700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512233.1"
                     /db_xref="GeneID:3256109"
                     /translation="MFSLPSFLTTFSFTLPSLPSISLPANIQRRFLSYVLKRTLGRFV
                     SHQALDAERIQAQVSEGWVEIENLEIECSEINNYIPPPLPLSLTSGTINKLTAKLPFP
                     NLWSDPLQVSLDTLTLDFTLSSPSPLSRGRAATRPEHHDLAESVTSAADDFLHHELDA
                     YEEKELEGSIRQSLILSQTDPFISDVPGGFPLGSPGEISPGRPLPANMESTTVLAGMV
                     ERILARLEFRVEKIKIRLVIEDEEDVVELTVGRIRYADESEAQTNDDGKSTTRAIRIS
                     NISLDIVPSQRKPPSLVIPQRQSLEPSVSSSTSTASTSSGNDYSDMFMSQAVVDLRQS
                     LLTPEQISEPANEQTVHESNMFYSALSQPNESEPGASTGIKRSGISQNPKLADEIEEE
                     RSRSETPTPETKPQPSGIPVLSFGQEDVVLHMRTTRPLISAGHQTSFNDNKPTVEMNI
                     TIGTITTVLLPSHLKLFISALQTLQALCQKDDVPAAKDKPAQSTSPQTRLTATTKLKA
                     FYVSLVYDLSAETSLNLHSTMASHLTRPTNPIPYPHLRFRLDTLVASYQSPGHSNPSR
                     PAFTRPTPNMSTANLRRKSSGHARFGSLPSNLTVNVGDISLFEWMGEGMIAPVILFDP
                     GLKHQYDLPSAPPHKGQAGFPECECRDWREEKKTGSEKAWRVRPRGRGILKGGARATT
                     EDEGPVVHVRQDLGSDSAAVINLQSLHVFVDLSLIERLLPLLRSVTPLIHPPEPTPAW
                     LQSVPSQSISEEITPESIISSLSAPPPTARGKKMKADIRCDLVRLSVRCPAPPPEPAE
                     RQIGDGRQLRSGIVFVDVHGLKSRFMDTSRTGTRPASSEVANVEFEQTLIFFASVSQH
                     YAYPFLIFAPLSPEPGEEDIPLLPSISLSSFPQASSLPASSIAKTTLVTCKMPAIRAS
                     VHHPTVTGLQYFADDVTRWLDVAFADGSAKPRDELKMIGSRFFGGSKGSEASSEIDEP
                     YDVEEVAAGMKVEIEISEIDMGLYVPRLDASGERVFSFKANDLGVRMETHPEENETAL
                     ELSIMDLDFSDVSSTPLRILGRTTPFTLTSHQAPVVYLRFVSSTDLRTTLKESNISVA
                     LSHFTFAVHKEIAWLHEIAQFAKPPKGVFENLSPTDLTRLSINLSSASFLLVPPNLPG
                     SIVILVREVEGKTEIPKGATDSVLEVGMSGLGALAVEGESGPLEVSSDLADVWKKAGY
                     AQLAEVMVLELRLMRELVAAGEVSLDITQAQFKVTACADSLATFAEIATDFGRLFPNK
                     KEEHVKLPSMGQSINVFDSLDENAFNLLPEIVSHSDTDMIEDDLPHNLDYLDHATRIS
                     KHYPSMDRTTGENLRAWHTPEEGLEEGEWENGESGETIRAFGGEIEEEEGYWEGLPIL
                     NDVYSADQKPGKIHIRVLDASLKIFLHDGYDWPRTRKAIEDEVRAVRRRLERIRQLLA
                     SGQKADESIENATSSVLFNSIYIGLEQKGEMGLSTMGMGKMDEKALMAAIDEELDGME
                     TESGSSWQTLPAGVGAGPSAVHQAHKKTRLKGKRLVRSKKAQIEITLSGIKTDVDLYP
                     TEESTSSRVHFTAKEMEILDHIKTSTWKKFLTEMKADNRGNIRETDADMLRIELVGVR
                     LKEDEEELRLRAKILPLRLHVDQDALDFLKRFFSFKAPPMTSARPLAQHTTSSTPDLY
                     FQHVEIFPIQLKLDYKPKRVDFRALREGKTIELMNFFHFEGAEMTLRHITLSGITGLE
                     RLGTTLQDLWTPDVKANQLADVISGVSPIRSMVNVGSGVADLILLPIEQYRKDGRIAK
                     GVQRGTNSFVKSTALEVMKLGARLATGTQVILERAEGVLGGKSGEDVVGQVQGLSTNA
                     FGVDSGMLEGGSSSEDEQEAISRYADQPESMKEGVQAAYKSLSKNVNAAAQTILAVPM
                     EVYERSGDDGPLKAVIRAVPIAVLKPMIGTTEAVSKTLLGMRNSLDPSARRELDDKYK
                     "
     gene            205595..208444
                     /locus_tag="CNB00710"
                     /db_xref="GeneID:3255904"
     mRNA            join(205595..205682,205738..208444)
                     /locus_tag="CNB00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656440.1"
                     /db_xref="GeneID:3255904"
     CDS             205744..208413
                     /locus_tag="CNB00710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512234.1"
                     /db_xref="GeneID:3255904"
                     /translation="MASVYEARQARPEAIFVVLFLIVALYILVGGSRRSSGKGNDGNG
                     GHGAESGNRRSRNSEGEDLERAGKGMKHPSSKREGSGIETSSASDSNTSSTDMEERST
                     KDKKEEKQKKRDGKEVKKNEPEAPIFAPSTSPTPDLPKEESPSLPNLPVKASPPIPGT
                     RWQRDPNQRPDRTRRDSTSSVLLERNDDGTWKRPPLIKEGVKFDDGGKEGKEANRFAM
                     FNLHDTPVTLYDQTGLEGWSNHASRKKQPDDAALYGKLDGSESPLISLKQGGKLSQKL
                     IKFMERAEYLASLDLLDPRLRKDVVATALKDRWLDGAGTIPEVISDTLRQFVVEKQID
                     IVKIVEEYSAPSANDLKLSVPGKANARLDQIAKLLMDCGFDLDTLREDLKFYDWKRMP
                     AAEIRSMIRKWTERQLQKGKAVSFIAGFFIPYYRATTSYKAKHLPKMFPPNWRVVIGA
                     HQDDLIGWLRYIGQAFIISRMFSPTGADISEEYVRVGVSRRKTVVGFVMDFTIFTPEP
                     DEKELRTQSELTSIFQRAEAPICRAKYLGLRWAEHLNKVVYPQPDGRMLLVENNPFHI
                     TRLTFRPGLKKSTVNAAALRLATSEVSTPRLPPDVPIKRDRKIMNVSQDVIREKYEAN
                     KGSNELNDAFARSFRAADALTVRFVNKHQYHWYQSTGPVNDSFDETTFNILLMLCSIA
                     LSKYHLHQKFKVKGETDYRTDEESAMDFQYDAGYGIVQSMDFGGMMPLEGASTVKPRF
                     LQLDTFVGLRNIMLPVMFHVQNRSTSFPASSSLLLRDEWGMSKFLYGPKAINVTFHGQ
                     TSSEKEHLMREILEDLSEQADRWISEELGQPDNALKRIVLQKVDAAVGMIKTRVRFVA
                     LGEQQPSAGEMDSKIEELRDFELPIEYLPALLR"
     gene            208693..211851
                     /locus_tag="CNB00720"
                     /db_xref="GeneID:3255903"
     mRNA            join(208693..208853,208909..209160,209965..210003,
                     210051..210265,210328..211141,211194..211324,
                     211380..211515,211576..211851)
                     /locus_tag="CNB00720"
                     /product="glycogen synthase kinase 3, putative"
                     /transcript_id="XM_024656441.1"
                     /db_xref="GeneID:3255903"
     CDS             join(209970..210003,210051..210265,210328..211141,
                     211194..211324,211380..211382)
                     /locus_tag="CNB00720"
                     /codon_start=1
                     /product="glycogen synthase kinase 3, putative"
                     /protein_id="XP_024512235.1"
                     /db_xref="GeneID:3255903"
                     /translation="MSGVVNGVRVATDDPNRVITVSAQWGKTGADTTISYTNCKAVGN
                     GSFGVVFAAKMSPVKHEDGSEEPESDIAIKKVLQDKRFKNRELQIMRLVHHPNIVDLR
                     AFFYSNGDKKDEVYLNLVLELVPETVYRASRHYAKLKQAMPMLQVKLYMYQLFRSLAY
                     IHSIGICHRDIKPQNLLLNPATGVLKLCDFGSAKILVAGEPNVSYICSRYYRAPELIF
                     GATNYTTNIDIWSTGCVMAELMLGQPLFPGESGIDQLVEIIKVLGTPTREQIKTMNPN
                     YMEHKFPQIKPHPFTKVFRPRTPADAISLISTLLEYTPSARYTAPEALVHPFFDELRV
                     EGARLPNGKDMPELFNFTHEELSSRPDLIRQLVPTHAEEELRSRGIDVNDFKPIPPEQ
                     LRVTLD"
     gene            complement(211865..212525)
                     /locus_tag="CNB00730"
                     /db_xref="GeneID:3256016"
     mRNA            complement(join(211865..212271,212351..212525))
                     /locus_tag="CNB00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_569082.2"
                     /db_xref="GeneID:3256016"
     CDS             complement(join(211975..212271,212351..212446))
                     /locus_tag="CNB00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569082.1"
                     /db_xref="GeneID:3256016"
                     /translation="MSVTAKAFFVSAVALSATTVWGVHYLQKWEYDNMYQGILKDDAR
                     LAAKAAAAAAAAATQSQPQPVIQPAPTVDPDCTTCVISPPPQLLEAQSAEQRAREREG
                     RKREYEEQKQLAGRLATEQGVREEARRV"
     gene            212696..216686
                     /locus_tag="CNB00740"
                     /db_xref="GeneID:3256017"
     mRNA            join(212696..212849,212907..212917,212987..213090,
                     213138..213236,213285..213350,213399..213406,
                     213460..213760,213814..214043,214090..214668,
                     214725..215328,215377..215729,215781..216102,
                     216159..216305,216365..216686)
                     /locus_tag="CNB00740"
                     /product="kinesin, putative"
                     /transcript_id="XM_569083.2"
                     /db_xref="GeneID:3256017"
     CDS             join(212829..212849,212907..212917,212987..213090,
                     213138..213236,213285..213350,213399..213406,
                     213460..213760,213814..214043,214090..214668,
                     214725..215328,215377..215729,215781..216102,
                     216159..216305,216365..216393)
                     /locus_tag="CNB00740"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_569083.1"
                     /db_xref="GeneID:3256017"
                     /translation="MSGNNIKVVCRFRPMNRMEIESRSEQCVEISEDYTAVQLKNKAS
                     LAGPEKDGFTFDRVFDTTTKQDEIFDWGVKGIVEDVMTGFNGTLFCYGQTGSGKTFTM
                     MGADIENPSLRGIIPRIVEQIFASILSADSSIEYTVKVSYMEIYMERIKDLLAPQNDN
                     LSIHEDKQRGVYVKNLTDVYVGSEEDVYRVMKAGGASRAVSSTNMNAESSRSHSIFVI
                     AIHQRNTETGSQKSGNLYLVDLAGSEKVGKTGATGQTLEEAKKINKSLSTLGMVINSL
                     TDGKSQHVPYRDSKLTRILQESLGGNSRTTLIINCSPASFNEAETLSTLRFGMRAKSI
                     KNKARVNVEMSPAELKALLKKTQAELVGVREWATKLEEEARIWRGGGKVDQANWAPGL
                     DQALAGGSTAASAAKRAVASPALPTPSSSSASRATTPGGTLSAVDGSRPDTPSTFSLS
                     LDKDEREEFLKRENELSDQLAEKESALAAQEKLLADLREEIAYFKDQESAISQENKTL
                     SSELNELRISSARLESEAKDATITLDSYKEKIAELQKDIEDQKAEIENLKHAQTREKE
                     EEKEKRKQEMLNEMMSKIDLGGTLDSSSEKLRTVLREFEETSDAERKDKLTSQTRELI
                     RMSLAESQDAMRGLQERLRLACEEQDMQVKRRSELEKMLEKRDAAFEELLDKTASDQG
                     LSLAEIKSSLETKYSSREELLRSEISTLSDHVESRTEDVRRLQSTVESYKLSNEELNR
                     ALTAATNGTDGETFASSAKELERARKAHEIQYAEFEMVKKSLMKDLQNRCEKVVELEM
                     QLDEVREQYKIIARSANSRAQQRKLEFLEHNLEQLSAVQKQLVEQNTSFKKEVAESQR
                     KLMSRNDRIQNLEAALSNADQRLAQKNQKYEQQIQLFREKLAEAQAKQNATYAHGRIA
                     KPLRGGGGAQTGVVGGIQGIMGGGKQEESPSGKRQSWFFPQQR"
     gene            complement(217296..221813)
                     /locus_tag="CNB00750"
                     /db_xref="GeneID:3255890"
     mRNA            complement(join(217296..217624,217696..217797,
                     217850..218098,218168..218287,218343..220008,
                     220057..220154,220212..220484,220548..220888,
                     220938..221095,221149..221813))
                     /locus_tag="CNB00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656442.1"
                     /db_xref="GeneID:3255890"
     CDS             complement(join(217360..217624,217696..217797,
                     217850..218098,218168..218287,218343..220008,
                     220057..220154,220212..220484,220548..220597))
                     /locus_tag="CNB00750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512236.1"
                     /db_xref="GeneID:3255890"
                     /translation="MSNSQIIKTSERQTRINWSKDPQLTVKLLKLISHNPAWKKACFG
                     NRDAGMTHIWTVYRDVALQFFAGSEWMKGAISKGLVVQDDQGRFIATNKWTSQTNNPV
                     QTRITSLKNSFRENEFETKHRIRRSWKEWDDILENDRRHRLKAKFPYYFLLLELMVPP
                     PSEDEVDELEDDDDYSIIPPLKIKEEVQEEINELEDDGCPMSGEKFKAKKPDLSTVNG
                     DRYTRYEEKEEAIENCTNLSQDTELTGTEDVDEMTHEENQLESDRRKEQIDEGIDELK
                     DDDVEFHSETAEKKTDPAIRTTSPETAEVPSHNLSPQSSLSSSCPLPVLSSENSVSVL
                     DSSLIATSPPTDIQTCTFQSISSASSSSAAKQTNIIHASPSAPLLSSSVSNATSSTPK
                     WPLFRLKRVDSWTPPKRPLASSHSTTVAKKTKLDQSIEGLNSGRDLVGIPSEPLSDAS
                     SSVEIARVQPEVVNPSSDALSTLQNNIPAHSQSSLQPHTKTVIDIPPKNGFPSPAAGC
                     STWHFVRFTRHVTPSVPIDLVSSNQDLKQATEVKTHSDTSSCLVSPSSTEERSAQQAR
                     DKSKGKEHINVRERKKPRNFPQQQLRPIPSVPKSKDPFHLNWDPKEHGILRREGHYKD
                     LDFLLREKSQNNIRAIIKSSAADYFHAQPEYVYEECSNGWKALRCRSHRQRYRIRCRV
                     ELLSYYLKENDQIHYYSKNTKLNVMEGYFMYITYRFKDDPILARLAKTAAYAGAKVYM
                     CRTPYDHEKLYAEYASKNKHLPVQKIEVIGLVDEKQPYLPQPVRGTERWNILQFGLAL
                     LGAIEQHFGLFKDTADICIRHPSRCGEKMAVFIDRDTVSTSIFNQLQRIFCSESIARM
                     DSLQELQQCDGPYNEFFFITNDARAFNGIGVPGLVSRQVKVKRPIQFVEIYRIYRNRE
                     RSRQEAAKRDGGWRAHHELRGDRQIE"
     gene            222130..222967
                     /locus_tag="CNB00755"
                     /db_xref="GeneID:36392724"
     mRNA            join(222130..222477,222527..222602,222657..222762,
                     222832..222967)
                     /locus_tag="CNB00755"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658910.1"
                     /db_xref="GeneID:36392724"
     CDS             join(222416..222477,222527..222602,222657..222762,
                     222832..222935)
                     /locus_tag="CNB00755"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514201.1"
                     /db_xref="GeneID:36392724"
                     /translation="MFSLLSIMWDQPILIDVPLFNQVVEFQASGKLQKVAQSIIARRL
                     LERIIPPLVEHMVDPGSEPFPAEFDIYHSLDHILFRFTIVRRCSTSLSSDHACEKQIW
                     ADRLLVEAVACKE"
     gene            223057..226038
                     /locus_tag="CNB00770"
                     /db_xref="GeneID:3256020"
     mRNA            join(223057..223639,223692..224435,224491..225023,
                     225078..225132,225182..226038)
                     /locus_tag="CNB00770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656443.1"
                     /db_xref="GeneID:3256020"
     CDS             join(223211..223639,223692..224435,224491..225023,
                     225078..225132,225182..225928)
                     /locus_tag="CNB00770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512237.1"
                     /db_xref="GeneID:3256020"
                     /translation="MSKIQPSYNAPQYPSSAPLPPPRPNSTVYPSTYDYRATPIPPPR
                     PSTAYIARYASEVSHGQPSSSSWSHPQQFPTMSETPQIPLMSDSGQFATPQSTLLPHS
                     SQAAGRPGASSYSRQNDYRSSNYSTGIPASLQGEHIVSGSVVPSTTFIPEPTSSMPPP
                     TSSFDPRPFATIEAQPTTSNNFSNSEAGGFAPAPPRSSSLNQPYLGQAQTPTLPAPRL
                     TTPTNPIKLHPCPTAESLTYASAKLDSWTDAHQITWAQDVVRLVERYWQQTSNADHFE
                     QPPSPPSDSQHLSITLQRLLDTAAPIVIAISDSDIKEHASLALYLKGKLLSSGASPAL
                     LPKDKRQSFKDFEGAARKGEKRAWYRLGKDYEAVNDLDRAGDCYDRGAKAGDCESAFR
                     MGMAHLLGQLNFLPDPATGLYFLHQSSDTASIDFPQASYVYGMLLAGDITLQTNLPPS
                     LIIPPTSPPTDALLAQQNLACESIARAAYLNYPAAQFKLGQMYEHADLGCVYDPIASV
                     AWYTFASQNGEMEADMALSKWFLCGAEGHFPKNESSAKTYAEKAARKGHPNGCFALGY
                     YNEIGVGTDVDLEQARKWYEKAAKAGNAEASTRLAALSLPVPTAISMNEHQSRLNDTL
                     VRKHTTAKLRSDRNKSSRPVRQQIYESQHPPPLPSYGQTNSLLEFGQVSQIQMPMALP
                     KSPPPISHTPSPVSSLTVPPMNYSSHQPQPSYALQDPPINPSRPPMHEHQYSSHSTST
                     TSTGGGRQSSSTPRPISVVDHRRMSTVSSSVNDFPVLSASSSTSISIPSSGPTSTISG
                     GISGTMEKKRKKKKGPQTFAEMGFVSKPVEEDGCVIM"
     gene            complement(226011..228174)
                     /locus_tag="CNB00780"
                     /db_xref="GeneID:3256021"
     mRNA            complement(join(226011..226422,226491..226720,
                     226784..227025,227078..227167,227215..227357,
                     227406..227721,227770..227891,227940..228174))
                     /locus_tag="CNB00780"
                     /product="DNA polymerase Delta, small subunit, putative"
                     /transcript_id="XM_569086.2"
                     /db_xref="GeneID:3256021"
     CDS             complement(join(226244..226422,226491..226720,
                     226784..227025,227078..227167,227215..227357,
                     227406..227721,227770..227891,227940..228150))
                     /locus_tag="CNB00780"
                     /codon_start=1
                     /product="DNA polymerase Delta, small subunit, putative"
                     /protein_id="XP_569086.1"
                     /db_xref="GeneID:3256021"
                     /translation="MATVLPEPEGIPCIRPAASYDPLTELSKPFTIDPASRSYKHQYA
                     NIYFVRLVEQRPAVEKKATEKWKDVKGNPPLLPRILNLTRSQLCYIVGTVYMEMPLKP
                     NILEDMARDHWLAAPIPRTKFFSAQDSIHLEDESGRVRLIGDAIQRERDREGGGLVTG
                     VIMAALGMETPSGDFEVIDICFAGMPDKLVLNPAPSSAKRKGKEKVENDEDIDMQEDA
                     KIELPENAKTWIAMVSGLSIGTQEASTDLKAEMLVEWLMGEIGGHSDQLGGGRIARLI
                     IAGNSLTLPVKGEDDKKIKRFNSTSKPLFPNHPTKTLATLFADLLSSSLPIHLIPGPS
                     DPAGATLPQQPLPKILFGGKAKTEGLECETNPTWMEVGGRSFLTTGGQAIDDIFKYVP
                     GNSRLGMTQRTLEWRHMAPTAPDTLWIYPFPDTDPFIMNYRPDVYIVGNQPEFETTII
                     GDEDAPTRLVLLPSFAKTGVIAFVCLETLECRTLEFEAPMWVGETMAGEAEGVDNEEM
                     ES"
     gene            228343..230858
                     /locus_tag="CNB00790"
                     /db_xref="GeneID:3256026"
     mRNA            join(228343..228855,228910..228929,228974..229047,
                     229097..229237,229284..229406,229456..229817,
                     229876..230233,230290..230540,230600..230858)
                     /locus_tag="CNB00790"
                     /product="DNA strand annealing, putative"
                     /transcript_id="XM_569087.2"
                     /db_xref="GeneID:3256026"
     CDS             join(228527..228855,228910..228929,228974..229047,
                     229097..229237,229284..229406,229456..229817,
                     229876..230233,230290..230540,230600..230726)
                     /locus_tag="CNB00790"
                     /codon_start=1
                     /product="DNA strand annealing, putative"
                     /protein_id="XP_569087.1"
                     /db_xref="GeneID:3256026"
                     /translation="MSVSTKLLENYLEHQQTNPGLERSFSAPALSNRLTRPIQKPTLQ
                     NRSLKMDPNDSSYMGRQNFPVSTPIQGFASQWSEERVHQIQARLARKLGPEYITQRPG
                     PGGTSKLCYIEGWKVVELANDVFGFNGWSTTVVSLTTDFLDVNKDGRVSVNCTAIIRV
                     TLLDGTFHEDVGCGQGDNMKGRGAALDKAQKEAITDGTKRALRSFGNMLGNCLYDKDY
                     TKEVVKMRVPPVRFNRDALERRPEFLPAGVPAMPPAGPSHVSPIPSHLNNAPRPQAPA
                     PVQNNMLPPPNIPPQPPAAPATPLKSVNEMHDDDVTIALDENFDPEFADFYGSDSIFA
                     ELDDQSIQAGPNLSNSNNTDPETPKPVPVPEQPAYQNRQRPDLTKAASDNQITTPKPA
                     NHQFNPAFKPTINPQGTNHHTEANNGLPKPGHSNTPPVLGNQNNQTGGPSSSAGSTTG
                     SKPVLPKSRPLGGFAFPGKQTPKQSRANAIASAFKQAGRTPQSPRIPSGGVDFVAKRA
                     TTKLMVEGARLGLEENCDIDPVADGFQGFSSARGLKRLSEEQRRSMSPTKEASNPGLA
                     SSETRTALGELPVEDESSWSSKRPRTSK"
     gene            complement(230862..232067)
                     /locus_tag="CNB00800"
                     /db_xref="GeneID:3256029"
     mRNA            complement(join(230862..231232,231297..231445,
                     231705..231797,231951..232067))
                     /locus_tag="CNB00800"
                     /product="mitochondrial inner membrane protein, putative"
                     /transcript_id="XM_569088.2"
                     /db_xref="GeneID:3256029"
     CDS             complement(join(231008..231232,231297..231445,
                     231705..231797,231951..232029))
                     /locus_tag="CNB00800"
                     /codon_start=1
                     /product="mitochondrial inner membrane protein, putative"
                     /protein_id="XP_569088.1"
                     /db_xref="GeneID:3256029"
                     /translation="MSFIRPSATPAFRAVGLGLGRRCLHNSRPLALGASQVKRDALVA
                     SNETGGFKYIPGGPILPGTVNDATTFPTPNKSHGSYHWAFERLLSASLIPITVGAAVS
                     SGSAYPIMDGILAISLIVHTHIGFDACVVDYVHPRKFPVLGPITKWILRAATGLSVWG
                     VYEFNTNDIGLTELVKRAWTA"
     gene            232855..234711
                     /locus_tag="CNB00810"
                     /db_xref="GeneID:3256032"
     mRNA            join(232855..233091,233144..234711)
                     /locus_tag="CNB00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656444.1"
                     /db_xref="GeneID:3256032"
     CDS             join(232951..233091,233144..234541)
                     /locus_tag="CNB00810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512238.1"
                     /db_xref="GeneID:3256032"
                     /translation="MMSEHYSSTAPHRLDTLPDDVLGAIFKKLTIQDLLKCRRAGKLL
                     QSRVDSLGIPLYLITHRQYHQTLSPPPSQWPPFLLAKHNHRINRSLESHTWHALQMGR
                     TWPQSVIPTIYVDEDRGRVVVGAGGEVIVHSLYAPRGYYGEPRYGSKVVGPGRGFVLR
                     TPGSGSTSDVVSIVDLHDGQGSLAIAKFDGQIERVILPDCGPSIPKSTARYPHESTRS
                     TRLRKVTGSEKGEMMMTTSWDGVVSLLQTRSPWIEPATMSLEGKVAWSSLLTTSHPTI
                     SPTAMLGTKTAISVHSILPSGISSTPSRLLQGPEHPQTSSPYDLRLPSPSSSHHPSLL
                     LSAWYDSHLRIHDLRSPSLSPILTFQDPFTWADGSAFYSTCFTGEHYIAGGGARHGTV
                     AFFDIRNSKTGWSCFSPGGKGSPVYSLQGEGGRVWGVTERRAFVLAFDGSGDEPGGLV
                     AHEARAMALRDRDRGRHAPSGWRGRGGKWAWTVKYDTDEGNRAVGYEHTERDIRLFDS
                     LIAA"
     gene            complement(234559..237581)
                     /locus_tag="CNB00820"
                     /db_xref="GeneID:3255888"
     mRNA            complement(join(234559..234801,234855..234959,
                     235009..236831,236905..237089,237141..237146,
                     237233..237243,237325..237581))
                     /locus_tag="CNB00820"
                     /product="transcription factor, putative"
                     /transcript_id="XM_569090.2"
                     /db_xref="GeneID:3255888"
     CDS             complement(join(234724..234801,234855..234959,
                     235009..236831,236905..237089,237141..237146,
                     237233..237243,237325..237381))
                     /locus_tag="CNB00820"
                     /codon_start=1
                     /product="transcription factor, putative"
                     /protein_id="XP_569090.1"
                     /db_xref="GeneID:3255888"
                     /translation="MGKKVIASGGDNGPNTIYKATYSGVPVYEMVCRDVAVMRRRSDA
                     YLNATQILKVAGFDKPQRTRVLEREVQKGEHEKVQGGYGKYQGTWIPIERGLALAKQY
                     GVEDILRPIIDYVPTSVSPPPAPKHSVAPPSKARRDKEKETGRTKATPSRTGPTSAAA
                     LQAQAQLNRAKMHDSTPDADASFRSFEERVSLTPEDDSSSDTPSPVASVMTDQDMEVD
                     KMGMHMSMPNVTLSQNMEELGAGSRKRSAAMMMEDEDQFGQLRSIRGNSAVHTPHGTP
                     RHLGIGMPPEPIGPEQYTDIILNYFVSETSQIPSILVSPPHDFDPNAPIDDDGHTALH
                     WACAMGRVRVVKLLLTAGASIFAGNNAEQTPLMRSVMFSNNYDMRKFPELYELLHRST
                     LNIDKQNRTVFHHIANLALTKGKTHAAKYYMETILARLADYPQELADVINFQDEEGET
                     ALTIAARARSRRLVKALLDHGANPKIKNRDSRSAEDYILEDERFRSSPVPAPNGGIGK
                     ASTSAAAEKPLFAPQLYFSEAARLCGGQALTDITSHMQSLARSFDAELQGKERDILQA
                     KALLTNIHTEVTENGRSITAITNQAAPLEEKRRELEALQASLKTRVKDALKKGYIGWL
                     EGELVREQRWENGELEGNEEEKAAVQALRDVPTGGQEVVQAEEEKLRWEIEEKRKRRA
                     MFVEKFVRAQTEAGTSEQIAKYRKLVSAGLGGVSTNEVDELMNQLLEGLEEENDNQVY
                     NTTAGESGPSSWVQ"
     gene            237721..238714
                     /locus_tag="CNB00830"
                     /db_xref="GeneID:3256037"
     mRNA            join(237721..237775,237822..238097,238147..238305,
                     238358..238714)
                     /locus_tag="CNB00830"
                     /product="expressed protein"
                     /transcript_id="XM_024656445.1"
                     /db_xref="GeneID:3256037"
     CDS             join(237770..237775,237822..238097,238147..238305,
                     238358..238645)
                     /locus_tag="CNB00830"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512239.1"
                     /db_xref="GeneID:3256037"
                     /translation="MKFSNTAPQHLANREVLDHFISLKQETDRLGEAIALKKARDSAA
                     ARKLYPLERDDPDKKDDPSLFEPLNAEKEAELKVAERRGLSAELVWVQNEVIKYLCSD
                     MVPTSRQTPEGVAQLANELQDHQLTKAEILQLCNLAPGEPVTLYSIIEEADTRFYPDA
                     SGKLDEIGNQIYNTLLTSPPDELLPYMPDRPGAVSNEDVYDPVYLDNADAEMEEMAMM
                     QEEEFIHETGREGGVDDEQDGDMD"
     gene            239227..241000
                     /locus_tag="CNB00840"
                     /pseudo
                     /db_xref="GeneID:3255709"
     gene            243053..248136
                     /locus_tag="CNB00850"
                     /db_xref="GeneID:3256039"
     mRNA            join(243053..243730,243789..243819,243872..243974,
                     244022..244577,244628..244745,244802..244981,
                     245039..245211,245261..245375,245428..245516,
                     245568..245898,245953..246075,246143..246245,
                     246307..246382,246435..246560,246625..247449,
                     247501..247585,247645..247816,247887..248136)
                     /locus_tag="CNB00850"
                     /product="expressed protein"
                     /transcript_id="XM_024656446.1"
                     /db_xref="GeneID:3256039"
     CDS             join(243279..243730,243789..243819,243872..243974,
                     244022..244577,244628..244745,244802..244981,
                     245039..245211,245261..245375,245428..245516,
                     245568..245898,245953..246075,246143..246245,
                     246307..246382,246435..246522)
                     /locus_tag="CNB00850"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512240.1"
                     /db_xref="GeneID:3256039"
                     /translation="MATQLAMDWTDFHHSQWPKQQDSGGLVPPTDEWDLNDVLNTEMF
                     GSSSTLAASSSEQEPRPSSSNSLPLNISEPLGSNDALFQSYISQSTKMLGGMGETEQL
                     LETERAFPGDGALPSSITNPRGRAVTADAPTPSYKPASASGEPPLRRGMACMFCRRRK
                     LRCSGEKPTCASCVRHNQSCEYRVTENFSKVRSRKNGIYEGNHNPNYHYSQRPIANFS
                     VPLPPIFGGLLSYAPAQHEQPGFDPVPSNASSSTPSVSAIFNSASQAVQPCPSPSTNT
                     DHPPQSSAPETVSFFPEKEEEDAVERLTERLGEFLFSHKGSEDTSRAVDTPTLSKETG
                     WQKKRKTGKDGRWATDGKPTSENVRRAGVLQTTIESDGLSNETRNALLEFFLSSPYKF
                     FDMNIPRLRYRLSFTDKRRPALALLNAMYLWAARLSDVPNSDAMERHFFTKACQHLGS
                     ATASDDQLMDTIRAAALLSIYMYTRSRYHEGWLVAGVAVRLVLSSGIHQISSLTFQPS
                     PSEDPLLRNRVHLLSPPKDPIELGERVHTFWIVFIVERAGALATGFPSTIRDEDILTP
                     FGKPLSDISSQNVTLHDDITITDMYHDTGDSNPKTIYTHNSQWIQALAILERASKLAF
                     LKPSRDSDYTKAWVEYTNALRSSNAQASPPSPPPVYLNQPKHRNPREYRECLLALDNL
                     RKNLGVEGLSPLERKRMADAIGAQLVIPPRTIHLHHHFAATELLLHDINCTDADNSEA
                     MKAARQSVDLIRCLPQTTYHRFDGEISVVWCLIAKCMIKELGRLKRAGDDDACELVSE
                     DVDVIINELHHVGEALHMSRTQAKAMEELKRVVLSSHKEPTSPVGNA"
     gene            complement(246295..250031)
                     /locus_tag="CNB00860"
                     /db_xref="GeneID:3255885"
     mRNA            complement(join(246295..249092,249149..249436,
                     249493..250031))
                     /locus_tag="CNB00860"
                     /product="longevity-assurance protein, putative"
                     /transcript_id="XM_569093.2"
                     /db_xref="GeneID:3255885"
     CDS             complement(join(248676..249092,249149..249436,
                     249493..249873))
                     /locus_tag="CNB00860"
                     /codon_start=1
                     /product="longevity-assurance protein, putative"
                     /protein_id="XP_569093.1"
                     /db_xref="GeneID:3255885"
                     /translation="MACNLTTSAIPSLLHSYVPQSLRPFVTLSYPITDPLAHPSAQTL
                     YDKGPRDACFVVFWALAFTVLREAAMKGVFSPFMRICLPSPPRVKGQEREYAKARKKR
                     EHTVTRFAEQGWSWLYCSIYWTFGVIVLRQNASPTSPEQLWGTYPVIPLPALTKFYYL
                     SQLGWWFHQLLVINCEKRRKDHWQMFGHHILTITLIVGSYAMNFTSVGVLIHCLMDFC
                     DILLPLAKMFRYLSFTTLCDFTFVVFLISWFITRQVGLFLVIRSTYLDLPKFIPFEWT
                     PEQGRFLTYWTHIGFVSMLSILWILATAWFYMACIVAIRVVRGMGAEDSRSDDESEED
                     ALEQVPESVGTSTAITSEAEEDLRKRK"
     gene            250172..252458
                     /locus_tag="CNB00870"
                     /db_xref="GeneID:3256046"
     mRNA            join(250172..250380,250437..250563,250611..250875,
                     250935..251019,251072..252458)
                     /locus_tag="CNB00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656447.1"
                     /db_xref="GeneID:3256046"
     CDS             join(250211..250380,250437..250563,250611..250875,
                     250935..251019,251072..251264)
                     /locus_tag="CNB00870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512241.1"
                     /db_xref="GeneID:3256046"
                     /translation="MHLHLLVQIPTLHSTPTAMAILSTPSPTLYVSGLETKTKKPELR
                     QQLYALFSPYGRVIDVVAKKHDGGRGQAFVVFEEQVAATAALRGLTGETFYNRELRIS
                     YAKKPSYATTARQDPSASREAAAIQAAKLTVSRAQDEYEQLEKERHDEEAGFLGEKRG
                     LEDEGDERGAKRVKQEDDEAMEIEMDEEEDEEKPVLICSNLPAECNADIMGALFSQYQ
                     GFVSATQLPSSFTPPSSHPKPNPGAVSFHATFQSRDQAAKAKDEVNGYLMQPGWAMTA
                     TLA"
     gene            complement(<251362..252405)
                     /locus_tag="CNB00880"
                     /db_xref="GeneID:3256049"
     mRNA            complement(join(<251362..251513,251562..251671,
                     251723..251750,251800..251878,251945..252309,
                     252360..252405))
                     /locus_tag="CNB00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656448.1"
                     /db_xref="GeneID:3256049"
     CDS             complement(join(251362..251513,251562..251671,
                     251723..251750,251800..251878,251945..252172))
                     /locus_tag="CNB00880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512242.1"
                     /db_xref="GeneID:3256049"
                     /translation="MSNTQSPEFFELSDPHPESSPTARPHPASTGTVQSVDHALALTT
                     GPENEEAFEARHETKNHVQTNEEYTEFDPMAEIGRFDSKTELEDKWDEIQGEMVPFLQ
                     EFAEQALASTYDIILHVHYIFHQLDLQAQQSLIEGVQAIEEEEHRQEEARKVMTDFSN
                     EMKRAAEVLKRFGSATSSSQLREKEALLGDERDKEISQ"
     gene            complement(252420..253501)
                     /locus_tag="CNB00890"
                     /db_xref="GeneID:3256051"
     mRNA            complement(join(252420..252512,252564..252637,
                     252693..252823,252874..252943,253023..253237,
                     253287..253290,253345..253501))
                     /locus_tag="CNB00890"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_569096.2"
                     /db_xref="GeneID:3256051"
     CDS             complement(join(252465..252512,252564..252637,
                     252693..252823,252874..252943,253023..253237,
                     253287..253290,253345..253444))
                     /locus_tag="CNB00890"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_569096.1"
                     /db_xref="GeneID:3256051"
                     /translation="MILRIPSLLYLFTLLTAVYAVKFDLTSDRNPKPKCIWNFASAHS
                     LVIVTANVPGEPDQQVDIQILDGSERGNVYLSKKDVRGEARLAVTTHESADVGVCLTN
                     RYTGSGNPRVVRSVELDVDIGADAIDYNAIANQESLSILEVEMRKLEAVTKEIVEEMG
                     YLQRREMRMRDTNESTNQRVKVFSVLIICCTIGLGVWQLLHLRSFFKRKYLID"
     gene            253717..256752
                     /locus_tag="CNB00900"
                     /db_xref="GeneID:3256061"
     mRNA            join(253717..254055,254104..254599,254651..254966,
                     255016..255248,255295..255402,255454..255579,
                     255633..255739,255789..256752)
                     /locus_tag="CNB00900"
                     /product="cysteine-tRNA ligase, putative"
                     /transcript_id="XM_569097.2"
                     /db_xref="GeneID:3256061"
     CDS             join(253778..254055,254104..254599,254651..254966,
                     255016..255248,255295..255402,255454..255579,
                     255633..255739,255789..256566)
                     /locus_tag="CNB00900"
                     /codon_start=1
                     /product="cysteine-tRNA ligase, putative"
                     /protein_id="XP_569097.2"
                     /db_xref="GeneID:3256061"
                     /translation="MLPSTLARIPIRLLHPQATQQLRSLSNTMATNKSAVTQPTWYSP
                     AKSADEPVLRVYNSLTRSKDVFVPTNGRRVDWYNCGPTVYDSSHMGHARNYLTQDIVR
                     RILRDYFNYDVNFVMNVTDIDDKIILRARESYLLDQAISTNLALTPELISDVEAAFTK
                     YLAKPLKSLTAPLEHSPNATSFEILDLLLQKDQSEAQWAKEAREREEKFGMYLASLSK
                     ARDAYNAAQQRVGKPEGEGQAVKDLVEGATDVLGPYLGEKLGHTIADPIAVCRRLASY
                     WENAFFTDMARLRVLPPDTITRVSEYVPEIVSFVQRIVDNGFAYEGGGSVWFDVDKFE
                     GAEGDGFRHEYAKLQPSSKGNKKLLDEGEGALTGSQGKRRPADFALWKAKSKPGEPAW
                     PSPWGEGRPGWHIECSVMASAILGSGMDIHSGGVDLMFPHHDNELAQAEAYHGCKQWV
                     NYFLHTGHLHIEGLKMSKSLKNFITIDEALQTYSARQLRLAFMLQIWNAKLDFKKDLI
                     VDTKAKEETFDNFFTNVKARMSDAAARGPNEDGKHHYEEAEKSLMADFHKAQNDFRAA
                     LCDSFNTPAAIQILLDLVSSVNLYFASRGREYNIAPVVTVAQWITRMLRMFGLGEGDV
                     TSGQIGWGKEGDEASGGDFEGKLDPYLRAMASFRDDIRRLAIDGATPGEILKLCDKFR
                     DQDLANLGIQLDDGQSTTGGALYKLVDPAILIRAREEKERAAAEKAEKKKAAEAKRLA
                     QLEKGRVPPQEMFRPPNVAEGTYSAWDEQGLPTKDGEGQDLSKSLQKKVAKEWKVQEK
                     AHGAWLAWQKEQEGK"
     gene            complement(256571..257577)
                     /locus_tag="CNB00910"
                     /db_xref="GeneID:3256067"
     mRNA            complement(join(256571..256868,256939..257046,
                     257105..257133,257188..257198,257273..257287,
                     257336..257577))
                     /locus_tag="CNB00910"
                     /product="expressed protein"
                     /transcript_id="XM_569098.2"
                     /db_xref="GeneID:3256067"
     CDS             complement(join(256837..256868,256939..257046,
                     257105..257133,257188..257198,257273..257287,
                     257336..257443))
                     /locus_tag="CNB00910"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569098.1"
                     /db_xref="GeneID:3256067"
                     /translation="MPVRGSDIVLILVAIIFPPAAAAIITGCSCDLLINILLTILGYL
                     PGHIHAFWLIYKRIKAEEAYGNGGYTYLGNGNFVGNAPGGVAPGAPAQQPYYGSTR"
     gene            complement(257652..259012)
                     /locus_tag="CNB00920"
                     /db_xref="GeneID:3255720"
     mRNA            complement(join(257652..258294,258348..258577,
                     258634..258731,258786..259012))
                     /locus_tag="CNB00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656449.1"
                     /db_xref="GeneID:3255720"
     CDS             complement(join(257781..258294,258348..258577,
                     258634..258731,258786..258951))
                     /locus_tag="CNB00920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512202.1"
                     /db_xref="GeneID:3255720"
                     /translation="MSHPGMADPAISIKPQSEISPEASSLTALLAHPLLQDPKFVAAA
                     GGLALLLLFLTLFRQGKKTHKRNGPATVLLVGPSDGGKTSLFTKLIHDIYPQTHTSIV
                     PSDTTFDFDSPYEDDQKKQIRLIDIPGHPRLRDEVKKYIADSAGVVFVVDIQGIVRNA
                     SGVAEQLPPILTALSNISSRLPPSAPPPKLLLLAHKADLLARPTPSPSHCPPEIPSST
                     LTTSTDRLKSILTREMDRLKSTRAGTGGKIEGIGKVAGTSGGFFSKLFGGGAGDVAGE
                     DEGDDDESLIWGGKGPFKWEDVEGVEVEWGASGLGSTKGKTEAESGNGLDELKAFLWD
                     I"
     gene            259194..260812
                     /locus_tag="CNB00930"
                     /db_xref="GeneID:3256073"
     mRNA            join(259194..259275,259338..259396,259540..259737,
                     259798..259884,259938..260812)
                     /locus_tag="CNB00930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569099.2"
                     /db_xref="GeneID:3256073"
     CDS             join(259242..259275,259338..259396,259540..259737,
                     259798..259884,259938..260003)
                     /locus_tag="CNB00930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569099.1"
                     /db_xref="GeneID:3256073"
                     /translation="MADVSDPKIADAYEQIRSNGGEESWMLLDYESEKSNKLVLTATG
                     KGDLSELSAQLKPENASFAYAKVRYENDEHSFREKFILVIWIGENVKVMRRARVSVHA
                     ADVKKVLRTYSIEISASTPADLEQDDVVTRLRRAGGANYDRSKFD"
     gene            complement(260714..262162)
                     /locus_tag="CNB00935"
                     /db_xref="GeneID:36392725"
     mRNA            complement(join(260714..261218,261275..261377,
                     261429..261674,261726..261843,261926..262162))
                     /locus_tag="CNB00935"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658921.1"
                     /db_xref="GeneID:36392725"
     CDS             complement(join(261076..261218,261275..261377,
                     261429..261674,261726..261843,261926..262095))
                     /locus_tag="CNB00935"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514202.1"
                     /db_xref="GeneID:36392725"
                     /translation="MHLYNNMDRSRTRYAPPRTTPPTNFIRLLSAGTFAPAQTNQLRK
                     LPTRSLPSSSTAGLLIALAARDKQANPAAHHRTLLYIAIGLARELIHVLPYHVSLLLR
                     DNPDITIPLNNTSRHFMLPKVETEGGRQFEEYLFKGSIEGVFATDNGPPPTSEPSMPL
                     SDIKSLRPTVSLEEYKYIGNERSFDYIGIRRPSTNEGALFQVKNSWLNSLVQSFDQGS
                     LDIIVFPPEIDPDLLDKVCSLSRFAHNILDFVTLSDVRACT"
     STS             261902..262381
                     /standard_name="ha2609"
                     /db_xref="UniSTS:515574"
     gene            262313..266702
                     /locus_tag="CNB00940"
                     /db_xref="GeneID:3256078"
     mRNA            join(262313..262421,262471..262577,262630..266143,
                     266199..266398,266441..266702)
                     /locus_tag="CNB00940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656450.1"
                     /db_xref="GeneID:3256078"
     CDS             join(262491..262577,262630..266130)
                     /locus_tag="CNB00940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512243.1"
                     /db_xref="GeneID:3256078"
                     /translation="MSFLPARPSSSPSIHPIAARQARMNTFQKVKPICVALMGIAAQT
                     PTPYSEHHKLIDKLYAAISTVPSSTMDPAVINYVLFPITNIMRQSNPASLPDNFLEAA
                     FNLLALMVGAWRKCDGGIDVIAWEQLWRFSVAAVGPKVVNREKDKGKEKEAGQEVQLN
                     AVKLLAALLEPSTENSPTLHPSAAMLEKVANPKSPLLPTLFQTITLLLETVLPSPPYL
                     QLQLSSLRLLRRLMQSYLPGKHQFLAALLPGTVSAMAKLINTEGKNLKGEAAQESAGL
                     IEIVVTLTLNDHDLQELGVLRPPAEDLSQLAEEWEAANISTDEPPPPSPASSSTSIAP
                     NPFPPLTASYLSFTATQLLSAIPPVLFTFVPHSSDLARIAASSLAFSLIEKCSKSLPL
                     LRPRALTCLLLLSQDTFDPVRHDARRKLRRLISTETSTLSPILVDLLNDAVNSLPRLV
                     TSQQDTKVDEIARLVTAIAEASTELSRNRKQPARGNAIAELLGPNGNVERWSWALLDC
                     LEFGRPSGWSAAAGTAERAARLGWEGGFSQKSNLLLMDGTAEEQVEDEVEALGSFPHL
                     PLRYIESEATARRMGEMLSALGSAAEEAALYSVEYFIRFTKTNRRKHTVKAVSSLWVA
                     DRLLSGVIMSQLEGAEGKVSKATRKMAREVVKAVIVMEEDGEEEDEEDFGYDQEGTSA
                     LIPIERTKGIDTLTTLLDRNPLPNSHTAAETRRLHLQAQQTLLTSLSLQSLSLSARVL
                     SSSFRPLLLTTLYIILSHLASPHPIVQSYASLTLSHVAQYTGYASPAALILDNVDYVI
                     NVVTQRLTYKRLSAMAPLVLIAMIRLVGEPIVPLVHDVVDEIFDALDDYHGYETMASS
                     LLAVLVTLIDVMSKKVKLEAEESEEKRKRKAEELSWIGKAPNPAGDFAEFEKWWEEKA
                     QRSQKIVSEILERAPQHAWGREEAVNEDQDETTGENDTKMDEVEVPATRSQQVATRIL
                     TKALFFLTHRSPFLRSKVLSLIANSVPILALGNRESDLLPLIHDSWSSILNRLDDPEP
                     YVVVEAAEVIASLCEHVGDFMSKRVLEHAWPRLLKLLDEQRELDRRSALARRGGMGTE
                     SSFTVSHRLHIAILKTAIFIAREVPVADNVLWEMMLSFRVFIDDRVHEELCGKAMELY
                     TELGKRDGDALWIVLNGTLGNGVAGDSWEYLSRAKLNIERCASILLNAI"
     gene            complement(266124..267790)
                     /locus_tag="CNB00950"
                     /db_xref="GeneID:3255876"
     mRNA            complement(join(266124..266380,266432..266525,
                     266576..266753,266812..267079,267133..267308,
                     267375..267440,267493..267790))
                     /locus_tag="CNB00950"
                     /product="dCMP deaminase, putative"
                     /transcript_id="XM_024656451.1"
                     /db_xref="GeneID:3255876"
     CDS             complement(join(266224..266380,266432..266525,
                     266576..266753,266812..267079,267133..267308,
                     267375..267440,267493..267603))
                     /locus_tag="CNB00950"
                     /codon_start=1
                     /product="dCMP deaminase, putative"
                     /protein_id="XP_024512244.1"
                     /db_xref="GeneID:3255876"
                     /translation="MFIAIIGTPSSGKRTVLQYLEKKYGFKHLRLNKGEAQLAKTING
                     VVDGIGKPDVESTTTLFANASDLLDHVTRNWLSHFVTTDLQTYEEIDPFLKRPFFLLV
                     SVDGPLRARFERERARAGAEGRNITLEDFIEAHDSLLHGHPSSQIHALPALAQGQFMS
                     DFRRVLTLAHVHVDNNFTDVSALNWYLDRLDLLDEERLRPGWDTYFMTLASLASERSN
                     CMKRRVGALLVRSKRILSTGYNGTPRGTRNCNQGGCSRCNGSARGGEALNECLCLHAE
                     ENALLEAGRERIGDDSVIYCNTCPCLRCSVKIVQCGVREVVYNQSYSMDEASARVLKE
                     GGVLLRQLHLPNEIW"
     gene            268814..272672
                     /locus_tag="CNB00960"
                     /pseudo
                     /db_xref="GeneID:3256085"
     STS             276747..277162
                     /standard_name="Pp_Pp7"
                     /db_xref="UniSTS:259708"
     STS             276749..277199
                     /standard_name="PMC156610P1"
                     /db_xref="UniSTS:271418"
     STS             276897..277272
                     /standard_name="PMC133845P2"
                     /db_xref="UniSTS:270669"
     STS             276909..277203
                     /standard_name="PMC89798P1"
                     /db_xref="UniSTS:273611"
     STS             276947..277203
                     /standard_name="PMC89798P2"
                     /db_xref="UniSTS:273612"
     STS             277015..277262
                     /standard_name="PMC120649P1"
                     /db_xref="UniSTS:270380"
     STS             279685..279897
                     /standard_name="ITS"
                     /db_xref="UniSTS:275294"
     STS             280460..281256
                     /standard_name="PMC343294P1"
                     /db_xref="UniSTS:273189"
     STS             280551..280899
                     /standard_name="PMC133845P3"
                     /db_xref="UniSTS:270670"
     STS             280612..281115
                     /standard_name="PMC104890P1"
                     /db_xref="UniSTS:270115"
     STS             280709..281229
                     /standard_name="PMC125238P1"
                     /db_xref="UniSTS:270483"
     STS             280714..281082
                     /standard_name="A62960134FB73"
                     /db_xref="UniSTS:229217"
     STS             281053..281161
                     /standard_name="RH125423"
                     /db_xref="UniSTS:162245"
     STS             281087..281641
                     /standard_name="PMC106412P1"
                     /db_xref="UniSTS:270119"
     STS             284829..285244
                     /standard_name="Pp_Pp7"
                     /db_xref="UniSTS:259708"
     STS             284831..285281
                     /standard_name="PMC156610P1"
                     /db_xref="UniSTS:271418"
     STS             284979..285354
                     /standard_name="PMC133845P2"
                     /db_xref="UniSTS:270669"
     STS             284991..285285
                     /standard_name="PMC89798P1"
                     /db_xref="UniSTS:273611"
     STS             285029..285285
                     /standard_name="PMC89798P2"
                     /db_xref="UniSTS:273612"
     STS             285097..285344
                     /standard_name="PMC120649P1"
                     /db_xref="UniSTS:270380"
     STS             287767..287979
                     /standard_name="ITS"
                     /db_xref="UniSTS:275294"
     STS             288542..289338
                     /standard_name="PMC343294P1"
                     /db_xref="UniSTS:273189"
     STS             288633..288981
                     /standard_name="PMC133845P3"
                     /db_xref="UniSTS:270670"
     STS             288694..289197
                     /standard_name="PMC104890P1"
                     /db_xref="UniSTS:270115"
     STS             288791..289311
                     /standard_name="PMC125238P1"
                     /db_xref="UniSTS:270483"
     STS             288796..289164
                     /standard_name="A62960134FB73"
                     /db_xref="UniSTS:229217"
     STS             289135..289243
                     /standard_name="RH125423"
                     /db_xref="UniSTS:162245"
     STS             289169..289723
                     /standard_name="PMC106412P1"
                     /db_xref="UniSTS:270119"
     gene            complement(291129..294121)
                     /locus_tag="CNB00970"
                     /db_xref="GeneID:3256088"
     mRNA            complement(join(291129..291498,291548..294121))
                     /locus_tag="CNB00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656452.1"
                     /db_xref="GeneID:3256088"
     CDS             complement(join(291481..291498,291548..292816))
                     /locus_tag="CNB00970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512245.1"
                     /db_xref="GeneID:3256088"
                     /translation="MSEPKEETASAKISPLMGEDNYSDWSFDIQAYLLGLRLMSTLHE
                     TPVLHIPVTVPTGDPNQSPRVLTTDELNTLNAKIQNQHRAYSIVIRYLSPQVKAALSA
                     EAKNLLEPNPKLLWEELNRSYSKATGHRVGELYSILWTTRIPEGADPRPYLATLRSAL
                     AQLKQTQSVDDQQCAYAMLHALPASFRPIKQLLWAQTKFSTSDVIAQVSGKWVRAQGD
                     VAEEAGMALLAQSKSTVNSKRRKEKTGDDAGESQYCIWHGPNRHSSKDCWVEQRQKEI
                     KAGKVAEAKLAEADTYEADASSAYLAQTTAPNLSSPSTTFVIDSGATDHMVSDPSLLH
                     DVRHASTEHIRIGDGSLLPSTQRGSITIQGVDFHNVLVVPGLDRNLLSARRTPTGAQW
                     LFTRRAALLLDASGKILLASDFSDKGLYTLQIGIVA"
     gene            complement(294328..298566)
                     /locus_tag="CNB00980"
                     /db_xref="GeneID:3256090"
     mRNA            complement(join(294328..294391,294462..294518,
                     294569..295273,295330..295613,295675..295760,
                     295808..296034,296084..296166,296233..296406,
                     296462..296607,296663..297274,297336..297540,
                     297589..297834,297893..297984,298034..298159,
                     298225..298566))
                     /locus_tag="CNB00980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656453.1"
                     /db_xref="GeneID:3256090"
     CDS             complement(join(294477..294518,294569..295273,
                     295330..295613,295675..295760,295808..296034,
                     296084..296166,296233..296406,296462..296607,
                     296663..297274,297336..297540,297589..297834,
                     297893..297984,298034..298159,298225..298229))
                     /locus_tag="CNB00980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512246.1"
                     /db_xref="GeneID:3256090"
                     /translation="MSSTAAAAQSASTSSFVTSLIVNSALAGGELAAFIGLRRWLKAI
                     YEPRTYIPPKDAQAPALGKHIFYPLWQIITSDPQEILHKNGVDPYVFVRFLIMMAKAT
                     IPIWLLSWIVLLPVDTANSHVLGKSGLDRFTFGNVSPDKTSRYWSHLVLVYIFDFWII
                     WLLWGEMKHWLVIRQRHLINPSHSRLAQANTVLVTGIPKHLLSEEKLAQLFSHLPGGV
                     KRIWLNRNLKEMPNIHDRRNYALQKLESAQVSLIKYALKYKVSREKKTEKLEKKSKPI
                     PETLSGPVNPQMISECHNNTTQTAATVDGSVDLSNIESGHGAQQVFTSPSDLGLADQL
                     VPRSKRPTLRIKPKWAPFGLGFLGIGQKVDTIEWARKEIAYCTAELARSREQLQKDIE
                     SPGSDQDKYPPLNSAFIHFNQQIAAHMAVQCLAHNQPYAMNNRYIEQSPANVIWRNLS
                     LNQYERNVRQAISWAATFGLILLWATPVAFIGALSNVTTLTEKYHWLAWINGTSFGKK
                     VLQGVISGILPPVLLALLMELVPFILRQLAAFEGFPSRTEVEINLMTRYFLFLVIHTF
                     FIVTLASGLISSIQQFADNPGSAATTLATQMPTASTFFITLILTQFTGTMGSLLRVVN
                     LLLYYVRIILLGGSPRSVFTSRYRLNRPQFGETFPKITVYVVIMIAYCVISPIINGFS
                     AAFFVFATLVYKYLYIWVIDQPPSQDTGGMFFPKAITHVFVGLYVQEVCMAAMFFLVR
                     NDQGKATCVAQGALMVVLIVITIAIQYTVIVSYSPLKSSLPLSLARYSFGMPDNKLDE
                     KSASESAHIEEQTSLQLSTSREPLVSRILHHRRVKEGLLKGHKGFSNSRGKLSSQGTE
                     RPSEETTLAERDFAAEPGGNDIELGVQTTSRDHQTEVSQPTPCAATIPGPPVSRIPSA
                     AVSTTPSSGSEEQYFAVPGGPGVLMRKLDDGNDPNAFFHPATKEPQRIVWLPQDELGL
                     CEAELQVNEGDGIHSSCRGAWLDIKGKVHISGPPPDDI"
     gene            complement(298811..300889)
                     /locus_tag="CNB00990"
                     /db_xref="GeneID:3256093"
     mRNA            complement(join(298811..298995,299051..299205,
                     299255..299349,299407..299787,299846..300217,
                     300288..300386,300441..300466,300515..300588,
                     300686..300889))
                     /locus_tag="CNB00990"
                     /product="2-oxoglutarate metabolism-related protein,
                     putative"
                     /transcript_id="XM_569105.2"
                     /db_xref="GeneID:3256093"
     CDS             complement(join(298937..298995,299051..299205,
                     299255..299349,299407..299787,299846..300217,
                     300288..300386,300441..300466,300515..300588,
                     300686..300792))
                     /locus_tag="CNB00990"
                     /codon_start=1
                     /product="2-oxoglutarate metabolism-related protein,
                     putative"
                     /protein_id="XP_569105.1"
                     /db_xref="GeneID:3256093"
                     /translation="MIRTSSRAIASSSTAALRRSSLRSISLARNVSKTQISRTALQPR
                     ANIVFRSSFHSSSLLLAETVKVPQMAESITEGTLKQWSKQVGDFVKQDEEIATIETDK
                     IDVSVNAPVSGTITELLAEEESTVTVGQDLLKIEPGEGGAQSSESKPQAKSEPKNAEE
                     GNKDEAAPAAGKEKGAGEEALAKHEEKAPKLDKAEAEKPAPKKQEKPSPKQEPQPEKA
                     VGSRNETRVKMSRMRQTIAQRLKASQNAAASLTTFNEIDMSSLMEFRKLYKDGVLKNE
                     GVKLGFMSAFAKASCLALKEIPAANASIEGDSIVYRDYVDLSVAVATPKGLVTPIVRN
                     AESMGLVEIEKAIADLGKKARDNKLSIEDMSGGTFTISNGGVFGSLYGTPIINLPQAA
                     VLGMHTIKEKPVVVNGQIVIRPIMVVALTYDHRLLDGREAVTFLVRIKEYIEDSRRML
                     LPSPI"
     gene            complement(301064..304916)
                     /locus_tag="CNB01000"
                     /db_xref="GeneID:3256101"
     mRNA            complement(join(301064..301459,301529..301646,
                     301721..301793,301843..301862,301914..301937,
                     301988..302114,302167..302561,302634..302768,
                     302829..302849,302905..303103,303155..303171,
                     303229..303547,303597..303648,303709..304035,
                     304085..304101,304168..304337,304394..304633,
                     304688..304916))
                     /locus_tag="CNB01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656454.1"
                     /db_xref="GeneID:3256101"
     CDS             complement(join(301086..301459,301529..301646,
                     301721..301793,301843..301862,301914..301937,
                     301988..302114,302167..302561,302634..302768,
                     302829..302849,302905..303103,303155..303171,
                     303229..303547,303597..303648,303709..304035,
                     304085..304101,304168..304337,304394..304633,
                     304688..304915))
                     /locus_tag="CNB01000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512247.1"
                     /db_xref="GeneID:3256101"
                     /translation="MPPFPAYHRPLSLPYSRQQDLPALLLRADPSSSVESSPSTTGDS
                     ISASDLILEAEEHWNVSAKSILAAWGLTAAGAVIIVLLYSLARPRWKLIYLPRLKIRK
                     PSRTPKEKIEEKQMLAEMDEHERKKYLEQKESNKPTYYPEGKNNPGQWIARAPKSENG
                     FFGWLIPTLREISIECKSAMPKFLRSMWAGRSKNMDEKATGNPGLSVFEHDLKLLHML
                     GLDAMVYLLFLRLLKYLFSAMSVLAGLLAITNYYLNTQTTYGSTSTISSSGGEDDITK
                     RDSPSSSSSETSNNTSIIDNPQLLTAANVTSNGLLVHISFEWIVTMMIIVFVLKTSAH
                     HLKIVQEWTHLNYNEVAFKTLMITNLSLRQNKAKSIVTVADAKREIKSLVLGAERGKI
                     DARVWFAIHNMNPLHEKMETFKKKHFNLAIKAVAMETFHGRGAGVLYDSCTGRMCGRS
                     KSASSRVVEAFKEKLEIEELQDRIRQGQVDVRHTDLSGTITSAFVTVPSAKQAREILK
                     NVKDDMKRAGYHIQRAPRSHNVLWKNLEKDVKSRHSHAIIGKFALVIICFVNTIPLMI
                     VTVLANLGTAIDRWPTLAKLEDSSEIWKAIFTVLAGVLPATISAMFSYILPYIMRRLS
                     RWSGALTRGQLDKAVIRQLFIFQLVSNFIVFSLLGVVYETYLTISEDIGKESWSTIYA
                     GLGDVPAKVTQAYISESLYWLSWYPIRSVVACLQLLQIPRLILKTPQLLMIKTPHDLA
                     EVAQPENFEYAIEYSHVLFAMVVGLMYAPLAPIIVICAAIYFWALYIIHNNQLKFVFD
                     SKETDGKCWKILINRVLIATVFMQLFMVLTCTLKTQSAAMAVGAGLPVGIIFLFKMYL
                     RRHYHPDGEVFSQYIDKYEDDDTRHGEWAPEYEHELLREDWMPKIKTVKNAKLMSVAM
                     REFPKLKELLRVGRKADGEKYRGLMDKKRRKRVREKG"
     gene            304194..307128
                     /locus_tag="CNB01010"
                     /db_xref="GeneID:3256106"
     mRNA            join(304194..304302,304355..304444,304622..304643,
                     304721..305038,305405..305525,305588..305718,
                     305786..305985,306042..306107,306163..306240,
                     306297..306404,306449..306907,306963..307128)
                     /locus_tag="CNB01010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656455.1"
                     /db_xref="GeneID:3256106"
     CDS             join(305482..305525,305588..305718,305786..305985,
                     306042..306107,306163..306240,306297..306404,
                     306449..306907,306963..307067)
                     /locus_tag="CNB01010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512248.1"
                     /db_xref="GeneID:3256106"
                     /translation="MAAEQPSSSASDITITVKGPQELKLTISVSPDKNVAELKQLIAS
                     KCDVEKDRQRLIYSGKVLKDEETISSYKIQNGHTIHMVKGAAKPSSSTPAGQASQPPR
                     LPQMGTGLNVGSNPIDNVENIHHGLAGFNPFTGVQGLENLNDPNAMSNMMQSPEFLRS
                     MSDLMSRPEVVDQIIASNPQLASMGPQIRQMMASPFFRQMMSNPETLRTMMQMQSSMG
                     QGGGLGGLGGFNPFAPAAAGANANSAQNNAGPTDPFPNLFAPNAGNANPTAGGGNAAA
                     DQATNAPSNPSQPNAGQFPPGLAALLGLGGGMPGAGTNAGTNPNPFGGINPALFGGLG
                     SPWGAPPARDERPPEEIYATQLGQLNAMGLWDAQKNIRALRTTGGNVEAAIELIFSGQ
                     LDQA"
     gene            complement(307153..309293)
                     /locus_tag="CNB01020"
                     /db_xref="GeneID:3255859"
     mRNA            complement(join(307153..307400,307460..307530,
                     307594..307758,307820..307992,308047..308215,
                     308280..308505,308559..308709,308767..308880,
                     308935..309014,309064..309092,309151..309167,
                     309218..309293))
                     /locus_tag="CNB01020"
                     /product="mandelate racemase/muconate lactonizing enzyme,
                     putative"
                     /transcript_id="XM_569108.1"
                     /db_xref="GeneID:3255859"
     CDS             complement(join(307214..307400,307460..307530,
                     307594..307758,307820..307992,308047..308215,
                     308280..308505,308559..308709,308767..308880,
                     308935..309014,309064..309092,309151..309167,
                     309218..309254))
                     /locus_tag="CNB01020"
                     /codon_start=1
                     /product="mandelate racemase/muconate lactonizing enzyme,
                     putative"
                     /protein_id="XP_569108.1"
                     /db_xref="GeneID:3255859"
                     /translation="MSGLKITEFSVHDIRFPTNVTGDGTDAMNKECDYSAAYIVVKTN
                     SDLKGQGMTFTIGRGNEIVCFAIEQIANRIVGLDLAPIFADMGKFWDFLVADPQHRWL
                     GPEKGVIHIATAAISNAIWDMYAKHAGKPLWKLIVDFTPEEFVKATSFRYITDALSPA
                     EALEILKSKESGKAAREADVKKRGYPAYTTSVGWLGYSDEKVRRLTKESLAQGFNHFK
                     LKVGADPEDDLRRGRLIRSIIDDPANMPKDRKPIDPASIANKNAGPTGCVLMVDANQV
                     WDVPQAVEYMKKLEPLKPWFIEEPTAPDDAVGHAAIRKALKPINIGVATGEHAHNRMV
                     FKQLLQLDAIDVCQIDSCRLGGVNEILSVLLMSAKFGVPVCPHAGGVGLCEYVIHLSL
                     IDYICVSGDMERNVLEFVDHLHEHFLYPVSINSEGRYNVPTDAKGGYSIEMFEKSMED
                     YAFPGGAYWAAVARGENPAVSH"
     gene            309591..314838
                     /locus_tag="CNB01030"
                     /db_xref="GeneID:3255839"
     mRNA            join(309591..310556,310608..311878,311931..313402,
                     313460..313622,313695..313817,313870..314543,
                     314609..314838)
                     /locus_tag="CNB01030"
                     /product="multidrug resistance protein 1, putative"
                     /transcript_id="XM_569109.2"
                     /db_xref="GeneID:3255839"
     CDS             join(309667..310556,310608..311878,311931..313402,
                     313460..313622,313695..313817,313870..314543,
                     314609..314773)
                     /locus_tag="CNB01030"
                     /codon_start=1
                     /product="multidrug resistance protein 1, putative"
                     /protein_id="XP_569109.2"
                     /db_xref="GeneID:3255839"
                     /translation="MSTSSRFASPDRVELVALTPRQLPPTSDGSPFHDRHSVATPVAS
                     MAEESDGLSGYGYGRSRQKTAPGYQFANPSPAGLDEKRGQPVSFGPMLDEITPPSQWR
                     RSLYPADAPPIPASTFERHLGLVPLPTSPATSHRIMPVSEPIKPRFRRLFVFTTTRDY
                     ILLLCPAVVLSILSALIQPYMSIVIGNAFAIFAAYPLNTSLATDADRAALRSGVASTS
                     IQLTVAGVLALLFNYLKGVMWTRYGETVADRLRAKVYHGVQGKPMEWYDMGMGMREEE
                     QGEGKENDTVGAGGLMSKFNRETDDVRMATSHAFGLVVQNTFTFVLCFILAIIESPSL
                     AFVTLSTIPLVVLTQVVTQILCAPLLATERRVLAEASTNVERATAAISTVKVHNAQAA
                     EENRFMHSVSKSKGNLIKQGLVWGVSAGLTDFFLLGTFVLGFWYGAKIIREGKATSGA
                     VMTCFWACLFAATYLQQVVPQLTIMTKGKNSIASLLTVIQANPSRPISGNPFSPTNSP
                     IDSSFSPAVNTLNPKRVSRPLALQGVRPSRCHGEFNFNHISFAYPSRPENPVLCDISL
                     FIPPGETTFIVGGSGSGKSTIAQLLLRLYDPTSGEITMDNQSFPFLNGHFTRENIAAV
                     QQGCILFDMSVHDNVAMGLAGAGADPKTGVKRAPEDVTREQVVEACKMAMIHDFVVSL
                     PDGYDTILGTGGSSLSGGQRQRLAIARARIRNPTVLILDEATSALDATSRVLVFQNLK
                     AWRNNRTTIVITHDLSQIVSDDFVYVMKNGVVAEQGFRLDLMKKPNGTFAHMAAEQAV
                     NPLPAKEVASDAEWHDALNTLLDMEEDYEEVLDSRVRSHTPSFLGMQRNSAVYLDILD
                     EYSRSQRLSQVDRRQSRTSLTPAQKRLSWTPEQLGSRAPSRQSITAPISRPPSSQMSR
                     PVSRLSVVVDSNSRLSLRTMMAESRGQDGRMLHPGWMEKNSSSRISAIRQRQQRTLSE
                     NLEDDLKGLPSDVNLSDSVLVEEVSTGSATMPPVPGLSSLIKLYFPTLPAKPLLLLGC
                     IGSIGHGATTPIWSFFLSKLMTIVGAGGADTTSLTKYGLIVLGLCAAQGLSNCVQEYA
                     LVGLSARWTHMVRGVAMHKLITQDKAFFDLSSNSPSRLVQILIKDADDARTIMSQVIG
                     RAVTVVTMIGLGLIWAMAVEWRLTLIGLALGPIFGGFMAVNSWFIGNVELACKVAREE
                     VGRVFYESVANVRGIRAMALDSAFEKRFEEDASNARKTGTRSAWAMAMGGAIAGGLPL
                     FAQALMNFAGSAFMLQGRMNYEQMLQVYNLVLFSLTFGSGMLDFIPTMAKARAAARDF
                     NRIYQLCESTTESIGSLRFPINGHVEFSHVNFSYPSRPDVPILKDVSFTFKPGECVAV
                     VGPSGSGKSTIAALLQRLYVPDGGDIRLGDRSLREADVVWLRNHVAVVSQSANLFDAT
                     IAENIAYGSPNLPLSEIYRAAEAANIHDFIQSLPQGYETNLGENASLISGGQAQRLQI
                     ARALCRTSRVLILDECTSALDPDNARAVLDTIVKIKQDRTTIFITHSVEAMKRCDRII
                     CLGEGRVQEEGSFEELVRKGGVFAQLMKTGEWE"
     gene            complement(314857..320555)
                     /locus_tag="CNB01040"
                     /db_xref="GeneID:3255837"
     mRNA            complement(join(314857..315319,315377..315644,
                     315703..315842,315892..316493,316554..316616,
                     316676..316859,316916..316942,316992..317183,
                     317234..317365,317422..317575,317626..317943,
                     318003..318509,318558..318630,318685..319558,
                     319659..319715,319778..319878,319962..320100,
                     320259..320555))
                     /locus_tag="CNB01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656456.1"
                     /db_xref="GeneID:3255837"
     CDS             complement(join(315056..315319,315377..315644,
                     315703..315842,315892..316493,316554..316616,
                     316676..316859,316916..316942,316992..317183,
                     317234..317365,317422..317575,317626..317943,
                     318003..318509,318558..318630,318685..319558,
                     319659..319715,319778..319878,319962..320100,
                     320259..320330))
                     /locus_tag="CNB01040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512249.1"
                     /db_xref="GeneID:3255837"
                     /translation="MKLTAAALNKLARKTLELEGDPTTPVPPFYIDLLEKHLRKCPND
                     TNFIAELAEPQNPTSTKGGNGFGLIVCLEDQCWKEIILSADPFRGDGGRQEGFGSFWN
                     YQEHCKENEHIKGRNERCKKMGIPIQSSSSSLPLSSSHASSSRTSSTLNPLSTPASSS
                     RTNQSYTMPSASSSSSMSKKTSRPSILDALAPSPATISVHSSSPISSPQVVTTPSGMT
                     SAALNRNIAPHVKATPTPASKRMSSSDTHRHASSTSGSRALTARHSSSSDIVPINRVG
                     DSKNGGHIANGGSSTIPTTESFASDRTPLAPLRQNAKGTIPKREPVRQRTVSGTADNY
                     DDDDISLPSIKEQDKAFYKKFSAKREPIAVAATSSSVLNVGVSASASAAAKSSVTTGV
                     PLREFYSLLLNELKQGRNGLGIDFIPTEDKEQRYAAELQHLLKALAAFQNEKHKFRII
                     LQRMKFLKDALCNPNTVRAYIGPPIDITLIFPSLRLIIEKGRLIMMTRITTNTTGQLF
                     KLPCGCGDASHACDFGAFAKDSSILHCREPNAASSGSQLAHVGPVMASIPERTKIIDS
                     LAGILGVGRSYTSYSDDDMSDDDGLHDPRLIMQSYTHNVAESLTAFFSDNLKDFHADT
                     DVDKGLQKLGLNSLSDFLPGLKIKLMPHQVLGVSFMVEKERDHRYRGGLNGDSMGLGK
                     TVQSIATMAANPSQDAKCKTTLIIAPLALLSQWKNEIESKTTEGLMKVLIYHGPKRAT
                     TAAALKQYDVVLTTYGTLTSESASDKPSKHKVNSVDVTEEEGSGSTPAKMVGPLMKVK
                     WYRVILDEAHQIRNRNTRATKACWALRAHLRWCLSGTLVVNSLDDIYPHLRFLQISPS
                     AQWDHFREHISKPQKRFPKLATNRVQAILRVCCIRRHKESELNGKKLLELPPKTTRVI
                     DLQFTDEERQIYTAIENKYRVTFNSFLRKGTVMKHYSIMLVMLTRLRQLTCHPWLLRR
                     NPNDIGDARDVVVTDDDLFGGLEAPKMDDISEQARASTLIGQEYVERVKILLAERTKR
                     LEEAPPDGIDEAGDCECSICYEQYSDERITPCCHSFCAECLENIFNSAQGNADLSDDD
                     VQAGRRKCPLCRSVIDKAKIFRASAFMPVENDDQDDEDDNWGSQAEEVDDEDVDIGAK
                     LEELNDDDMSEKKKGKRKAVDSVVSKRKKRKGKGKSDEAAEDQLQAVNDEVSIEDVLP
                     STKMKKLGELIDAIIEQDPSQKIIVFSQFVEYIDLCSIFLRRRNIPHAKYVGSMKQDE
                     REDTIKDFNRPMEEDKSPRCLLMSLKCGGVGLNLCIANHVICLDLAWNAATENQAVDR
                     AHRIGQTREVVVHRLVVENTIDQRLMELQQQKQALSDGAMGEGAAAKLGRLNIQDLIK
                     LFGVRNQDDE"
     STS             319342..319848
                     /standard_name="D1S3693"
                     /db_xref="UniSTS:474271"
     gene            complement(321100..324100)
                     /locus_tag="CNB01050"
                     /db_xref="GeneID:3255832"
     mRNA            complement(join(321100..322105,322157..323349,
                     323556..323616,323834..323891,324082..324100))
                     /locus_tag="CNB01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656457.1"
                     /db_xref="GeneID:3255832"
     CDS             complement(join(321158..322105,322157..323341))
                     /locus_tag="CNB01050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512250.1"
                     /db_xref="GeneID:3255832"
                     /translation="MAPRQPVAGPSKPKHSQQPAIQSPPPPAAVSAFNSTRTLFALAS
                     PVLGQADKVQVWDVAGDRVISEWEVAGASKASSVCFTTVPSDAASKKKKRRKSGSGHG
                     AEEEVVLVTTSKSQLLVLSTKQTEPLRTLDLPAPVTAAWSEERATILATASSLLVLSA
                     DASSISHTFTLPSSLSSPTALTILPTSTAESLHVLVASSLVVTLHLGLASQEITFVSS
                     PLPASTSSISSLLPLPLTEQGASFLVVSEDDRTISQYTLTSPQSSARLSYRYASPTLS
                     SAHSISADPDLLAVLHESGEISLFRLPSELDLSRPQSDAKPSTVKIVEGKEERTARLC
                     RVAFAPVDDGASGALLCGRLTGGGRVKWSRAIFELPEGGLRPVTVVKVEAQELVGGSS
                     ASESVPVQRFVAPNTVNEAAPDDIDEAPVSQLPSDVNMAELSLGERMLAPASQEADSG
                     NKRAATSAGVTLDGPVNAASLTRVLVQALHTSDPALLTLCLSHRNPVLIRNTIRKMPP
                     QLALPLLKACVERLGQGKGANKRGGGRGAAQNEQQGRGTVEWVKGVLVERGSILMTIP
                     SLPVHLASLSQLLQNRLELNQPLQSLSGRLDLALAQITMRRIAAEQALENAKNGGQKG
                     GEGEIYVEGESEDEDEDFIEVGEDGGEIEDIDMGGLSESDESEEDEEEDEESDDDPLD
                     SGSDNDLLDLQAEEESGSDDEDESEEED"
     gene            324280..326179
                     /locus_tag="CNB01060"
                     /db_xref="GeneID:3255816"
     mRNA            join(324280..324714,324764..324963,325012..325129,
                     325183..325484,325533..326179)
                     /locus_tag="CNB01060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569112.2"
                     /db_xref="GeneID:3255816"
     CDS             join(324303..324714,324764..324963,325012..325129,
                     325183..325484,325533..326135)
                     /locus_tag="CNB01060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569112.2"
                     /db_xref="GeneID:3255816"
                     /translation="MSSTKPPTTTNKRKRTSNAHDEAPAKRVPEASSSKVTLDDSQPA
                     PATSSDAVLGARSAPGTDYERVPFSTLNLSPPTTAAIERMGFETMTEVQARTIPPLLA
                     GKDVLGAARTGSGKTMAFLIPSVELLSTLRFKPVNGTGVIIISPTRELALQIFGVAKE
                     LMQGHSQTFGVLMGGANRKAEADKLVKGVNLIVATPGRLLDHLQNTKGFVFKNLKALV
                     IDEADRILEIGFEEEMKQIIKLLPSENRQSMLFSATQTTKVTDLARISLRPGPLYINV
                     DETKEASTADMLEQGYVVCESDQRFMLLFTFLKKNLKKKVIVFFSSCNSVKYHAELLN
                     YIDVPVLDLHGKQKQQKRTNTFFEFINAPAGILLCTDVAARGLDIPKVDWIIQFDPPD
                     DPRDYIHRVGRTARAGKSGKSLLFLLPSELGFLRFLKVAKVPLNEYQFPQKKVADVQK
                     QLESLISKNHYLNTSARDGYRSYLQAYASYSLKKIFDVNKLDLAKVGKAFGFAVPPKV
                     NISVGSVKAKKSRDEDESSDDDGQPKKAYYRNRGRK"
     gene            complement(326185..327519)
                     /locus_tag="CNB01070"
                     /db_xref="GeneID:3255804"
     mRNA            complement(join(326185..326374,326426..326750,
                     326806..327253,327303..327519))
                     /locus_tag="CNB01070"
                     /product="no arches protein, putative"
                     /transcript_id="XM_569113.2"
                     /db_xref="GeneID:3255804"
     CDS             complement(join(326288..326374,326426..326750,
                     326806..327253,327303..327441))
                     /locus_tag="CNB01070"
                     /codon_start=1
                     /product="no arches protein, putative"
                     /protein_id="XP_569113.1"
                     /db_xref="GeneID:3255804"
                     /translation="MAAASNSAPLDPKLGRAADFVRPDFHQVNLDLENYLKTERNFKL
                     DADQQICPLSITPLGCPLPPSQCPYRHTTPSQLNFKPPPPLPAHPREREKKLTVCKHY
                     LRNLCKMGDNCEYTHDFNLRTMPVCIWFVKQGKCELGGECLYFHPRDRRVECPDYNRG
                     FCVLGPNCPRKHIRRRLCDAYAAGFCPDGKDCKLAHPSPNRPPAESYINPIPPDPEAF
                     NGPPPQLPAGYGRWREYKYDPNAVVVPAAAWVEGGSLSGWRAGGFLSANARRDNQRNR
                     DNDDEGGRGSGGERKGGWQKDLSTVLCFRCNQYGHFANNCPNQYVPGDRGGGRRRE"
     gene            complement(327716..329685)
                     /locus_tag="CNB01080"
                     /db_xref="GeneID:3255787"
     mRNA            complement(join(327716..327932,327985..328281,
                     328337..329048,329105..329685))
                     /locus_tag="CNB01080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569114.2"
                     /db_xref="GeneID:3255787"
     CDS             complement(join(327765..327932,327985..328281,
                     328337..329048,329105..329592))
                     /locus_tag="CNB01080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569114.1"
                     /db_xref="GeneID:3255787"
                     /translation="MPTNHAEQYELPAFPSSPEAGPSRLPRPQRRRASTWTKSRTLTL
                     HPTTSAANLLFSAPSGAFPATRQRHGRTRPQSNTDQSEEPRLHRATFLSEDPYDDSEE
                     VDLPDFGHILGFNDEGEDHFAVASGMRTRWKRKLYLLMEEPASGREAFFVHIIVTGAI
                     IFSAILTTLSTMPAFHMEPIIIKALFGLDTTIVVLFTIEYLARSLAHSGSWAQYYSWA
                     TSFFGLLDLVAILPYYIEVAQNEDTTILFRFSILRTFRLLRVFRAFKYQNQMLLTIEV
                     MYVAVRRSRDALWALTFFIILVLVLFSTLIYFAERGTWDPSLSAFIDSDGDPSAFDSI
                     PRTAWFSLVTMSTVGYGEVVPKSFLGKLLTIPLLMFGLLLIALPSFVLGRNFAIVFDA
                     MTRQLPKNVSSRMPTPRESIEQTRTAQASTDNIPLLPVSSQNTQTATPNGPSLSRPRS
                     ASPFPASGTVDQRAAFGNAPRMWQGGIDGTGETKRERDLTNTKLAKNQLVLFEQIDAL
                     RQTIDKQGEMLARLTEMLNVKDKGKGPEKSKGLQEDHFALGDSGEE"
     gene            329879..334338
                     /locus_tag="CNB01090"
                     /db_xref="GeneID:3255796"
     mRNA            join(329879..329975,330034..330181,330239..330775,
                     330829..332031,332084..332194,332249..332377,
                     332428..332985,333035..333461,333519..333771,
                     333827..333946,334000..334058,334116..334338)
                     /locus_tag="CNB01090"
                     /product="GTPase, putative"
                     /transcript_id="XM_569115.2"
                     /db_xref="GeneID:3255796"
     CDS             join(329914..329975,330034..330181,330239..330775,
                     330829..332031,332084..332194,332249..332377,
                     332428..332985,333035..333461,333519..333771,
                     333827..333946,334000..334058,334116..334195)
                     /locus_tag="CNB01090"
                     /codon_start=1
                     /product="GTPase, putative"
                     /protein_id="XP_569115.1"
                     /db_xref="GeneID:3255796"
                     /translation="MPPKNKVKKGGKKNLDDDEFWEKKEAALDQSEAPIQADEAPEKD
                     SKAGNSLFDLLEDGDAVSDEEGGGLMATIAANAAKKDKKKKKKASKFADLDDEVDEAE
                     PSPAVDTKPNLDDEWPEEDVKPKKGKKGKKDKKKAVEEDEELDEITAPADEQPEPITA
                     VNPDDEWPEEDVKPKKGKKGKKGKKVEEEEDIDAILEKAAAERKAQEAVAAPAKATPE
                     PEAEEAEEAEDEGPKILSKAQKEKLKKEKEKAKKKAQAAAKKAQATPTESPAEPTEIA
                     EAEEDEGDEEGAAGGDKKKKKKKKAAAKPAEPVPSAKGKKIPAHIAAMQAAMEERRRL
                     EEEAQKAEEERLKKIEEEEARIAAEEAAEAEAKAAKKAKEKEKLAKAKAEGKLLTPAQ
                     KRERAAAEARKQAMLAAGMVVAGLQEGGAAEKKKKPVYGNKKKQQQQQQKPKETPTPT
                     TTAPAAPAPESEAPKAEEKKEENEDDWDKSDNEVKKATAAVEKLKVEESEDDWDKSDE
                     EPAPEPARASTPAAKEAPASPAKNVAEKPAEKAAASTQTQPAPKAASAPAKANGKPAP
                     APAEESSSEEEESSSEEESSDEDSDEDSDEDSDDELAARKAKALQKIQERREAAQAAK
                     SSDDLRSPICCILGHVDTGKTKLLDKIRQTSVQEGEAGGITQQIGATFFPRSAIEEKT
                     EVVNKDHAYKVQIPGLLIIDTPGHESFTNLRSRGSSLCNIAILVVDITHGLEPQTIES
                     LNLLRQGRTPFIVALNKIDRMYGWKASPNAGFRETLNAQSKSVRSEFDDRVAKTKLAF
                     AEQGLNAEIFDENKNLGRNISLVPTSAVTGEGIPDMLMLLVKLTQERMNANLMYISEL
                     ECTILEVKVIEGLGTTVDVVLSNGVMREGDKIVLCGTDGPIVTQVRALLTPQPMREMR
                     IKGQYVHHKEVKAALGVKISAPGLEKAIAGARLYVAQDDDEVEAFKDMAMDDLTSLGR
                     FVTKSGKGVWVQASTLGSLEALLTFLEQMKIPVFNFGIGPVHKSTIVKAGTMLDKAPE
                     YAVILAFDVQIEKEAQELAQKAGMKIFSAMIIYHLFDAFTKYMSEVQEAKRKEAAPNA
                     VWPVRLKILKAFAHRDPIILGCDIIEGTMRIGTPMGVVKVDKETGKREVVPLGKITSI
                     EINHKPFEVVKRSQIGAGAAVKIERAPHQSAKLYGRHFDDKDEVVSLISRQSIDTLKA
                     NFRDQVELSDWAMIKKMKVEQGVP"
     gene            complement(334277..336356)
                     /locus_tag="CNB01100"
                     /db_xref="GeneID:3255781"
     mRNA            complement(join(334277..334393,334456..334522,
                     334581..334600,334659..334961,335021..335466,
                     335518..335687,335747..336004,336063..336095,
                     336155..336356))
                     /locus_tag="CNB01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_569116.2"
                     /db_xref="GeneID:3255781"
     CDS             complement(join(334363..334393,334456..334522,
                     334581..334600,334659..334961,335021..335466,
                     335518..335687,335747..336004,336063..336095,
                     336155..336203))
                     /locus_tag="CNB01100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569116.1"
                     /db_xref="GeneID:3255781"
                     /translation="MESQRPAQLPPRGLPILSGLPPVTESSNCRQCGKDFNPFWRRKH
                     ICGHCGYEYCSSCLSDGQALMPRRPGQAALNPKPLSELKAGLGLDDKRESSGSGYEAE
                     SVCLPCLGMLQVTAAPVTILRSLPIKRLKDYLAAYNIPCIGAKEKEDIVQTVLKARSP
                     STGCLSPEAESYYRRRSVPKGNTQSSSSPPNNTQTRPITNNNRPSSSGPQTYASSYQR
                     PSPHAHYRPPPPPPSNNYRRTPPRPQPQTQPRPQTNYGPTSAQARPSPRPAAAPTPPP
                     PVPSILSLVALPDSYLSSLSIGTLKAILYENHVRVDFKQVLEKKELIARVKELVDDER
                     KRLERQRIAEQEGLEQSPPLSSPQDPISDNVEASGNTAGLGDTEGDSDETPKAAKKVP
                     TGPMPEIERGLCVVCQDEEATLAAVDCGHLCMCPHCSDLIMATTQECPLCRTRIVTKQ
                     RLIRIYRT"
     gene            336447..339554
                     /locus_tag="CNB01110"
                     /db_xref="GeneID:3255942"
     mRNA            join(336447..336524,336574..336596,336644..338002,
                     338054..338159,338215..338296,338351..338480,
                     338536..338889,338947..339025,339076..339554)
                     /locus_tag="CNB01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656458.1"
                     /db_xref="GeneID:3255942"
     CDS             join(336480..336524,336574..336596,336644..338002,
                     338054..338159,338215..338296,338351..338480,
                     338536..338889,338947..339025,339076..339525)
                     /locus_tag="CNB01110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512112.1"
                     /db_xref="GeneID:3255942"
                     /translation="MALGSSTHGPSLYDKPRIRHITGIRIHQLTLPESLSYASRFVPE
                     QVPEGFTLGESSRTVASPEPASTRPEPQRSRQSSVGPKTISRDRRSSGSSSFRGRSDS
                     LASSKTIQPPSPRVASVPRARGTRHRAPTLAGEALGLGKDLEGDHDLSPHLHGSLSEQ
                     IELTRKEKRRLARCFVVFRLPPTASDTKSSECRPTQISASPDPKKASSDESLHQSKLR
                     EPGKWPIPVSASSSALSKSSPSSPTSVTPTASLPGSSSKPRIRTPSLTSHSPSKRPSP
                     PLASPRSSGLASLSPRSSSLRGESTSSASRSSTSIYRPTKKGTIGSDVATLPPPRPAF
                     TPMIVPFFISPIHSPSIFPRFCDLDPQSDFAPWLTYTDLASTLMEIQVWVETPDMDDD
                     QNAGPRKWKLLEGVGGVVQLDRLTRKTGQGSPNSLELTFSFDPQGVYCIASSESSQET
                     TSVLAEDQKWKDSKLKKGVGVGSLHQLVNMHAVITDTQRDIAQVQSNVNKLLDEDVDH
                     RALKRELSERENRIAWIKSKVEEVQKRIKDTRARITMKSEELQMRRDGLANANEVGNA
                     LRIQASELGDKIDSLRSERDSLLPKIHRIRASHIQILDNLFPIQPSDPSILLYTILGV
                     PLPIPSSAKDPAPPISLPAHKVDERTTAAALGYAAMVVQILGNLRGQAGTLPYPITCA
                     GSKSAVKDVVSVMQGPRSFPLYAKGVERYRYEYGVFLLNKNIEVLMQDANIRLLDLRQ
                     TLPNLKNLLLMLSSPVYTPTPRHQTSFTGSGISTYGSLRKSSGAWLHQRNNSVGLSSP
                     SSSVGKDSPLSISTRGATGVVAAPSTPNKRGRSVRRSMLSQNRMEREVDLGSTGSDES
                     ELYEKEGDSEAPAGQKIIV"
     gene            complement(338987..340590)
                     /locus_tag="CNB01120"
                     /db_xref="GeneID:3255921"
     mRNA            complement(join(338987..340065,340118..340183,
                     340241..340465,340514..340590))
                     /locus_tag="CNB01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656459.1"
                     /db_xref="GeneID:3255921"
     CDS             complement(join(339605..340065,340118..340183,
                     340241..340465,340514..340559))
                     /locus_tag="CNB01120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512113.1"
                     /db_xref="GeneID:3255921"
                     /translation="MPLAEADISATPIDDGSFASTTQPRDPNDRSYAPRSPQPKLVLF
                     NPRSGETETIDLGPASSVMTLEDYRNLNRQTTHRGMLTGLVGGGVLTYLVKRFKPTPP
                     TRNGLALTFLISSSFISYSTSRALLLSHILQIRAKARSQAAANGELQDPATPGSADVT
                     FDSFSTGDSPATLPSSESNSFGTPNPTDQLPGRWRPPQQQGKQVNSNVREELARARLG
                     NFPNRVDWSQGRRMDGGLQAEGETMSDPYGSPDQMRDPYAFTGSSRI"
     gene            340755..342623
                     /locus_tag="CNB01130"
                     /db_xref="GeneID:3255861"
     mRNA            join(340755..341038,341092..341223,341278..341361,
                     341417..341496,341550..341690,341744..341929,
                     341990..342161,342218..342623)
                     /locus_tag="CNB01130"
                     /product="mRNA guanylyltransferase, putative"
                     /transcript_id="XM_568787.2"
                     /db_xref="GeneID:3255861"
     CDS             join(340775..341038,341092..341223,341278..341361,
                     341417..341496,341550..341690,341744..341929,
                     341990..342161,342218..342430)
                     /locus_tag="CNB01130"
                     /codon_start=1
                     /product="mRNA guanylyltransferase, putative"
                     /protein_id="XP_568787.1"
                     /db_xref="GeneID:3255861"
                     /translation="MPAHTPIPDIPGELLTDPTLQYFLAERVSNLCGIGGGKFPGSQP
                     VSFSSSSLELLENEDFWVCEKSDGVRVLIFIVVNQSTEQQEVWLIDRKQRFFKVQGLY
                     FAHWENRSAFLGETLLDGELVIDIDPISGAQTLMYYAFDCMVLHGENIMEKPLLKRYA
                     RLRDWVVRPFEKALSANPDMRRTIPFMVVAKREELSYHLRFVMEEHIPKLKHGHDGLI
                     FTCVHTPYVAGTDENILKWKPPSENSIDFKVELRFPPLPDSDEPDYSAKPEFLLNTWL
                     GGDRYEFFDFMAMTDEEWQRFKESEEQLDERIVEVCWDSQIQAWKMLRMRDDKPHGNH
                     KSIVDKILVSINDGVEIEELYARADTIKAAWKERGKQRSQQQPPQTQRPPPPAYGQDL
                     HTPGHGYAHTGYNPDYSHPPPQQGVMSGLRR"
     gene            342685..349148
                     /locus_tag="CNB01140"
                     /db_xref="GeneID:3255711"
     mRNA            join(342685..342938,343106..343201,343255..343362,
                     343413..344468,344520..344675,344729..346950,
                     347004..347215,347268..348443,348494..348809,
                     348859..349148)
                     /locus_tag="CNB01140"
                     /product="nucleoporin nup189, putative"
                     /transcript_id="XM_568788.2"
                     /db_xref="GeneID:3255711"
     CDS             join(342824..342938,343106..343201,343255..343362,
                     343413..344468,344520..344675,344729..346950,
                     347004..347215,347268..348443,348494..348809,
                     348859..348978)
                     /locus_tag="CNB01140"
                     /codon_start=1
                     /product="nucleoporin nup189, putative"
                     /protein_id="XP_568788.2"
                     /db_xref="GeneID:3255711"
                     /translation="MFGSTSAWGQNNQNQQQQQGGGLFGGGGGGTFGQQNTGGFGQSG
                     TATGFGQPTQNTGGVFGGGATTNTGFGGFGASNQQQQPQQSNAFGAARPAFGASGSTF
                     GQNTTGGGLFGSSNTANTGFGSNTSNTSGGGLFGAKPATSTFGSGATSNLFGAKPSTG
                     FGASSNTQEVLKGPAELQTYRTDVPPPPPPSTGTANPIYYPTWQADPSTNTALGKEGP
                     PHLFHSITAMLPYRGCSWEELRALDYQQGRKEATPQQQNAFGASSAGGFGQPASTGFG
                     QQPATTGFGAKPAGAGLFGSSSPATGFGSTTSNTSTGFGASNTNTGGGLFGQSQPQQG
                     SSLFGQTNTNTGGGLFGQTQPQQSTGGGLFGSSNTSTTNPFGGAQTTQQPQATSTFGG
                     FGQSKPAFGSTGTTGFGTGSTGTSTFGQTGTGTTGFGGFGQTQPQQQQQQQQQPTTGG
                     GLFGGGGFGATNTQQQAPGTGLFGQTAQQQQPAATGFGAAKPGGLFGSTTTPASTNTG
                     FGGFGQTSNTSQPAGTGLFGSTNTNTNTTGGGLFGQTQPQQTTQQPATGGGLFGSTNA
                     APATGGGLFGAKPATTTAPSTGLFGQTQPTQQPAQTGGGLFGNTASTTGGGLFGSTTN
                     NSLGQLGQQNQQSGGGLFGAKPATGGGLFGGASATGTGTGLFGQQPQQQQQQQPQTGT
                     TGGLFGNLGQSQPASTGLFGSTTTQPAQQSTFGGGGLFSGLGQSAMQQPQQQQQQLQP
                     SLTASIDQNPYGNNPLFAYSGQKLEIGSQSKKPALPPLTASSYRLTPSTNKSKINKLR
                     GFASPLNVSQSPGRSGSPLSVSSPGRSSMFNSPAAPDRYKGLSDTALTPNAFVPRPNI
                     KKLSVTPNIGSSIGGNDQLESVLGKSALKASTSSLKGSTSTLQTPGTPLVFHPPVNGT
                     PSRPEIAESSVTRSTSAIASPRVAGSERAPKKGDYWCRPKLEKLEQMSKEDLSQLSGF
                     TAGRRGFGEVSFLEPVDLTLAPLEDILGSIIVVDQSELSVYPDDYSQKPERGQGLNVP
                     ARIMLENVFTTDKATKDWVRDPEDPRFQKFVRRVKAIPDTEFISYTDDGTWTFRVEHF
                     TTYGIADSDEDESIENGDLGRRREGVARKFSRSPSETSAEDDDDMFLPTKSIRDVEAE
                     HDSGFEEDQLSEKSYMEDGLTEADESGEMDFPEASWDLPIKSQLGAEGMKNLRGMQDS
                     FFGSSASMTRPGKELAMSKKREAEKGYESFFREAEGENVKLDERAIKRTSFGETQISL
                     PKLRQPRKYARVTEEESVAKGAEGLRVDAGLASGRSFRCSWGPNGELVHIGKICSPTE
                     SVRADTDAVVYIEKVEVLSEETEVETSKSQRLLSLHLETSLIEQVQGVPTATINPGIR
                     FHDFASRFDPGDRSHEANVFRLGVALFDEIDVQLPEGSSEELIERISSIRRKLALSRW
                     LEDAVAPLVDSDLITRSEDQPGKIFSLLSGHQVEHAVESALEAGNMRLATLLSQAGGE
                     ESFKDELLKQLEDWQAYKVNPLIAVGYRKLYALLAGITDISAGDPSRGSDGCPDVLIA
                     EGLDWKRAFGLHLWYGIPFENTIRDVVDSYTFSLSSSHPPAKPLPPYLEKSSDNIRSW
                     NLPTEPTDVLYNLLQLYSDDAISLDQVLRSRDTSPSPFDVRLAWHLYVLLSRVLRRRD
                     FEDRDESSGYSANADRLTAAYAAQLEEIGEWKWAAFVLLHLETVDGRFKALHALLYRH
                     PAITKEDQAFLTETLCIPEEWIHESRAASLCSTGDAWGEYHALLQAKIYDRAHKILVE
                     KLAPEAVLRDDKALLRRLCLKLEDKGVSGWEYGGKLFLEWADNSEDTVRLARVSGQPV
                     PPTSHFLSVFNSISLA"
     gene            349391..351378
                     /locus_tag="CNB01150"
                     /db_xref="GeneID:3255648"
     mRNA            join(349391..349474,349527..349558,349609..349986,
                     350036..350831,350887..350996,351046..351378)
                     /locus_tag="CNB01150"
                     /product="threonine synthase, putative"
                     /transcript_id="XM_568789.2"
                     /db_xref="GeneID:3255648"
     CDS             join(349412..349474,349527..349558,349609..349986,
                     350036..350831,350887..350996,351046..351310)
                     /locus_tag="CNB01150"
                     /codon_start=1
                     /product="threonine synthase, putative"
                     /protein_id="XP_568789.1"
                     /db_xref="GeneID:3255648"
                     /translation="MDQEMRYFSTRGGKETLSFEDAVLTGLAPNGGLYIPTHIPALPK
                     DWKTKWAGLSFPELSHEILSLFVPTSVIPSDDLQSIINTAYSSFRSPATTPIRQTGDK
                     EYVLELWHGPTWAFKDVALQFLGELFRYFLERRNKGKTEDMEELTVVGATSGDTGSAA
                     IYGLRSKPSITIFILYPDGRVSPIQEAQMATVLDANVYCVAVEDSDFDTCQSIVKTLF
                     SDAQFNATHRLGAINSINWARILAQIVYYFSAYFQLPEEARKDGAKLQFVVPTGNFGD
                     ILAGWYAKKLGLPMQQLVVATNENDILERFFRTGRYEADDPVQQDQTAETAAVNGSSD
                     GQQAVSAVKATHSPAMDILLSSNFERLLYYLALETNGTEGSDEEKRLKAQEKLNGWMS
                     ALKKDGKVDLGEDVRQAAGKDFWAERVSDGQTLEEIQKYYRREKYGPYVVDPHTAVGL
                     TAQERSAKKASSDTTWITLSTAHPAKFSGAVELALSASEFPDFDFRRDVLPDELKKLE
                     GLEKRVHRVKGEEGVRALIEKVKSASHEKVDAEEGRGSL"
     gene            351412..354863
                     /locus_tag="CNB01160"
                     /db_xref="GeneID:3255631"
     mRNA            join(351412..352212,352267..352914,352974..353377,
                     353438..354863)
                     /locus_tag="CNB01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656460.1"
                     /db_xref="GeneID:3255631"
     CDS             join(351433..352212,352267..352863)
                     /locus_tag="CNB01160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512114.1"
                     /db_xref="GeneID:3255631"
                     /translation="MFGYYSPVRPRSAAHSPVYASAIHESPQSTSSHRFSVTARDFAP
                     PPPPSNTSKEQQPQQQQKTTQTAKENRKKLSDDDFNFLSDSSSPMSANPPPPRQTSLT
                     PDTHLNLPPPSVHDPYVSSFIKPTGTVDHRRPSLHRSSSAPGEHQSHPLLPSALPPGR
                     EGDGGPKDVHQQPIFEVFNAELSAEGSEMSRKLRHLLETVLKGQEQVGKMHFNLEGLG
                     EDDGLEQEEKGGIEEDDKKKDYKGIEDRLQRREKGVDEIMEKLDELSETLRTYHDLGT
                     PKLSFNHTHTSPQSNRTKHRNTVSVPPVNADNPSHEHPTSPVSPTSATSPTSLRSPSH
                     PSIIRAQSSIDRAPTVRVHRPQSPLRQTFSPETASSGEGEQKSHPWGTRPDSAVSNLS
                     PLRLENEHSLDSPLSASPPQSQPKPKSFWDAEHEREREKGHKQQWLENVGQVIDSPFQ
                     MEDKTRPF"
     gene            complement(354800..359830)
                     /locus_tag="CNB01170"
                     /db_xref="GeneID:3255810"
     mRNA            complement(join(354800..355633,355685..356032,
                     356083..356402,356454..356599,356652..358065,
                     358373..359233,359304..359830))
                     /locus_tag="CNB01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656461.1"
                     /db_xref="GeneID:3255810"
     CDS             complement(join(354935..355633,355685..356032,
                     356083..356402,356454..356599,356652..358065,
                     358373..359090))
                     /locus_tag="CNB01170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512115.1"
                     /db_xref="GeneID:3255810"
                     /translation="MPLSLTARSLTSPSAMSGEYPQTLSLLVLLPSTSSSQAEILTPY
                     RPNPLTTRSSSPKVPTVLSLTKSGNGDQGGDGVVHAEELKAKVMAGRRLSLGSSLGSD
                     INLSIGEETMSANVIPVGINQPSRVATLHDMPPFSPIVSPTSSIPPPITKDPSSNLNT
                     PPFGYSSRSGSGGGAHSRRRRPQTASGTANDIAPALIKETANARSSLAMVSGAVKGRG
                     KARPGWEADELVGHLRESGLEVTVVHTLSHLTSLIDPAVSPSAHPIITRPADPAEPVT
                     HVILVPLADSPAFPSLSLLLNSGTTPSAVCFQQDILERAVRAEEQWLKGALAQIKRVA
                     DMCTKHRSPLSSATSTARPSPVASGPGSPTEAPAPLIIAYSANPSLSQSAISSCIAAG
                     VIGVLKPPYDLSTAEMVRRMVQSYKKGELPVAFQSPFDTSSPYDITASRFSISPGGGS
                     DETTTVVLPPTALDMGAEHEGEKVLAAAMGPRQGSSEAWNWARNEKRSSFSQRTSTSR
                     ESQNASRKGSTVSGIAFASADPFAASCACNSPSSQHLRPDQQTPPMYQQSPTMPTYKH
                     PEISLPPAPQYTYPYLFYQAPSFCVFHPAPDPRRRSVDIGGLAEAIKRASRLYEASHP
                     ILSGSRASSIQPQGFKHAQMHEDYSFPSAASPTSSANPKSSLSSSQETHSSDENDAWG
                     KYTELAELLSAMYCHTGTTIDIQMEEFEKFSNPLTPKKRSQLVEPHYLHEDDLYRMAC
                     LIFEGILNIEGLAELGLQQDNVNRLLFAMRAIYHAPNPYHNYVHALDVLQATYTFLAD
                     LGVAPPFEYMREWGPNKEIWRRPSENEDERSAGTKRAREIMRPQDILAVLIAAMGHDV
                     GHPGLSNAFMKNARVPLSQVYEDKSVLENMHCMLVVQLLRKYGFGFLIERTKSSSGEQ
                     AVSNLDQKSFRQVLYSSILATDMSLHFAWVQRLKEFDDRLKSGEAGAVEDERILICQA
                     LIKCADISNPSRPIDVSQHWSSVLLEEWAKQASLEQDLSLPVSVVASADAALQAKGQI
                     GFIDLFTKPLFQAVSDALPELQPYADSCMENQTIWKARLAELTEKEGEEGEAVRTLIQ
                     PAVEGASQDERFKTLFPLLLPTPLVSGLSGPEDTLLKRSSSIPSPTAAMTSFAPHTPS
                     MFNFGIDLTEQTGASPAASVMRAVYHAKLVDQGSRSRLASWSRGFVHGDWNEHRRMST
                     PDILTSSNHL"
     gene            complement(360934..363215)
                     /locus_tag="CNB01180"
                     /pseudo
                     /db_xref="GeneID:3255604"
     gene            361454..363217
                     /locus_tag="CNB01190"
                     /db_xref="GeneID:3255560"
     mRNA            join(361454..361584,361649..362150,362203..363217)
                     /locus_tag="CNB01190"
                     /product="expressed protein"
                     /transcript_id="XM_568792.1"
                     /db_xref="GeneID:3255560"
     CDS             join(361671..362150,362203..363141)
                     /locus_tag="CNB01190"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568792.1"
                     /db_xref="GeneID:3255560"
                     /translation="MATYLAPPVSSNKENSPAPNIALSDIDAISLSLRTSLSGVTLPA
                     KKKVAALGLGRAPKFTYRRHSNKPYNRSTSITRAKKAAVQTKSVRSKAAVKKSNTRPL
                     PLKLVQRLDVESARLERLRKAVWNPPAPVPGQVRVPLKLPYPRFPSIEYIDNEYLKEI
                     PVQYIFDRMVPLLPSIATITLAYQPYASIPHPDSKILRDTTLAFAIPEVIDGRKPHWA
                     AKARGREPDLALAVAYKSGEGSNGNTVVAVNSLAFATQCAYWPRLLTTSIPIPTPKRP
                     TPSASAVSTSLPAIVETEENVSDASFSSSSSWSDSDSEVEFIDLPRLPRPVKDDKGFL
                     HLPLVELPIPSPSTFPIIHRHLHHPSRALLPDLLGLPEHYTTRSQVLDAISGLSVQQL
                     MDKLTTLQGVWQNLCSLGIGRLGTWRQLGEAWACVVGVIAGQGLLIAGQEEAEVQRTG
                     RKTAAEDVAWEWVRREKAKEQQ"
     gene            363425..364921
                     /locus_tag="CNB01200"
                     /db_xref="GeneID:3255881"
     mRNA            join(363425..363555,363612..363706,363773..363795,
                     363849..364441,364503..364652,364702..364921)
                     /locus_tag="CNB01200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568793.2"
                     /db_xref="GeneID:3255881"
     CDS             join(363454..363555,363612..363706,363773..363795,
                     363849..364441,364503..364652,364702..364815)
                     /locus_tag="CNB01200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568793.1"
                     /db_xref="GeneID:3255881"
                     /translation="MSILTRLSSRVPYLAKQLSTMPSFQIPKTMKAIQVDAPGGPEVN
                     VLREIPVPTPNPDEVLIKVQYTGVNYIDTYYRSGLYPKKFPYTVGQDAVGTLVQGPSS
                     PDVKFDIPLGTTVFTPAGSSFAEYLVAPSSRVGVVPEGVDPKDGVSWSTVGLTALALA
                     KESYPVKKGDWVLIRAAAGGVGLVLTQIVKYLGGHVIGTVSSQDKAELVKSYGADLVL
                     LSTDPSEDNVKKILEVTNGGVHGVYDGVGKDTWEEDFLVVRRKGTIVTFGNASGAVPA
                     FAPLKLTPKALKVTRPTVWSIVTTPEEFKEYTTELVDIVKKAGLKFEVYKVYELTQEG
                     VVQAQKDITSRGTTGKLLIHVADK"
     gene            complement(364919..366704)
                     /locus_tag="CNB01210"
                     /db_xref="GeneID:3255849"
     mRNA            complement(join(364919..365124,365186..365399,
                     365451..365556,365612..366186,366241..366387,
                     366453..366704))
                     /locus_tag="CNB01210"
                     /product="nucleoside transporter, putative"
                     /transcript_id="XM_024656462.1"
                     /db_xref="GeneID:3255849"
     CDS             complement(join(364950..365124,365186..365399,
                     365451..365556,365612..366186,366241..366387,
                     366453..366681))
                     /locus_tag="CNB01210"
                     /codon_start=1
                     /product="nucleoside transporter, putative"
                     /protein_id="XP_024512116.1"
                     /db_xref="GeneID:3255849"
                     /translation="MLAAIRSALSTRPDPAEYQPVIPSAAANADPTDPATLDHIDRQL
                     GHGAAREVVEYESVKVYFCFWVLGAGVLMSWNALICTFPLLISYLPPDSSLRRNLASI
                     LSTVYCFGNLFFLGMAQRHVGKVSPAKRLHSSLVILLVTALLTTYPALPFLFPRLSSS
                     LLFSALVFISLVLSFSTAYLQSSVFALSSLWGSEQTLGVMSGQGGIAVLVSGVQFALA
                     FVSAIAKSDNGQDDEGEEASKLAGVGLWAACSLGVVGCFMASRYLKRHPKYLDVVAPK
                     FAASELNNVEGNKRENGTTRKLFKKNWELNLAVAFVFVVTLSVFPAITTRILSTHQPT
                     PRLLQPDVFMPLHFVIFNIGDYIGRTYLPSYSALLFTSPRRILLLSLGRIFFIPIFFA
                     CNVTPREVNNTPFIDSDILYFLIILLFSMTNGYLGSLCMIVSSSPNLNHRIKEDERDV
                     AATLASFCLVAGLAGGSLASFAVASAVNRGL"
     gene            366741..371545
                     /locus_tag="CNB01220"
                     /db_xref="GeneID:3255951"
     mRNA            join(366741..367161,367212..367420,367477..368353,
                     368406..368703,368761..369196,369254..369480,
                     369541..369883,369939..370113,370169..370226,
                     370285..370474,370519..371545)
                     /locus_tag="CNB01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656463.1"
                     /db_xref="GeneID:3255951"
     CDS             join(366854..367161,367212..367420,367477..368353,
                     368406..368703,368761..369196,369254..369480,
                     369541..369883,369939..370113,370169..370226,
                     370285..370474,370519..371276)
                     /locus_tag="CNB01220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512117.1"
                     /db_xref="GeneID:3255951"
                     /translation="MQGSSPAATGGPEASHQPLPPIDPPAAVQQQVTIPTLQVALENP
                     NPVPDAPAGVNSMVDPEAQLSDGINAVELGTAADDSTNLNGTIIETIADSSTAGEITT
                     YQGGIPPYSAPSHVIYPEENIPNPFVGDMRPQPVFDNLRPHSLFRPAVLPADVDLRLD
                     QSSIWMTVDEQTSRAVYWITPTCLCCKHPAFAQHCDRGWPACARCTSRGINCLPGKQW
                     GNLRAKSRRRGTASFVPAPRATTSRSVRLSNAAKLAIEAAEAASAAASTEITKATMQK
                     SNPKPKATTIVDTEMTNGEKANGITTKSATSPLTVPAEITSPDVPIPIVTAPPTAATS
                     LPNRSKRPHSVLAVPSSKNEVFTKRPRQKVPLAKSVVASSPDDELYFARLKANELKPA
                     LSNTHGSCPVWAQTRRGLQAALEYFREPKRTLGASVDISGGGMARGVLFEGAVEAQGV
                     YWGQGERIGTIMTSIGHPRRQKPIIPQEDEVAPVLPEPSSSTLSATAGINLAESLKSG
                     KKEAVNDELPEIKALLKTQRARIPVALAVAQDYSAVPFRVAKPFMVLGWFWIVESWLE
                     PVLTSLELFKPIQKAPSGPPEKVVWKFRFEYCRGSQPPPWWSTPSQQSGQQGEESITA
                     TRKVPVDSSWDFIGHSNTNEADTVRSPTPVDEPNGHVEMYSSEEDKKYTHQCENCRKI
                     SHRVYADGDICLNESCSWFFGDASDASNRIGPIRNEPGALQEIPHILPEQLNLVLVPE
                     EPGVHMLKGGRENIGREYWTGFVCSKCKLAQERDDWSGWRCKLCDYFVIKSGFHSHIA
                     LRPLRPVCTGPRQEDGFATWPKPAHRSWSLYEDNAKVIRYQVDATLGPGTEVHHVLGS
                     ERQADFTGKSFMELQKLGSVPSVAGDVNLPKRFPALPDEEVKRPAESFLSPFYTFLAG
                     NDAPSLPGFPTGPIVRWKSCPKTFVDVMHIINFQAGRMFPGRPQFSNLTMAAYPPQIL
                     TSQHPPITVPPNSYIAIMFLGSDCTVRFRPAGTRIKPGEITVQHGDLIGVQAGSEPTD
                     VSLKTGSFGIICIARHGGQYAESQNQNEFKSESPLESAPVPAEIIEKPALLPEAPLTN
                     WYIGGLPLDPAQPTIVLPPFRAERPKPVWTGDATNVEEKSKENNEGQQADPNIVILTT
                     PPPTPRLREPRGLSPLAGYGESTASLRRSLAVASPSSPPVAAKRGGKATRGRASTGSS
                     VADGRRSSTPMRGRKRASTGKRKAKAEPEASDVEGEDEVSNSGEPEEDGKGKGKRRKN
                     IGGRRSLGTPTTTRGRGGGRGRGGRKSAVV"
     gene            complement(372290..373312)
                     /locus_tag="CNB01230"
                     /db_xref="GeneID:3255869"
     mRNA            complement(join(372290..372416,372475..372727,
                     372791..372948,373051..373079,373138..373233,
                     373276..373312))
                     /locus_tag="CNB01230"
                     /product="cyclophilin A, putative"
                     /transcript_id="XM_024656464.1"
                     /db_xref="GeneID:3255869"
     CDS             complement(join(372373..372416,372475..372727,
                     372791..372948,373051..373079,373138..373181))
                     /locus_tag="CNB01230"
                     /codon_start=1
                     /product="cyclophilin A, putative"
                     /protein_id="XP_024512118.1"
                     /db_xref="GeneID:3255869"
                     /translation="MSFARRFVSTASTMSQVYFDIAINNAPAGRITFKLFDDVVPKTA
                     RNFRELCTGQNGFGYAGSGFHRVIPQFMLQGGDFTNHNGTGGKSIYGNKFADENFKLR
                     HDRPFLLSMANAGPNTNGSQFFITTVVTSWLDGKHCVFGEVSSGQDLVRKIESYGSDS
                     GKPKAKITITASGTV"
     gene            373579..381515
                     /locus_tag="CNB01240"
                     /db_xref="GeneID:3255989"
     mRNA            join(373579..373650,373695..374587,374634..375557,
                     375604..378021,378078..378214,378267..381011,
                     381071..381272,381324..381515)
                     /locus_tag="CNB01240"
                     /product="Cell polarity protein mor2, putative"
                     /transcript_id="XM_024656465.1"
                     /db_xref="GeneID:3255989"
     CDS             join(373629..373650,373695..374587,374634..375557,
                     375604..378021,378078..378214,378267..380967)
                     /locus_tag="CNB01240"
                     /codon_start=1
                     /product="Cell polarity protein mor2, putative"
                     /protein_id="XP_024512119.1"
                     /db_xref="GeneID:3255989"
                     /translation="MEEIVIPNLEDDEDDFLPALARPVFGAASSTTSLPDTDSYGHRT
                     NLSSDSSYPAKFGSTTPTRPALPKGSASFSANTGHGFGQDARLGKFSNASSSSLVTPG
                     TSISSSLALTPGKKNGLASKGSLASFKNAFKSSNTAVPPVPMFDSRSGAPGYPALKNP
                     FSRFDSPVSPKSAGFKISSKGKTPSTSSPAMARYQSSDGGRKYSITSSHRSQGGRSMT
                     SQGSSNFRADDYPMPALPPIPTRQTPSRIGRHGSDAGSFMMGRRNGSADLDGLYSAAT
                     PAEEALRVVFKEFREMAGNKVHKVCARPLNSHPSLSSFLDIGVDPQFDSIVTSLSQCA
                     TRHARRVVDLLMSWCRDYCGNIGASEVRTHLDRSIGLQIKVEEAAAILQARKSSAARF
                     IMNRVLIELLKIIPKDSLDQELGMTLEQNAFNAYRSEKIEDVMQFPHRKAVSQLQVEL
                     LGQLSKTRFLTVSDRFIRELSKYDTNQQPTKEAEAKIEHLLKGMRQLQLKVYPEEELE
                     LSAEFLQSLSAFFATAHGQSLKTAYAETLSYLLHPVVETATAEVNHPIWSQAVAVILE
                     RAIGMVSKARYWGSAFPLMVIVMGVSPRDGFMQQWQGVIDVILAKFKDRNLRPIAMGA
                     FIRLLWIYLHRCSESSTSTRKRLDPLVHILFHSSPTSPLYPPDIPIEAFISVLHYVMT
                     RQIEYGEELVSAFLGGRAVAGEGGADRATALVRAIDYTLRAIELEKAATWPQYPDFNK
                     FGLEGYESSGEVLPFEAESKVEVRDLLKRCGPLFLNTLVDCDNDVRHLLLSNDAVTLS
                     GHTSSNTMDNPLDSITIKHGDVYVSYSARFAARLRLMGAIIDTLPRCLPSDAKWGELA
                     SILSRATFSVDPKLCESAANALKRISQDPQKCLLLVTTYRGFVFETRHVFKDTFIGAR
                     LFESQFERVIRLWLDMLQSLVGHQRVAEAQAQADEEAPDLPPIESSQIAQIEGCALFL
                     LCSSSATLRKLAGQILVAARNLESQQRMPSAAFRYSRISPDRSAMSRVLDSYEHAFSE
                     ADIVALGQIPWLSQPDRLRLETLVGTIKKEGNKLIQRIAESEHPRDGALWLAVLPHFI
                     GKVAETLPNAAHELRSVVGGLVLRLQAHVAVVAGGAMRGTPSRNDGGYASTKSSTDVA
                     VLAEHWRAYHSVLCVTLIPPNANGPSPSTPPVQRSTAKDMIILNQDAINSSGLFTYLT
                     SLLGWEDPRFKDAAVHALGSIRQGMLRPLAEQLLTLARRLMDGTKVGGTSREGTTKKT
                     PNANIWTALAHIFRLISPLVLDSKSSSHLANLSSMIGFVKLTYSLLSDRSVKEDFDLQ
                     NLRRSFCVVVENLTNALGKLDSSHRFLGEDMRGAIFKLCTEWCLVGRRPDVAKARESQ
                     MLQAAAGGYKGEKDRATYLDDLQNKTKLLSMAAAEAMAGLCQGKLISASDSSPAQQAS
                     EHIVEPLLVLRWIRGMFGSGNASHNVTGKRALFALLKYNWECERLLDEVLHQSFGEGE
                     QFPLDSSFFGVVADLLSEGLITLPIEQIACLTLSKLGHPVPHIRQRAFQLIQTLLVLP
                     EQQMAASKLLASVGSFSPVTYRKAQTILSAQLAGIYAENSFEFLSECTIRLSQLEAPR
                     RQATLCIISPWAQHLEVLSDTSELEAEQVTRQLKALHNLVYLAVRFGDDYIEEVKAII
                     HSFVGSDTTQSENTTALVKFLFEQGGKRRSPDFVEHARRIIACLASRPAGDSIFEDIC
                     NFVEPNAMVALPDADVPPSPMSSLANLDTIMSAPSTKSQTFSTGQLALIFASELLPHR
                     LGDIDLPQKLPALLHAALIQCDHPSSALREQAQTVLFQVLRAWICDVSRVPSKDAHTI
                     WASAEHKVTSLARSGNIFWKSDDMGGTDVAFLAPANMTTFIVKILGILLPLQPKIRQH
                     WGELALSWATTCPMRHLACRSFQVLRILSPKINPRMISDTLARLSSTIGSSSSEIQAF
                     NSEVLRTFASIVQSLSPTEALAYPQIFWCSLACLTTPYENEFSEVIELLSHVLDKTNL
                     SDPTVVQLLNSYRPTDWVGPSPYLQSLLLVGLRSSKTAFLTFDIIRRLTSASNDELID
                     DPNDRLIHGFIAALPWMLHSTDLGEPNEELAGMALDLAEIADQQGQASFSRLLTSFAK
                     VRFRSKDDFIRQAASLLRDYMPTHALDIVTLLLGFVLNTYDWMREKSMQVLKLVLQSP
                     EARAPLQAHGNELLQPLLRLLATEHASQALDVLDMPVTATAVPAGDNSTVSPGYGEVF
                     GVVEESGWSVPKAKELSALTRENVRAVFNTCATETRAASAHFSVVQFADMRSFGPNAS
                     QVSLDIPASPFMNESVVMDNASIGDLVGALHNLGHFFEDEDGAAGTTGSTSPPLALRE
                     "
     gene            381898..383500
                     /locus_tag="CNB01250"
                     /db_xref="GeneID:3255851"
     mRNA            join(381898..382036,382097..382113,382172..382421,
                     382481..382527,382590..382595,382661..382696,
                     382751..383047,383103..383177,383229..383500)
                     /locus_tag="CNB01250"
                     /product="short-chain dehydrogenase, putative"
                     /transcript_id="XM_024656466.1"
                     /db_xref="GeneID:3255851"
     CDS             join(381930..382036,382097..382113,382172..382421,
                     382481..382527,382590..382595,382661..382696,
                     382751..383047,383103..383177,383229..383281)
                     /locus_tag="CNB01250"
                     /codon_start=1
                     /product="short-chain dehydrogenase, putative"
                     /protein_id="XP_024512120.1"
                     /db_xref="GeneID:3255851"
                     /translation="MFSILTKTTTNLLLLQTRRKVVLQQIRTMSVFSTSRLAGKTVLV
                     TGASAGIGASTAELFAKCGSNVVLLARRADNLQAVKAKCEAAHKESGLKEGGKVVVIE
                     ADMQKNEHLDAIPTKLEGLEVDILVNNAGMVRGKEQVGDISEDDINVMFSTNVLGLIH
                     LTQIFVRQFKQRNAGMIINLGSIAGREPYAGGAIYCATKHALAAFTGSLLRELVNTPI
                     RVCEVQPGMVETEFSIVRFRGDKDAADAVYKGIQPLVAQDIAEEIVWCASRPAHVNIA
                     QLFVMPVNQATPTLAHRSS"
     gene            complement(383348..385499)
                     /locus_tag="CNB01260"
                     /db_xref="GeneID:3255865"
     mRNA            complement(join(383348..384945,385001..385240,
                     385289..385378,385427..385499))
                     /locus_tag="CNB01260"
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /transcript_id="XM_024656467.1"
                     /db_xref="GeneID:3255865"
     CDS             complement(join(383412..384945,385001..385240,
                     385289..385378,385427..385461))
                     /locus_tag="CNB01260"
                     /codon_start=1
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /protein_id="XP_024512121.1"
                     /db_xref="GeneID:3255865"
                     /translation="MAKIKKRGESGAAKNYVTRNQALKKLQISLSDFRRLCILKGIYP
                     REPLNKKRANKGSSAPASFYYHKDIQYLLHEPLLVKFREHKAFAKKLARAIGRQEWGL
                     AKNLEDAKPVARLDHLVRERYPTFTLALQDLQDPLNLVHLFSTLPTNPIPGKTLVPSE
                     VIAECSRLISEWKLWAIRTHSLRKMFLGIKGVYYECEVPGQGGEPVRVRWLEGFEFQQ
                     HVPHDVDFRILLTFLDLYRTMVGFVLFKLYTDENLVYPPPLDVELDEQGESVGAFKLV
                     ERKAAEGADGKTQVSKKAVRKAIKGIKAAGDDADVDMDEGAKETDEEEDEDFVERPSK
                     AQEVDDVASAPLTTYNSLLATSSTPARQNLLFSPYTFYLSRETSSRTWEFVVRAMGGK
                     VITSLTAPTPADAPNADSITHVIIDRPITVERMREMEAGRKWVWIQPQWVADCVNKQK
                     IISSEGYGPGQLLPPHLSPWDGEGELYRPWLEEQGEKAAEGQEGEEEEEAAEQDEGES
                     EDEEEDGKEEVAAEYPPALLAAAQNPSDASLLHAAELEAETNGVSHSAFRAQLKEATK
                     VHAKKVPASQKEKKGEEDLRKIMMSNKKAKLYEKMQYSNREKAAEKEKLEKKRKAIEK
                     RKAKEAKA"
     gene            385654..389080
                     /locus_tag="CNB01270"
                     /db_xref="GeneID:3255728"
     mRNA            join(385654..385758,385807..385927,385981..386090,
                     386178..386665,386713..386824,386881..387019,
                     387163..387598,387650..387775,387832..387920,
                     387970..389080)
                     /locus_tag="CNB01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656468.1"
                     /db_xref="GeneID:3255728"
     CDS             join(385666..385758,385807..385927,385981..386090,
                     386178..386665,386713..386824,386881..387019,
                     387163..387598,387650..387775,387832..387920,
                     387970..388955)
                     /locus_tag="CNB01270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512203.1"
                     /db_xref="GeneID:3255728"
                     /translation="MARKCPVCGSKKWKRDRITGSAICEDGHVLQDFRSELHVVDGAV
                     NYALTRRRLAKAPRYNKRKMEGRRNQEFFHGSQAEILKLQAFQLLLRHQVHALKKLWN
                     LPDAFEMIVKDLWTYQLLISTLPELPLPQKPEEQESVRPATPPPIPYNHPEFKYVVEE
                     DEEQDSEDEIVQHPDPYQRYPDSEDSEVSKSDNDEEEDESEEGPYVDPEIIKRLEESD
                     KEEEVNQSNMDDKKKGDTRWKRKRRLRVSDTITTLVVALWIIRVPIMGLDIERLISTM
                     AIPFIDFGQTTYIPDEMKKHMNKDVMQALTPSHSPTPIKIHDSCRIFARILKRKYGVQ
                     IPPFNLYPVSWRIISYLGGNPAIHQMTIRLLRLMNINFRLITRQIALVTRPVRGRRLG
                     DNSIPTKNDGKRRRTGSPEKDGRGGKMKGKEKEMLSDNEVDDDDTEEEEEEGEEGRGA
                     RSKEKEKGKEVWETYERTKMMYDELPPEVSVAAAWVIVMKMLYGLDGRPRKAIVSEDP
                     AIGLPQEAPWLKELCERFENGLFKTRDRGPSKKLNFMTMPEDGLDAFLNKSEEILLDH
                     RAPVPDANRFPLPPFKPQQLPIIPPNTWAAHHSSLLMIPHTEISPLTHSSEPLPLMPG
                     EKIRSYSTSDRAGMLPKQYETVLKCAAQSIGWKKSVLGKIVKVFERKLIKVKGIRNKR
                     LRALGAKKRTKLERKKKIEEARMAKSMNIAAKGDGLRAQITSKTRANDKATKKRRTRA
                     TSVASAPSRTPSRRATAPSRATSTASTTRAPSRPLREGRATRTSSRALSTESDPGRAC
                     TTSQTSCDIVAESRLPTLETSGAATTPDIITPVIATPRASKMNSRVRSVSPTSEMPKR
                     PKIMEAPKSARTSRENSRARSGTPSSRPLAVRTRSMTSLAREL"
     gene            389188..393845
                     /locus_tag="CNB01280"
                     /db_xref="GeneID:3255947"
     mRNA            join(389188..389558,389613..390417,390470..391003,
                     391050..391130,391181..392458,392537..392691,
                     392749..393297,393366..393501,393562..393845)
                     /locus_tag="CNB01280"
                     /product="actin cross-linking, putative"
                     /transcript_id="XM_024656469.1"
                     /db_xref="GeneID:3255947"
     CDS             join(389241..389558,389613..390417,390470..391003,
                     391050..391130,391181..392458,392537..392691,
                     392749..393297,393366..393501,393562..393749)
                     /locus_tag="CNB01280"
                     /codon_start=1
                     /product="actin cross-linking, putative"
                     /protein_id="XP_024512122.1"
                     /db_xref="GeneID:3255947"
                     /translation="MAFSRFGASKYRNAVPSIPHREEWYRSALPPASATSTTSSAAST
                     FSSEIKTNREWIVTATQAGDLSYRPYHGDSTSLKVGSGGGVGDWDLSRLEDGLLVVGG
                     LDGAVSAYQLPSASATRDLSHVSTIPQSSSPVTNLILHPTTPNILLVSTIAAPASIYD
                     LSTTQSPSIILDAKEPKGMWSIAWNSDGRLVAGVGKSGMAYIWDPRSGKEPKVSKLLP
                     IQPLKPARIRWIGEDIFLTSFSKTRNRQYSLLSGSSLSTTFTQSLDTNPGVLLPLVDE
                     ERKIIYVAGRGDMTLRQIELSGPQGYQETLHPLQFPLASASLAAVHPAKLDVMKAEIS
                     RILVPIIDKDGDSLLPVSIKVPRRQLIDFHEDLYPDLAGFVPEQTASDWLKGEDKSPL
                     PISLDPSRRGAWESQVENLLKEKTAATPSKKPTDKPAQATVSEAQSSEPGSVPLTLNA
                     SAVPSGTSTQESKPKPSTTVPTPSQMSSQKVPSDSEPAPITEPKPEPTARPNLPSLLD
                     DEDYSSTSYKVRIIADYLADQVAKHKRKGNKGPLMVGLQGPQGCGKTTLTTALVSYLK
                     DGKQLKSAILSTDDLYKTHDALKSVAQQHPDNALLAGRGPPGTHDIALAVETIKKVNS
                     INDSAGSTVDLPVFDKSLCGGEGDRSVDKVVISGPLDVFILEGWSMGFAPLSESELKQ
                     VYDQPKPASSSTSKTYFPDHSLSSLLTLNGYLADFASSIYPSFTSFIQIEPESYDYVF
                     NWRLQQEHNMKAKNGGKGMNDEQVQKFVERYMPGYELWKDGIWSRGAPWIGQGLKLKF
                     GENRELLEMGVPPSQAPATSTSTQANNSSTSSAEMAPEKIVQATSAKVPKPATTAAPV
                     AAAQAQPQASAKPNYTAPQAAPLTERFNPHWSRKFLAAKSPLIPTYDSLPSISSLHQD
                     SQILKVTSHLAFFPIQGTGGRLCVHPLKKKGRVAVGGEGYLTNGVEIVDFDAELGDGK
                     RVAVAGEDGAVRVWKIDEDGVQGVGPQPGQVLHGKNIDKFTQILFHPTARDLLVGVTN
                     DYGQAHIRFWDLSKGEEVKVIDLPAPSVYRLAFSPAGDKVAVGTKDGRLVVFNPRDPE
                     TVSSGKAHDSPRSFQISWIDDNHIVSVGFSRGSQRRILLYRLPTSVGGEITTLSSITI
                     DVSPSVLFPVYDADTSILYVWGKGERVIQAYEVHPEDDREPIAKLPGFTGDSPQIATV
                     FMPKRMVDMKKVEVAKALRLTAKTLEEVSFTIPRNKPDFFQDDIYVPTKNVEITSLTA
                     SEWLDGKDVAQEIIDLKPEGMTLLSLAPKADTTARKKFVPAKNIMSEEEKKKKEMDAL
                     FAKAKMDESSSDEEEIRAGLDPPDDDW"
     gene            394032..394842
                     /locus_tag="CNB01290"
                     /db_xref="GeneID:3255972"
     mRNA            join(394032..394058,394123..394151,394202..394359,
                     394423..394675,394726..394842)
                     /locus_tag="CNB01290"
                     /product="cyclophilin A, putative"
                     /transcript_id="XM_024656470.1"
                     /db_xref="GeneID:3255972"
     CDS             join(394054..394058,394123..394151,394202..394359,
                     394423..394675,394726..394769)
                     /locus_tag="CNB01290"
                     /codon_start=1
                     /product="cyclophilin A, putative"
                     /protein_id="XP_024512123.1"
                     /db_xref="GeneID:3255972"
                     /translation="MSDVYFDIAINSQPAGRITFKLFDDVVPKTVQNFRELCTGQNGF
                     GYAGSGFHRVIPQFMLQGGDFTNHNGTGGKSIYGNKFADENFKLRHDRPFLLSMANAG
                     PNTNGSQFFITTVVTSWLDGKHVVFGEVSSGQDLVRKIESYGSGSGATKAKITIAASG
                     TV"
     gene            395019..397707
                     /locus_tag="CNB01300"
                     /db_xref="GeneID:3256000"
     mRNA            join(395019..395187,395242..395318,395374..395572,
                     395623..395712,395767..396471,396542..396936,
                     397005..397160,397239..397707)
                     /locus_tag="CNB01300"
                     /product="VpsB, putative"
                     /transcript_id="XM_568802.2"
                     /db_xref="GeneID:3256000"
     CDS             join(395098..395187,395242..395318,395374..395572,
                     395623..395712,395767..396471,396542..396936,
                     397005..397160,397239..397587)
                     /locus_tag="CNB01300"
                     /codon_start=1
                     /product="VpsB, putative"
                     /protein_id="XP_568802.1"
                     /db_xref="GeneID:3256000"
                     /translation="MDVTKAIQTYLFKMINQVPGMKVLLLDSHTTPIVSLVTTQSELL
                     SHEIYLVDRIDNNSREALNHLSCIAFLSPSGSSIEAVKTELAKPRYGNYWLFFSNVLS
                     KAQIEEMASVDELEVVKEVQEYFADYLAHYPSHWSITQAALADGGDGPSNPPIYLPLP
                     LHLPPPTLNSHLSTILSVLLSLKKRPVIRWERMSQAGRMLAQAVSGEMNQGKYRDLFE
                     FRGTQGPAPLLLILDRRNDPVTPLLTQWTYQAMVHELFGITNGRVHLDSETKPELRDL
                     ILSPSSDPFYSENLFSNFGDLGASIASYVHSYQSRNAALTGGKSNNRLETVADMKRFV
                     EEYPEFKRLGGNVSKHVTIVGELSKVVERDGLLEVSEVEQSLASQESHAADLKSVMTL
                     LASSRVPSPNKLRLAILYALRYQKSPSAQIPQVVSTLISNGVPPERARLVYAMLNFAG
                     ADIRQDDLFMNENFFSRGKSALKGLKGVENVFTQHTPHLSQTLDLLLKGRLRETSYPF
                     LEGDESARTQRPQDIIIFMLGGTTYEEARAVALLNRKLATDAAGGPGGTRILLGGSTI
                     HNSSSFLDMVEAAAEHFPQDIWQPPMGLSATTSTVPSNSVTPGPSTSGVSLRAGGYEL
                     SVGGTAGSGLYRSNPGEVGASFEIPKIDQVAGGIRDGAGRLWGNMKQRVEERVSRGGT
                     PQGQ"
     gene            complement(397707..400397)
                     /locus_tag="CNB01310"
                     /db_xref="GeneID:3255969"
     mRNA            complement(join(397707..398171,398227..398534,
                     398600..399928,399979..400033,400087..400107,
                     400161..400275,400328..400397))
                     /locus_tag="CNB01310"
                     /product="NADH-ubiquinone oxidoreductase, putative"
                     /transcript_id="XM_568803.2"
                     /db_xref="GeneID:3255969"
     CDS             complement(join(397841..398171,398227..398534,
                     398600..399928,399979..400033,400087..400107,
                     400161..400275,400328..400382))
                     /locus_tag="CNB01310"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase, putative"
                     /protein_id="XP_568803.2"
                     /db_xref="GeneID:3255969"
                     /translation="MLPRLAARHISRQVAGPSRARLFSTTIPKRADVTLTIDGKEVSV
                     PAGTALIQACEKAGATVPRFCYHDRLAIAGNCRMCLVEVERSPKPVASCAMPVMPGSK
                     VFTNTPLVHKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMRYGSDRGRFHEITGK
                     RAVENKDLGPIVKTSMNRCIQCTRCVRFANDVAGVEDFGTTGRGNDLQIGMYIEKTMD
                     SEMSGNIIDLCPVGALTSKPYAFQARPWELKKTESVDVLDAVGANIRIDSRGIEVMRI
                     QPKINDEINEEWISDKTRYAYDGLKYQRLTTPLVREGNRFVPAGWEQALETIRHGLIN
                     SGAKGDEIKAVAGHLADTEALVALKDLMNRLGSENLALDQKLGDLPSVANVDIRSNYL
                     FNTGIENVEDADAVLFIGTNPRHEAATINSRFRKSFLYRGADFAVIGEKFDSIFEYDH
                     LGTSAKDVAAFFGGKDAGSFSKMWKDAKKPLIVVGSAVLETKDGAAVLAEVSKHVLAN
                     SDKFLTPEWTGYSVLQRAVSRAAAYDIGFTPSASASSTKPKFVYLLNADEIDPASIPE
                     DAFVVYQGHHGDFGAQFADVCLPAAAYTEKSMTWINTEGRSQLGRTAVPPPGASREDW
                     KIVRALSEIVGQPLPYDTVHDLRLRLHSISPSLVRYDEIERPSPEVIKLGLEALSKST
                     VKPSAEPLKKPIQDFYRTDPISRASVTMASCSKAFTRKDYHISNVDESGAQASYA"
     gene            complement(<400609..>401136)
                     /locus_tag="CNB01320"
                     /db_xref="GeneID:3255848"
     mRNA            complement(<400609..>401136)
                     /locus_tag="CNB01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_568804.1"
                     /db_xref="GeneID:3255848"
     CDS             complement(400609..401136)
                     /locus_tag="CNB01320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568804.1"
                     /db_xref="GeneID:3255848"
                     /translation="MYPTRSAPRPPRETASLPPNHPFATSLKPFGYHANSSTSSLHSS
                     SYHRAGTYPSSRSRAPTSHAASLARPPPPSRIPPPCRAIDDFGCFSQPHGAYPRSTKP
                     TTESIPRTYTTLPVELSLFDPRPRQTLLQDVEFILGKKLRFPFMEKCTSSDKKAKSKG
                     EKGKKGRGVREGNWI"
     gene            complement(401570..402937)
                     /locus_tag="CNB01330"
                     /db_xref="GeneID:3255901"
     mRNA            complement(join(401570..401901,401973..402135,
                     402202..402272,402332..402396,402468..402495,
                     402573..402579,402639..402937))
                     /locus_tag="CNB01330"
                     /product="expressed protein"
                     /transcript_id="XM_568805.2"
                     /db_xref="GeneID:3255901"
     CDS             complement(join(401663..401901,401973..402135,
                     402202..402272,402332..402396,402468..402495,
                     402573..402579,402639..402812))
                     /locus_tag="CNB01330"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568805.1"
                     /db_xref="GeneID:3255901"
                     /translation="MSAGTQSQGPRPVRTTASAPQTPYLGRLFFHVGTAAVMASGFHA
                     MRSATTFGDFIEPQYGGFYQFLTILGLICSSIAMLFSGASDLLPNIALIKLIKRVFLL
                     VSLPVELVISSIYWSIILTAPHLMLPPTSPDAVQGEPSSSGTGPSLFRIPLWMDLSMH
                     LVPAVALLIDFFLLEKKYPKPFSTYVALFLAAAFGTSYGIWVEHCASINGVFPYPFLT
                     IMELKGRVLTYIGATLGAWGVFRGLNGMHK"
     gene            403142..404604
                     /locus_tag="CNB01340"
                     /db_xref="GeneID:3255910"
     mRNA            join(403142..403478,403539..403620,403680..403751,
                     403805..404604)
                     /locus_tag="CNB01340"
                     /product="expressed protein"
                     /transcript_id="XM_568806.2"
                     /db_xref="GeneID:3255910"
     CDS             join(403245..403478,403539..403620,403680..403751,
                     403805..403860)
                     /locus_tag="CNB01340"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568806.1"
                     /db_xref="GeneID:3255910"
                     /translation="MINISYYTLPLVHLQTLGASIRFATRRLGFRNNVNPRQVLDDME
                     KSGKVKPKTLEKLRRRQAAHENCFENEAIFIGAVIAGNQVGLSTKYMNIMSVSYFLLR
                     CIYIWMYINFADQKKSYWRTIVYWTSNFCFLTTFVKCGLKLNAGD"
     gene            complement(403890..407055)
                     /locus_tag="CNB01350"
                     /db_xref="GeneID:3255863"
     mRNA            complement(join(403890..405961,406017..406240,
                     406293..406408,406457..406578,406627..406742,
                     406796..406902,406962..407055))
                     /locus_tag="CNB01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656471.1"
                     /db_xref="GeneID:3255863"
     CDS             complement(join(403989..405961,406017..406240,
                     406293..406408,406457..406578,406627..406742,
                     406796..406902,406962..406985))
                     /locus_tag="CNB01350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512124.1"
                     /db_xref="GeneID:3255863"
                     /translation="MGVSGLWDLLRPSAASVTLHTLSKEAFLENKNGLRALTVGIDAS
                     IWIFHAAVPQHGENPFLRTIFFKITALLQHPVLPVFVFDGPNKPAMKRNQKVGGKFGT
                     HDYRSKQFKALLDTCGLEWWNAPGEAEAELAVMNRQGKIDAILSDDGDALLFGAKCLI
                     RNSSPTLSGSLASSTKNNPSAGSKRDYDVYTLSRICGEWAKEQDTELTSEESCTMAMV
                     WIALLSGGDYTPEGLYSIGHKISYGLAKAGLSDYLKEYCRDKQAFLKSLPGLHARMVE
                     ELRTNSSKQQDKRYPDRSNKLSAMSPSQLFPTSTLDAYLSPCTSPLDDPSQGWPGFGQ
                     GSCSMARGKARSEGRGDMEGMAAACEKYFEWGTKDLVCKKFAGESVGIFGAEIMNAAR
                     EAVRARDSLGLGVGIGPEKTPSRITSFFQQSVPSPISSKSTGASQFPNPATQLRDTVP
                     PHIVQIHSERTSKDGTEKDYRISFHQDVYVERCRNAMLGIRVDPSELPQEEKNRLGLA
                     DHADKDNDDKVSATQTASKSEIRVWLPQYLVREAWPELVKAYDDKLAAKTASKLKTPK
                     KDVQPLKTNAAGKAKRGRGKKALEADGEDVNAFTSFFSQRPKESTLDAFEEEEEQIEP
                     TPPQSKATQEVIDLSLSPSPSPPASPTQKSSNNAEKKKLARPALNTSTSSTPSGGEKG
                     EGSSRTARRARKKIHKSTSPLKTITDLSKSSPSPEQSTATPTITPRFSSRTFRKTISS
                     PSAFPPRRVQAQEVIDLCSSSEEDTAPAKPIHRRQAARSPKISSPPSGILSSSTKINT
                     QSSRSSRSTSVSFPACPLNKPSSRSPRESSILSHPLLSGSSQSSSLSPPPPTPPNTQR
                     ATSPKKTKVSSPARRRPKYKIISSTKDGEVIDCTMRR"
     gene            407210..409462
                     /locus_tag="CNB01360"
                     /db_xref="GeneID:3255978"
     mRNA            join(407210..407352,407406..407583,407637..408182,
                     408240..408524,408576..409462)
                     /locus_tag="CNB01360"
                     /product="expressed protein"
                     /transcript_id="XM_568808.2"
                     /db_xref="GeneID:3255978"
     CDS             join(407247..407352,407406..407583,407637..408182,
                     408240..408524,408576..408744)
                     /locus_tag="CNB01360"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568808.1"
                     /db_xref="GeneID:3255978"
                     /translation="MASSQKKPQKRKSAAADSLVHVSVGDSSRGSGPAFVNFPSVKPS
                     KKIPFTMYTRDAATTADLTKQHTLIAGETEDVEFFSTNRDRSNNPEGVDCQYLPAVYD
                     PSTRTVHVHPSAPLYLVAHRAKRLRTVPLTVPPDQAAKAQWRTQRNDLGETFGTRKAK
                     AQIKSEEKNRVDAGAMKDVKGHLMESIGELEEENDSVAPSEFIPNPNTDTADPTEVYT
                     RESIITTQEWAAIDASRLLAIEDDKERASALPYKRSSWLQYKSRAVANIKDKTARKTQ
                     MKYLYYLSCLLTLLDFSPRLSKTPVHKLAPAFPQVPRQIIDGMLSRFAEPNGLKHNVT
                     EKTKTKLLVWICLLYLILEGYSVEVAKVAKELKMEPAKVATLYKQLGCNVKLASPAER
                     EAQGITLAQANAARRAVLVAPVRFPKLKRRGPVKR"
     gene            complement(408803..410866)
                     /locus_tag="CNB01365"
                     /db_xref="GeneID:36392726"
     mRNA            complement(join(408803..409595,409656..409750,
                     409801..410866))
                     /locus_tag="CNB01365"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658931.1"
                     /db_xref="GeneID:36392726"
     CDS             complement(join(408881..409595,409656..409750,
                     409801..410175))
                     /locus_tag="CNB01365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514203.1"
                     /db_xref="GeneID:36392726"
                     /translation="MSPLTPESIKSRFTTPPYDRDPSPAPTSASNTQPTNDPIDSCYP
                     HPVRSRARSASLFLDSRQLPNPRSTAGFNLKKQGHSLSSTSIFHLDKDISAKTSSPVS
                     FRQHKESFTRAESRESATTEVCRIPIQSVNPQYQIYRSPTPDQNPHNNRLDRPSQYVF
                     GPRLKLYPFVLPPNLWDGPIPEEVVDSDQKIQQASRPMVSLSLSALNLSDKTHSTSFP
                     SQLLGGPCTSVTPRIIQNPHFSDPRVGKHLIPPALLNRPSNESLHLSNLVPYPDEPSE
                     MGQLVWLDAETAYHLRKGGCITVRNYQGKMRSCYSVEAEDAAMRRDAAILQMSSIPTP
                     SMMARIKGRAHARTALAKNVSNQDAGRRVQVARALKSRGQRTQRGPTGPRTRSSTVKE
                     RA"
     gene            411077..412152
                     /locus_tag="CNB01370"
                     /db_xref="GeneID:3255880"
     mRNA            join(411077..411234,411295..411392,411443..411519,
                     411572..411665,411720..411872,411940..412014,
                     412065..412152)
                     /locus_tag="CNB01370"
                     /product="DNA-directed RNA polymerase, putative"
                     /transcript_id="XM_024656472.1"
                     /db_xref="GeneID:3255880"
     CDS             join(411148..411234,411295..411392,411443..411519,
                     411572..411665,411720..411831)
                     /locus_tag="CNB01370"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase, putative"
                     /protein_id="XP_024512125.1"
                     /db_xref="GeneID:3255880"
                     /translation="MSQPISKLDNPSTLLQSVSSNAVHEKITILPGHEPDYSACTFAL
                     WQEDHTLGNALRWIIMKDPEVEFCGYTAPHPSEPKIHLRIQMYENQSAVDCLRRALSN
                     LRDLLNAVNDSYTSSLQNDDYVREDDYDVKAAVDETLKERGFAVEEDDRMDVS"
     gene            complement(412099..415458)
                     /locus_tag="CNB01380"
                     /db_xref="GeneID:3255939"
     mRNA            complement(join(412099..412231,412273..412337,
                     412385..412729,412784..413065,413113..413342,
                     413395..413512,413567..413694,413755..414453,
                     414504..414561,414616..414694,414749..414838,
                     414896..415048,415101..415152,415202..415458))
                     /locus_tag="CNB01380"
                     /product="damaged DNA binding protein, putative"
                     /transcript_id="XM_024656473.1"
                     /db_xref="GeneID:3255939"
     CDS             complement(join(412155..412231,412273..412337,
                     412385..412729,412784..413065,413113..413342,
                     413395..413512,413567..413694,413755..414453,
                     414504..414561,414616..414694,414749..414838,
                     414896..415048,415101..415152,415202..415351))
                     /locus_tag="CNB01380"
                     /codon_start=1
                     /product="damaged DNA binding protein, putative"
                     /protein_id="XP_024512126.1"
                     /db_xref="GeneID:3255939"
                     /translation="MSDRAGFTLSIFAIDVSPPMGELKADPSGSGKVSKLSLAKEYVA
                     RQIQSKILSGRKTEVIGLVSFGGRTNNQAYNSGLEEGMENELYRAVSSDVACQTAKAK
                     ALEVLMNLEEGKHAGNPVSALMVGLDMIQSWKVTKQWSVDLTLITDGETAFEQDEYEE
                     AIDRLEQLQVILRVLGIDFQPISQAVDKSKSRNKRLSEKFWRVFTSTLQGRLEQSSNP
                     RLYPALKVFDDSLEAARSPQVATVNSTLSGIDLHIGSLDVGRDEAIVIPVRYSKATAK
                     ASAPTFSKAWKPAMDLQMPMRSTADGISLSNPLISGLLNQSQSQGKNPPSTEEMAGMI
                     SAEVKQHHSYVIKKPEINASGNRISTQASGLEPSEQVDENENEEEDDEEYVDKEDVVK
                     AWKFGSTWVPVPEKTFTTLDTSKGIEVLGFFPVENIRRYHLIGEARYVWPDLLSPKAQ
                     IQFSALVEAMHDRKMCAVTRWVLKDRGEPTMGACVPVIENKGPDEEGKPSILPYMYWL
                     KLPFAEDERTFRFPSLTTIKTNTGKILTEHPLLPTKEQSLLMDELVLGMDLDEYAREG
                     KRKTQENEEQDVDEQMDEQGQDVTWFKPWEAVNPVIHRIKEAVFHASLTPDLDKDPLG
                     PPHPELTKYFETPSELAEKVKDVTERLKEVLDIKKVPEKRKRRKAQKEELGEDEGFIN
                     EDELFAEPTETKPTTKTELQTQTSSQPTTAAPIQDQSKPKPGRLISNGSPIDDFNRVI
                     QVGDVFRKAIQDMNEVVKENVESSFSRQNFAGAIDCLKLMRSTALGYEEVETYNNCID
                     SLEQTVKARGFKHPDFWDYFKSAGKSVSKISEEEAEAAMEDFE"
     STS             414133..415382
                     /standard_name="Fgf8"
                     /db_xref="UniSTS:506892"
     gene            415651..419623
                     /locus_tag="CNB01390"
                     /db_xref="GeneID:3255997"
     mRNA            join(415651..415777,415843..415993,416040..416344,
                     416395..416539,416592..416629,416680..416843,
                     416896..417162,417213..417437,417489..417660,
                     417718..417986,418058..418739,418792..418848,
                     418941..419623)
                     /locus_tag="CNB01390"
                     /product="heterokaryon incompatibility protein HET-C,
                     putative"
                     /transcript_id="XM_568811.2"
                     /db_xref="GeneID:3255997"
     CDS             join(415696..415777,415843..415993,416040..416344,
                     416395..416539,416592..416629,416680..416843,
                     416896..417162,417213..417437,417489..417660,
                     417718..417986,418058..418609)
                     /locus_tag="CNB01390"
                     /codon_start=1
                     /product="heterokaryon incompatibility protein HET-C,
                     putative"
                     /protein_id="XP_568811.1"
                     /db_xref="GeneID:3255997"
                     /translation="MAKTALLLLLVALVTLSFTPGVYAFGAGNIPSFSYLEEKAFRHG
                     DIEDIIANLFKAAGGGFLSRGTKFTPLDVKRVYFGNWLRDYSQAVDVGSLKKTNLQTI
                     INIVMVLGFMAHGYATGEFEVTKDRLGCYLPTEHIDNPKGYADGEDARQYDSRLRGPV
                     DPRELEIDPRTGMKNYIANENGGWATSKALVRQRLQECIHYGRQYRSNNNKSDLYEAF
                     QLLGRALHTLEDFTAHSNWCELALISFGYTNVFPHIGQNVKVRAPNGRDVYPLVTGTF
                     GGADFIHSLMGEATDHLSQASVSDLSKQMTNARSVSEGQSSSADTLRQLFFSIPGGEG
                     DSMTRDLEGIQNMRAGQPGGVDPSTMSPQELHQTIWQILSFRDSVMKKIENTIDRIPG
                     LSGLVEKISNSVSVFIITTLEPFVKPLLGTATEALGQSSQAVIDSHDQYEVWNDRNAS
                     DPTHSFLSKDHFGLLLNQPAGEIARIVVEHTVNLVVKAWDDNNINPSQVTETALEALF
                     HPDFASGHSQIQKQMLDKMREWINSTGSNKNEILHRLTSDMVKQGKNRRIGDTSATTG
                     HVHNQLLPEGGLQQVIAQQNVHVPGASVLNAGQDLMSGKMPWDQGFGSGGAHAWRDVD
                     PSNPSAPSGGYNAPTNYNSQPSYNSQPSHTYEQSYSGQPTYTTHSQASYGAPTMPQSY
                     QSPSPQNHNSQPSYGNQGDGSGYPGQQYRHDRPGHHQPPHHGGYGAPPQGEYGTPYGG
                     PHGGPPHGGPHQSHGGSPQPPYGQQPPYGGQSQNQWAQRPSYQGPPGGW"
     gene            complement(418616..420365)
                     /locus_tag="CNB01400"
                     /db_xref="GeneID:3255852"
     mRNA            complement(join(418616..418766,418829..419193,
                     419248..420365))
                     /locus_tag="CNB01400"
                     /product="expressed protein"
                     /transcript_id="XM_024656474.1"
                     /db_xref="GeneID:3255852"
     CDS             complement(419269..420288)
                     /locus_tag="CNB01400"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512127.1"
                     /db_xref="GeneID:3255852"
                     /translation="MADIKHIADLVGIKDQETLHEFADTIQAFLRSHNLPALPDVSSS
                     KTLSLERLSPVHYLILEHLSYLAPAKYLVLSRYHYKRLIPSIYRHVTINTNILDACEE
                     NYGRMFQLLGHIETLKFSDLTALKNICSLKDDWLYSRLFHNTKRIEIDTQMLRVYNND
                     YNLGPSGSLSVTLGDKFEELVFRFTQVPKKTFRLPRQAFDNILGRQPDIVTLIFAIPY
                     KHCNSWSTLLEYVPDYLEGCEPGKSCKVVFDIPKGKRKDLRGNVTMTVARHIMRHLRS
                     QGARQVGWKIEYHVTAAEEFGAVIWQVLTEMMPNDAALGDFLGERCEFVELDREKFQF
                     KRGVL"
     gene            422198..>423985
                     /locus_tag="CNB01410"
                     /db_xref="GeneID:3255727"
     mRNA            join(422198..422402,422459..422485,422557..422660,
                     422717..422814,422862..422886,422943..423061,
                     423125..423224,423275..423882,423934..>423985)
                     /locus_tag="CNB01410"
                     /product="expressed protein"
                     /transcript_id="XM_568813.1"
                     /db_xref="GeneID:3255727"
     CDS             join(422396..422402,422459..422485,422557..422660,
                     422717..422814,422862..422886,422943..423061,
                     423125..423224,423275..423882,423934..423985)
                     /locus_tag="CNB01410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568813.1"
                     /db_xref="GeneID:3255727"
                     /translation="MAGLHHANVTKGMMMLLGVSTLAASLLDIKPYLHLQFVPHMTKY
                     HQYWRILTHPFAFANSAELLMGEVLLYGAGVHTERAFGSRKYASFILISSVVSTIMAC
                     AVIVLLHPFGIRSIPGGPYGIIFSILWQRYRMVPPLYQFNLFGIHISQKCFQWIFALQ
                     LMLSVPPSSILISLCGLLSGYIYRTDVMFPIPSFSPRSRRFFVRQPLKTYRIPLSIYN
                     LFGRLFSPFMGVSTAPRGSDRVLPGQINERRGLLAGLPTGTAAVGGAGGGAGGTPRPS
                     LRSLLAGRIAAESRIQTPRPNAANGREEEDGEGEGEPGSTRAAMGEWVSGMTGRSGAR
                     APTEDEIGTLSAMFPNLGRETIVRALQRNDYNTAQAVEALLQQSE"
     gene            complement(425069..427049)
                     /locus_tag="CNB01420"
                     /db_xref="GeneID:3255656"
     mRNA            complement(join(425069..425240,425302..426156,
                     426209..426341,426392..426874,426920..427049))
                     /locus_tag="CNB01420"
                     /product="Eukaryotic translation initiation factor 3
                     subunit 7, putative"
                     /transcript_id="XM_568814.2"
                     /db_xref="GeneID:3255656"
     CDS             complement(join(425157..425240,425302..426156,
                     426209..426341,426392..426874,426920..427008))
                     /locus_tag="CNB01420"
                     /codon_start=1
                     /product="Eukaryotic translation initiation factor 3
                     subunit 7, putative"
                     /protein_id="XP_568814.1"
                     /db_xref="GeneID:3255656"
                     /translation="MANFVLPPIHDNSDGSWGPSTSTLPAQFKDIPYAPFSKSDKITR
                     IADWHDPQAEAAAGTRTARTVQSGGRRTAYGAAEGTVFGFVHDEDEKSFSLVDSGVRV
                     GARGKAPIRGRSVRGVASARGARGRGGQRGGFSTRGGRGGARGGYGDWNKPQRTRDSS
                     VTIGPEWEVLEEIDFNRLSKLSLSVEDPEDLASYGTVQAYDKTFDRINTRNEKPLEIV
                     NRVRYNPSTSDDPIISQYAEKKEAQIFATDSILAVLMCAGRSVNSWDIIIEHRNGQVF
                     FDKRESGPLDYITVNENAADPPVDSDDVSNINSAGSLSLEATYISHNFSSQVSANSKS
                     KAYTPNPNPFYSPEVESEPPASTLYKYRKFDLSIDEEEQFSVILRTEADAYLGKKEVL
                     VTVKALNEYDPRVQGGSGKPLDWRKNLDTQKGAILASEMKNNSAKFARWAIQSILAGV
                     EQMKMGYISRANPRDAQRHTIVGVQSFKPLDFARQMNVSLANGWGIVRTIADLVLKQP
                     EGKFVLVKDPNNPLVRLYKVPDDTFEAGAEEEEEEQDEE"
     gene            431544..434016
                     /locus_tag="CNB01440"
                     /db_xref="GeneID:3255927"
     mRNA            join(431544..431988,432034..432149,432199..432384,
                     432439..432526,432576..432659,432710..432755,
                     432809..432946,433001..433150,433209..433321,
                     433375..433590,433646..433762,433848..433895,
                     433954..434016)
                     /locus_tag="CNB01440"
                     /product="CAP64 gene product - related"
                     /transcript_id="XM_024656475.1"
                     /db_xref="GeneID:3255927"
     CDS             join(431726..431988,432034..432149,432199..432384,
                     432439..432526,432576..432659,432710..432755,
                     432809..432946,433001..433150,433209..433321,
                     433375..433590,433646..433762,433848..433854)
                     /locus_tag="CNB01440"
                     /codon_start=1
                     /product="CAP64 gene product - related"
                     /protein_id="XP_024512128.1"
                     /db_xref="GeneID:3255927"
                     /translation="MLVNSSSMLVTRSKVRIYLGISVMLNIIVLITLFLPTDKAHGLM
                     GDEAWKELAKYGLTRWSDDGAFLTVPARGCSMCEVDPVLCEEIGEDNLKRSLAFSGTN
                     RRLKRVLAKLRRGETINVGAIGGSVTKGYGLNRYNEPYYPDTPTNLHRIIFDHLVSLY
                     PAPNGVKTDDSGRKEGKHGYINGGQGATGTGYFSYCWEEHVPADLDLIFLEQAINDEL
                     LLRNIDSYELLVRSLLDLPTSPAIVNLHVFALMFNSITLGGDLHQSIAQFYDLPVLSL
                     RNALLNDMLKNESLISEYFFVHPEGDIDLRHISRKGHNVMGRIGAAYMDSQICEMDKY
                     EQGIPGADSMSIDQLYPVEPIPRMQINMKYDKDLVLPTIKPQCFSANSEKHPLVPVEN
                     NGWRKWNWKEKHYLVADVPGSRVSFKLKTNMGKIEVQYLRSYQYHQGSAKCWVDEEVE
                     KAIKLDGYWKEPYNIGRAVTIREGLEPGEHTLTCELLKQTADPEGGLEFRLISIMSI"
     gene            434441..438342
                     /locus_tag="CNB01450"
                     /db_xref="GeneID:3255660"
     mRNA            join(434441..434799,434854..435179,435235..436306,
                     436356..436549,436749..436784,436983..437966,
                     438018..438342)
                     /locus_tag="CNB01450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568819.2"
                     /db_xref="GeneID:3255660"
     CDS             join(434450..434799,434854..435179,435235..436306,
                     436356..436549,436749..436784,436983..437966,
                     438018..438283)
                     /locus_tag="CNB01450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568819.1"
                     /db_xref="GeneID:3255660"
                     /translation="MAENSQIKPRPVRHRHRNRIATEGDVSSSRSKGKERAVDVNGDV
                     TLVDGAKAGKKRRKRQAPNGLPSLPTDDSVGGQGESSTCRAPRRRDDSEHWDHIPVAQ
                     NEFTRVPPVWSKDGRFYFSVVHTSIHIHSSTSPSFPRLSTLSSTHPRGHSKPITSLQL
                     SPINPFQIVSSSLDGTIKIWDWVAGRLIRTIDFHEPQSKVDHVAFGQVVGKWWLFAAV
                     THAKQSNSGQKLAYRLLRTPLGGNSNPILLGKLSNRPVSLIMSPRSTYLVALAANKAY
                     TYRMPTPPFKSSDPWEDRPTCVKFVSDQPFTCGAFCPEKTLATATEEDWFATGDQKGV
                     IRLWHGLTQAFRQVDAAASLALGGVVGSNQGPETEKRLPTTSLHWHAHAVSAIAFTPS
                     GSQLLSVGEESVLVQWHLASGRREYIPRLGGRPIVSLAVRKATAAGEEEWWMALADGS
                     VVRVGASSNRVASVGQGIRLDPLRPSSSDTPYPLSVHPSTGSLVVPSSHPSTIQFIDP
                     IASTVLFDLEVVPSNRVSRREEKEHEPVKVEKVAFSDEQDGKSIWMATMEGREGDEGE
                     GGGRVKNLKMWKWMDDRYLVNTQFPRPHGTSDISSVTFSPTPSAPGTSSNPVSTPDPY
                     LLTTSTDGVAKIWHVRQSGKSEQGKVSAKKPIIVELYWSCRSTFNYRNLPIRASAFSP
                     DVSILALSHGSVVTLWDVSSNILLKVLDNGLISDIMTIGFIGKEGRWLVGTGKGRGVA
                     VWDLLSCEVAWSSPSLAADNLITSSTASYFISASNAPSSTTLRVFAPDSPAPLRTISI
                     DTKVTQIVSLSQSSASESSSSLHFIGIAPSGEIYRFGDIAAALVPESANSVRQAQAKE
                     GLSIWQEMFGKGAFLEEPETEEPITATASALQQRVSDKSGRPADIFEGPSHTMPPTGL
                     LFDAFMDELLHGNTAAKDERKVKEVTRDEAVVYEMEVDDSGAEETSAGEIKGRAVEDG
                     EIRELEAFFKDLLSSIPRAPLTPASRKPDTLRNRLPSHLTNHTPARSVATPLQSRKAN
                     GDASRGRASLLAGGNHVDESDIGTPGSVTASGNKKGKKRKAPREE"
     gene            complement(438283..439647)
                     /locus_tag="CNB01460"
                     /db_xref="GeneID:3255591"
     mRNA            complement(join(438283..438343,438404..438593,
                     438663..438761,438817..438893,438951..439054,
                     439109..439298,439356..439647))
                     /locus_tag="CNB01460"
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]imidazole-4-
                     carboxamide isomerase, putative"
                     /transcript_id="XM_568820.2"
                     /db_xref="GeneID:3255591"
     CDS             complement(join(438304..438343,438404..438593,
                     438663..438761,438817..438893,438951..439054,
                     439109..439298,439356..439486))
                     /locus_tag="CNB01460"
                     /codon_start=1
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]imidazole-4-
                     carboxamide isomerase, putative"
                     /protein_id="XP_568820.1"
                     /db_xref="GeneID:3255591"
                     /translation="MSRRHSQFRPCIDLHQGVVKQIVGGTLDLTSQSGAGPTENFVAT
                     HPPSYFADLYKTNDLVGGHIIKLGPGNDEAAKEAVSAWRNGMQVGGGITETNAQEWLN
                     NGASKVIVTSYLFPNGKFDEDRLKRLANQAGKDKLVVDISCRKRENGWVVAMNGWKTL
                     TDMAVTKESIQLVERYCSELLIHAADVEGLCQGIDEELVTRLGEWVSIPCTYAGGAKD
                     ISDLALVDRLSNGKVDLTFGSSLDIFGGKGVKFTDLVKADKEAKEHLKCTTCIDSDTC
                     "
     gene            439744..440921
                     /locus_tag="CNB01470"
                     /db_xref="GeneID:3255742"
     mRNA            join(439744..440206,440267..440547,440599..440921)
                     /locus_tag="CNB01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656476.1"
                     /db_xref="GeneID:3255742"
     CDS             join(439785..440206,440267..440547,440599..440810)
                     /locus_tag="CNB01470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512129.1"
                     /db_xref="GeneID:3255742"
                     /translation="MERTAILALRSTLNPSNTLRSRPTLCFLQLSSRRASTTSTPRPP
                     TTTGSHPALQRRGPTLQPRLPSATNWPWRQIPSSSPDVTVLERTVFARPSDFSPPLLL
                     FAAGVWGLFVISWYALPDPPKRELTEEEKVKIEAEYAGAGFWLQLGNRVSGSVYSSAQ
                     PILMGGVSLILAGFLIASSTIATRITMVQMRPVNGSGEGKRFLKLTTVAHEMVKGMVK
                     PREIRMEDCSVYFPSAERATTVRLRVLKPDGRPFKYTLDRFPYNLDFREIKEDYKVVD
                     KEIVLSIPRLQQTFGAILKGKPDYAKAA"
     gene            441514..447527
                     /locus_tag="CNB01480"
                     /db_xref="GeneID:3255812"
     mRNA            join(441514..441707,441755..442117,442173..442585,
                     442639..442864,442914..443157,443208..443403,
                     443452..443528,443577..443891,443939..444122,
                     444175..444704,444761..444897,444948..445085,
                     445139..445238,445295..445422,445482..446045,
                     446098..446266,446317..446343,446395..446504,
                     446555..446788,446845..446893,446942..447116,
                     447167..447192,447244..447527)
                     /locus_tag="CNB01480"
                     /product="UDP-glucose:glycoprotein glucosyltransferase,
                     putative"
                     /transcript_id="XM_024656477.1"
                     /db_xref="GeneID:3255812"
     CDS             join(441586..441707,441755..442117,442173..442585,
                     442639..442864,442914..443157,443208..443403,
                     443452..443528,443577..443891,443939..444122,
                     444175..444704,444761..444897,444948..445085,
                     445139..445238,445295..445422,445482..446045,
                     446098..446266,446317..446343,446395..446504,
                     446555..446788,446845..446893,446942..447116,
                     447167..447192,447244..447465)
                     /locus_tag="CNB01480"
                     /codon_start=1
                     /product="UDP-glucose:glycoprotein glucosyltransferase,
                     putative"
                     /protein_id="XP_024512130.1"
                     /db_xref="GeneID:3255812"
                     /translation="MRANTVALALAASALAASASPPVRVSLETSWAAPPLVLEILETV
                     YDEYPSSYFPLLHLLSSLPADSTDESILSSTLDLIQAYSLLPSPSSLSTFHLALSLHS
                     TAPRIEAEYNWYNSAVKGQESKLGVEGCEGWVEWRGKGFCDVDGLKRDMELSIEEGTH
                     KINQKPLSLPFDHTSPSVSSTSSSPRAIFYYAPFASTSNELLGYLDHHASQYPEFTYT
                     VRYQPPLSDEAKKPLSLSGWGAEMALKKMDYLVVDDRATGETTFRDESDEVARNESNI
                     FAHVFGDDPWGDQATHLTAAEIRDIGLKAATLIMSSDDPISALIHLSQDFPKYSAALA
                     RQVEVPEDIQSKGRTIAVRGNAKEAIYINGKPFDRDLNPYTLLKALRDERQLTVSLTS
                     LGLTPKQSIDILGDPVVGQGQIEDDMGEGLVDASDRIEGGDVIVYWNDIEKDKRYQNW
                     PIHPQGYMRPLYHGQFHTVRRNTFNLIFALDLSRISSLELIVHSISAMIQRGLPIRFG
                     IVPVFEPEQQDDISFQMAKVFWYSVKTFGRSSTRDFLAAIIDATPRQLNNPAPQVNDD
                     VLRKGYEALSATSKKASLAFDDVLTSEDWDRHVEKTGNYLKRLLITKKDAENGGMFMN
                     GRFTPNAPAWPNIVTQEMQSQLAFIQGQVMLDAIPEDISTMFYDLPSTSKRRSSLVIP
                     VGDNKLKVFNLVDLFKNEGIEGKLSGEFVYPDGERGTPISMWIIGDLDSPEGLETVKN
                     GLQHLQTSQCASRLGFIHVPPARSHSSCPAGQYCFSTVLYQILSQNALSLTKPSDLLE
                     LISDVQHSIKTNLEKAGEIEVGNQGVDDCGTTFTLSPEDQQKYFEAKPLHGMTFGGWA
                     AGDIAAASEFWKAGTQISGKLGITDGVHLLANGRLVGPITPVTFPLDDFEALEVYEHR
                     KRVKPIIDILKTMYDDIAAFDRPTLANLISKVSSVVTSAYKPLDGEGIFAPTQLTRTR
                     YYERLDDGSMSFKLGDEDMSLLKVAIVVNPLSEQAQKWSPLIQTLSEMEHVFVSVYLE
                     PEALMEEVKLKRFYRTSVPSRLTFDVDGAAIAPGLTFNSLPSNPIYTLGLDTPPSWIV
                     SPRTSPYDLDNLLLSSISSPVSVTFQLKQLLIEGHAREAGNIPPRGLQLQLKTLGGDI
                     AADTQVMANLGYLQFRATPGYYTLSIRPGRGEEVFNLESIGAEGWDSPSVEEVGEGVD
                     LGSFDGQTIYPRFARKEGMEKADVLQESVAAPEGLAKQVYSKMKSIVGLSTKATPAKT
                     EHADINIFTVASGLLYERFASIMILSVMKHTNSSVKFWFIENFLSPTFIAFIPKLAEE
                     YGFQYEFVTYKWPHWLRAQTEKQRIIWAYKILFLDVLFPMSLDKVIFVDADQIVRTDM
                     KELMDVDLHGRVYGYAPMGNSRKEMEGFRFWKSGYWKEALRGRPYHISALYVVDLKKF
                     RQLATGDRLRGQYHALSADPNSLANLDQDLPNSMQDQIPIWTLDQDWLWCQTWCSDES
                     LATAKTIDLCQNPLTKEPKLVRARQIPEWDVYDQEIAAFGARVSEEGEESGALAISVD
                     DLASEGYVSGVEGKEEETEREAEGRIGDEL"
     gene            complement(444768..447445)
                     /locus_tag="CNB01490"
                     /pseudo
                     /db_xref="GeneID:3255754"
     gene            447646..448859
                     /locus_tag="CNB01500"
                     /db_xref="GeneID:3255717"
     mRNA            join(447646..447843,447898..448159,448216..448490,
                     448557..448755,448826..448859)
                     /locus_tag="CNB01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658940.1"
                     /db_xref="GeneID:3255717"
     mRNA            join(447646..447831,447898..448159,448216..448490,
                     448557..448755,448826..448859)
                     /locus_tag="CNB01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656478.1"
                     /db_xref="GeneID:3255717"
     CDS             join(447684..447843,447898..448159,448216..448490,
                     448557..448738)
                     /locus_tag="CNB01500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514204.1"
                     /db_xref="GeneID:3255717"
                     /translation="MFGQAVIRFYRRECFITGSNGKTTLRQGTLQKAFHFASKRAAKV
                     PTAPRGERSCPPAPPSNTRSTVALTSPWPWRPITPSSRLPAHTILEERVIYARPLSFS
                     PRRHLFLGCTLAGCGVMFWMMPDKPRMADWFSEDVGLFRRILGTINNYLFLDLPPFLA
                     LAGTTLVAYRIFFATGRRVTRLSQIRTRSDGVQDIQTKTTLRLQTGKQDLWGKNSGVR
                     DLDIADLRVEAVPGRAGKGYLSLTLRPEAIKHKWIERRPYYMDFRNSRFVAETDQEVV
                     MSLNRVEHVFGKVQGA"
     CDS             join(447684..447831,447898..448159,448216..448490,
                     448557..448738)
                     /locus_tag="CNB01500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512222.1"
                     /db_xref="GeneID:3255717"
                     /translation="MFGQAVIRFYRRECFITGSNGKTTLRQGTLQKAFHFASKRAAKV
                     PTAPRGPPAPPSNTRSTVALTSPWPWRPITPSSRLPAHTILEERVIYARPLSFSPRRH
                     LFLGCTLAGCGVMFWMMPDKPRMADWFSEDVGLFRRILGTINNYLFLDLPPFLALAGT
                     TLVAYRIFFATGRRVTRLSQIRTRSDGVQDIQTKTTLRLQTGKQDLWGKNSGVRDLDI
                     ADLRVEAVPGRAGKGYLSLTLRPEAIKHKWIERRPYYMDFRNSRFVAETDQEVVMSLN
                     RVEHVFGKVQGA"
     gene            449255..450383
                     /locus_tag="CNB01510"
                     /db_xref="GeneID:3255829"
     mRNA            join(449255..449764,449838..449914,449978..450089,
                     450158..450383)
                     /locus_tag="CNB01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656479.1"
                     /db_xref="GeneID:3255829"
     CDS             join(449489..449764,449838..449914,449978..450089,
                     450158..450232)
                     /locus_tag="CNB01510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512131.1"
                     /db_xref="GeneID:3255829"
                     /translation="MYKSRPHLVDLIPRPLYYIQFSTTPRVEKPYSSTIMKIFSTLRI
                     ISTFLVVLSASVSAKVYHVSVPDKASPGEIITAILSSSSYIQNWDDFGVIWGLVREGQ
                     ECDGCIGQEIGYQNLYKDPSYPTQPGNVSLQVTIPNITTGSYTFVAAVPHLVGASGET
                     GINYFTQAIELVSSAKIRV"
     gene            complement(450328..451712)
                     /locus_tag="CNB01520"
                     /db_xref="GeneID:3255682"
     mRNA            complement(join(450328..450418,450470..450624,
                     450681..450826,450889..450951,451005..451162,
                     451226..451316,451370..451508,451638..451712))
                     /locus_tag="CNB01520"
                     /product="t-SNARE, putative"
                     /transcript_id="XM_024656480.1"
                     /db_xref="GeneID:3255682"
     CDS             complement(join(450407..450418,450470..450624,
                     450681..450826,450889..450951,451005..451162,
                     451226..451316,451370..451508,451638..451698))
                     /locus_tag="CNB01520"
                     /codon_start=1
                     /product="t-SNARE, putative"
                     /protein_id="XP_024512132.1"
                     /db_xref="GeneID:3255682"
                     /translation="MSFNDLERGQAEPLLRGGAPDQDATFIALKDSVSIQVFKIQSNV
                     QGIQRLVDKLGGNADGDNLRTSLHNLTEATRDMVKNSSLDVKKLAAYPAGGELATRKP
                     IQTKLSKEFTNAITAFQRVQRLSAEKQRLYVENQKRKVDRLVEENEEAYDESRSSVEL
                     EQVQTQQQVHHVSAQELEFQETLIAEREAEIREIESGIHELNDIFRDLGTMVVEQGGL
                     IDNIESNVISVARDSSSAAEELTTAHEYQRKAGKRMACLLLILVIVGAVILLAILS"
     gene            451829..453010
                     /locus_tag="CNB01530"
                     /db_xref="GeneID:3255714"
     mRNA            join(451829..451877,451935..452108,452152..452204,
                     452262..452354,452407..452587,452639..453010)
                     /locus_tag="CNB01530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656481.1"
                     /db_xref="GeneID:3255714"
     CDS             join(451858..451877,451935..452108,452152..452204,
                     452262..452354,452407..452587,452639..452666)
                     /locus_tag="CNB01530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512223.1"
                     /db_xref="GeneID:3255714"
                     /translation="MESISRPTLTAHATSLICADTDLRGPISVGPNVIIHPRATIYAA
                     AGPIMLGEGCIVEEGCIIVNRKKDTMKIGENNHFMVGCRIESPSIGNNNIFQPKSTAS
                     GGVIVTDNCIISAGTILLPSPTGTDQEPETLPPYTVIYGADSSRRTWDGSGHVAEMAL
                     RSKQAEYLREIMPKFNRLRPTT"
     gene            complement(452665..455615)
                     /locus_tag="CNB01540"
                     /db_xref="GeneID:3255684"
     mRNA            complement(join(452665..452856,452914..453175,
                     453229..453657,453712..454145,454203..454283,
                     454341..454412,454463..454582,454642..454871,
                     454918..455615))
                     /locus_tag="CNB01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656482.1"
                     /db_xref="GeneID:3255684"
     CDS             complement(join(452740..452856,452914..453175,
                     453229..453657,453712..454145,454203..454283,
                     454341..454412,454463..454582,454642..454871,
                     454918..455554))
                     /locus_tag="CNB01540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512227.1"
                     /db_xref="GeneID:3255684"
                     /translation="MLAIRYSRRSVLRLTRNFPHGTLQPENDLPYAESSSASSRRHMS
                     VSLRSDGPQSPGKVGNAIAHKGHKSNFARRQIIANAKRLADALKDGSSNTPPQLPPSS
                     DAKYWSDFLQTPVTSSPNPSPTLDDLLSKQPTEPPLKPWHPDYPRLYKRLYDSIHTAF
                     LTKQLKSFARELGLNYVGGKGVSKAAVIKRIMSTWDWVEPRDEPREPPPKTEVYELSS
                     SELFLFLRDNALIQRFAQYENLQLSVMRASEAPQSPFQTSQPGDENRMVLVAKGRNES
                     CNTLREVLDERRKSIVTIEFSRDDVLGLEATVGLLQTISNAAGAYVELTAEGMYRATA
                     LSEDAAEASKRMLGVAALRTSVLPRHRPLQNVRPAVAHFLSHNPASVLDPRQDTYGLY
                     PFFPSNTEPLPWDLSATTIGSHFCRLEKVKKWDGSPSSRATEQMAEKMEDRLVSYPLS
                     SSERGEKGRLKVVIEELVQNRGKLVAKFGHLLLPVVTQDGKNALWDSPLPGQWQVENL
                     ERWVREDQSRRFIFSPSLTPVMVQHPPFNPPTKLHRLRYRSHPSSSTNESRYLKFDYT
                     LQIRWQDRFAKLVDHLEKTAIGEGVEFETEVKAMESVEQEVIEEVSEAAEAAKQEVIE
                     EVSEPVEAANQEVTDQEGEPSTVEDKLKSEMGILNEVDLFLPDRPTDVQLIASAPLPF
                     TDIPIAISSFFNISQASTESSSPQPPISLEIDGVVYYLEADEYIEEVTQIEEGVVIRS
                     VKATELNGRTIAYSEIESSATDGIPSQFWRQLSSISRDVTPEIASSRPSPSVQ"
     gene            complement(456230..460163)
                     /locus_tag="CNB01550"
                     /db_xref="GeneID:3256028"
     mRNA            complement(join(456230..456641,456702..456781,
                     456830..456951,457004..457110,457159..458002,
                     458058..458180,458231..458361,458412..458477,
                     458525..458585,458637..458786,458835..459131,
                     459172..459225,459273..459296,459352..459667,
                     459716..459818,459873..459969,460028..460163))
                     /locus_tag="CNB01550"
                     /product="ATP dependent DNA helicase, putative"
                     /transcript_id="XM_024656483.1"
                     /db_xref="GeneID:3256028"
     CDS             complement(join(456469..456641,456702..456781,
                     456830..456951,457004..457110,457159..458002,
                     458058..458180,458231..458361,458412..458477,
                     458525..458585,458637..458786,458835..459131,
                     459172..459225,459273..459296,459352..459667,
                     459716..459818,459873..459969,460028..460093))
                     /locus_tag="CNB01550"
                     /codon_start=1
                     /product="ATP dependent DNA helicase, putative"
                     /protein_id="XP_024512133.1"
                     /db_xref="GeneID:3256028"
                     /translation="MLAFPSSTPAERPYTNLVNSTQFARNNFRPTKREWRRTMSPQET
                     PSALQRNLKHHWGYNDFRHPQLEICTDALRGCDLIVVAPTGLGKSLCFQLPAITIEHG
                     VTIVVSPLKALMSDQVKDLTSRGIKAVQLNEYTTLAEHNEVRRQMRMGHPEIRLLYVT
                     PEMLLSDKHRSTFDTAYAQKQVARLVVDEAHVITEWGTSFRGKYRELGKFRERYYDIP
                     ITALTASATKEVRHDIIQTLRIRKGYGQWVMPFNRRNLFYEIRYQGRGSIEKEEMEVQ
                     KNPLDDIVDFIEKYRPEAAKRNRENGIFRICVTGIVYCRTTAACEEVAGFLSNRRIKA
                     MPYYKNLSQTVKDQALAGWKDGSIECIVATIAFGMGIDQANVRYVIHYQMPKTFEGYY
                     QETGRAGRDGHISHCILYYSREDAKYLRWLLEQEDAKQKRIARFKSGDACAETSSQTL
                     NSFKALQHYMESLGRCRHVGICSYFGEKIDDKDPEIKAAYCQSMCDICKDNAKVRKAA
                     MHLTDAIPVASAIAGREPTPIPDQDPKPEPLFDPREGDDTDTDEHHDEFLDLHGPDPD
                     IFEEGLAGTAPPIFQIADPRSSGSHAGNHQNTPLVSSTNSHVQSSNTIPSSMSSKPPS
                     VPLSRTPVLVRDLSSERVAQPIRVREIIHIETGGEPEPQSLANKRRRAGQGSMLSSSP
                     TSSMEFEEIEKEREREMEKVRLRKEKERQEAMARERERPIFSSNARLPDNVKFVQDSE
                     EGTASELKLTREQRIKAERMLNSVKPVRGEGPYACYNAAPPAARFRKASSASDKAFKP
                     PILKSPTKVRCDLLTKSARDNAVLEISNSLKDSLGHGDLARTVLNSWGRLERGSKRVT
                     VLQDVARAIERDFAAISREDPLGFERRITEFRKAAKALRSSEVVDAIAQGDIDLFDDG
                     SPEVGHLKSLEKYMRTWKPEPSE"
     gene            460350..467547
                     /locus_tag="CNB01560"
                     /db_xref="GeneID:3255581"
     mRNA            join(460350..460468,460637..460668,460718..461173,
                     461225..461513,461562..466337,466390..466532,
                     466593..467031,467098..467547)
                     /locus_tag="CNB01560"
                     /product="tubulin binding protein, putative"
                     /transcript_id="XM_024656484.1"
                     /db_xref="GeneID:3255581"
     CDS             join(460775..461173,461225..461513,461562..466337,
                     466390..466532,466593..467031,467098..467372)
                     /locus_tag="CNB01560"
                     /codon_start=1
                     /product="tubulin binding protein, putative"
                     /protein_id="XP_024512134.1"
                     /db_xref="GeneID:3255581"
                     /translation="MGSPLPRQRSRANLKHALPAPPSTRSLASMAGNSPTSSPTPQRR
                     SEITADALRSHLSSLLEQKSSQLQMLGTMGQEILRQQQELEERIRDFEGEGIEGDAIA
                     EETKEKLRELDEAMKAWENQNEDMMRELGGKMPESFQGPAVATVPSSTKAAAQPNNLT
                     RRQRNTQHRQLDMEFATEIGQNLLVEVRRLQALLSERDRALEKLSEEKETWEQESQTL
                     LIAVRAAESSVDRYKEENWNLEVNLQELRSSVADMQDQLTKANAEQARLQKTLVSSRE
                     AAEAYKTEAEKHAQAIEELKAKHETDMAQARRTTAGLQRDKSDLLGELNHERQRRVSA
                     RGRMSQSLSASPGMLSPNHLDSDEDDVFAAGGKGNSSPTKRGPGFDANDNALSPSQLY
                     ESDFDSPNPTPSKPFPRSPLGEMFVSENDELREKLRVAEQEIEALKSENERVRLGSFS
                     KKESVVDEFGTRAPAGEWEEDEHTIGASSRGRGSTRGRRGGRGKNFAASIGRKFGFNR
                     AVSGLSTPNAGDRSFNSTSSGTPDLLRPRDMSASPAPSVIGGETLGNVLGNRSVERLG
                     SASPFNTPSIDSLKANFGQPTALADEIGAPIEPSTDYVDAGIMTDKWSPEKPIMPGTQ
                     SPAVIPSPTTPTELIASWGAETPKRGVRDESQFANLPPLPPPPATPTAAGDTTPTKKN
                     TPLPMPSRLQQVFAPISIDDSMSITTDTDADDYESAAETIGSLTPNRTQSELPTDTEA
                     YQTGREWPNESSAEDSDTEEVQEQEHTLRGLKASSTIGLGLASAAAGGWAAAKQAHKM
                     ASRDRIADAPVEKIVEKIVEVEKRIEVPVDRIVEVEKRVEVPVDRIVEVEKIIEKIVE
                     VPVERIIEVEKIVEIPVEKIVEVEKIVEVEKRIEVPVDRIIEVEKRVEVPVDRIVEVE
                     KIIEKIVEVPVEKIIEVEKIVEKIVEVPVDRIVEVPVEKIIEVEKLVEVPVEVEKIVE
                     KIVEKIIEVPVEVEKIVEVPVEKIVEVEKRVEVPVEVEKIVEVPVEVEKIIEKIVEVP
                     IDKIIEIEKRVEVPVEIEKIVEVPVETIVEKIVEVEKIVEKTVEVPVEKIIEVEKIVE
                     VPVEKIIEVEKIVEKIVEVPVEKIIEVEKIVEVPKIIEVEKVVEKIVEVEKEVIKEVE
                     VEKIVEKIVEVEVVKEVPVNVDVEKIVERVVEVEKPVEKIIEVPKIVEVEKIVEKVIE
                     VIKEVPKEIEIIKEVEVEKIVEVIKEVEVEKIVEVIKEVEVEKVVERIVEVPVEVEKI
                     VEVEVEKRVEVPFEVEKIVEVEKVVEVLVEVEKRVEVPVEVEKIVEKTIEVPMEVEKI
                     VEKIVEVPVEIEKRIEVPVEVEKIVQIPVEVEKIVEKMVEVPVEVEKIVEKVVEVPIE
                     IERIVEVQKIVEVPVEVEKIVERIVELPVEVQRRIEVPVEKIVEVERIVEVEKIVEVL
                     VEKIVEVPVERVVERQVEVPVEIERIIERRVEVPIEKIVTIEKRIEIPIERIVTVEKI
                     VEVPVAANKSLFSDSTSQTEPLASVNSSSLAPNPDIGLFRVTPGTSYDFLKAPPSTVR
                     RVSADNLAAVASGSADSTKTVETKSVPTSPADKSQPPMMNLPPPPSNPPPSRIGKKMS
                     MGPPPLPTSPHPDDFLQRATSPAFQSTVNRRSSTRTAPSAAGAAIRASGGDMPPPAST
                     SRKPSRSSFKPAASAQATPVRDDVKSRQSVRRRTDNTFASSGYTSANSSATGHDQLIE
                     HDRNPSLSSFDSYAGTVPKPRGVPTAGSTDPQTIHAITQTMIGEYLYKYTRRAVGKGQ
                     SSNRHKRFFWVHPYTKTLYWSTEDPGSSRASESSAKSVFISNVKVIEDTNIQPPGLFT
                     KSIVVSTPGREIQITAPTQERHELWMSALQFLLQKQSPEANNTLAETTVRNSSRPALA
                     SIADEQGRLTMPKSPLSLRSFGSERHSLSNITPKANRSHSTMSNYPRSASTMGKRAGT
                     VAHEYTRRHEVPQPFHGGHRYKGPYKGAPIVDDEFDVVSREDGEDMDTSFEGLENVRA
                     CCDGKHLVGQHNHHHDHPNVPRTPARAETPSLRGWSMRSGRASNVLSDGESIFSTAKK
                     REERSKSAMGHRDRRDGAKSPAMGSLRNLKQA"
     gene            complement(466952..468362)
                     /locus_tag="CNB01570"
                     /db_xref="GeneID:3255821"
     mRNA            complement(join(466952..467015,467078..467518,
                     467580..467902,467961..468138,468201..468362))
                     /locus_tag="CNB01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656485.1"
                     /db_xref="GeneID:3255821"
     CDS             complement(join(468013..468138,468201..468341))
                     /locus_tag="CNB01570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512135.1"
                     /db_xref="GeneID:3255821"
                     /translation="MSRPITFEPLPLRPRSALQLYIGAACMFTISLLSALLALSYFYC
                     PAQITWLRPLCEDEHYKYLVPLLIPVTTWFAIANWVGWEYFRFA"
     gene            468443..473789
                     /locus_tag="CNB01580"
                     /db_xref="GeneID:3255825"
     mRNA            join(468443..468609,468683..469085,469140..470172,
                     470240..470303,470381..470589,470646..470702,
                     470758..470876,470948..472051,472116..473344,
                     473399..473789)
                     /locus_tag="CNB01580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656486.1"
                     /db_xref="GeneID:3255825"
     CDS             join(468723..469085,469140..470172,470240..470303,
                     470381..470589,470646..470702,470758..470876,
                     470948..472051,472116..473344,473399..473465)
                     /locus_tag="CNB01580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512136.1"
                     /db_xref="GeneID:3255825"
                     /translation="MPRLLHALAHHKHIFPSDSSSSHQDYNASMQDPNRLRSRLHALF
                     HSKDNHPQDDDAQDSRQQRAIQAIDGDDWSGDGHDTSRSMSFSFSNGSEIGSTVAPPK
                     PQREAIKVLVITWNMGDALPKGDLSVLLGKVPPYKPPQSPITGLPSLPIENAHPYHIV
                     VIAGQECPTPSGAPRGLGGGLIKGVTLRHKKEIKEKKEKEKEIKEKDKEIKEEAIDLE
                     KDAEDVVQGTKSPEIGGDDDDRLRATSPMTPHSPFLHRLSPAAKGWSQMLDDYFCGPN
                     YRYDVPHSLPSSNPTSSRDSPVPAHKPNIQSPVPSPQPSAILRSSSVPMTPSNPVPTP
                     LAKIAATNGKGNVPSPHGPSHLRPPLSPLATSRSSLESGSNTFINSSSDDSEDNGEDV
                     VPYINPAGDKKLQQKPKALSSPSKQKLKRPEIVIPTEETKNDDQGAYVHVAKERLLGM
                     YLSVYVYKDAEHLIQGLDKDFVTAGLAGGRFGNKGGIGISLKLADHRFLFVNSHLAAH
                     TDRQAARLANIAKIKSELRLDCFLPKDDPRAQAEDIADRFDTVFWCGDLNFRLELSRL
                     HADWLIEQKKYAEALMWDQLKMAMADPEINPFPGFEEGPINFPCTFKYDVWKSVRATN
                     REIRRNLKRRKSSASAASVDIDSSQISSSNPGNGGGGGRKAGGHQKSLSGVPEADAIE
                     EMGEETSASALAPADGMMSGQGPSPTSGQESDKDQLRPPSRSGDRSDEEDYGRQSFES
                     SRYTSGVASTVGTDAEEDNSDADSEPRSHHSHNHRQHHHQQHKAFESALKEKTRHLLG
                     LVKMDGILTGSPGRRNHNSNNSDNNNIGRRVSNRNRGESTSTARRERRKEEQDRNEYE
                     SRRASMSSFASTNIGTEYTTEPDIGRLSNSSYRSIRNPTASSQDDHLGIPSKTDRSVT
                     SHSSASPPSYAGDWTKPPFTRRLSGMKRTSSSKSVYRELEEGEDLDNDLDVDRREGVY
                     DSSKKQRVPSWCDRVLWKAHITPDPPLEPISEDHDPSLNHERPLSRISTAFSNFGGHF
                     RLPMGRASTKEPSLLVPTSTRSGKKLEHAVKESDEDDHWGEKVDKALRFDADRNMSDS
                     FVSSPPESPDLRSTGTESGLIPAPRQVSPLGKEQKFFSASKSIPPLLTPKMSPVKTES
                     ESSSPRITHSAPDPGKRKLSFDPTSSSPLKGTSTPPTDQSSHIDRVKSPASRPRSNSD
                     STGDQGVEQEKEKKKGRVSDGIVGALATPTKIETKLSVMGRGNGASPRNKSPKGTDSP
                     TRAATWQPLQSSKTESATNTAETPLPPIHSKSYAPSRPTSSNMDSNPSFQPLTHATTL
                     AGPAPTVSNRREHDKNAFMRFLRDLPGWLHRSDRSTEEEKDKDETGEELNQEEKRWQK
                     GEVRCLHYGTIDDAGMRLLEGRSDHRPAIFAGAVYI"
     gene            complement(473636..474987)
                     /locus_tag="CNB01585"
                     /db_xref="GeneID:36392727"
     mRNA            complement(join(473636..473846,473900..474987))
                     /locus_tag="CNB01585"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658429.1"
                     /db_xref="GeneID:36392727"
     CDS             complement(join(473838..473846,473900..474886))
                     /locus_tag="CNB01585"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514205.1"
                     /db_xref="GeneID:36392727"
                     /translation="MPVTKKKGAVFAIYTESPDRNPQPLSKQPRRTSPRRSTNRSRQA
                     LTSLQPKSLVPPPSKTLSLKQSAVSKKKSQADVPVKPKSKSTIQIYTDPEPSKPKSSG
                     VIGATAIKRRAPTSTLVTSQPLPAASSIKRTRDLLSPLPIFSDPQENEGASRRPTTRS
                     ETGRSPAKRGRTVLSAVESSPAVISSVSRHKKEITMNKENSAPPTLLFEDFEGSPATR
                     TRSKVRNMPFEVNMTLSPLNFRDTPQQRRRTEVERLLGDSPILGVNATRRNTVEEMTD
                     HGSPKAEKTGRGKPLAGKTQGKGMTVQPDGALADVSEAYGAKGDAPEGFDSQGQS"
     gene            complement(475103..478338)
                     /locus_tag="CNB01590"
                     /db_xref="GeneID:3255862"
     mRNA            complement(join(475103..475427,475488..476080,
                     476132..476338,476389..476472,476523..476674,
                     476723..477239,477288..477599,477650..477812,
                     477857..477964,478013..478095,478148..478338))
                     /locus_tag="CNB01590"
                     /product="expressed protein"
                     /transcript_id="XM_024656487.1"
                     /db_xref="GeneID:3255862"
     CDS             complement(join(475185..475427,475488..476080,
                     476132..476338,476389..476472,476523..476674,
                     476723..477239,477288..477599,477650..477812,
                     477857..477964,478013..478095,478148..478289))
                     /locus_tag="CNB01590"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512137.1"
                     /db_xref="GeneID:3255862"
                     /translation="MSNRRGHLSRKIPNAINRPAPPKAHVPRERSPLSRMDLELLRQA
                     EAEDEEVRIHSHQSERPWKGVFITFTGVENKAQLSSLARELGAEVDTALTRSITHVVA
                     VSYESPKYQFALANGIPIMTPAWIIEAHEIWLAGGELNFEEDEENHRLLPFTGFRISM
                     SGIDQMDRRRFLIQLITSHGGEYSKDLDRDCTHLVSSHPTSDKRRSEKVKWALRENAE
                     NEARRRKGVRDERDILIVYEEWIWDCVAYRGRWPSDKYDATKPRRGGKVDPEDVINGT
                     FQISRPDRKVVINSSTATGGELYASEQASVRRRKTAGLDTLVGQIIGEGKNRDTPKRS
                     ASAVLEEPTAKRPKLVAKSSMVHLSRSTSFVTADAPTSACPTTHETEGKTKIDESKQV
                     ARIFEGLRMAVCKSKGWEAMLEALSSRGAILVDEKDWMKGETCNYAIIRLANPNIPPM
                     PEGQSTIYVTENWVESCIVEGKLVSPDEHLLYKPLTIDVPIPGAKGIIVHISGSEDHQ
                     LSSYHRRLARALGFELQLTVDRDVTHLISFRNHGIKVRRAKAWGSQIVKHDWLLKMAE
                     TGKLEPEEEYQLHIPPENLRGSHKDLLSTADKANHSKADLSVPCDSGVKPEPRLEHRF
                     EPGTSGQNKQITSQAGPSSIPASRALRPTPTHVNDSTDDISMLDARADVSEIQHADAT
                     MEERSDPLKPSPQSLNRHTSAPDPRPSPLNNKLLTEADKNMNMTPGSSAAGASTSALP
                     NKAASTAALGDMDKKQDISDVLRRLAEKPSGTPVNIPRRGRPSARIKSTNSRSPALLS
                     PSNRPNPQPLHPEYQESIEVEDDPMKNFGNDAPEESMQIKYVDQKAVRERRKLMALFG
                     EEGETSKNKKR"
     gene            478453..480192
                     /locus_tag="CNB01600"
                     /db_xref="GeneID:3255694"
     mRNA            join(478453..478705,478763..478821,478876..478957,
                     479010..479099,479154..479321,479381..479488,
                     479540..479845,479901..480192)
                     /locus_tag="CNB01600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656488.1"
                     /db_xref="GeneID:3255694"
     CDS             join(478562..478705,478763..478821,478876..478957,
                     479010..479099,479154..479321,479381..479488,
                     479540..479845,479901..480149)
                     /locus_tag="CNB01600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512224.1"
                     /db_xref="GeneID:3255694"
                     /translation="MISLSAILRPSFCLPLITRRALHTSTYHLQNKAVQPQTPATGNV
                     DLGAPVTYISKSHDPWFNLSYEDWLLRNTPHDQPVLFLYRNFPCVVIGRNQNPWKETT
                     PKKLREESIPLVRRRSGGGTVYHDMGNTNFSIILPRLLFTRSHGAQLISRAIRETLGI
                     TGCGVNDRNDVVIRDGDREYKVSGSAYKIIQHRAYHHGTMLISSSLAELGKSLRSSSP
                     KMETKGIASYRSPVTTLNHYLPPWQSKHLHHDDFVRAVTAEFAKTYAGEEKPMTTCEV
                     TESIIKDQKIWNGYEELKSWEWQYGQTPEFTNELEGNFSFGDLSIPIAARHAVITSMS
                     IHLTPPLHSSTEETSIKQAYLDSLALSLVGRRYESLEGFEGAMGEEWDDEHWRDLGND
                     IVSWLRKHM"
     gene            complement(480163..481334)
                     /locus_tag="CNB01605"
                     /db_xref="GeneID:36392728"
     mRNA            complement(join(480163..480497,480548..480907,
                     480961..481036,481090..481334))
                     /locus_tag="CNB01605"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658440.1"
                     /db_xref="GeneID:36392728"
     CDS             complement(join(480565..480907,480961..481036,
                     481090..481255))
                     /locus_tag="CNB01605"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514206.1"
                     /db_xref="GeneID:36392728"
                     /translation="MDPRSSIPQVPLHLTSICILSPSNTPLYVRSFTSEQDELRHYHL
                     NHAAVDVLEERLVMTSTPTRPADSYLGLLYSLEDMAFYGFQTTTKLRIVLSVSMVDAM
                     IKDADIVAIFRAVHNLVLIACNNPFLSLPPSFHAISANKHADGQAENLTNPSLPTSKM
                     FATNPEEIKPIWLKQSRRFTEGIKAIGEMLSGGR"
     gene            481504..482542
                     /locus_tag="CNB01610"
                     /db_xref="GeneID:3255905"
     mRNA            join(481504..481774,481844..482038,482092..482542)
                     /locus_tag="CNB01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656489.1"
                     /db_xref="GeneID:3255905"
     CDS             join(481586..481774,481844..482038,482092..482331)
                     /locus_tag="CNB01610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512138.1"
                     /db_xref="GeneID:3255905"
                     /translation="MTTLDPSHIPFRSQAQAVHRPSSSPFPDDLPKPSRHDSVRARQE
                     GRKRVKGHMPPLPDLRFEQSFLLSIRPFLKPKPGKGSRLDRVEKPEQKVGAGMVQSAD
                     RDEVYFWGREVEVDWSSVAWVTIRDQLFAPLVQGALWGWATVLLSATGVALRASLYPA
                     RHSPRGRIAGGPGGSTNAAGGGEAVGGEWWRKWVKSWFGGLETAAVI"
     gene            482989..485391
                     /locus_tag="CNB01620"
                     /db_xref="GeneID:3255868"
     mRNA            join(482989..483209,483264..483448,483514..483887,
                     483941..484073,484122..484200,484251..484628,
                     484686..485067,485118..485391)
                     /locus_tag="CNB01620"
                     /product="L-lactate dehydrogenase (cytochrome), putative"
                     /transcript_id="XM_568831.2"
                     /db_xref="GeneID:3255868"
     CDS             join(483054..483209,483264..483448,483514..483887,
                     483941..484073,484122..484200,484251..484628,
                     484686..485067,485118..485209)
                     /locus_tag="CNB01620"
                     /codon_start=1
                     /product="L-lactate dehydrogenase (cytochrome), putative"
                     /protein_id="XP_568831.1"
                     /db_xref="GeneID:3255868"
                     /translation="MSIRTAFQKAARLSRNRSVFARGLTSRIAPNTSSKVVSSRFLIG
                     AGVALAVPTYMYLNRAHLDSQQVVETAVPDKPEALEQEKKQEAKKVSIKEVLEHKDGD
                     RVWVVIQGEVYDMTDFLEDHPGGKDIIVENRSKDVTFIFNPRHPSDQLEADNLPPNVQ
                     HLGTLDTASASVEEKEALKLKVSKDEQDETERIERKRKEIEEQGLGSVVNMRDFEKLA
                     EDMCTSVGWAYYASGADDEFTKNENNTSYQKIHFRPRVLRKVAQADASTTILGYKSTL
                     PVMISPAAMAKLGHPLGEVNMTRGAANTGIIQCISSFASCSLEEICAARSENQPLFFQ
                     LYVNSKRDLAAEVLKRVNRLNLNAILLTVDAAVGGKRERDLRLKGNFEPPKTGAYEKH
                     DDTKGVSEAMFAGVDPDLCWDDIKWIRSQTKLPLLIKGVQTVEDAILAYRMGADGVVL
                     SNHGGRQLDTTHTGIDTLLEIRKHAPYLLRPEYRGPTGVQPAALEHPENLTPPDPQEK
                     PTDRPFEIWVDGGIWRGSDAVKALCLGANAVGSGRGFLFANAVGGQKGVEHAVNIFSA
                     EILTTMRLLGVNKVDQLRPSMVEIKA"
     gene            complement(485744..487902)
                     /locus_tag="CNB01630"
                     /db_xref="GeneID:3255902"
     mRNA            complement(join(485744..486012,486080..486197,
                     486251..486678,486724..486833,486880..487178,
                     487228..487291,487343..487423,487471..487489,
                     487540..487902))
                     /locus_tag="CNB01630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656490.1"
                     /db_xref="GeneID:3255902"
     CDS             complement(join(485836..486012,486080..486197,
                     486251..486678,486724..486833,486880..487178,
                     487228..487291,487343..487423,487471..487489,
                     487540..487722))
                     /locus_tag="CNB01630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512139.1"
                     /db_xref="GeneID:3255902"
                     /translation="MFSRWTRRVNESRLAQRKLTLLGRAIALVAGELLFNAVCWIAAG
                     ICFGKTDGILGLALLAWTIGLRHGLDADHISAIDNATRQLVSQGQLPITCGLFFSLGH
                     STIVIVVNVAIAVSVDIYDKLDRVGSIGGIVGASVSASFLFLIACLNIYFLIGAIKQR
                     RSMKRRQALGLPPDEDEGDPSKIYGGGCMVRVVGPILRAVDRPWKMYPVGVLFGFGFD
                     TASSIALLAISAIAQRGPNGDSISHGKIVILPFLFTAGMSLVDSLDSILMLYAYATPD
                     TTSPEGKLALLQYPDLDHKDSYLEETVATALPAEGGQTERHVIEQTDIPQGEIERLET
                     EDNIKAKTGNEILVEEERVGGPSRVDNNGGVRNERVIKAKANTMSSLSIILTLLSILV
                     ALSISLIEIMGLIGDNCTQCQDAANDPDGGGLAGSWWRAWARANDQSGYIGAAIVGCF
                     AAILVGWYGARWGMKKWKARRDANAAILLEDNEDDVTQTPVA"
     gene            488039..491114
                     /locus_tag="CNB01640"
                     /db_xref="GeneID:3255930"
     mRNA            join(488039..488119,488160..488354,488414..488550,
                     488602..488730,488781..488839,488891..488947,
                     489001..489068,489120..489229,489276..489361,
                     489404..489590,489639..490049,490103..490171,
                     490224..490304,490358..490379,490435..490634,
                     490703..490899,490955..491114)
                     /locus_tag="CNB01640"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_568833.2"
                     /db_xref="GeneID:3255930"
     CDS             join(488077..488119,488160..488354,488414..488550,
                     488602..488730,488781..488839,488891..488947,
                     489001..489068,489120..489229,489276..489361,
                     489404..489590,489639..490049,490103..490171,
                     490224..490304,490358..490379,490435..490634,
                     490703..490899,490955..491003)
                     /locus_tag="CNB01640"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_568833.1"
                     /db_xref="GeneID:3255930"
                     /translation="MPPLQFWKPGTAAPGSSLDRESEKDGSLLPINTSQNAHLSLDAQ
                     RQRLPIYKHREKLLWCVEKYPVVIVVGQTGSGKSTQLPQYLHEAGWTGQNHVVACTQP
                     RRVAATSVATRVAEEVGSILGDEVGYTIRFEDLSHPTRTKIKYMTDGMLFRETMMDPL
                     LSKYSVIMIDEAHERGAYTDLLLGLLKKIMRKRPELRVIISSATIDAEDFLEYFNTNA
                     DGTDRSKDDAIIVSLEGRMFPVEVCYLKEPCADYTQAAVQTVFDLHLREPLGDILVFL
                     TGREEIDQVIQEVADRLLSLPKAAPKLLALPLYATLPPEEQSLIFDPPPRDTRKVIFS
                     TNIAEASVTIDGIKYVVDSGFVKIKTYNPRTCMDVLTTTPCSLASANQRAGRAGRTSA
                     GKCFRLYPASILPTTNPSSPMPLTTPPELVRSDISLYLLQLKALGIDNLAKFDFMSPP
                     PSEMMIRALEFLFCLKAIDDEGRLTRPMGERMAEVPLDPMMAAILLNSHEFRCGEEIL
                     TIAAMTSVQNVFITAQGGTKATMAELERRKFTAEEGDHLTLLNAYNAFARYGQNNKQW
                     CGNHRLNYKALSRAMSIRKQLKKYMERFRIPIVSCEGDAIRLRKCLVSGYFKNAAKMM
                     PDGTYRSARENAPLHVHPSSVMFTRQPSTGWVIYHEVVETTKSFMRDLTVINEDWLVE
                     LAPHFYKFKGGGLKQHF"
     gene            complement(491136..493617)
                     /locus_tag="CNB01650"
                     /db_xref="GeneID:3255744"
     mRNA            complement(join(491136..491485,491559..491634,
                     491697..491759,491813..491872,491927..491934,
                     492002..492187,492248..492262,492320..492620,
                     492674..492775,492830..493117,493172..493205,
                     493320..493431,493513..493617))
                     /locus_tag="CNB01650"
                     /product="acyl-CoA dehydrogenase, long-chain specific
                     precursor, putative"
                     /transcript_id="XM_568834.1"
                     /db_xref="GeneID:3255744"
     CDS             complement(join(491222..491485,491559..491634,
                     491697..491759,491813..491872,491927..491934,
                     492002..492187,492248..492262,492320..492620,
                     492674..492775,492830..493117,493172..493205,
                     493320..493431,493513..493572))
                     /locus_tag="CNB01650"
                     /codon_start=1
                     /product="acyl-CoA dehydrogenase, long-chain specific
                     precursor, putative"
                     /protein_id="XP_568834.1"
                     /db_xref="GeneID:3255744"
                     /translation="MSTQEPQKELKELTKEEVAKHNKQGDLWVIIDSIVYDLSKFGAM
                     HPGGVGVLLDPEVAGQDATTVFFGLHRHEVLLKPQYQRLIIGQLSGSAPTIKPPTPGA
                     LSRVPYAEPTWLTAEFKSPYYKESHRKLQQVMRKFVEEVIRPDAQLCEENGKRASKSV
                     LEAMAKVNLNAMRLGPGKHLHGRTLFDGVVKGEEFDYFHELVINQELVRCGARGYGDG
                     LNAGMVIGLPPVLNFANEPLRSKVVQEVFDGEKIISLAISEAFAGSDVAGLRTTATKQ
                     EDGSWVINGTKKWISGGMHSDYFTVGAKTEGGLTVFLVPRTEGVETKQIKTSYSTAAG
                     TAYITFDNVKVPAENMLGPEDGGLLVILSNFNHERWVMCCASIRSSRVIVEECLKWGA
                     QRRVFGKPLLAQAVIRAKLASMIAKVEAMQAWLENVTYQMCNMSYKEQSRNLAGQIAF
                     LKMQSTRFAGEIADDAVNIFGGRGLTKTGMGKFVEQFQRTQKFDAILGGAEEVLGDLG
                     VRQAMRKMPKDVRL"
     gene            complement(493766..494970)
                     /locus_tag="CNB01660"
                     /db_xref="GeneID:3255738"
     mRNA            complement(join(493766..494083,494140..494162,
                     494232..494326,494386..494446,494502..494525,
                     494604..494699,494764..494970))
                     /locus_tag="CNB01660"
                     /product="expressed protein"
                     /transcript_id="XM_569004.2"
                     /db_xref="GeneID:3255738"
     CDS             complement(join(494068..494083,494140..494162,
                     494232..494326,494386..494446,494502..494525,
                     494604..494699,494764..494874))
                     /locus_tag="CNB01660"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569004.2"
                     /db_xref="GeneID:3255738"
                     /translation="MSVLRLRSLQALRVQRTMPAVRILSRGAASKHDNDPNVLAREKA
                     RNLSGTQDSSAPHKEHAPGWNEHLATDAEANVKADQAAPDGPPGKDLQEKTVSHVDKH
                     HHTPDGMSGAEHHHINPGPDPTPSEENVKADRGEASLYL"
     gene            495167..496571
                     /locus_tag="CNB01670"
                     /db_xref="GeneID:3255970"
     mRNA            join(495167..495249,495388..495693,495803..496571)
                     /locus_tag="CNB01670"
                     /product="expressed protein"
                     /transcript_id="XM_568835.2"
                     /db_xref="GeneID:3255970"
     CDS             join(495456..495693,495803..496317)
                     /locus_tag="CNB01670"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568835.1"
                     /db_xref="GeneID:3255970"
                     /translation="MAKPIPNSKPHHSLPNSHLSPDLITPAGTPPSGADSSYGAAMES
                     RLHQFMSSFDAGTHSFDREDRESPEERRMSFGSSDVFPTPPSSRRPSFLASLGIRPFT
                     LVSSSPSSSSATLSSSQPKDAFGNAMNFGMTPASGPDGGDDPSSTQTRPHLGRDIKST
                     PNLAHSPTHHPDNVERMDQALSGHLPNGGMARSKTTGQINKQSGFILNSTVSKGENAT
                     LESSSASRQVGREKEEKRHFDPSRDPRLLGLI"
     gene            complement(496591..500767)
                     /locus_tag="CNB01680"
                     /db_xref="GeneID:3255568"
     mRNA            complement(join(496591..497541,497599..497847,
                     497919..498188,498242..498412,498464..498516,
                     498564..498869,498923..499265,499325..500060,
                     500115..500412,500460..500471,500521..500767))
                     /locus_tag="CNB01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656491.1"
                     /db_xref="GeneID:3255568"
     CDS             complement(join(496809..497541,497599..497847,
                     497919..498188,498242..498412,498464..498516,
                     498564..498869,498923..499265,499325..500060,
                     500115..500412,500460..500471,500521..500676))
                     /locus_tag="CNB01680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512140.1"
                     /db_xref="GeneID:3255568"
                     /translation="MSIHGNLSKRPPLDGTVHIDTQESSAQPSNNNDVAGVLRRNQAC
                     LQCRRRKLKCDAARPHCATCVRSYRHLLRTSPKSNPVLCCDYDDGASNQVEEGDSQNK
                     SSAGPLGAPANEEEETSGVANGSKKKRKATGEGRRKKKEEEFDEERDRLTKQIQELQA
                     RLADKPRTPAPAFSSSLFQNATAPSPNTFINLFTSNPSQPASNSRADPMWGNSDPLEQ
                     IQSQHTHLVNLGSSSTNVSHCNGPSPANQGSDTSRRSSSLHNNTSTPNLTSGESSSGA
                     NILSPGEIFNFSPADISNDAWNGAVPDINDQNKSQNWQSFNPNDLSSTVDPLKGQAQW
                     RGLESVSATFATTMNGNVGADLQMETEISMDGLEAGLDAAMQQQILMDLFWPGWPAKL
                     PEPNVVNDLIESFFDQVPNLPRILHRPRFLARIALPPTHSNFPHPSLIHAICAAAAAR
                     CPEEVYSKSTRDKQWAKFEFSTSGHSSDSESARDGFGLRQTMFAKEAVQDGLNTGNRL
                     FDVVRAMIILCRVFIDDTRMLECWAYAGLVARMILPLGLNVRSAELSLKSVMLPPPLD
                     ALEREERRATVWMAFYHDTVASAASGWGTSMSLDELTVALPVSAKEFEDGSEFMEPNP
                     QDVESPDLFLKHPVVDPFVMVTKATILMNRTNRFVRKWKNRHLRPNDDMDGMDKPEFR
                     ELANSIACFQMSFPSALRNACKFNSRRRLDADLVAAHLLPHAATICLYEPFADLDNPS
                     DQPTRHLVSATQGIVSIVQQLASAVGGEAEKFSSVMHSSASVCFVTAARTSLLLMRHA
                     LNNGDEVSASSHRTDCDTVRLALSYFGIRFKIGQHHAQLIEYFLDRAVNPTFEKLMAH
                     YPDHPRPGAPPLTRDADFGLCVENALNVKRGYWRIKTRPSFSGTAFDESSANYNHSHS
                     FAGFSQAQTYINNNFNPPSGPGGSGISPIGSGNTPESQGNEGSGTGSGVGGASLKDIS
                     MDSSPASGLNTGSSASAPPGEGQGAADLWQDQFYALNDQHAADPFRAQQSSSTQKVEY
                     MSGVSVHCPTDLTKQPAPVPTLMPESEASPTRMGSFITTTNNVINITGPGSGMNKGDD
                     GLRWVKDHMNKYPWSENERK"
     gene            501005..504743
                     /locus_tag="CNB01690"
                     /db_xref="GeneID:3255994"
     mRNA            join(501005..501448,501489..503074,503140..503491,
                     503567..504028,504080..504347,504414..504743)
                     /locus_tag="CNB01690"
                     /product="protein kinase/endoribonuclease, putative"
                     /transcript_id="XM_568837.2"
                     /db_xref="GeneID:3255994"
     CDS             join(501078..501448,501489..503074,503140..503491,
                     503567..504028,504080..504347,504414..504596)
                     /locus_tag="CNB01690"
                     /codon_start=1
                     /product="protein kinase/endoribonuclease, putative"
                     /protein_id="XP_568837.1"
                     /db_xref="GeneID:3255994"
                     /translation="MLYFLLLLPLLIAYAAPEPAALIPFPHHTLRALAPSSAATLPVQ
                     IDHDLHPLVLVSTVDGALHALERNTGKEKWVLEGDPLVGGKMKGGVEEYIVEPLSGSL
                     YVHEDKDGQMKMRKLPLSVDQLIELSPFTFPESPTQIFTGSKHTSLMSVDLRTGEQID
                     CFSPTANLSQYDGSSVCDDLDDLEQRGSSQRDTLFIGRTDYRLTIHSPSSSQGLSTYT
                     SAAYSSEKKSAPAIQEISYSTYTPNAYNRPLAESWVKAGVAHQSWGPDNEEPRIRIEL
                     GFNGKALGVKPGGGLIWNRELEHVGVGVYEILIPRENPMGAPILVPQPPAHLPALFPG
                     QNDPRAFNIHDAPPSTYIATLPECLTLPSPNTTSDNTAAGNKDTKPLHFALSSSSYPL
                     INFARPPPPGHLSDGLFYNTDDGDSSDLDHRRGRGLLSGLIDPPREHEMIDPPFIERR
                     AGPAKNWWWKWVVALGMLFILLGGMMVRFGRGKGAAPESVESKVDEKMPLLAAPVQEV
                     RLEQKEEEQKEEGEEVLSVVKSVPVVRIQEPSPTPEDSPPRSEGTPETDQTATPPPKK
                     KSTRRRVRGKKKKPDATAATAASLIPEEHDGENEDEDHEKDKEDVSPRPTPKGGNKPL
                     PELPRELSSTDLLDYQDKERLAISDTIIGFGSHGTVVLKGTWGGRPVAVKRLLSDFTR
                     LASQEVKLLQASDDHPNVIRYYCQEKRDNFLYIALDLCQASLADLIESPDKHRELADQ
                     LDRKRALMEVTKGLKHLHGMKIIHRDIKPQNVLVSQTPSGLRILVSDFGLARRLGQDQ
                     SSFAPTANNLAGSLGWRAPECIRGVVRLNEGFDASSSVGSSGGIANAEDGVARSRLTK
                     AVDLFALGCLYFWVLLSGEHPFGETYNRESNIVKGEAVNMGMLSLLGEEREEVEDLVG
                     RLLSSEPDARPSTSECLAHPIFWPAAKRLGFLCDASDRFEIMQTEPAEPTLVLLEQGA
                     QSVVGKDWYSRLDKTFTGSLGKYRKYKGGSVRDMLRAMRNKKHHYQDLEPAVQKHLGA
                     LPAGFLLYFSSRYPKLLMHVYRTVKESELREESLFEGYFQEAI"
     gene            complement(504695..>505983)
                     /locus_tag="CNB01700"
                     /db_xref="GeneID:3255964"
     mRNA            complement(join(504695..504857,504913..>505983))
                     /locus_tag="CNB01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_568838.2"
                     /db_xref="GeneID:3255964"
     CDS             complement(join(504804..504857,504913..505983))
                     /locus_tag="CNB01700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568838.1"
                     /db_xref="GeneID:3255964"
                     /translation="MSTRFIVPPAPSPLPPAPALSLLPFSLGPQHAPYTDKHANTAHY
                     FQPRPLAPPAHSPGADQQQLVRAAFRGRQVVGQYLSVPPAYRGIILSTTLPPNKGGTE
                     DHTHSIPASAPPTPASIDGVDGGGGGGKRPQRKSVLAKIKGAGQTALAKPRTRRTAPA
                     KKRTRLDSDDEQNEEGDGDGDGEETARTPSKRFKSTTTTPKRTLSVPEIVIQEATPLK
                     QPPIATPTTATTRQEGEEEVQEPFIPSPETENNPPAFNISPPPHTLASKNQEEQTDDD
                     GPVRILYPTAEFQGFMLYSGDVPLTGFRSDELEEKHEQRDAGEAGCATINLRPSWWRH
                     DGAGEGGDEFVRGMGEWLGLVEVLNKPVYLEGLDDDDEDE"
     gene            complement(506122..507266)
                     /locus_tag="CNB01710"
                     /db_xref="GeneID:3255966"
     mRNA            complement(join(506122..506270,506316..506440,
                     506499..506619,506680..506761,506802..507266))
                     /locus_tag="CNB01710"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_568839.2"
                     /db_xref="GeneID:3255966"
     CDS             complement(join(506157..506270,506316..506440,
                     506499..506619,506680..506761,506802..507082))
                     /locus_tag="CNB01710"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_568839.1"
                     /db_xref="GeneID:3255966"
                     /translation="MAYPAAQSRFSASAPLPTTPLARRDSARTAPHPSLQQQLFGPPA
                     AGAAPPSIVDRPLARTKGAEVAVGAWAFMFAEIVAYSQSRADSVSDLEARLSSLGYDA
                     GQRLLPLLLLRNTQAAGTKEPKREHRLVPILQFIHTQVYRYCFGRAADGLERSVEEEN
                     EYMITLNQPPLTQFISVPKDMSQLSCEAYTAGIVEGVLDGLEVPARVTAHTVPTDAFP
                     QRSVILIKLDQKVMDREEALGK"
     gene            507555..509955
                     /locus_tag="CNB01720"
                     /db_xref="GeneID:3255792"
     mRNA            join(507555..507988,508060..508252,508300..508619,
                     508675..508769,508833..508964,509023..509955)
                     /locus_tag="CNB01720"
                     /product="protein serine/threonine phosphatase, putative"
                     /transcript_id="XM_024656492.1"
                     /db_xref="GeneID:3255792"
     CDS             join(507620..507988,508060..508252,508300..508619,
                     508675..508769,508833..508964,509023..509074)
                     /locus_tag="CNB01720"
                     /codon_start=1
                     /product="protein serine/threonine phosphatase, putative"
                     /protein_id="XP_024512141.1"
                     /db_xref="GeneID:3255792"
                     /translation="MPVSPAGTTRARSSSPPPSSSPAAASHLSRDSASSLSPGFALTQ
                     TVSRGSLGAGGAGFQILDVDNMIQRLLEAGYSGKVTKSPPLKNAEITSVCAAAREVFL
                     SQPTLIELSPPVKIVGDVHGQYADLLRMFEMCGFPPAANYLFLGDYVDRGKQSLETIL
                     LLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRTNIKIWKTFIDVFNTLPIAS
                     IVASKIFCVHGGLSPSLKSMDDIRRIQRPTDVPDYGLLNDLVWSDPSDTALDWEDNER
                     GVSFCYGKSVINAFLATHDMDLICRAHMVVEDGYEFYNDRTLVTVFSAPNYCGEFDNF
                     GAVMSVSEDLLCSFELLKPLDGAALKKEMTKSKRKSLQAHQSPPNNPMAQSF"
     gene            complement(510000..513638)
                     /locus_tag="CNB01730"
                     /db_xref="GeneID:3255601"
     mRNA            complement(join(510000..510365,510432..510749,
                     510806..511103,511168..512773,512821..513073,
                     513124..513325,513393..513638))
                     /locus_tag="CNB01730"
                     /product="oxoglutarate dehydrogenase
                     (succinyl-transferring), putative"
                     /transcript_id="XM_568841.2"
                     /db_xref="GeneID:3255601"
     CDS             complement(join(510165..510365,510432..510749,
                     510806..511103,511168..512773,512821..513073,
                     513124..513325,513393..513577))
                     /locus_tag="CNB01730"
                     /codon_start=1
                     /product="oxoglutarate dehydrogenase
                     (succinyl-transferring), putative"
                     /protein_id="XP_568841.2"
                     /db_xref="GeneID:3255601"
                     /translation="MLRSIPKHIRIPSRSTAQPARAILSLSAVQRHTQKRSYAAEAVA
                     PSKNDAFANGGNAYYTEEMYRLWKQDPKSVHVSWQTYFSGLDKGLPSAHAFTPPPGVL
                     SGAVPTPAGGSPKLSVEGSGDVTDYLKVQLLIRAYQVRGHHIANLDPLRISGADLDGR
                     VPPELKLDYYGWTEADMTKEFRLGDGILPRFMGQVKDDTMTLGQIIDELKQMYCTHVG
                     CQYVHIPDRGQCDWIRERVEIPTQWNYSTEEKRMILDRLMWSELFEKFIASKYPNEKR
                     FGLEGCESLIPGMKALIDRSVDAGVKSIVLGMPHRGRLNVLGNVIRKPIEAILNEFKG
                     NEDADDTGGGDVKYHLGANYIRPTPSGKKVSLSLVANPSHLEAEDPVVLGKTRAIQHF
                     EGDEGDGSSAMGVLLHGDAAFAGQGVVYETMGMQNLPNYGTGGTVHLIVNNQIGFTTD
                     PRFARSTPYPSDIAKSIDAPIFHVNSDDVEAVNYVCTLAADWRATFKKDVVIDIVCYR
                     RYGHNETDQPSFTQPKMYKAIQKQPTVLSIYTDKLIKEGTFTEKEIDEHRQWVWGMLE
                     KAYDGSRDYKPSPREWLSSSWEGFPSPKELAEEVLPQHHTGASEDALKRVGQIISSFP
                     EGFHPHKNLARIIGNRGKTVAEGKNIDWSTAEALAFGTLCLEGTHVRISGQDVERGTF
                     SQRHAVVHDQKTEQTHIALKHLDADQGSFTVTNSHLSEFGTLGFELGYSLVSPNSLTI
                     WEAQFGDFANNAQCIIDQFIAAGERKWLQRTGLVLSLPHGYDGQGPEHSSGRIERFLQ
                     LCDDEPRVYPSPEKLERQHQDCNMQVVYPTTPANYFHVLRRQNKRDFRKPLIVFFSKS
                     LLRHPLARSSLEEMSGDSKFQRYIPEPHPESLVEPEKIRRHILCTGQVYFQLLKEREE
                     RGINDVAISRIEQLSPLPYDRLTPHLDKYPNADLVWAQEEPLNNGAWTYVQPRLITAL
                     QETEHHKSKIPFYAGRKPSSSVATGSKYAHKKEIEMINEMAFAPSEGQ"
     gene            514473..517064
                     /locus_tag="CNB01740"
                     /db_xref="GeneID:3255722"
     mRNA            join(514473..515078,515128..515751,515804..515904,
                     515955..516292,516345..517064)
                     /locus_tag="CNB01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_568842.2"
                     /db_xref="GeneID:3255722"
     CDS             join(514521..515078,515128..515751,515804..515904,
                     515955..516292,516345..516793)
                     /locus_tag="CNB01740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568842.1"
                     /db_xref="GeneID:3255722"
                     /translation="MAPKAAQKKRSAPDAGSAPKKTKVAQSDKSSKPAAPKQSKSRSA
                     PREREEEAKKRKKPITQGGGEEEDEDVSMDEGSFSDEDQEDQETERNDVDMDDGDAQG
                     AAPEKKRLSKAEKQALHAAQPHRTTLLPSHPLLHDTLLPLWETARRADLSKEERKKAI
                     TELWEAVKGRVIEVSRGHKGGRVLQTIVKYGGKEERLGVAMELEPQWKAMMESKYSKF
                     LMSKLIRYCPSIRPLLIPHLAPQLLNLLNHAHAVTPLSDLYELWASAKERRLLVRGFY
                     PREVKIFDGAKQGVEVKGLEASLEDMGEGKGRERVLDAIEKTVLDVFNATQKNALGQA
                     IFHRLVLEYVQCIYKFLDGEASSKKMHELLAAGAESFPEIVHTKDGSAVVRELIVRGN
                     AKDRKQILQPLRKHVEALCKDGDAQMVLFTAFDCVDDTKLMGKAFVSDIISLAPDLAF
                     DKHGRRAIFYLLTPTSTRHFIHASLTSLAESAQKAKELGTSKKDMDVRRKELLSYANE
                     GLVKLVEEKGEVMVRDPGAGLVVQEILLYAQGDKSAAIQTLASALTLPYPDPAPLDPN
                     PDPTVSHPLDLSHAIRTYKLLLSGGHFDHKTQTLSIPDSSLSPAFSRAVWDALTSAEA
                     GGAENIERVCKGNAPFVMVELIEGMKKRGDGEEVKKILGKKGVKETVEKSVRKGTALL
                     AEKIGEL"
     gene            complement(516821..519721)
                     /locus_tag="CNB01750"
                     /db_xref="GeneID:3255580"
     mRNA            complement(join(516821..517112,517190..517279,
                     517331..517604,517657..517973,518027..518986,
                     519062..519175,519230..519721))
                     /locus_tag="CNB01750"
                     /product="D-lactate dehydrogenase (cytochrome), putative"
                     /transcript_id="XM_024656493.1"
                     /db_xref="GeneID:3255580"
     CDS             complement(join(516952..517112,517190..517279,
                     517331..517604,517657..517973,518027..518891))
                     /locus_tag="CNB01750"
                     /codon_start=1
                     /product="D-lactate dehydrogenase (cytochrome), putative"
                     /protein_id="XP_024512142.1"
                     /db_xref="GeneID:3255580"
                     /translation="MVPDMTEFNDKTGKMSRSESPSVERIYILLPVLQPTHTIGNTRM
                     VHFPLSSSSAFIRRSRHLSRRNPTVQLPATTSRLFWRALSLSSRSPKYTTLTTSHISH
                     IRKLLSSPSSVLSTLDGSATSDDLLPHNLDWMGKYLGQSKVLVKPKTVEEVSRIVKWC
                     DENDVAIVPQGGNTGLVGGSTPIHDELILSLSSLNSIRSFDPVSGILIAEAGLILEKA
                     DSFLESRGFVFPLDLGAKGSCQIGGNVATNAGGLRLLRYGSLRGSVLGLEVVLPDGRI
                     WDGLSGLRKDNTGYDLKQLFIGSEGSIGIITAVSILCPHRPRSTNVALFSLPSYAACL
                     EVFSQAKQHLGEIMSAFEMFDNTAYEAVKKHGGAKKVFEKEGDFYCLIETGGSSAEHD
                     SEKLTSLFDHLLSSSFILDGVLAQDSAQIHSLWQIRELCPESLSKAGKAYKYDLSVPV
                     EKMYEVVERMRAHLKERGLLGGKVKYVAGFGHLGDGNLHLNVVAEGNEFSEEVQCIIE
                     PFVYELVAEYNGSISAEHGLGSMKAPYISYSQTDTSIELMRRLKKLFDPKGIMNPYKF
                     IL"
     gene            520888..523058
                     /locus_tag="CNB01760"
                     /db_xref="GeneID:3255860"
     mRNA            join(520888..521021,521522..521586,521648..521711,
                     521765..521829,521885..521963,522016..522044,
                     522096..522160,522213..522386,522442..522537,
                     522595..522648,522703..523058)
                     /locus_tag="CNB01760"
                     /product="expressed protein"
                     /transcript_id="XM_568844.2"
                     /db_xref="GeneID:3255860"
     CDS             join(521550..521586,521648..521711,521765..521829,
                     521885..521963,522016..522044,522096..522160,
                     522213..522386,522442..522537,522595..522648,
                     522703..522813)
                     /locus_tag="CNB01760"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568844.1"
                     /db_xref="GeneID:3255860"
                     /translation="MAAVTSTPTEVPQFQIVSKIDSIPVVHDSVAYAQSLINSNKLSA
                     KLYETAVGVASKSYDVATPVLTRTKPLLESADGLAVATFDRAAATFPYPFKTPTEELI
                     VVKQAKGVYDNKLHPAISGVIAKAASVNSAIGARASATIHTSQDLAHALLEQLRQITE
                     HGVQLPSALFEGASKASNDVKEIVFAKEVSVQEKSNKFASYVLEQAKPLIEEIYNYVY
                     TAKTKAAEKGNNTAEEASEASDKVADKANGGVEHVENGQ"
     gene            complement(522994..524953)
                     /locus_tag="CNB01770"
                     /db_xref="GeneID:3255878"
     mRNA            complement(join(522994..523362,523426..523632,
                     523683..524036,524084..524212,524272..524349,
                     524399..524572,524636..524953))
                     /locus_tag="CNB01770"
                     /product="expressed protein"
                     /transcript_id="XM_568845.2"
                     /db_xref="GeneID:3255878"
     CDS             complement(join(523108..523362,523426..523632,
                     523683..524036,524084..524212,524272..524349,
                     524399..524572,524636..524848))
                     /locus_tag="CNB01770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568845.1"
                     /db_xref="GeneID:3255878"
                     /translation="MRALLLSRQSCQQLSTTLFGRPCLQLAKCLGHCTKRHTSTKAAN
                     NDWMTFLKPTSPSSPDPCGQALLFAGLGSYPHTPHAPTPSSLKIWEEASDALFSPDAT
                     IGYQPCGITDVGNIKGGLRSWVEGRSLDNLMKNPDVTAAFILTSSIAILASEQEKSGS
                     NSLLPPRTTHLAGHGFIGTLTALVTAGRLDLATGVRLARIYASLPASPAGRSRTHLTT
                     VLSARHFHSLSAPSFSVPPASLSYTPSDVFLHDSAETVDCDPDEAPKTPMPAQRRRAM
                     QLILDEIHGLEREWIEQSDEGHEEWAAAGIINSSKVVVVTGTHHAVLQVIERLQQLNL
                     ANPVMDVHMPCPYHTKLMNHAVPKFKDVLERCHFVNKPGGPIILDPMTTHPIGRSATV
                     LLPHLTAQLRWRKTLSRLCGTPVPEVGKFLTVGRGAKGLGIMLRGELRGRGQNAAPIV
                     IEEMGVGPRDERLVRALRS"
     gene            525415..526657
                     /locus_tag="CNB01775"
                     /db_xref="GeneID:36392729"
     mRNA            join(525415..525618,525692..525707,525795..525826,
                     525886..525981,526032..526657)
                     /locus_tag="CNB01775"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658451.1"
                     /db_xref="GeneID:36392729"
     CDS             join(525569..525618,525692..525707,525795..525826,
                     525886..525981,526032..526167)
                     /locus_tag="CNB01775"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514207.1"
                     /db_xref="GeneID:36392729"
                     /translation="MRSTICKMAQDIIQFKVSGAVQGVNFRYHTQKEAQKLGLRGHCY
                     NHSDSSVQGVAAGSSEKVEQFRKWLEKGPSSAEVHNVELIKELRNASEADVEKAVGTS
                     SGFEVRR"
     gene            526715..530981
                     /locus_tag="CNB01780"
                     /db_xref="GeneID:3255697"
     mRNA            join(526715..527258,527314..527406,527453..527776,
                     527825..527986,528042..528104,528157..528507,
                     528561..528649,528712..528796,528860..528963,
                     529021..529113,529171..529185,529234..529300,
                     529352..529496,529557..529799,529857..530264,
                     530320..530558,530620..530703,530763..530981)
                     /locus_tag="CNB01780"
                     /product="signal transducer, putative"
                     /transcript_id="XM_024656494.1"
                     /db_xref="GeneID:3255697"
     CDS             join(526824..527258,527314..527406,527453..527776,
                     527825..527986,528042..528104,528157..528507,
                     528561..528649,528712..528796,528860..528963,
                     529021..529113,529171..529185,529234..529300,
                     529352..529496,529557..529799,529857..530264,
                     530320..530558,530620..530634)
                     /locus_tag="CNB01780"
                     /codon_start=1
                     /product="signal transducer, putative"
                     /protein_id="XP_024512143.1"
                     /db_xref="GeneID:3255697"
                     /translation="MPIMDYLTANTASRTPTASSSSIDSLSGSSDTKAYKQSRSKSFG
                     GVFKRHRLSWGGPSIEKFRLGERDSSNEDCSGGIGGKPYNEQQPLDNLNGQSYVNHIR
                     RSSDSSQLIRDLRKGNESEDFKAIDTYRLPGIGFVGTNASKDAIERPPWRSIRCEESS
                     GSLLSPGWSPALSDRLYEDLAPAPQNPSHRYLTPQDSYSLLLTYQSSAVTSHSSFDVS
                     TSSRCPIDQKMSSSSADQELSPEWHQIVDKSLCDSLDKMEQRRQGLWWEIIKGEREYV
                     RDMGIMHHVFIQELRDCRPPVIESTKLEPFIAEVFSTAVILSHAHETILRNLMERQRI
                     EWPLLTTATDIYLQIMLEIVDPYEAYMKNYPFAEARVRRESVKNQEFHKFLELRNTAS
                     LTNRRDIFTFLSRPVTRLPRIILLLGELLKVTPKEHADKEDIPVLKEMLERVVKDTEH
                     GIEAAAVKIKLWNIAERLLFKKGEITDLDISNPKRTFVHSSYLFRRIRSESNWHGWQD
                     IYAILLDNYLLLTREEEGGKYVVISRPIHLDFLNIISTDGAPEKRYDHSAHGNHKKNN
                     TVAMDTMLPAEALMYPFTVSIGGPEGKAYTLCTTDQAHRSEWIDKIQNTQMLRKYDLE
                     SNRIFVTHTISMPSKMRSPVICSETFIVHGRDTVAFATETSVWLGWLRDTHSFRELVQ
                     LQNGQISSIALVPEFSWLLVLSSGTLLAFNLKRMMPTSDPSTWMSMGRAQGQLLNQSG
                     HSVAWVYTGKTKGRTLITYVVYGRNTHGCTLNFLEPLFDNSYPSASSLLSDPVFRSFA
                     SLHLPGHASSITFFRQTVAITTEKTIVIAEPGNPVYNCVPTAGSTAFLAEDAVVAKLL
                     NGQGRTRAEGRPLGMWQTGGDEFILVYDWGACFVTKFGEICRSGAFLIWDLFPVYAIF
                     RSPHLLLFDDSSRAEVRNVTSGKMCEVIEEKGLRMMPRTREEQGMLGWSEKGLIQLVE
                     TVEL"
     gene            531021..533801
                     /locus_tag="CNB01790"
                     /db_xref="GeneID:3255779"
     mRNA            join(531021..531324,531380..531482,531531..531727,
                     531786..531979,532027..532170,532213..532543,
                     532594..532825,532884..533083,533148..533191,
                     533240..533266,533320..533422,533474..533543,
                     533596..533801)
                     /locus_tag="CNB01790"
                     /product="peptidyl-prolyl cis-trans isomerase, putative"
                     /transcript_id="XM_568847.2"
                     /db_xref="GeneID:3255779"
     CDS             join(531114..531324,531380..531482,531531..531727,
                     531786..531979,532027..532170,532213..532543,
                     532594..532825,532884..533083,533148..533191,
                     533240..533266,533320..533422,533474..533543,
                     533596..533713)
                     /locus_tag="CNB01790"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, putative"
                     /protein_id="XP_568847.1"
                     /db_xref="GeneID:3255779"
                     /translation="MSEGAGSSSNLGKRPRDGENTSPAPENVNNNGLEVPEMPPADME
                     DSSDDEIGPMPGGDIVISKGRKKKRTVLPHEKLYLASLPDTDRYYKSFMHREPLNSIT
                     MTRTNFVITTSIDGHLKLWKKQEQGIEFVKHYRASLKAIVGVSASDDGKLFATVSEGG
                     EGRVFDVVNFDMINILKFPYTPKACCWVHEPGAGQPLLAVSDVASPTIRIYDGRGDGK
                     PLYELTKLHRAPVHLMVYTAKYDCVVSADEDGFMEYWQPSEPWGLPSVPGLWQYKSST
                     DLFHFKKSKTIPTCVTFSPNSSHFVTLALPSRAVHIFNFLTGKLTRTYDESLTAVMEM
                     QQADTAVFKLDDMDFGRRLAAERELDRSESGPGGLLRTANAVWDESGNFVLYPTMLGI
                     KVVNTVTNKVARVLGKDETLRFLNIALYQGAPAKKGVTTVQMAASANPLLQDKASRDP
                     HLFATAYQKQRFYLFARSDKEESKGERDVFNERPTREEQTVAVPAEEKKRPSAKRCTI
                     HTTKGDISVQLFPDEAPKTVENFITHARNGYYNGTIFHRIIKKFMIQGGDPFGDGTGG
                     ESIWGGTFEDEISPRLRHDRPYTLSMANAGPGTNGSQFFITTVPCQWLDGKHTVFGRA
                     VGGLDSVDAIEDAKTDKNDRPFEDISISSITVE"
     gene            complement(533809..534827)
                     /locus_tag="CNB01800"
                     /db_xref="GeneID:3255688"
     mRNA            complement(join(533809..533929,533982..534041,
                     534097..534179,534231..534312,534400..534460,
                     534554..534827))
                     /locus_tag="CNB01800"
                     /product="macrolide-binding protein FKBP12"
                     /transcript_id="XM_569051.2"
                     /db_xref="GeneID:3255688"
     CDS             complement(join(533907..533929,533982..534041,
                     534097..534179,534231..534312,534400..534460,
                     534554..534649))
                     /locus_tag="CNB01800"
                     /codon_start=1
                     /product="macrolide-binding protein FKBP12"
                     /protein_id="XP_569051.1"
                     /db_xref="GeneID:3255688"
                     /translation="MFRSILTTSRPLVRQPLRQFTTTAIKMGVTVENISAGDGKTFPQ
                     PGDSVTIHYVGTLLDGSKFDSSRDRGTPFVCRIGQGQVIRGWDEGVPQLSIGQKANLI
                     CTPDYAYGARGFPPVIPPNSTLKFEVELLKIN"
     gene            complement(534878..536098)
                     /locus_tag="CNB01810"
                     /db_xref="GeneID:3255961"
     mRNA            complement(join(534878..535000,535051..535318,
                     535390..535486,535546..535644,535699..536098))
                     /locus_tag="CNB01810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569318.2"
                     /db_xref="GeneID:3255961"
     CDS             complement(join(534967..535000,535051..535318,
                     535390..535486,535546..535644,535699..535983))
                     /locus_tag="CNB01810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569318.2"
                     /db_xref="GeneID:3255961"
                     /translation="MMPSQRVILVTGASGGIGRASSIALSNTFPSTAQPEQLVLVLVG
                     RRQAELEETGRQCRDGTLIEVATGDASNEEDVKRIFETVKSKYGRLDVLFNNAGINDK
                     SPGEFEDQDMDVFRKVLDINIMSAVLFTKYAFHLMKAQEPQGGRIINNGSISATSPRP
                     NNTAYTLSKHAIHGLTRSTSLDGRKYHITCTELDIGNAATDLGSHVTAGSLQADGTKK
                     VEPVMHVDNVAKTVAFIASLPAEADILSLEIIASGMPYVGRG"
     gene            complement(536418..539489)
                     /locus_tag="CNB01820"
                     /db_xref="GeneID:3255611"
     mRNA            complement(join(536418..536657,536715..536896,
                     536948..537040,537095..537292,537349..537440,
                     537495..537696,537747..537802,537857..537923,
                     537974..538338,538392..538529,538576..538627,
                     538679..538760,538814..538891,538946..539489))
                     /locus_tag="CNB01820"
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /transcript_id="XM_568848.2"
                     /db_xref="GeneID:3255611"
     CDS             complement(join(536511..536657,536715..536896,
                     536948..537040,537095..537292,537349..537440,
                     537495..537696,537747..537802,537857..537923,
                     537974..538338,538392..538529,538576..538627,
                     538679..538760,538814..538891,538946..539371))
                     /locus_tag="CNB01820"
                     /codon_start=1
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /protein_id="XP_568848.1"
                     /db_xref="GeneID:3255611"
                     /translation="MLGTTVGFHVHLRQQLFASAVRVRPMAGSRCLDVLPTQPRLLLQ
                     QRPRLCRTLTNRSSQPSIQQSRSDKSAQPELAEIDTTTPERPAKRQSLISRLTSKVSL
                     QSTKGASSENGESETGASSVRKLISLAKPESRHLSVAVGLLLVSSSVSMLVPLTIGKL
                     IDFFSTNSSTFLGLSFPVAAGLLAVTFCVGAAANAGRAIIMRTSGQRIIARVRNQAYH
                     STLRQEPEFADRSAGDIVSRLSVDTNILGDSVTSNLSDGLRALISATVGVAAMFWISA
                     KLTLVMLCVVPPVSLGAVFYGRYLRKLSNLTQEAVGDMSKVAEEKLNAFKTVAAYNSQ
                     SLEANLFSQKVDRVFQLAKKEAYMTGIFWGASGLTGNLAMLCLLGYGGHLVATQEITV
                     GDLTSLLMYSAYVGGSVSGMTGFFTGLMRGVGAGGRVFWLLDRQSHIPLEAGVKLSAA
                     RNGPIVFENVRFRYPSRKEVEVLKGINMTIEPGMSVALVGSSGSGKSSIQALLSRFYD
                     PEEGKITFDGTDIREFTPESWRSRIGVVFQDPILFAGTVHDNIAYGSPDITREDVEEA
                     ARAANCDFIWDLPDGFDTMIGKASLSGGQRQRISIARALVRNPSILLLDEATSALDST
                     SENAVNAAIDDIIHKRNITVVLAAHRLSSIAMAERVVVLENGVVSEAGRYDVLSRREG
                     SRFRTLMAAQLLVEKNSGVEDGAPEEEGEGNKRELEEARIIEK"
     gene            complement(539591..541170)
                     /locus_tag="CNB01830"
                     /db_xref="GeneID:3255566"
     mRNA            complement(join(539591..540930,541003..541170))
                     /locus_tag="CNB01830"
                     /product="expressed protein"
                     /transcript_id="XM_568849.2"
                     /db_xref="GeneID:3255566"
     CDS             complement(join(539783..540930,541003..541075))
                     /locus_tag="CNB01830"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568849.1"
                     /db_xref="GeneID:3255566"
                     /translation="MAVVLRSNTDLVYLPDHGFVGEEGAFRILPQITRQIHRLNVSHN
                     PLGSSGALILFKGLSALRSKHSAPEIGMGIWGLHEVNLAATGVDDEALDGILSYAKKD
                     GLLRQVYLQGNIVRLLENVESIALSLNMSHVEMISLTNNSLIDSDGLQRFLHNLNSPH
                     LRELHLAACGLTPEAAPAIAEFIRSPRSRSLDCLLLNGNQLGGTGVTQIVDAIEEDNR
                     SLLMVGLLANHHSEARVDDGNARELPGLVTANQKEGEQLEYQVHRRLPALLDRNRILT
                     RRVRTAASRTISAARIILNALPPSNEVTAQRVISDVSSGTSSYNPFRLLDLPGEVIHL
                     IVRHTSGDPRALSEGQFTRIRHEAVNRSALKAWSRKRIELLKGKNIMEEKDAIVELKE
                     LWLRVGKWDKWERE"
     gene            541354..542393
                     /locus_tag="CNB01840"
                     /db_xref="GeneID:3255749"
     mRNA            join(541354..541593,541648..541799,541866..542078,
                     542144..542393)
                     /locus_tag="CNB01840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656495.1"
                     /db_xref="GeneID:3255749"
     CDS             join(541434..541593,541648..541799,541866..542078,
                     542144..542311)
                     /locus_tag="CNB01840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512204.1"
                     /db_xref="GeneID:3255749"
                     /translation="MSLGRYIGWSILAFTYLVLAILLRLIFLQPSKTSRASYRPKDAK
                     CSLGVFLGSGGHTSEMKALLSTLDYERYQPRTYIYCHGDDLSLRAVSDIESSKGGLIS
                     SKMYYLLSLPRARRVGQPLLSTMVSVLKTLYIAALRLFLIPLLKNPRRPFVDLLIVNG
                     PGTCVVLVLVSYIRRILGLEYTRIIYVESFARVKSLSLSGKMIRPLADRFLVQWPDAS
                     DSDNVIHKGLLV"
     gene            complement(542308..543971)
                     /locus_tag="CNB01850"
                     /db_xref="GeneID:3255645"
     mRNA            complement(join(542308..542938,542990..543082,
                     543139..543567,543629..543971))
                     /locus_tag="CNB01850"
                     /product="expressed protein"
                     /transcript_id="XM_568850.1"
                     /db_xref="GeneID:3255645"
     CDS             complement(join(542384..542938,542990..543082,
                     543139..543567,543629..543829))
                     /locus_tag="CNB01850"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568850.1"
                     /db_xref="GeneID:3255645"
                     /translation="MSLPAPGSPGFSSLLLRHVLNHSALKGWAVNASLFSTILLILIV
                     KNGGLIIDIDNSKSDKIVEVIRAMMESIFGLSVGHLSLSSSTYTEELPWKLFRSSPAC
                     ISQFSAHASESIKSLKHDLDSNTRNKRDIHHHLDKGHLIVPQVLVLTGLESAASTVQM
                     KLCEYFTKKRIEVRAGQVNGTLGDEMLKLCDFNPMVIWIRRNGADVPWWVIDHFMCAT
                     SIQSSEISLPPNDIDLGAVIPQSYLATLSLLLPYTHIHPPLAVHISNLFSALTCHPSL
                     HSAITQRAVRAFPEYVRAHRLLVGDFALPNGFEIRLQEEQDGRARAAKDRQGTGGGVV
                     GVHTWNVLAGEEPDINDLRGDCGRGEEELEDWYATPLNVQGVWKVCMIHRIRKRQVRD
                     EVMWLMKGSASGGMKKGMGRGVGKILDEILTAV"
     gene            complement(544243..545165)
                     /locus_tag="CNB01855"
                     /db_xref="GeneID:36392730"
     mRNA            complement(join(544243..544399,544458..544656,
                     544740..544958,545017..545083,545132..545165))
                     /locus_tag="CNB01855"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658460.1"
                     /db_xref="GeneID:36392730"
     CDS             complement(join(544330..544399,544458..544656,
                     544740..544958,545017..545083,545132..545140))
                     /locus_tag="CNB01855"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514208.1"
                     /db_xref="GeneID:36392730"
                     /translation="MEGQIDNAKKFLNSEQGQGLKQQLFGGGDSNTEQDNAPTKDIQG
                     NQGAPGQFGQQGQYGAVTGSGFGGSLAKDAQGQSLQGGKQGQKDSPYEGMDNDDTTAS
                     GGYGRNAQGGAFSRQNQMGTDHLNHLNPGGVYDGDEGREGYKTGYSTPGYRKEDETEE
                     QLRQSNRNVYGQQSDERGSKDNDYHEI"
     gene            545559..547076
                     /locus_tag="CNB01860"
                     /pseudo
                     /db_xref="GeneID:3255826"
     gene            complement(548044..551105)
                     /locus_tag="CNB01870"
                     /db_xref="GeneID:3255783"
     mRNA            complement(join(548044..549336,549385..550017,
                     550070..550823,550891..551105))
                     /locus_tag="CNB01870"
                     /product="cellular response to glucose starvation-related
                     protein, putative"
                     /transcript_id="XM_024656496.1"
                     /db_xref="GeneID:3255783"
     CDS             complement(join(548338..549336,549385..550017,
                     550070..550681))
                     /locus_tag="CNB01870"
                     /codon_start=1
                     /product="cellular response to glucose starvation-related
                     protein, putative"
                     /protein_id="XP_024512251.1"
                     /db_xref="GeneID:3255783"
                     /translation="MGNTPSSHAAPPPSSSTNTASASERERASSSAQPINPSTAGRIQ
                     RPSVSFHSGLTPPTSPPSPPPPSTPPLLPYAGHLSPQNPHCLSHPQAHDYSKSAVTKL
                     ILDGKLAPFYRGLEDFEEDWTEEDIGRILTETREKDYAEGVANSYTERAKEEREGGSS
                     IGNVTKKMGIHKSKELRREGEKEERERRERRAYLNAVECPICFLSYPPNINTSRCCQQ
                     PVCTECFVQIKRSEPTITHLESEPACCPFCVEADFGVIYERPPTPMSSLSSTALATSP
                     AEAGTPSFGQAFSVGSDAELAVGPGMNPIQKETIRRKSVSSKAKEVVTIDEIRPDWEH
                     KLNSVKAAAARRASRRIIMRQVGDRLVPIGYTSSRAPGTADFSMSVPQIQNSVQSGAD
                     ESGSNPRRSSRRRGSNRERDIEELMIMEAMRLSLLDHEEHQRRQADDLRNNSTTSNVA
                     PSTPPSDAPANTSTVVQSPGPPPGPSTAAAFAATAPSTSSPTESPRRLSGQSDKQSGA
                     SKLLSKFSNVRARANSSASSKGLGSGDFKNTFGRTRDNSGGTQTLSSSPALVATQTSA
                     SASTSNSAGSSAAPSPIPSISPLATTHTQPLNKTSVPTHSSGLSLTTSVPAAPITTLA
                     SPGASGQNTGEADLLGGPSAPITQADAPVGLPHLSADMPTLIPDAPGDRAATAFTSVV
                     LPEGDPGTALPNSDTAPPPSTLSDSSAPTSRVGMHRSHSCITEVTEPEAEGNGPGYAR
                     LDTDEER"
     gene            complement(551367..555440)
                     /locus_tag="CNB01880"
                     /db_xref="GeneID:3255795"
     mRNA            complement(join(551367..551633,551708..552916,
                     552965..553135,553195..553353,553405..553486,
                     553538..553641,553694..554116,554173..554292,
                     554346..554592,554639..554861,554914..555078,
                     555130..555440))
                     /locus_tag="CNB01880"
                     /product="valine-tRNA ligase, putative"
                     /transcript_id="XM_569118.2"
                     /db_xref="GeneID:3255795"
     CDS             complement(join(551415..551633,551708..552916,
                     552965..553135,553195..553353,553405..553486,
                     553538..553641,553694..554116,554173..554292,
                     554346..554592,554639..554861,554914..555078,
                     555130..555337))
                     /locus_tag="CNB01880"
                     /codon_start=1
                     /product="valine-tRNA ligase, putative"
                     /protein_id="XP_569118.1"
                     /db_xref="GeneID:3255795"
                     /translation="MLRHALRSVQRILTPSPIVYPRLQRTYAAMSAEETKVPSQESLP
                     VEEINPAGPQPAIATEGAAEKSKKGAKKEAKRLEKLAKAATKTSAAQSQAPKKEKAEK
                     KEKKAEVPAEAWVDTTPKGEKKDVSGNFPSGYDPIQVEAAHYDWWNAKGFFKPRYGAD
                     GKPLDKGTFCITFPPPNVTGNLHIGHALTVSLQDALIRWKRMQGQTVLYLPGYDHAGI
                     ATQAVVEQRLMKTEGHSRHHYGREKFLEKVWEWKDQYQGKITNQMTRLGGSFDWDKVA
                     FTMDDNLSTAVREAFVQMHEKGLLYRANRLVNWCVYLNTSLSNLEVDQLHLTGRTLLN
                     VKGYDAKERFEFGVITSFAYPIENSDERIIVATTRPETMLGDTAIAVHPDDPRYTHLH
                     GKFAVHPFNGRRIPIVTDAITVDMEFGTGAVKITPAHDPNDFECGMRNNLEFISLMND
                     DGTYNENAGPYKGMKRFHVRNAIVKDLKEKGLYVEQKDNEMQIPICSRSGDVVEQIIK
                     PQWWISCKPLAEDALKRTRAGELEIKPKTSAGDWVRWMENMQDWCISRQLWWGHRCPA
                     WLLKFEGESPDTSDDKNWIVARTEEEAQEKAKARANGKNFILEQDDDVLDTWFSSGLW
                     PFSTMGWPNKTPDMEHFYPNSILETGWDILFFWVARMVFFGNTLTNVMPFKEVYCHPM
                     VRDAYGRKMSKSLGNVIDPLDVITGQKLEKLHNDLRMGNLPEKEILKAEEGQKKLYPK
                     GIPQCGTDALRFTLCNYTSGGRDINMDIGRVEGYRKFCNKLWNATKFCLFRMDLVDLQ
                     GVRQTSAFVPNASHLPTGKEGLVEKWLFHKLNLASAAISDALENRDFSEASTVAYQYF
                     LNDLCDVYIEATKPIFEANSDPAAKLSAQNTLYTCLEAGLKLLHPFMPYVTEDLWQRL
                     PRREGDSCETIMLAPFPEKIPEQEFPAEVASFDLVVDCIKSARSVIGLYNLPTNGKTP
                     EDKITVIIQARNAEQLELLKSVETVIVGLTKGCGKVEWIQEDSEIPRGCGTEVVTTDI
                     SVHIPVQGKVDAASEIDKLEKKSIVVEGQKAKLQKVIQQPNYEKTVKEDVRQQNDEKM
                     EKIEVEIEALRMAIERFKGLL"
     gene            555551..557561
                     /locus_tag="CNB01890"
                     /db_xref="GeneID:3255772"
     mRNA            join(555551..555610,555655..555684,555733..555767,
                     555817..555948,556001..556131,556194..556285,
                     556345..556477,556526..556634,556688..556828,
                     556875..557108,557167..557279,557344..557561)
                     /locus_tag="CNB01890"
                     /product="intracellular protein transport-related protein,
                     putative"
                     /transcript_id="XM_569119.2"
                     /db_xref="GeneID:3255772"
     CDS             join(555602..555610,555655..555684,555733..555767,
                     555817..555948,556001..556131,556194..556285,
                     556345..556477,556526..556634,556688..556828,
                     556875..557108,557167..557279,557344..557471)
                     /locus_tag="CNB01890"
                     /codon_start=1
                     /product="intracellular protein transport-related protein,
                     putative"
                     /protein_id="XP_569119.1"
                     /db_xref="GeneID:3255772"
                     /translation="MISAFFIFNQKGEVLISRLFRSDVKRSLSDVFRIQVISNPDVRS
                     PIITLGSTSFFHVRVNNVYIVGVTKCNASAALVFEFIYRFITVARSYFGKLDEESVKN
                     NFVLIYELLDEIIDFGFPQNSEIDTLKMYITTESIKSEMAVREDSSKITIQATGATSW
                     RRSDVKYRKNEAFVDVIETVNMLMSKEGSILRADVDGQILMRAYLSGTPECKFGLNDK
                     LVLQKRGGEQAAKSDSAVELDDCQFHQCVRLGKFDSDRSISFIPPDGEFELMRYRSTT
                     NINLPFRLQTHVVEPSKSRVEYTIHLRAAFDSKLNANNVVLRIPTPLNTTGVRSKVGI
                     GKAKYVPGENVIVWKIPRIQGAQECTLTAEADLTATTHRQAWSRPPIQVDFSVVMFTA
                     SGLLVRFLKVFEKSGYQSVKWVRYLTKANGSYQIRF"
     gene            complement(557536..559163)
                     /locus_tag="CNB01900"
                     /db_xref="GeneID:3255788"
     mRNA            complement(join(557536..557857,557918..558679,
                     558730..559163))
                     /locus_tag="CNB01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_569120.2"
                     /db_xref="GeneID:3255788"
     CDS             complement(join(557693..557857,557918..558679,
                     558730..559101))
                     /locus_tag="CNB01900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569120.1"
                     /db_xref="GeneID:3255788"
                     /translation="MPSKLLLPLLKPTLRSFRYIPTSLITLPASVGLHFTSHPAPTIS
                     NYVVSPTTSPLHLPLIFTLASIPIFYLLGLVTGKVSWVDKAWPLYPPAISAMLYGWVL
                     VNHAGGVYAHNIPRVTFMFGLQLIWSFRLFSHAVKRGFYNPKSEDYRYTVFRKLVPRW
                     AFALVHAFAVAFAQPILLMSLSLPLYAALVSPPASKQTDGWRTLTFGNISRLLPSHLR
                     KAVPPHIAVLNMSDYIMTMVSLLIIYAEYQADKKMYQFQQGKHNKISSLSKEQLIHPP
                     VPQSGESQPLVQKEGLPKPSPYPASHHPGFPTQGMWRFSRHPNFAAEQLFWVSQAMFP
                     GLSGKDNGISGKGWWAGCVFGPCFALSLLFLSSTTLTEWITGIKYPAFKNYKGIVGEF
                     LPQETLFKWIWTKITGSRERLYQAVYGPPPGEKQDSSRLR"
     gene            559386..560290
                     /locus_tag="CNB01910"
                     /db_xref="GeneID:3255790"
     mRNA            join(559386..559566,559635..559732,559794..560290)
                     /locus_tag="CNB01910"
                     /product="60s ribosomal protein l19, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_569121.2"
                     /db_xref="GeneID:3255790"
     CDS             join(559537..559566,559635..559732,559794..560103)
                     /locus_tag="CNB01910"
                     /codon_start=1
                     /product="60s ribosomal protein l19, mitochondrial
                     precursor, putative"
                     /protein_id="XP_569121.1"
                     /db_xref="GeneID:3255790"
                     /translation="MSKAAAAQIVKIIVPAGKAAPTPPVGPALGARGVKAMDFCKEFN
                     AKTAHYQTSLPIPTMITINPDRTFSFATRTPPVSYLLKKTTGIDKGSGQGMKVKTGQV
                     SLKHVYEIAKIKCMDEDLKAVGLERVARGVVGTARSLGLEVVP"
     gene            complement(560212..561988)
                     /locus_tag="CNB01920"
                     /db_xref="GeneID:3255721"
     mRNA            complement(join(560212..560477,560539..561281,
                     561332..561717,561767..561818,561866..561988))
                     /locus_tag="CNB01920"
                     /product="iron ion transporter, putative"
                     /transcript_id="XM_569122.2"
                     /db_xref="GeneID:3255721"
     CDS             complement(join(560282..560477,560539..561281,
                     561332..561717,561767..561818,561866..561889))
                     /locus_tag="CNB01920"
                     /codon_start=1
                     /product="iron ion transporter, putative"
                     /protein_id="XP_569122.1"
                     /db_xref="GeneID:3255721"
                     /translation="MTLTDYFSPVAFFILLRESLEAGIIIAVLLGFITQIIPKPSSHP
                     RTLSTPGHPANLPRHSGESAQSENSGTQLLSSGRASIDRGYGASSRSVSPARIERLEV
                     ENVAEEVGKDEGLLGADVDRRAIMKKMRVQIWSGAILGGSVAIAIGTVFLYVFYTYTR
                     DLWQDAENLWEGGFCLLAAVLILVMSLAFLRLPHAQTKWRLKLLSAYQSQSNDVESDS
                     RPGSPDGRPHDNSLGHPSQVTTNPRRRRANRASAILFGLPFITVLREGLEGIVFLGGI
                     GLSESPSSVIGGGICGLFAGALCAYLLFSSTTPLSVHTFTTFSSLLLFLIGAGLASRS
                     AYALERQYFINHVGAAAAESGNGPGSYRVKGNIWHLTWWDPEPGSGDNWAQVAQAVLG
                     WNNTGTWWTISTYMFYWLLITFTLIYMKWAEGRCAIFGVLSSRGKELERSRRVRGTAG
                     EDDEEVLLDDRSDVGE"
     gene            562180..564273
                     /locus_tag="CNB01930"
                     /db_xref="GeneID:3255696"
     mRNA            join(562180..562404,562454..562541,562588..562632,
                     562687..562718,562777..562787,562834..562858,
                     562912..562980,563033..563115,563169..563199,
                     563244..563352,563402..563463,563515..563525,
                     563576..563840,563900..563966,564022..564273)
                     /locus_tag="CNB01930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656497.1"
                     /db_xref="GeneID:3255696"
     CDS             join(562216..562404,562454..562541,562588..562632,
                     562687..562718,562777..562787,562834..562858,
                     562912..562980,563033..563115,563169..563199,
                     563244..563352,563402..563463,563515..563525,
                     563576..563840,563900..563966,564022..564077)
                     /locus_tag="CNB01930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512225.1"
                     /db_xref="GeneID:3255696"
                     /translation="MNNCAGRSLFTIHFPLPPFTSPAPMSQYSHRFSFAPSSRGEVGE
                     GVGYVNPPGWSADLKQEELLEDPKDQVEITPSLPQVGNRKTQLSAAIIIPIWIALSSA
                     VILYNKYLYTNLAYSYPVFITAYHLGCAALGTRILRATTNLLDGLDKIEMTRELYLRS
                     ILPIGVLFSGSLILSNTAYLTLSVSFIQMLKAFTPVAILLISAAFKLQVLNSRLILIV
                     LLISTGCVLAAYGELYFEMFGFICQVSAVAFESSRLVMIQILLQGLKMDPLVSLYYYA
                     PVCAIINAFFIPFTEGFAPFRHFLRVGPLIMLSNAAVAFGLNVAAVFLIGVAGGLVLT
                     LAGIFKDILLISSSCIFFGSPITRIQIFGYSLALVGLMAYKTSSSK"
     gene            564441..567433
                     /locus_tag="CNB01940"
                     /db_xref="GeneID:3255634"
     mRNA            join(564441..564585,564643..565640,565700..567433)
                     /locus_tag="CNB01940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656498.1"
                     /db_xref="GeneID:3255634"
     CDS             join(564539..564585,564643..565640,565700..567312)
                     /locus_tag="CNB01940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512226.1"
                     /db_xref="GeneID:3255634"
                     /translation="MACEASPVSTLYSTSTTYIPTTITTSTPVIVTPSPSTSLWLTSS
                     CTTSTSRQRDSGFENLLVKATGIGGSSIQSPQRASEADFVTTTSRTAKRDIASNIVEE
                     TGAEVEDIAVESGQAENSSSEVGRISASKTSQEPGQTSSLYSGEAKVGIVQLGTRTST
                     TLTYAFISTKQSPGTSPSLPTSAASDTITAWEWSQGRNVRERSQNIDRVTITSSLPNE
                     RRQWWSHSSSEYGNGSDDDDEWDDTSNDMSCNAITSSTTLFYAPITSWSTMYLTSSVA
                     SEVVMPTQTIWANCEPGITQMWTTTSTDLSQPTAQADQEVSQQATSMSTPEYSDSTTA
                     GGDGAWIVASSSGSVFSSPIITSSAGHMASFITTTFPSLSVFTAANPPQTNSKTAIPT
                     YITTVPVTTTATSEVVPSHTTSSTNTHDATAAADNTSSSSTISSTPSSASSHHSKAVS
                     VGAAIGGVFGLFALLALSLLIIRWWKRRQRIQRTNELRSSWFYGGDVPEPDMGIHDEK
                     DRGEYPFNNVGLQSRFSAPSLLSRQSLAISTFLTRPISHVRQGSGRFPPIFPFKHLRN
                     SFFSRSERSHKQQGNRAWADKYTNRPQSSLGGEFLKRKISPPRAFMMDPPIDANTDDQ
                     AGWEEGGPYPRVTPSLPVAAQASSRIELCEAIPVTWGSSYAATPPLRAQSQSASLDWR
                     SDKSQPKLNVVAPSETSHSVYSHGSTYIATGLSRGNTMKSTQSEGESMHTGEGVVNPA
                     ASNFPMPPLSFPMSHALSHDPYAPLHLPEIPSISFSPNFSHRNLHDSALTTRSTAQSS
                     GTWEYAAYADPGGASPVIVFPKGLDNARVTRDWYEKPLWDGKSMADPTSIYGVAIVKG
                     EVRRDERNRKSMKSVRWKDEGLDNEPRAL"
     gene            complement(567385..571058)
                     /locus_tag="CNB01950"
                     /db_xref="GeneID:3255757"
     mRNA            complement(join(567385..568837,568889..569182,
                     569297..569609,569661..569781,569831..570116,
                     570161..570232,570285..570440,570495..570517,
                     570572..570658,570714..571058))
                     /locus_tag="CNB01950"
                     /product="hormone-sensitive lipase, putative"
                     /transcript_id="XM_569123.2"
                     /db_xref="GeneID:3255757"
     CDS             complement(join(567497..568837,568889..569182,
                     569297..569609,569661..569781,569831..570116,
                     570161..570232,570285..570440,570495..570517,
                     570572..570658,570714..570987))
                     /locus_tag="CNB01950"
                     /codon_start=1
                     /product="hormone-sensitive lipase, putative"
                     /protein_id="XP_569123.1"
                     /db_xref="GeneID:3255757"
                     /translation="MIDQLLGRPSPNLRRSQVFIVLFFCIWRLYKGDGAPRPFPSRTE
                     SAFAPGPSGRRGLKARDKAGKSWIWRLWVQLVGKRAVAWIGKLNERLKHFTPYQLILA
                     TLTLVYALRHFDDLLGISAPEPLAKMYTRSYYRATYVNTAFDAGFSIAMNIRPKWLKD
                     ICSMLFSAYYLAYASEGDEVLRRFRAVCSVEMLRTTWEKTKNPYIRLITSSHRVRLPI
                     VRTVTIARPSNSSRSSLPPVKAMLFFPGSEEELASATELIVDFPGGGFIAMGPECHEE
                     RLRIWAKRTGKPVLGVDYGKAPEYPYPWAIEEGFDAYRTLMETKGEVIGITSGKLGIV
                     LTGDSAGGNICATIMLRILEHPTGIPKPVSMILAYPALDFNFTSWMSPQNLRVLRTEQ
                     SETQIPGLVHGKDHMRHKAPLSVVDDLEDRTRKSGSSKQKSWAKTLSGKLPGEEEDTH
                     EEDDEEEVQNARWDQRRDAEKSLAERVKTPREERRFEFTLLDSPAPLEGKEEQDLQVN
                     EMVETKRKKVPIGTRLTMTSRVGYFQDRIISPSMMRAMAILYIGPARNPDFETDYYIS
                     PILAPPHLLAHFPPVYFISGERDPFVDDTVIFSGKIREAKRARKAQAETAALSNPFKF
                     GETLRMSSGKRGGKSFAAKMDTPDPILSELDDDWVQMRIIEGWGHGFMQMSSLMREVD
                     PVLMEMADWIDESFEKAKEKQMDLEKLQAAKMAIPASPLSEDGSRTPVEAALLNNSIT
                     AHSVHIKPSREYGEATPGQASKGGDLGTAFAGDGEVDDGKDNMVTFTPKTKKRIPPPS
                     NFHTVPRRPSKESLALQRSPSAPKFDADETGSSGEAMTIQTPPLVNSAKRFLSVQGTP
                     KGSGAFAFFGSGKSAPTSKPRSGRISPTLFGIPRISPSPAGINGAPVTESNTNKITRP
                     PLSGAASAPDKPKKGLVAAAVASARAASPALAAAGFAPQSVGNVSEAELLRRRRMEAV
                     YGIGETKDGTGNEVDE"
     gene            complement(571184..573041)
                     /locus_tag="CNB01960"
                     /db_xref="GeneID:3255761"
     mRNA            complement(join(571184..571365,571424..571514,
                     571575..571650,571704..572222,572280..572530,
                     572584..572634,572686..573041))
                     /locus_tag="CNB01960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569124.2"
                     /db_xref="GeneID:3255761"
     CDS             complement(join(571254..571365,571424..571514,
                     571575..571650,571704..572222,572280..572530,
                     572584..572634,572686..572893))
                     /locus_tag="CNB01960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569124.1"
                     /db_xref="GeneID:3255761"
                     /translation="MGSPSSSARLTLLPSNYLSSQNPSSEITLQSLIDVSDRMANEAK
                     EALPYNFDECSYSKGYLRQSVWSCLDCGEKGVCYGCSISCHSEHRLIELWTKRSFRCD
                     CPTVSMQAEQPSGSKRRKCVLNRPETQPQLPNEKNRYSKNFQGKFCRCGRDYDPETEE
                     EAMLCCLGCEDWFHETCLNLRQLGDKTSNLTQPVAKDSQLPTLVTAPDDASSVLIAEE
                     VEEEEEDEQVLIPSDTYDSLICGECVLSNPFLTSQAGKEGFMIIEPRESSWVVIGRNM
                     RHEDEIKIGLGEKRGLEENEEASKRVKLDDGSEARGGDAFTDSEKRKGKGDVFLAHGV
                     RNRLKSQLDMNTISSLPFPLEDEEIYEPPQDVEQEETIEEATSRVVSSLPRIQAIEAL
                     HGYQRLKEQLNDMLRSHVQSGKTVSKEDIEELFEKLKATRERR"
     gene            573132..576785
                     /locus_tag="CNB01970"
                     /db_xref="GeneID:3255760"
     mRNA            join(573132..573728,573784..574267,574321..574548,
                     574601..574877,574930..575598,575649..575835,
                     575885..576785)
                     /locus_tag="CNB01970"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_569125.2"
                     /db_xref="GeneID:3255760"
     CDS             join(573200..573728,573784..574267,574321..574548,
                     574601..574877,574930..575598,575649..575835,
                     575885..576729)
                     /locus_tag="CNB01970"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_569125.1"
                     /db_xref="GeneID:3255760"
                     /translation="MPRSPYRSSNRSYRSPSPSRYDRSHPSSSSRRQDDRKASRYDDD
                     YSRDRERDRERERDRTRDYRDRDRDYDRRRDKDRYRDDDRDRRRRDDKDDRRREERDR
                     GSDRKRDSERRSPMSTIRVDPIVSLASPVPETEEEKKRKAKERLETWKRQRALKEGKS
                     AAATPEPKSTAPPPVTSGLPPKPTAFSLSRIGLPLKPTNPTPLKRSMAALDDEDTSDR
                     KLQKLDLPDFDPEVQSGDAAQVGSIGADLAVADGDEDDDTVVKKEEEKEEKMDIDKKA
                     EEDEEEDPLDAFMRDNVQQVVEVNKADAKRMGLRVAEDGSDDENQGQVVEKDKLAEAE
                     ALLQQAAAKSRKKDLPPPDHSKIDYEPFRKAFYVPPVEVLEMDEEEAELVRLEMDGIK
                     IRGQDAPKPVRNWGAFGLPQGCLDVIKHQGWETPTSIQAQAIPAIMSGRDVIGIAKTG
                     SGKTVAFLLPMLRHVRDQRPVSGSEGPIAVVMSPTRELASQIYKECQPFLKVLNIRAS
                     CCVGGSSISEDIAAMKKGAEVVICTPGRMIDLLTANNGRVTNVRRTTYIVMDEADRMF
                     DMGFEPQVMKIINNVRPSAQKVLFSATFPKTMESLARRILVKPLEITVGGRSVVAPEI
                     DQRVEVRDGDTKFTRLLEILGEMGEEHKDEDDFRTLIFVDRQESADDLFRELLQRGYV
                     CASLHGGKEQVDRDEAIKNFKNGDVPIIVATSVAARGLDVKELKLVINYDAPNHMEDY
                     VHRAGRTGRAGNKGTCITFITPEQERFSVDIVRALEASKAFIPDDLKKMSDSFLGKIK
                     SGKARAAGSGYSGKGLERIERRREEKDRAEKTTYGDTSEALSLSSREGAVIPYKAKTN
                     EFKPPETSHKGEADYTFTEIKVDIVNGPAPDRVSSQPVFNPKNAVASLPAQTLAALEK
                     AKKEGRGVDAANLANVVAKLTQSIELTKAEKLGLAAATSAPRLAPGARTKDPDATDWH
                     AIFPINDYPQKARWKATNKEQMTLLQEVSGASITMRGRFYPPGEEPALGGEPKLSLLI
                     ESNDEMRVRAAVEEIRRVLVEGSVQALNAVDRAGASGGRYAV"
     gene            complement(577329..579051)
                     /locus_tag="CNB01980"
                     /db_xref="GeneID:3255762"
     mRNA            complement(join(577329..578139,578195..578750,
                     578800..578879,578939..579051))
                     /locus_tag="CNB01980"
                     /product="expressed protein"
                     /transcript_id="XM_569126.2"
                     /db_xref="GeneID:3255762"
     CDS             complement(join(577436..578139,578195..578750,
                     578800..578879,578939..578996))
                     /locus_tag="CNB01980"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569126.1"
                     /db_xref="GeneID:3255762"
                     /translation="MLPQRPPWVVKDIANILGLDDESVKQMIVPDLESQNIEPRLRTH
                     LQDFLGPSQAAKDFTSRYLALRFPSLTNTPSSVPNTQLTPDADILKSKAKAKTPAHVS
                     TPTAGSSSGISTKEFEAAFGPGGKVYMKNRNADDTSFQIGRSSQPGGSRSGSNTPLSR
                     QRQGGAISVSIVEKPKSSAGVGSGKGKGKVEKIWDVPKSKEVKKIEAIIASLRSIQES
                     GPKPGEGYNCFCQARMHPLSPYTPICQTCALIICKLHAPHLPCPSCAQPLYNPAQLTR
                     LILKVETDLEDQMEKERVEELERERERQEMLQAESGGGQFPSLASGSASATGTNNVPL
                     GGARKVISIGAKDKGKGRATVTTTTYRTGSSAPSPRLTTPPPENIMPRPRSIPVDRIK
                     AEKELTKVLSWRKEEGKPWGDMKAEKRGNAMKYVGVDVIVMSQVNENTMGRRRKGKLK
                     TGEAGRVVPGAQTKA"
     gene            complement(579194..584397)
                     /locus_tag="CNB01990"
                     /db_xref="GeneID:3255768"
     mRNA            complement(join(579194..581498,581557..581777,
                     581830..582805,582861..583649,583698..583905,
                     583960..584397))
                     /locus_tag="CNB01990"
                     /product="aromatic amino acid family biosynthesis-related
                     protein, putative"
                     /transcript_id="XM_569127.2"
                     /db_xref="GeneID:3255768"
     CDS             complement(join(579243..581498,581557..581777,
                     581830..582805,582861..583649,583698..583905,
                     583960..584345))
                     /locus_tag="CNB01990"
                     /codon_start=1
                     /product="aromatic amino acid family biosynthesis-related
                     protein, putative"
                     /protein_id="XP_569127.1"
                     /db_xref="GeneID:3255768"
                     /translation="MSSSSADVLKISILGNESIHVGFHLLPYIFKTITTTLPSSTYVL
                     ITDTNLSAIYLNDFKASFEEAASEADNKARFLVYEVAPGEGAKSRKVKGEIEDWMLDN
                     KCTRDTVILAFGGGVIGDLTGFVAATFMRGVKFVQIPTTLLAMVDSSVGGKTAIDTPH
                     GKNLIGAFWQPSYIFVDLAFLTTLPTREVSNGMAEVIKTAAIWKDDDFALLESRSAEI
                     SLAASSRPTGVPTAGRFVSDRSHAQSLLLQVVSGSIYVKAHIVTIDERETGLRNLVNF
                     GHTIGHAIEAVLTPAMLHGECVSVGIVLEAEVARQLGILSQVAVGRLTRCLQAYGLPV
                     SLSDRRITALPASSQLSVDRLLDIMKIDKKNSGPAKKIVLLSRIGKTYEEKASVVADD
                     VISKVLCEAVTVKAATPTKSPITMATPGSKSISNRALVLAALGKGTCRVRNLLHSDDT
                     AVMMNALVELKGAVFSWEDGGDTIVVEGGGGILSTPAKGKELYLGNAGTASRFLTTVC
                     AMVSGSASSERSTVITGNARMKQRPIGPLVDALTANGAKVKYLESTGCLPLDIDTDGF
                     RGGHIQLAASVSSQYVSSILLCAPYAAEQVTLELTGGQVISQPYIDMTIAMMKQFGAT
                     VERQKDEQGNLLDIYVIPKCTYVNPPEYSVESDASSATYPLAIAAITGTTCTISNIGS
                     SSLQGDARFAKEILEPMGCIVEQTLTSTKVTGPPVGTLRALGNVDMEPMTDAFLTASV
                     LAAVAVKPCLPERKVEGLPETASRIYGIANQRVKECNRIQAMRDQLAKFGIETDEFDD
                     GIIIFGKPEASLFRGASIHCYDDHRVAMAFAVLSCIIDETIIEEKRCVEKTWPNFWDD
                     LQNKIGVAVEGVELETHNQASTSAKPVSPIDQSQSDRPIFLIGMRGAGKTYVGRMAAD
                     ILSGQFTDADDVFAQESHQTVSEFVAANGWDEFRKKETEILSKFVEEHRGNHVIALGG
                     GIVETETARETLKAHVAKGGHVVHVTRALEDIEAYLDSIGNTAVRPNWGETFADVFKR
                     REPWYQACSSHEFYNVLEAVGGQTHEEHTKAMRAECGRFFKFITGRESNRPRLSVGNP
                     TSFLSLTFPDVTPALIHLDELTEGADAVEFRVDLLSTTGQAPTRPALPPISFVAKQLA
                     SLRLATTLPIVFSVRSKDQGGMVPSDNAEAYGALVRLGLRCACEYVDLEVCWPEQLLD
                     SIVQLKRETHIIASWHDWTGDMAWDGEEMKAKHVLCEKYGDVAKIVGTAKSGLDNAKL
                     AIFVGEVQSHPGAKPLLAINMGAAGQLSRILNPILTPVTHDALPSRAAPGQLTAREIL
                     QARALTGSLPAKKFVLFGSPIAHSVSPLLHNAGFATLGLPHTYRLHESEKVDQGVLEV
                     IRSPDFGGASVTIPLKLDIIPHLDSVSEDAKIIGAVNTVIPRGGKLHGENTDWQAIHQ
                     AAAQNLDADALSYGSSTALVIGAGGTCRAAIYAMHKLRFKTIYLFNRTPENAAKVKAS
                     FPESYNIAVVTSLSSLPEAPVVVVSTVPGNSLTLDTFSQGIYLPSEVLSRPKGVAIDL
                     AYKPHMTALLHAAEKKEGWKVVPGVEILCLQGFKQFEEWTGKRAPQKKMRKAVLDKYF
                     A"
     gene            584568..585661
                     /locus_tag="CNB02000"
                     /db_xref="GeneID:3255686"
     mRNA            join(584568..584733,584790..584945,585003..585361,
                     585414..585661)
                     /locus_tag="CNB02000"
                     /product="tubulin-folding cofactor B, putative"
                     /transcript_id="XM_569128.2"
                     /db_xref="GeneID:3255686"
     CDS             join(584647..584733,584790..584945,585003..585361,
                     585414..585531)
                     /locus_tag="CNB02000"
                     /codon_start=1
                     /product="tubulin-folding cofactor B, putative"
                     /protein_id="XP_569128.1"
                     /db_xref="GeneID:3255686"
                     /translation="MPYLSVFVTSPDTHSERRFDSGLTVQQLKDKLTPITGISPQYQV
                     IKICRSADQTSGPPLAVLDDDSRTLASYGLEEWNCIKVDNIDPNYRPGEFTDESNLER
                     FELSPEEYAARSDTVLAHLKANKLGRFADAPTTLDSPLPPPPMIMDPTIVPGKRCEVS
                     HGEDGMAKRGTVRFVGEAKIGKGGIWVGVELDEPLGKGDGEIEGTRYFSCLPKHAVFV
                     RSAKVTVGDFPEEDIFSDDEI"
     gene            complement(585537..586473)
                     /locus_tag="CNB02005"
                     /db_xref="GeneID:36392731"
     mRNA            complement(join(585537..585919,585968..586473))
                     /locus_tag="CNB02005"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658471.1"
                     /db_xref="GeneID:36392731"
     CDS             complement(join(585695..585919,585968..586279))
                     /locus_tag="CNB02005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514209.1"
                     /db_xref="GeneID:36392731"
                     /translation="MPKTTNPKAKPSLAKPKLQTKAKKSRQSSSSSADMSLLPLSPKC
                     DASLDLTKDLVLQIVLAKLQSSKTCDWYALSQKLNKDEKRGWEKKKGEITGTELHDLY
                     HNRILPALKSGIALWSDGNNERRHVSASSSGSDVRPTEGTIAPFSRSGKGNTESRPKR
                     TSAKNGKSRMVDSELDEF"
     gene            587984..589307
                     /locus_tag="CNB02020"
                     /db_xref="GeneID:3255715"
     mRNA            join(587984..588308,588375..588479,588537..588707,
                     588770..588898,588969..589307)
                     /locus_tag="CNB02020"
                     /product="expressed protein"
                     /transcript_id="XM_569130.2"
                     /db_xref="GeneID:3255715"
     CDS             join(588117..588308,588375..588479,588537..588707,
                     588770..588898,588969..589106)
                     /locus_tag="CNB02020"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569130.1"
                     /db_xref="GeneID:3255715"
                     /translation="MSASETTTPAAVAAPSTATAETPASSIPPKPVTPAENFTEPPAR
                     ALDAIAEPTILDKAKDIAKPYLDKAEPYVQKVQGATKPYADKAATKFEQLVDKIEGND
                     PSTSAVPTSAGTLDESIDNAKARTVGTTERAATVAEETGEKAKGFFEQGLSAVQSTFN
                     QITNTIEQRTTTDSHPGILTQMSNVVHKGLDKVEGFLNEATDATVPPTSTSATANAAT
                     GTDNSTSTTQPVQTTTNTVPHIPLGP"
     gene            <589531..>592145
                     /locus_tag="CNB02030"
                     /db_xref="GeneID:3255713"
     mRNA            join(<590315..590369,590429..590560,590618..590848,
                     590901..591077,591129..591280,591333..591467,
                     591517..591574,591939..>591985)
                     /locus_tag="CNB02030"
                     /product="protein phosphatase type 1, putative"
                     /transcript_id="XM_024656500.1"
                     /db_xref="GeneID:3255713"
     mRNA            join(<590315..590369,590429..590560,590618..590848,
                     590901..591077,591129..591280,591333..591467,
                     591517..591574,591939..>591985)
                     /locus_tag="CNB02030"
                     /product="protein phosphatase type 1, putative"
                     /transcript_id="XM_569133.2"
                     /db_xref="GeneID:3255713"
     CDS             join(590315..590369,590429..590560,590618..590848,
                     590901..591077,591129..591280,591333..591467,
                     591517..591574,591939..591985)
                     /locus_tag="CNB02030"
                     /codon_start=1
                     /product="protein phosphatase type 1, putative"
                     /protein_id="XP_024512253.1"
                     /db_xref="GeneID:3255713"
                     /translation="MGEQPEIDLDSVIDRLLEVRGNRPGKAVQLAEYEIKYLCTKARE
                     IFISQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLE
                     TICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
                     IAAIIDEKIFTMHGGLSPDLQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSE
                     NDRGVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEF
                     DNAGAMMSVDDTLLCSFQILKPAEKKPKYGGYGGSARPVTPPRKGKSNKRKA"
     CDS             join(590315..590369,590429..590560,590618..590848,
                     590901..591077,591129..591280,591333..591467,
                     591517..591574,591939..591985)
                     /locus_tag="CNB02030"
                     /codon_start=1
                     /product="protein phosphatase type 1, putative"
                     /protein_id="XP_569133.1"
                     /db_xref="GeneID:3255713"
                     /translation="MGEQPEIDLDSVIDRLLEVRGNRPGKAVQLAEYEIKYLCTKARE
                     IFISQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLE
                     TICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
                     IAAIIDEKIFTMHGGLSPDLQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSE
                     NDRGVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEF
                     DNAGAMMSVDDTLLCSFQILKPAEKKPKYGGYGGSARPVTPPRKGKSNKRKA"
     mRNA            join(<590315..590369,590429..590560,590618..590848,
                     590901..591077,591129..591280,591333..591467,
                     591517..>591579)
                     /locus_tag="CNB02030"
                     /product="protein phosphatase type 1, putative"
                     /transcript_id="XM_024656499.1"
                     /db_xref="GeneID:3255713"
     CDS             join(590315..590369,590429..590560,590618..590848,
                     590901..591077,591129..591280,591333..591467,
                     591517..591579)
                     /locus_tag="CNB02030"
                     /codon_start=1
                     /product="protein phosphatase type 1, putative"
                     /protein_id="XP_024512252.1"
                     /db_xref="GeneID:3255713"
                     /translation="MGEQPEIDLDSVIDRLLEVRGNRPGKAVQLAEYEIKYLCTKARE
                     IFISQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLE
                     TICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
                     IAAIIDEKIFTMHGGLSPDLQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSE
                     NDRGVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEF
                     DNAGAMMSVDDTLLCSFQILKPAEKKPKYGGYGGSARR"
     gene            complement(592767..595539)
                     /locus_tag="CNB02040"
                     /db_xref="GeneID:3255693"
     mRNA            complement(join(592767..593225,593275..593706,
                     593760..593855,593905..594083,594147..594325,
                     594378..594727,594781..595539))
                     /locus_tag="CNB02040"
                     /product="efflux protein, putative"
                     /transcript_id="XM_024656501.1"
                     /db_xref="GeneID:3255693"
     CDS             complement(join(593310..593706,593760..593855,
                     593905..594083,594147..594325,594378..594727,
                     594781..595436))
                     /locus_tag="CNB02040"
                     /codon_start=1
                     /product="efflux protein, putative"
                     /protein_id="XP_024512254.1"
                     /db_xref="GeneID:3255693"
                     /translation="MSGIIPPFQGQFSIEALAPRAEGLATTSRQVSLPPDPSSTTLYE
                     SQSATTSGEVNLEKTSTLGTNINSCASNESRQERGIQEEPALQTLQGLPSKTATIEHS
                     GPARLSTPHLIAISAILTFTMCMSSAGQQTLNIALPTIQTDLGMSESDLQWITSAYTL
                     TNGCFLLLSGRLADIHGRKKVFLVGVVWYSIWTLVGGFMKNGAALVITRALAGCGASM
                     STPSAVGIIAHTFTGRARSTAFASFSAGAPVGGALGLILGGLFTSYVKNTWRGALYCV
                     AGLAFAVSICAFFLIPNDGSHSSDRRVDWIGAVLVTVGLIFLLFAVSDGENAPNGWKT
                     SYVLALLIIGFFLVVAFFFWERYIINNTTRPPLMRLQLWTRAKGRLASVYFIGFVAWM
                     GFTSLFYHTTLFYQQVQGTGAVGAMLRFLPTSVSGILCNVLVAFLVSKVKTQYLVCTG
                     LLATGIANLLMALSQKDTLYWRLPFNAMWLSVMGADFLMATSLIFVAALALPDEQSVA
                     GALFQTLIQLGGSFGLAVTSVISNVENQKALRAGKDETEAQLTGLHAAFWLAAAMSFT
                     ALVIALIALKGMGTIGKGDKRGKLSENKHKEEEKEEEKYAVQGRDENDDKAV"
     gene            595748..597204
                     /locus_tag="CNB02050"
                     /db_xref="GeneID:3255690"
     mRNA            join(595748..595971,596030..596265,596318..596386,
                     596433..596741,596862..597204)
                     /locus_tag="CNB02050"
                     /product="expressed protein"
                     /transcript_id="XM_569135.2"
                     /db_xref="GeneID:3255690"
     CDS             join(595812..595971,596030..596265,596318..596386,
                     596433..596741,596862..597029)
                     /locus_tag="CNB02050"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569135.1"
                     /db_xref="GeneID:3255690"
                     /translation="MAPPAKPASTPKRKPFTPKPPRPAEERLPKLYRALTDQVDDGYF
                     ENAIKTCKKILTLDASSRTAFQTLLFLHLQTDDYTSALSLLDHPSHEESLGFERAYCL
                     YRLHREKEALEVLKGLSEKGRKIDHLEAQILYRLGEYSQAQEIYEGMLADCDVSSPEH
                     ADIVTNLSATTAHLDFDTHGYHSHLSTTVSSTSQTPMNTADLENIVPSLPTGWSSGGL
                     AATVEKKTATVKAPEEKNERSRPRHKLPKGAVAGKEFTEDPERWIPLRQRLSYITAQS
                     KKKGAKESMGTGFTQGSTGGHSGGSGGGGKNKKGKRK"
     gene            597212..601440
                     /locus_tag="CNB02060"
                     /db_xref="GeneID:3255658"
     mRNA            join(597212..597563,597734..597905,597972..598020,
                     598078..598191,598240..598273,598323..598576,
                     598633..598686,598736..598789,598844..598981,
                     599028..599132,599184..599859,599914..599954,
                     600000..600101,600158..600265,600314..600333,
                     600390..600419,600498..600576,600631..600645,
                     600700..600757,600820..601440)
                     /locus_tag="CNB02060"
                     /product="expressed protein"
                     /transcript_id="XM_024656502.1"
                     /db_xref="GeneID:3255658"
     CDS             join(597826..597905,597972..598020,598078..598191,
                     598240..598273,598323..598576,598633..598686,
                     598736..598789,598844..598981,599028..599132,
                     599184..599859,599914..599954,600000..600101,
                     600158..600265,600314..600333,600390..600419,
                     600498..600576,600631..600645,600700..600757,
                     600820..600896)
                     /locus_tag="CNB02060"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512255.1"
                     /db_xref="GeneID:3255658"
                     /translation="MSHSPSASPRLRPFAIPIRKPEETSNLQALPIDDRNDDTGCVKT
                     RPQEESCHAPIPPEPCSPDLSKLKVTDDEEISPTRVQNLWSTPSKKKEEWTYQTPRRF
                     SLASTPSTTPGLTSTPFTSRSSFTADSNNTPHTPYTPGFVGYRRHSDSSDELSCLSGK
                     VSTSAGHSIETLGRYLLITQVPNEVSEFEFRDMIQSMADFKALIVKHLKSKGCIIIVF
                     YDLRQNLKVYERLQEGPVTIGVAHPMVQLQCMPVSRDVVETVTGHGGAWDQVWKTSES
                     TIKIEIKGGHPVTTEVMENVMQSIGDVRQIDPIGYDGREFAVDFYDTRDAAQSITDLN
                     GRTAGQALLCVDYHDHRDKEYLYSRPSNNRAFSLGSAAYIPGCLSASRLESTSSDAFN
                     LTRIADGNSDLRTPSNMALNTLRTDDFFSSHPSSLTPSKQSVAAPDFACSTSPSWSLD
                     KSFFDYETPPRILSLSRRLSEAGTVQGLVNRADMAARARQKQGLGGHWDANDRKAIPE
                     QNRVFPERIMAGLDSRTTVMVKDVPNKLSRQELVDILNRVVPGEFDFVYLRFDFKNCC
                     NVGYAFVNFCSVQSLLRFIQARVGKKWNLFSSEKVLQVSYADIQGKLALINKFRNSAV
                     MGVIEPWRPQIFYSSGTLKGQPEPFPDSDNLAVRERSGLSQTSIFSTQPSSLFHSQHR
                     PYDYTSASFDHSF"
     gene            complement(601384..605598)
                     /locus_tag="CNB02070"
                     /db_xref="GeneID:3255897"
     mRNA            complement(join(601384..601573,601630..601839,
                     601893..602011,602063..602379,602434..602952,
                     603000..603146,603210..604312,604831..605598))
                     /locus_tag="CNB02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_569010.2"
                     /db_xref="GeneID:3255897"
     CDS             complement(join(601564..601573,601630..601839,
                     601893..602011,602063..602379,602434..602952,
                     603000..603146,603210..604312,604831..605015))
                     /locus_tag="CNB02070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569010.1"
                     /db_xref="GeneID:3255897"
                     /translation="MADFDYGFASLQTPPATAPNGSASQSASASDANDEGWQEATTDG
                     SDNVKRDNGGKKGGPSASLGAAEGSSLASGSATVNAQPPPDPRFPYANLLASDPVQPP
                     DQFQPDLRTGYHRYYLASDLPPSSNPQESSLQALPPSLQHSQAHHRVQTSRQQHRLHP
                     YQTSSNILNRHTTARAHWDDVSSPDQDLQGQIASANSSAANTPPGSVPLAPPPPAAAA
                     AGASDTTEGTNPKPTGRSGQKRRKKYTRTRTGCLCCRSRRIKCDEARPVCKRCTIAKR
                     ECVYPDGTGGSNPASGTDAPGGSNRGKGRSSGEDSESENDRYRKSRPGSPSVLCYPPI
                     PNGNFGYGDGTDAYDASALNMAPMSGGLVGSAMGGGMSLMEMGMAQQQQQQQQQQQQY
                     RQQQQLSTQGQVSFGSEAGKQEWGVQQGGAPILSTPNFLLPWFPTAEERSLILHYCAN
                     AASLLMAIPSGLNPMLAINLPLALDSPRGMNPSADALRVALLGIGAIHQAFLLARSGV
                     SNQQTAAMFQYASTLRDTGKEMVRRAAHIGTTDAALGAATALATIDIFFGGSNWQDNF
                     SLAKEMVRARGGPAEMLKSSTPKTLTEGVTVSPARLMLEVLAIYETFGCLTTGEEPTL
                     ISEHGENWWLEASRSTYEEHSVEKQFGMSRVMVLLFIRLTRLINRLDKSNIKITESAS
                     STSSANNPFPQFALIPTPSSTSSLNDASSFAEDSLIKEARQLNKDVDTWIESLQLSTL
                     EHERVQVGNRAYAHAMKILLLRRVFKYTRSDPRVQSAAQQVLQHCSWSTAALGMSIDL
                     TWPAIIAASCADGSSRQWVLTLFEGFKSQCCFDIDTATRIITEVWRRVDTGEGRADWK
                     EVCDDLGLRVLLC"
     gene            complement(606034..608133)
                     /locus_tag="CNB02080"
                     /db_xref="GeneID:3256058"
     mRNA            complement(join(606034..606334,606388..607102,
                     607159..607313,607365..608133))
                     /locus_tag="CNB02080"
                     /product="oligosaccharide transporter, putative"
                     /transcript_id="XM_569009.2"
                     /db_xref="GeneID:3256058"
     CDS             complement(join(606268..606334,606388..607102,
                     607159..607313,607365..608038))
                     /locus_tag="CNB02080"
                     /codon_start=1
                     /product="oligosaccharide transporter, putative"
                     /protein_id="XP_569009.1"
                     /db_xref="GeneID:3256058"
                     /translation="MTTPPSTLPASNPLLTARSLVLLQLLSRILTFTLNQSLLRLASP
                     SVFGTAAIQFDLVCSSILFLSREGIRNALLRKSDVEVEPKSQAQIHALSIAPLQLGMV
                     VAPLITGLYLWSSSQSTTSQQGFHLSLILYVASALIELSIEPCYIQVHRSSPPKINVR
                     VQAEGGMAIVKAIVTVTSLVGLGEGRALISFALGQVAGAIWLAVLYIKEFDWNVKSLV
                     SAQKVAGQPRFDADTLSLAVANTGQSLIKHVLTEADRLAVARISPLDDQGGYAVAMNY
                     GSLIARIVFQPFEESLLLYYSNSLSSAATLPLFTFTIRLSLYLSTIIQAFVPPLFPAI
                     SSLLLPRQYRDTSASSILSLYLKLYIPCLSLNGVAEAFHTASADPGEVKRQVRWMVAS
                     SGVFAGTLFVLTHLPPHYISTNGGSYQLLTPNTEECLVLASCAAMVIRIVYALCHAKR
                     CFLLRKPNLRWLSLLPSVKIMSWACLVRVVLGLLAASGRWERGWKEWAELIGVGGLMG
                     LATLGFIAQAEVGHMKDLRKVMKAEKSE"
     gene            608258..610125
                     /locus_tag="CNB02090"
                     /db_xref="GeneID:3255571"
     mRNA            join(608258..608373,608436..608572,608625..608734,
                     608789..608940,608994..609607,609657..609845,
                     609892..610125)
                     /locus_tag="CNB02090"
                     /product="expressed protein"
                     /transcript_id="XM_569137.2"
                     /db_xref="GeneID:3255571"
     CDS             join(608279..608373,608436..608572,608625..608734,
                     608789..608940,608994..609607,609657..609845,
                     609892..610079)
                     /locus_tag="CNB02090"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569137.1"
                     /db_xref="GeneID:3255571"
                     /translation="MPRRKVAMPHHPPAQSSLSPLETRWGLLTYTLSRVPARKLPLLV
                     AYALTIVKLADHGWISREALGKGGGSIVGALSMVSGLLLSYRFSSAIGKWDEGKQVWS
                     GVRTTIRDGIRMLSTLPGGKVKQVSLDGYEESPDQEGKSKQKLVSQRIDELSGLLVSF
                     AFALQHNLQGTRPLPQAPLCDLLPSGYLSSLKRTEARVRFAEDHAGPSGSQSNPPESG
                     PSKTSPTDQEESDQSRELGSLAFGAEEAIAKLSEAVTAMDPVDTSRNEELQQQLNQLN
                     LPDGSVDLPSELSDDKSFTFTTLEPSKPQKSNLHSPNPPNLALAILKLIELYVEGMRE
                     IPEDEGGWDLARRERGFNLVKALSEHLGKAERLSSNPPPLPLTLHLSHLLVIYLAAVP
                     CSLLCVVDGWLLVFITLIAGWCLLGLEALIGEVSGVFGSSENHHPLPIFTEQILSESL
                     DISPSFLRYYKARIIARVGRNTKEAVELDRRGRKGAEDWTPSFK"
     gene            complement(610092..612862)
                     /locus_tag="CNB02100"
                     /db_xref="GeneID:3255657"
     mRNA            complement(join(610092..610550,610609..610675,
                     610730..610856,610906..611025,611083..611151,
                     611204..611296,611366..611605,611658..611722,
                     611768..611863,611915..611930,611980..612029,
                     612087..612308,612369..612518,612616..612862))
                     /locus_tag="CNB02100"
                     /product="expressed protein"
                     /transcript_id="XM_569139.2"
                     /db_xref="GeneID:3255657"
     mRNA            complement(join(610092..610550,610609..610675,
                     610730..610856,610906..611025,611083..611151,
                     611204..611296,611366..611605,611658..611722,
                     611768..611863,611915..611930,611980..612029,
                     612087..612308,612369..612574))
                     /locus_tag="CNB02100"
                     /product="expressed protein"
                     /transcript_id="XM_569138.1"
                     /db_xref="GeneID:3255657"
     CDS             complement(join(610323..610550,610609..610675,
                     610730..610856,610906..611025,611083..611151,
                     611204..611296,611366..611605,611658..611722,
                     611768..611863,611915..611930,611980..612029,
                     612087..612308,612369..612565))
                     /locus_tag="CNB02100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569138.1"
                     /db_xref="GeneID:3255657"
                     /translation="MSDDSTLADIHPIDASKLEKAESEHNQLHQNASHHHSENTLANL
                     SQARKNFLVLIFSIATFVDICNVSGVAVAVAQISTDIKLDYSQIVWIVTSYSLCFAAL
                     LLFAGRLADLFPAQIVFEGGFIMLGILSLVTSFVTSNKYGFLILRGLGGIAGAMTIPS
                     GYHLTVHLFPEPAEQQAKLALLGLAGAIGNVLGLVLAGVCMLASYKWFFRVIAIICIV
                     FTIICVLVLPFTGSTYSPDPNMPRWKRLDFMGVGLMMTSLICFILALTQGPIDGWGSA
                     SFIAPFILSFPLAIGFFFWESKIPAKSAVLPSSVWKITNIVISSLAIGIPFPFWATSQ
                     LLYSTYFQEVFGWTPIKVAAAMVPQGVTALIIGASAQVIPQIITKPRITLPIGGALVI
                     IAEILQVFSNGGHGTDYWRYCFPAFVLGSAGAVMTFFASAINLISYCPPEMAGVAGAW
                     TQVISQIAGAITLAVQASFEGDGVADWNKAGRRSFYFQIAWTAILLLQFLIFYKTPGT
                     PDEEHEAARKRIKESGKDAGV"
     CDS             complement(join(610323..610550,610609..610675,
                     610730..610856,610906..611025,611083..611151,
                     611204..611296,611366..611605,611658..611722,
                     611768..611863,611915..611930,611980..612029,
                     612087..612133))
                     /locus_tag="CNB02100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569139.1"
                     /db_xref="GeneID:3255657"
                     /translation="MLGILSLVTSFVTSNKYGFLILRGLGGIAGAMTIPSGYHLTVHL
                     FPEPAEQQAKLALLGLAGAIGNVLGLVLAGVCMLASYKWFFRVIAIICIVFTIICVLV
                     LPFTGSTYSPDPNMPRWKRLDFMGVGLMMTSLICFILALTQGPIDGWGSASFIAPFIL
                     SFPLAIGFFFWESKIPAKSAVLPSSVWKITNIVISSLAIGIPFPFWATSQLLYSTYFQ
                     EVFGWTPIKVAAAMVPQGVTALIIGASAQVIPQIITKPRITLPIGGALVIIAEILQVF
                     SNGGHGTDYWRYCFPAFVLGSAGAVMTFFASAINLISYCPPEMAGVAGAWTQVISQIA
                     GAITLAVQASFEGDGVADWNKAGRRSFYFQIAWTAILLLQFLIFYKTPGTPDEEHEAA
                     RKRIKESGKDAGV"
     gene            complement(613267..618704)
                     /locus_tag="CNB02110"
                     /db_xref="GeneID:3255629"
     mRNA            complement(join(613267..614079,614130..616125,
                     616174..616251,616304..616521,616573..616826,
                     616885..616937,616989..617076,617130..617265,
                     617319..617384,617449..617578,617646..617749,
                     617802..617849,617899..617958,618018..618068,
                     618131..618178,618234..618258,618319..618381,
                     618458..618704))
                     /locus_tag="CNB02110"
                     /product="microtubule motor, putative"
                     /transcript_id="XM_024656503.1"
                     /db_xref="GeneID:3255629"
     CDS             complement(join(615897..616125,616174..616251,
                     616304..616521,616573..616826,616885..616937,
                     616989..617076,617130..617265,617319..617384,
                     617449..617578,617646..617749,617802..617849,
                     617899..617958,618018..618068,618131..618178,
                     618234..618258,618319..618381,618458..618597))
                     /locus_tag="CNB02110"
                     /codon_start=1
                     /product="microtubule motor, putative"
                     /protein_id="XP_024512256.1"
                     /db_xref="GeneID:3255629"
                     /translation="MSKSIACHVRLRPSKPSDGKVNEQGIVINGNKISALNVQGDKRY
                     HFEFEKCHNERSTQEEVFEHVKPLLDQAWKGINTTIFAYGVTGAGKTHTMQGTKEEPG
                     LIPRAVNVILQRRALSPSLINVSMSYVEILKDEVYDLLGSRAEPRKREIRMSAGGHNV
                     IADLIHQPISSWEEFETIYDTASKTRKTASTKLNSSSSRSHAILTIHLEMLGSSDKVN
                     YGKICFTDLAGSENNNLTGNDRERMRESSAINTSLTTLGKVVDALNVIAQRGGDGTGV
                     FVPYRESKLTRLLQGALGGSSLSLLICCLAPGEKFARDTINTLQFGKKSKTVENRLNN
                     DRTDFRRLSQLPPPANFKTINPQAPFKIHAEGCPPLSRPSLGRPALAPLAPNTCHLRQ
                     RSKTGFATEGKSDQKEKVAVALTEEQLEKRIQMIVSQEMAHEREKERQLQGQSPQQPI
                     PQVGPSSNIDITSRPHNREAASLSEEEKDNRAKAIVKHARCVHQSGDLVNALDLYKKA
                     YEYAPQNQKLAMRITELQLAIEGILPPPRLSGRSGHENRHLPSASHLKRSRAPHGSMS
                     LAELSWEGDEDTHADSKKRPRTEIDNHTLN"
     gene            618869..621067
                     /locus_tag="CNB02120"
                     /db_xref="GeneID:3255570"
     mRNA            join(618869..619128,619191..619350,619414..619531,
                     619581..619682,619732..619841,619894..620028,
                     620073..620176,620241..620400,620468..620641,
                     620686..621067)
                     /locus_tag="CNB02120"
                     /product="expressed protein"
                     /transcript_id="XM_024656504.1"
                     /db_xref="GeneID:3255570"
     CDS             join(619046..619128,619191..619350,619414..619531,
                     619581..619682,619732..619841,619894..620028,
                     620073..620176,620241..620400,620468..620572)
                     /locus_tag="CNB02120"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512257.1"
                     /db_xref="GeneID:3255570"
                     /translation="MDPSMTVVAAINKDKLLTGPQLHQAVDQLTADAQSGYNVHQNRD
                     NFQERALRDVTMSSSDSALTLDPNNPILVREEMKAQKDYFRKLKFTYLEQDAKRHFLA
                     SITGDEPQRVEPGENEERELINAEKKERLKAVKADIEDMRTESVKLAEENAKKHEEMS
                     QQLVEAQALQKQIRDMELELARIKATHPPENRMTINQANDTLDSQIVEIQQLTDEREA
                     TQAQIDQTREAVARIAKELQRLSKDREREEARAKEVREGREAGDTKVDDICRWLTSSI
                     SFYRSLLGIRSVQAVSDTELHLEYDVPQGPVILIMKFDELTKRLADAALVGSDIDVAE
                     AVGIAVGSNDVPGLIADVLARLRP"
     gene            621427..623303
                     /locus_tag="CNB02130"
                     /db_xref="GeneID:3255564"
     mRNA            join(621427..621768,621877..622221,622276..622465,
                     622516..623303)
                     /locus_tag="CNB02130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569143.2"
                     /db_xref="GeneID:3255564"
     CDS             join(622022..622221,622276..622465,622516..623034)
                     /locus_tag="CNB02130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569143.1"
                     /db_xref="GeneID:3255564"
                     /translation="MLFSSLVTLVIALPVFGFSESRQSRSRIRNSQSLNSTLEQGLEK
                     RATVYSGRATFYDVGLGACGNQNVASDYIVALNSDQYGSGYPGPQCGRSITISYNGVQ
                     VSATIEDECPTCPYGGLDLSEGLFDRFADENLGVFYMTWWFNDETDDATTSTSETPTY
                     VAPTSTYVEPTSTYTPPTSTYTPPTSTYTPPTSTYVEPPTSSYIPTSSDVTPSTYSSS
                     ESPSSTLPSSSPSSTSTYISTSTLADAVIQTNVSIPGTAAATAVASATAALEPSVNEV
                     VSLGNLVSLNQAVVNLGRILVVGAQE"
     gene            623439..624734
                     /locus_tag="CNB02135"
                     /db_xref="GeneID:36392732"
     mRNA            join(623439..623784,623836..624073,624144..624734)
                     /locus_tag="CNB02135"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658489.1"
                     /db_xref="GeneID:36392732"
     CDS             join(623528..623784,623836..624073,624144..624545)
                     /locus_tag="CNB02135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514210.1"
                     /db_xref="GeneID:36392732"
                     /translation="MPIHPHIHCFLPSSSPHINLEARLYLPLTDNHAIPLTTQLATYT
                     SPPVYYDKLDVEIVGAIREMGIERLITAAHPWGRMGGNMLDPVLCHLVSATFTPAETA
                     ETALISPVLPPPKTAILTYNVRGVGCSQGSQPWLGIGSDPADLSKVEAVVSDLLGNIK
                     QVMRFGYSWGSLLVTLANPHPLLRHILVVSPPCKIFAGITFFSSKSFRMALNDLLKSG
                     VNVTMIYGTKDEFTSADTFRAFGNDLPAVTMLQDSRRTAIKDGGTFEKLEIEEADHLY
                     RRENGEILRKKVGEWLGWAVHP"
     gene            624967..627900
                     /locus_tag="CNB02140"
                     /db_xref="GeneID:3255573"
     mRNA            join(624967..625684,625742..626957,627009..627900)
                     /locus_tag="CNB02140"
                     /product="metallopeptidase, putative"
                     /transcript_id="XM_569144.2"
                     /db_xref="GeneID:3255573"
     CDS             join(625094..625684,625742..626957,627009..627673)
                     /locus_tag="CNB02140"
                     /codon_start=1
                     /product="metallopeptidase, putative"
                     /protein_id="XP_569144.2"
                     /db_xref="GeneID:3255573"
                     /translation="MRRLQQSLRRRSARRCPFILIPHRLLTTSYASYKPAPQATLEIE
                     DTNSPTFLLKTSPIQLPARATSDDSAIKAHFDLPHSIFGDMVGVRREHVKGLFHYDSL
                     TQPESLMRLTDRTLIQASAIVQRIVVAPQDPTGRELRLVVKNLDRLSDILCGVIDMCE
                     LIRNVHPHQDWVNQSDRTHQILCSFMNELNATRGLYESLAKAIAHPFNDPLTTSELRV
                     ARIFLTDFERSGIHLPPSVRERFVKHSDALLFLGRSFLSSASSGPSTVPHIEIPDPHR
                     LLTGLGRQFVDSLPRTGRNGQAVIEPGSWEAQMILRYAREGRARELVYVGGMRADKKR
                     ISVLEAMLKERAELASVLGKNNWAEVVLVDKMTKTPENVMRFLTSLAQHHQPVARAEV
                     DMLRRMKATALTGNYFDPRNSRTRHLPLFHAWDRDYYSDKYLTSLIPTGSPPSISPYL
                     STGTVMSGLSRIFSRLYGISFKPAVVSPGEVWHPSVRRLDVVHEEEGLIGVIYCDFFS
                     RIGKSSGAAHYTVRCSRRVDDDDIDGDGLPEDWDKPYGPGLEADKESLSGKPGKYQLP
                     IIALSMDVGTVNEGRPALLNWQELETLFHEMGHAIHSMIGRTEYHNVSGTRCATDFVE
                     LPSILMEHFVSSPEVLSTLAFHHATGEPLPIPVIEAHLALNQSLSALETHGQIAMALL
                     DQKYHTLRHGQDSFDSTAIWFQLQQEIGVIQPVPGTAWQMQFGHLYGYGATYYSYLFD
                     RAIAGKIWSTLFHRSGTSQAYDRKAEGILSREGGELLKEKVLKWGGGRDPWEMVGDVI
                     GGVEGDELSKGDERALALVGSWSVV"
     gene            complement(627896..629230)
                     /locus_tag="CNB02150"
                     /db_xref="GeneID:3255944"
     mRNA            complement(join(627896..628130,628193..628555,
                     628626..628781,628854..629230))
                     /locus_tag="CNB02150"
                     /product="expressed protein"
                     /transcript_id="XM_569008.2"
                     /db_xref="GeneID:3255944"
     CDS             complement(join(628047..628130,628193..628555,
                     628626..628781,628854..629069))
                     /locus_tag="CNB02150"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569008.1"
                     /db_xref="GeneID:3255944"
                     /translation="MWWLEAAPGGMPSAILALLLTALSLMPFEGLARKTSTGNSEFIG
                     CLDGSLSLLAGSHQIKKEAAEKSYYDCSAACVETGAYPYSYFTDLGKGVQKCYCSSIG
                     PRPSDYVVQPVGSFGCQLGQTRAALTQTDHHFIICSSGFIGSFSRAGTYSSPLDCLDA
                     CGEDEGALFLPTYNGFSCRCGGVTSVKSIAACGAPNAEFSYVYKPAKSPKASKSKASF
                     GTGRKKLGKGSKNRLDSQEGVKKYDNPCDDPDSILGYCGFGEEDNPVFHDRTLA"
     gene            629429..630883
                     /locus_tag="CNB02160"
                     /db_xref="GeneID:3255614"
     mRNA            join(629429..629950,630008..630253,630306..630380,
                     630431..630883)
                     /locus_tag="CNB02160"
                     /product="expressed protein"
                     /transcript_id="XM_569145.2"
                     /db_xref="GeneID:3255614"
     CDS             join(629718..629950,630008..630253,630306..630380,
                     630431..630767)
                     /locus_tag="CNB02160"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569145.1"
                     /db_xref="GeneID:3255614"
                     /translation="MAPIVALLGLNGTVGSNLLPYLIKAHKKGSLKLVILHRSGSDLS
                     KIPSDVGIEKRVVELRDGEVEKIQAAVKDLEVIISTIATQSVSAQNYLLEALSGSSAL
                     KTFIPSDFGAPWDKQEIEIPGLAALKAKERVTEKAKELKVPITEIKVGLFDLFFFGYK
                     ALGVDVKGNKIQYFHQSLKNPLHLTSLAYLGHAVTELVTNVDQLAQLPGTTPNIYDFA
                     PTGQEIVDILTKIHGKSTEQIGISDKDNEEQLQGPRAIGAAIFKKWGDNNWGAIPKTE
                     VDGWVGKEFADVVKEWTDKA"
     gene            631315..634086
                     /locus_tag="CNB02170"
                     /db_xref="GeneID:3255622"
     mRNA            join(631315..631852,631921..632142,632193..632242,
                     632307..632322,632383..632478,632531..632595,
                     632652..632891,632944..633036,633094..633162,
                     633230..633349,633404..633530,633583..633649,
                     633698..634086)
                     /locus_tag="CNB02170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656505.1"
                     /db_xref="GeneID:3255622"
     CDS             join(631629..631852,631921..632142,632193..632242,
                     632307..632322,632383..632478,632531..632595,
                     632652..632891,632944..633036,633094..633162,
                     633230..633349,633404..633530,633583..633649,
                     633698..633925)
                     /locus_tag="CNB02170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512258.1"
                     /db_xref="GeneID:3255622"
                     /translation="MSDNAIPTDFTKGPSHVHPPIDKKSMTASQNEVEKGSQHNVDIQ
                     DAPHGLATLGQGRKNVLLLIFSIATFVDVCNVSGVAVAVAQISQDINLGYSQIVWIIT
                     SYSLCFAACLLLAGRLSDLFPASIVFEGGFFVLGIFSLIVSFVTSNKYGFLILRGLGG
                     IAGAMTIPSSYHLTVHMFPDPDEKQKKLALLSLSGAIGNVLGLVLAGICMLANYKWFF
                     RVLAIICVAFTAICFLLLPLTHSAYKSEEGLPRWKRLDLIGVGFMMACLICFILSLTQ
                     GPIDGWGSASFIAPFVLSFPLAIGFFFWESKIPAKSAVLPSSVWKITNIVITSLAIGI
                     AFPFWATSQLMYATYFQEVMGWTPIKVAAAMLPQGVTGLIVGGLAQQIPQIITKPKFI
                     LPLGSLFIVAAELLQIFSNGGHGKDYWRYCFPAFILGSAGAILTYFCTSINLITYCPP
                     EMAGVAGAWVQVMAQVASAITLAVQASFEGDGVADWNMAARRSFYFQIAWTAVLCIQF
                     VIFFKKPSSPEEAHEATRRRIAESGKDAGV"
     gene            complement(633304..635326)
                     /locus_tag="CNB02180"
                     /db_xref="GeneID:3255612"
     mRNA            complement(join(633304..633521,633602..633946,
                     634077..634422,634501..634544,634595..634673,
                     634731..634792,634848..634970,635036..635098,
                     635168..635326))
                     /locus_tag="CNB02180"
                     /product="hydrolase, putative"
                     /transcript_id="XM_024656506.1"
                     /db_xref="GeneID:3255612"
     CDS             complement(join(634132..634422,634501..634544,
                     634595..634673,634731..634792,634848..634970,
                     635036..635098,635168..635210))
                     /locus_tag="CNB02180"
                     /codon_start=1
                     /product="hydrolase, putative"
                     /protein_id="XP_024512259.1"
                     /db_xref="GeneID:3255612"
                     /translation="MKAVLQRVINASVTVDGKIISSIGKGLLVLVGIDRYDEPQDATR
                     IIKKILTARLWEDENGVAWKKNVKDIDGEVLCVSQFTLLAGFKGAKPDFHESMSTVPG
                     NAFYSSFLKEIKTAYDPSKVQDGQFGAMMQVSLTNDGPVTILLSSKDKPEKSGTTTST
                     PSATASGISTPLEGKKKNKGRGKLLTEIKADQQLGETNGADFSGTSLSAQQEQGVSAA
                     EDEIGKLSVNENTSSR"
     gene            complement(635816..636965)
                     /locus_tag="CNB02190"
                     /db_xref="GeneID:3255616"
     mRNA            complement(join(635816..636411,636458..636786,
                     636843..636965))
                     /locus_tag="CNB02190"
                     /product="26s proteasome non-atpase regulatory subunit 8"
                     /transcript_id="XM_569148.2"
                     /db_xref="GeneID:3255616"
     CDS             complement(join(635973..636411,636458..636786,
                     636843..636935))
                     /locus_tag="CNB02190"
                     /note="26s proteasome regulatory subunit s14; p31"
                     /codon_start=1
                     /product="26s proteasome non-atpase regulatory subunit 8"
                     /protein_id="XP_569148.1"
                     /db_xref="GeneID:3255616"
                     /translation="MSFDLQQALAQLQSAYDASSEQVSTQLAKLKLELAQSGLYFAPP
                     SADPQDLIAARSILEIGAFQSLRQGDLKSYARYNFALQPFYDNLRDIIPASPNRPVTL
                     GLHLLGLLSENLLTEFHTLLETLKPEELNDSFVRLPVDLERWLMEGSYNKVYRARDRV
                     PRPEFEFLLERLMGTVRGQIASTIESSYPSLPLQHAATLLFFKSGETSSLTDFAFARG
                     WSLSPNTQTFSFPRSSKPDIALAAAESSSDVSSATIDKLKGTGVVRGVPMETMVGPAL
                     RLAQQLEAIV"
     gene            637129..639438
                     /locus_tag="CNB02200"
                     /db_xref="GeneID:3255615"
     mRNA            join(637129..637180,637227..637318,637381..637489,
                     637558..638469,638522..639438)
                     /locus_tag="CNB02200"
                     /product="RAN protein binding protein, putative"
                     /transcript_id="XM_569149.2"
                     /db_xref="GeneID:3255615"
     CDS             join(637230..637318,637381..637489,637558..638469,
                     638522..638935)
                     /locus_tag="CNB02200"
                     /codon_start=1
                     /product="RAN protein binding protein, putative"
                     /protein_id="XP_569149.1"
                     /db_xref="GeneID:3255615"
                     /translation="MASTQPPVAAPDQSKIRPQDVGWQFVPQYYNFVNSQPHRLHCFY
                     NKRSTFIHGEEGEDVTPAFGQQEIHDRILQIGYNQCKVYIHSMDSQSSADGGIIILVL
                     GELSNNHQSWRKFSQTFFLAEQPGGYFVLNDIFRYLREDVDEDESAPQETVQPQEEPA
                     QPEVAAEKLPEATTVTQEPAEDPVPEPAPVSAPAEVVVDAVPEEAEIAAVPDKDVAPE
                     QEPPVVKEPEAAPEPVEETPKPAASVTESIASPAPAAPIPAAKAASPSPAAPKAAAPT
                     TNGSSPASTTPAAPSKPMTWASMAASNVWGKTASPSATAPAPAPAPAPAAAPAPGPAQ
                     PKKDEKPAPAAGTGQGQRRQQTIDPSKVQTAHCFVKLPNWSPDSQSSSDFLTDAELSK
                     IASRFGEVKSTEIVKSKACAFVEFARVESARKAIQHSLPVEQGGEGGTKFPNGTLYFE
                     PRKEKDDRPKAKGQRTGGQQGQGQGQRQVNGGAGGRGGRGPRGRGGQGNQGDRQPQK"
     gene            complement(639281..642185)
                     /locus_tag="CNB02210"
                     /db_xref="GeneID:3255561"
     mRNA            complement(join(639281..640180,640233..640331,
                     640385..640664,640725..641320,641374..641667,
                     641726..641920,641977..642185))
                     /locus_tag="CNB02210"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_569150.2"
                     /db_xref="GeneID:3255561"
     CDS             complement(join(639461..640180,640233..640331,
                     640385..640664,640725..641320,641374..641667,
                     641726..641920,641977..642132))
                     /locus_tag="CNB02210"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_569150.1"
                     /db_xref="GeneID:3255561"
                     /translation="MDTPASNTEAPPTPSPAPPQIPSASTTTTTSAPAPAVASAPIKK
                     QYNKRVSKKKVEGLLAYTTAFVPGTYNVKIPAGDYLQKERNVDVVRQMSLEKARREEE
                     GLSSKIPTAGDGERENPLSKILVIHPGSRNLRLGLASDFYPKEIPNCIARPTKAVQTS
                     GSRKAPVMGSRVKSLKEQHERNNKRKRGEADEDDDHLEEDVEMSNGDDIGEWVDPIDE
                     SIGYLRDYLRNRLVQERLATDWRELTRVKANNSKVKPELLPEHNDPYRIDWTEPEGKP
                     FFIGTDALRLPESAGYTVRYPILHRSLNRRDWASSQTVLDDISTIITSSLSTQLSIAP
                     RDYPFFSVLLIVPDHGDRVFIQEMTHLILQVLGFKSIAVQQEAYCAIFGAGMSSACVV
                     DIGAQETSVTCVDEAMLLAETRIKLNYGGDDITSALTHLLVASNFPYRELDLARSQDW
                     LMMDNLKIKLCTLEEHLVANTLWDFYVPRVEGLTQKWMLRTFDENILAPLVFFDTRMI
                     DFDEKKGQGSFRFWNTSDDKVTDEITSAYEEPTSAMKALTSHLLPGASHTSASGFQKS
                     EAPSNSESTTPAPAPLAISSNSSPEKPNASLSTTLAQTPVPELNLPSTASTPTPAAGG
                     AADADTPGTAAPALLSLPTLASLAPQPTLSASQIFTASSQSPLDAAIAASLSLCGTEN
                     KIRTLSHSILLIGGSSSIKGLPAFISDRLPPLLKQRGVPGNGEVTIVPPPRGLNPRYV
                     SWKGGSVMCNIEGLGDMWIRRDEWEALGVRALKDRYMWF"
     gene            642384..644829
                     /locus_tag="CNB02220"
                     /db_xref="GeneID:3255546"
     mRNA            join(642384..642715,642768..642839,642889..643398,
                     643457..644111,644166..644435,644489..644829)
                     /locus_tag="CNB02220"
                     /product="nucleolus protein, putative"
                     /transcript_id="XM_569151.1"
                     /db_xref="GeneID:3255546"
     CDS             join(642426..642715,642768..642839,642889..643398,
                     643457..644111,644166..644435,644489..644779)
                     /locus_tag="CNB02220"
                     /codon_start=1
                     /product="nucleolus protein, putative"
                     /protein_id="XP_569151.1"
                     /db_xref="GeneID:3255546"
                     /translation="MGRRAKNKQGPPAPLPGSIPERTESRRQKTKKRAPSAVTNEVAS
                     RGKALKGPGASVAGGRKKGVIVGRTGKMIKGPKRKKVDEVDEDSDLDEALQPGEYSSD
                     EEEVEQPKTKKSKKSTEDESEGEEELARGPVKELVFSDSEEDEEEDDNLNDDDEALPK
                     GQHNFDLDDAPPSDDDEEDLEMGDEFDMDEDEFGSEEEDEEDSAFASSGDEDADMAED
                     EDVQVGADEEDGIQTNLEDDLEETYTLPAVDNGGEEEEHEHGTSLREVENRMRWLVGV
                     VLNKEEKVSKGVPGKSRSDHMLQLQHDIATYFGYNTFLVGKLMKLFAADEALAFFESN
                     ESPRPVTIRANTLRTRRRDLAQALINRGVTLEPIGKWSKVGLQVFESPVPIGATPEYL
                     AGHYMLQAASSFLPVIALAPQPNERVLDMASAPGGKTTYISALLQNTGIVFANDSNKA
                     RTKSLTANVHRMGCKNVVVCNYDAREFPKVMGGFDRVLLDAPCSGTGVISKDASVKVN
                     KTERDFQLLAHLQKQLILCAIDSVNPNSSTGGYVVYSTCSVTVDENESVVDYALRKRP
                     NVKLVETGLDFGVHGFKSFEGKNFHSSVSLTRRFYPHKHNMDGFFVAKFKVEPRKKLT
                     KAPVAEEDDSPQMIINEEGEIVPEETAKFDAAEDEELIRESKRKALKKKGIKVSVKGA
                     ENGRKGKGKAGKA"
     gene            complement(644794..646279)
                     /locus_tag="CNB02230"
                     /db_xref="GeneID:3256009"
     mRNA            complement(join(644794..645157,645205..645491,
                     645546..645643,645701..645721,645778..645812,
                     645871..645882,645932..646279))
                     /locus_tag="CNB02230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569152.2"
                     /db_xref="GeneID:3256009"
     CDS             complement(join(644895..645157,645205..645491,
                     645546..645643,645701..645721,645778..645812,
                     645871..645882,645932..646127))
                     /locus_tag="CNB02230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569152.1"
                     /db_xref="GeneID:3256009"
                     /translation="MVAKNVAVTGASGLLGRAVAAYFISQGDQVISLANSRADRDPHY
                     TKLDLMDQEAVKNFFGSNDIDFVVHCAAERRPDVAEADPEKAAKINAAVPAQLASLAK
                     EQGFTLIYISTDYVFNGRNPPYEVNDTPDPLQMYGRQKLDGEKAVLAEHEKGAKVSVL
                     RIPVLYGRTEYNAESAVNILRDVVEDQSGKTYKMDARQVRFPTNVEDIGRVLYDLAHL
                     EKPLPPILHYASPAPALTKYDMTSIIAKHLNLPIDHVIKDTTVPTGATPRPENTQLST
                     KVLKELGIDVSEKKTFEDWWAEYVKEK"
     gene            646404..649913
                     /locus_tag="CNB02240"
                     /db_xref="GeneID:3255652"
     mRNA            join(646404..646615,646687..647793,647842..647947,
                     647995..648060,648121..648299,648359..648429,
                     648482..648609,648661..648767,648820..648952,
                     649025..649238,649295..649576,649640..649913)
                     /locus_tag="CNB02240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569153.2"
                     /db_xref="GeneID:3255652"
     CDS             join(646434..646615,646687..647793,647842..647947,
                     647995..648060,648121..648299,648359..648429,
                     648482..648609,648661..648767,648820..648952,
                     649025..649238,649295..649576,649640..649776)
                     /locus_tag="CNB02240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569153.1"
                     /db_xref="GeneID:3255652"
                     /translation="MPFGRKSTTSKKKSLNSDDLPRAPSSKTDTPAKMRDVSNSSAID
                     DGTSSTGKHKRRHTLLGSKGRKKLSSLFSSSSSLSSYTEREGTASPKHGRSKLNVSST
                     SSGTSTPSRSTQLSDATNAQKALNQLSIGTAGNQMTESPESSPTVTTDGAARRQRRDS
                     LWSQWELEGAGESSDEDDAFLTPSEGLSEVEEEDEQENEPPTAPKRTSQPSDEAAVVD
                     AASSTPDHLSSSTDVKVEPTNVAKGSVTSSGDIAGTGTSTIHRSLPSTAETKVKRHMS
                     HNRPSATTVDQAAVLGDDIETCREAIRLFLTSRMKEAEEFCEESESEGHHLYLQSAMG
                     IIEALKGMMTFDSVDLHNALEICKSTAVTASSLRRPSDNVFSRLGGMVKSHGGLARVK
                     AMTPLERHAELVYAEQSLMKAMLAIISGGDWIGLVREAFNMRTAHGIYRNLQHFLEDA
                     DKHGYDDDIDMDFRSGVLLGTGTSSLMLSLLPGKVLKIAEVFGYAGDRKVALATLMAA
                     GGWSHDSPEPTFNEKNEGLRRPVCDLILLAFHLVISVLIPITGVDVPLAKNVLAYNMR
                     RYPNGVFFLYFQARLHTTQCQPAEANDSLQRALDLKLEYIQLQHMCLWDYACNYMMLG
                     KWKGALDCFSILKDESNWSRAVYTYAAAACIVELVEDGDQDAKMSEADRLMQQIPKLT
                     KKIAGKSLPIEKFASRKARKFSSQSSRLFLPALELAYVFGSLSNTPRRSLLDIHVPRL
                     NEMMKKLENGEENYGNGTGKEYWDDYVLAHFLRGMCQFIARYQPVDAEPSTLVVLPTD
                     PSDPDLDQAAEKDFQAVIRHTPDVQLDHWILYHCYYELGRLYARRGDDDQAKYHFEVV
                     MSGKLPDHNAYMAKAAGKYSLEGALLLKTHAALSAVKEREKESSGKR"
     gene            651776..656583
                     /locus_tag="CNB02250"
                     /db_xref="GeneID:3255608"
     mRNA            join(651776..652125,652193..652232,652309..653827,
                     653882..654152,654207..655294,655353..656144,
                     656200..656583)
                     /locus_tag="CNB02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656507.1"
                     /db_xref="GeneID:3255608"
     CDS             join(652379..653827,653882..654152,654207..655294,
                     655353..656144,656200..656466)
                     /locus_tag="CNB02250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512260.1"
                     /db_xref="GeneID:3255608"
                     /translation="MPLFFQRSRRASEAPPALHPPDPQVHKRLSIDATSNTDHNPPFS
                     SMNSTKLKTLLGAGPGSGSQSGTPKKERMKKKLTTPSMFFRRNSSSSPEPPRQSSTSL
                     DQGSHGLPGSAPVATRPGNELAMADYRDSAQKLSTKPVNAGYFPSATVVPDNFILSHT
                     VSPETSSPLSQESVSPNARTRPLSRTWQPSYPLVLPDEGYAEVPPNELVPLTTGPDIV
                     SATNDENAKRRSTDAQMLDSRPTTKQQEMVVVPPEPQLPTPPLSGRVSPETGSQNEVD
                     TSQRRPSLALNISDEVLTPKALQPVSREQGNIKTSVAGADSQMLSGNVHPPKTHSQDI
                     LAIAPYPITHHTASSIPSISAPPATPSSTMSSSSSPVRMSHPGLSVRKTTVIHSPPMP
                     QPIRNLPTLTNLASLAGDTSSPTPTATPGWGELAKEGGPKTPGGGIMRSPITMMNGAR
                     TPALGSFTLNLPPGKAKKTPMTEQELRKARRAMPVMLRQPSTVPSNEDDEGGDAGDDD
                     DEEESEDGVGSDGDSDNDSEAETTRNPSTVDSSLMGFAGRLARKTRTGSSSQVGEMAK
                     SAVTEEGDVSGSRVSNASTDIRHESDFPRFSNMSNVPGSTIIPKANGKSVWSLSTPCE
                     KSESTSWAQFSNEGTPVQDVVPTVIVDTGNAQPTAGAAAAIARATLERGQPSNPSTLT
                     TTSRCSSGYFDSQPSSSGPSAMPSPLPRLDKGKGKDAAVDSGLAASVTAPRVEDEEER
                     SVLEEESEVEEDARREELGASSEDTSEVSTEGGTPSVEANDTVESTVQPPPSQQAPQR
                     PSLYTQTSISMINLPPKPQDSGDSTAGRMLVKPKLETVKSGEQMPFRISLPPQQEPTG
                     PGGILSPQEWAKPPPTPAAGLNGFNLSVAGKDKQKELKRRRSADDLVAPPPKYEPPFP
                     GTFIPKPRDEEGREKLPKYWCSVHIEGMLQRKMEFTGEKDLGTGPDGKKKVEKIQARD
                     RSWKRYYFILHGTALLVYKFDPHRFPLKTDAPVPTIDDEDADEFLHVHPAPERRRRAS
                     SSSAIGPGNKRSSISADPGRRGSVDTTNSMTWRGTGDSTSPISIPIPGRRTSESNNTL
                     GSGSYRRSSLSIVHNAENGDDVKDAALFNSQRRASTSGTNAAYPSSSYGSTNTPLSSH
                     FQHNALVKQYSLNKTESGLAADYHKRKNVVRVRADGEQFLLQTESARDMVDWVEAFQA
                     ATNVAKDLDERPMPKIITLPRRRRRRNPAQQAAAAAVSNPANAAASGAINPREATMVQ
                     QALVAADEAERERERMLREDQEAAAT"
     gene            complement(656510..657457)
                     /locus_tag="CNB02260"
                     /db_xref="GeneID:3255987"
     mRNA            complement(join(656510..657137,657191..657457))
                     /locus_tag="CNB02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_569155.2"
                     /db_xref="GeneID:3255987"
     CDS             complement(join(656660..657137,657191..657384))
                     /locus_tag="CNB02260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569155.1"
                     /db_xref="GeneID:3255987"
                     /translation="MAEGIELKPLGASAPPLPPRHADPPAGSLGKAYRSAEEKAKAII
                     HLQQDAGLDAISVWALVLSSWFAILAVPLLLFPRILIFFSQTPPPTVPFSSSSVANAA
                     AAARENHYDSLTPLEYTLCLSLSLGLIAMSLVSLFILVPTYTPPSTNPSRTPLLGVLV
                     GLTTISGAVLWNAGGLGGLGVFVGGGNVFVAVWGWWVIVFGGGRGRITKKQHKHNTPE
                     RLRKL"
     gene            657686..661170
                     /locus_tag="CNB02270"
                     /db_xref="GeneID:3255595"
     mRNA            join(657686..657812,657878..657922,657970..659388,
                     659444..659839,659895..659948,660003..660118,
                     660181..660366,660429..660478,660524..660572,
                     660627..661170)
                     /locus_tag="CNB02270"
                     /product="peroxisome targeting sequence binding protein,
                     putative"
                     /transcript_id="XM_024656508.1"
                     /db_xref="GeneID:3255595"
     CDS             join(657714..657812,657878..657922,657970..659388,
                     659444..659839,659895..659948,660003..660118,
                     660181..660366,660429..660478,660524..660558)
                     /locus_tag="CNB02270"
                     /codon_start=1
                     /product="peroxisome targeting sequence binding protein,
                     putative"
                     /protein_id="XP_024512261.1"
                     /db_xref="GeneID:3255595"
                     /translation="MSAFLSGASVQCGPTSALKNVSDRINVDRSLQQDRLAYTSNASG
                     SSSKQPFRAQLAQLPVNQSPKQVPGPPSTFDLSSLRQQLSPVPSTSHASDWASDFVPL
                     TGPTASKYTRSVASTKSGWQEEFSQHVAAAPPLGTTRSQKPLYNAGLAPWEVPETQYQ
                     LQRPALMRPSFRSHDIPISEASLTFPRPDIHAAAPVSKYEEQIGQPTGSETLPLDESQ
                     QLLARTARSFVSNLETQSDILSANPKFAQSKFLSLLRGLGDEQVVVKEGQEVKGEEVG
                     EGATFVERNIVGNNWAEGFAKQKEKSIPQEAPTLAEAEYLERRSPYPPGQKEYPALNS
                     WVPALPTHTLVPPQTAPQAARLAANNGALWDQQYHDQEALIQSSESPAPEPRKNVHFD
                     EHPASRERSGVPSTLEEAISSPGNIPGAGWGWNEQGLTHDFDEDVFEEFNGQLRRAQE
                     SLEGGVGKQESWDRLQSDWEEFQRTEPGVAHFRGMGTGDQSERYMFQSRNPYSTDEEE
                     LYFEVSRDSPTLKGILELESEVQKDSTSHEAWYALGLKQQENEREDQAILALSKVIQL
                     NPQYRPAYLALAVSYTNEGENEAACTMLEDWIRLKDSKNTTGADGQKGKDRNKLIESL
                     IEIARQTPHEIDADVQVALGVLFNMSGGQDYSKAEDCFLAALEARPEDWLLYNRLGAT
                     LANSGRSSEAVQYYHQALRLHPGFVRALFNLGIAYMNLGEYQTAAQSILDALRLQHSE
                     ASEAYAYGQNGGGAKGVTSETLWNSLKGACFYMNRQDLVKIVEKRDLSGLPLKFVDEE
                     L"
     gene            complement(660576..661587)
                     /locus_tag="CNB02280"
                     /db_xref="GeneID:3255984"
     mRNA            complement(join(660576..660995,661052..661141,
                     661217..661328,661533..661587))
                     /locus_tag="CNB02280"
                     /product="DNA-directed RNA polymerase ii 13.3 kda
                     polypeptide, putative"
                     /transcript_id="XM_569157.2"
                     /db_xref="GeneID:3255984"
     CDS             complement(join(660650..660995,661052..661141,
                     661217..661269))
                     /locus_tag="CNB02280"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase ii 13.3 kda
                     polypeptide, putative"
                     /protein_id="XP_569157.1"
                     /db_xref="GeneID:3255984"
                     /translation="MNQPNRIDSWLLQDDEKPLTITEDPKLPNASTIVIRRQDHTLGN
                     MLRAQLMLDPTVLFAGYKVPHPLENDILLKIQTDERSNPAEALKRACHELIRQTVHIK
                     AQFQQQAKNIEMGMGPEQGVAPDAAGANGAYDPYGDGFGREGNVVVGGAVRDQGQDVY
                     DF"
     gene            661804..664014
                     /locus_tag="CNB02290"
                     /db_xref="GeneID:3255940"
     mRNA            join(661804..662601,662649..662937,662983..663003,
                     663069..663079,663135..663320,663388..663456,
                     663518..663598,663657..664014)
                     /locus_tag="CNB02290"
                     /product="expressed protein"
                     /transcript_id="XM_569158.2"
                     /db_xref="GeneID:3255940"
     CDS             join(661907..662601,662649..662937,662983..663003,
                     663069..663079,663135..663320,663388..663456,
                     663518..663598,663657..663864)
                     /locus_tag="CNB02290"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569158.1"
                     /db_xref="GeneID:3255940"
                     /translation="MPLSSSNFHPNPPTVLIPSKRSSARTPRSGSLYKKHRSNPKEQP
                     EEEKKDMSQILSTLTAIIMAQSNAFQAHAQRFDAFAETVQTRLDSIESKCDDSLNRKE
                     LGIMGSLGVITQEVNTLREEFLSIFSSGTRSRSRQIRRSHRSVALSSRGAHGHSPADF
                     NDGQRQSSMPSDGDSGHGGGIVERAIARELKRLGGAPVLADGETTIHFNPRKRWSKNR
                     VDILDIEEESDLESDTGSSLYPMSSSLERRLADDDEESESEEEEENEEETESEEAEET
                     ESSELIRENGEGHMHEKEPSLKRDKVLAASNGHNVDGHKWPKLGPDCTEGRMKVIDCT
                     ACDGRVHWACAGLDPEVSMLKKSWYCPSCTLLIKDLKPAIARRMKEREELPRTQDRER
                     CLRPDCIHHQPVDMTSAKAEDDNLYYMSGIVGRRHTKDRPRTLQYLVQWNEWEDYDCT
                     WEPPSNIPAVDLPGYKSLFYKQAKNENLDLSNKKTAILSQFSQYYEADGSYNVKLLKR
                     LGVEDKDWWGW"
     gene            complement(664267..665753)
                     /locus_tag="CNB02300"
                     /db_xref="GeneID:3255941"
     mRNA            complement(join(664267..664758,664822..664957,
                     665009..665088,665143..665368,665425..665753))
                     /locus_tag="CNB02300"
                     /product="integral to membrane protein, putative"
                     /transcript_id="XM_569159.2"
                     /db_xref="GeneID:3255941"
     CDS             complement(join(664417..664758,664822..664957,
                     665009..665088,665143..665368,665425..665558))
                     /locus_tag="CNB02300"
                     /codon_start=1
                     /product="integral to membrane protein, putative"
                     /protein_id="XP_569159.1"
                     /db_xref="GeneID:3255941"
                     /translation="MKENHAAENALGTIGAILWMIQILPQIIKSHREKTTKGLSASLM
                     FIWALASLFLGAYIVAQKLSIPLQIQPQAFGVLAAVSWCQCLHYDRGYSLKSVWAIFF
                     GFCCIFAGFETGSVYALWAGQRNGSEWPILMYGYISAVLLAVALLPQYWEIYKYREVI
                     GISVLFMVVDILGGVFSFLSLFFREDLDIAAFVSYALVVILDSIVVILYFILNPIAKR
                     RRAREAEKQQSDSEAGIEGASTTPMPTAPTLVGHGLMVDKEVQDDGDRGRDIACVDSE
                     KEQPRLDDKEEPKAAGGGIKSTQTYNVRA"
     gene            666335..671068
                     /locus_tag="CNB02310"
                     /db_xref="GeneID:3255883"
     mRNA            join(666335..666702,666754..666935,667001..667242,
                     667297..667459,667509..667538,667588..667972,
                     668024..668496,668544..668686,668751..668841,
                     668892..669901,669958..670043,670103..671068)
                     /locus_tag="CNB02310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656509.1"
                     /db_xref="GeneID:3255883"
     CDS             join(667102..667242,667297..667459,667509..667538,
                     667588..667972,668024..668496,668544..668686,
                     668751..668841,668892..669901,669958..670043,
                     670103..670169)
                     /locus_tag="CNB02310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512316.1"
                     /db_xref="GeneID:3255883"
                     /translation="MNQSSYGYLLDQPSPKNQPLELHFPSITHPPHTTDGSAHIPKPH
                     PHLISPVIYINSYPQDLPNSLLLDCLEGCPVKITLPPVVLPDVRLMPDAYYDWMPRSG
                     TLEFNSLADAEKALAIINSHSMLAPRGVWVSPSPPDQPISFPKSVIAERLIRPSKFSS
                     LTQKATQSLPKFAPTPSELYDAIRPWGSLKSVSTWLAGVAPANPTIPDWFAKVEFWYA
                     DEAQRFETEFGQTSSLIKGWQVVIWGNTPIPYSDSVLPCFAALAQPPPVISANIFASD
                     SSSLATAFFPVPFSEISHSSFPPIAVPQPLISQPFFPPTPSSISGSPPWATHNPFAYK
                     PRNPPTAPRMMRSRSSPTRLNNNGPDLPLNIGPRRWSLTMGETPDGVFQPTGLVSDDG
                     KIIQHGPGQHIRPAPAFGPGSQSASGLVDYSNIFIKNLDSDINSFYLEETFSQFGRVI
                     SARVMRDDHQRSRGYGFVSFYTPEEAACAVKAMNGTQFGRQVLSVTLHEPRKLRPEKI
                     AERVAQGLIHRQAVPPHVARRSSNPVKSRRSFREISIFDRSNDSDPSDDIRLLSPESR
                     KAVLEKRLIARVRVYAKKRSVSEEMIQPIVNSLLPSDLALIPLLHNHTQLDNRIAETL
                     SSIQEVPEVPAAAQRPTESDIDDLRVQIEKIDSDDADNVMRVFMDILKAEDWERGLGN
                     KAEVAIKYGDAKRLLLKERNERQKESSEDISDKDAMTGDPIFETGLSDEQDPTIIPLE
                     TITVPLLASLSAKKIIWNLSSSYGSDILLKLGLKAPSDQERNSLLAWRAKIMNKGNVV
                     MRGEMVRMLERHAVVDGLKRSQRIKTLREFVNAEDDDESLCELVLYPALFHAKLECFL
                     SSREFR"
     gene            complement(670295..672573)
                     /locus_tag="CNB02320"
                     /db_xref="GeneID:3256110"
     mRNA            complement(join(670295..670520,670618..670773,
                     670851..671012,671132..671142,671217..671237,
                     671305..671668,671732..672573))
                     /locus_tag="CNB02320"
                     /product="expressed protein"
                     /transcript_id="XM_569007.2"
                     /db_xref="GeneID:3256110"
     CDS             complement(join(670343..670520,670618..670773,
                     670851..671012,671132..671142,671217..671237,
                     671305..671668,671732..672486))
                     /locus_tag="CNB02320"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569007.1"
                     /db_xref="GeneID:3256110"
                     /translation="MMDRQPSQPASATGKCQKRHALSSPLRESGDVAHKRPRIDPPEP
                     LSLRKPGSQQSLVMAINSFNAKLDSQERHFNRKLAEQETRWQTRFESLESKWVGKLAL
                     AELEVERSKTKATSVEMDLRERVGRLEGALAVLMRQSQGMLMPMGNLSSIDYHTSGGH
                     AGAFASNGVATSSGQAHADLEQTLTPLWSREQAIEDLDEQQAVKVQPPDTVDNQIVVE
                     SQDTSIAIDLTGVDDEVDTTLPGREHGHANNYFTNPANDPILPTVSPQALIPNNFTDH
                     LEPDTDDDMETDGAHNNNIINNGLWLPDSLSSVSTPLAVDNALAASSRSSSSSSPEYY
                     SIQGEASTSTTALLPASDGSRRTKGRWPPKRAYSLVGTMQEIACDWCHGRCHWCCAGL
                     KETSDMSDKSWLCFDCRYLVKYHGLTKQTVEPSQQERCIRSNCILLDDIKPQDLIEEQ
                     VFVVERLLGRRSMMRKGKRIERETQYLVKWDGYGIHECSWEYRANLKPHDTKLVKNFE
                     AALSREGLVSSKSTVILLNEATSHWDPKTGHPLVGLQTAI"
     gene            672749..675673
                     /locus_tag="CNB02330"
                     /db_xref="GeneID:3255977"
     mRNA            join(672749..673171,673227..673526,673580..673743,
                     673807..674039,674090..674158,674226..674274,
                     674335..674387,674453..674650,674730..674812,
                     674874..674900,674966..675035,675091..675105,
                     675170..675228,675319..675472,675543..675673)
                     /locus_tag="CNB02330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656510.1"
                     /db_xref="GeneID:3255977"
     CDS             join(672801..673171,673227..673526,673580..673743,
                     673807..674039,674090..674158,674226..674274,
                     674335..674387,674453..674650,674730..674812,
                     674874..674900,674966..675035,675091..675105,
                     675170..675228,675319..675472,675543..675593)
                     /locus_tag="CNB02330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512262.1"
                     /db_xref="GeneID:3255977"
                     /translation="MPRYLRIYIAVAALALLAAVHYHLQPFSLARRRTPSTAQSYPLG
                     LSAEDGQLVDSAGLVVDEKGLVSYSPGHAARHPVEILIERGKTLADETESKIASVKSL
                     KDSAMDYVTAFGMKPPQGFEAWYAYTQSVPAPHPLSIPSLIPLAHRPMLPFLSHSASI
                     LRERVEALRETAESIFTLTFVPDGQGDRGTACTANEKWNKMDWRVRGKGRVLVRGAAG
                     WSWRCNNTLSLLLPLLPLMPEKMFSHNPPLELAFSTEDGPRGLVHNTFRERSENLARA
                     GRLWPKSQLHQAEQAMRWTYGFSWSCPEHTPLKDHAADVILNDLPDIVSAQSQHVKEP
                     KTFIADFDRSVDYCVNPDLMNSHNMLLSDQSIAAANLIPALVACKTKWNSDLVGVPLD
                     GVYETVKFVPWEDKEVSKAFWRGSATGLFHDKNKPWRQSQRERLHWFGTNMTGTVPLL
                     LPDGSIKDWDRADLVDKWLDIGLSGGPTQCDAEDGSCAAMAEEIDFKNRVTKQDAIKY
                     KYVIDVDGNGWSSRFRRLLQGNNVVFKSTLYPEWFHEILIPWYHYVPTKLDYSDVFDT
                     LAFFQGSPDGSIPGRDDLAKEIAGHAYKFVQERWREEDMRSFMYLLILEYWRLMSDDR
                     KAASYQG"
     gene            complement(675946..679995)
                     /locus_tag="CNB02340"
                     /db_xref="GeneID:3255981"
     mRNA            complement(join(675946..678220,678278..678768,
                     678813..678952,678997..679127,679195..679604,
                     679646..679995))
                     /locus_tag="CNB02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_569161.2"
                     /db_xref="GeneID:3255981"
     CDS             complement(join(676082..678220,678278..678768,
                     678813..678952,678997..679127,679195..679604,
                     679646..679652))
                     /locus_tag="CNB02340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569161.1"
                     /db_xref="GeneID:3255981"
                     /translation="MAVAAQPTPYLSAASANALISDLRPTTFSAAALTHLNTLLDELL
                     IALLTAARSLNPLDLRREAIPSFFSGDRGTGDTTGVRALGRNAVAEAEVELRSWQEGR
                     SVWGYPPDGKGSGTRTGRSFPLLQAVELMRAKCVAFSTLAPQDESDQTKEQQAVADWL
                     KVGGDASEETIVPSALWITAIIEHVCEHILSSVARIVARDSGTAVAGPQDLYTALCED
                     ESVWGFFKRMKVKDQLELTIRSSSRSKRFNASRSSPDNRSQGRASPALSTASPGEDAS
                     IDTARSTRIGSPSLETSSTGGIAGGIILKGSTLIKRGPTGSPVTKILQRAQHERSGSA
                     LSANTRFILGAFHDTYEQEGNQSQDEADGKEAQDEFDKLVRSGETRKVSLTPGRLKSF
                     EAANRKREPHLADIHSPSAGHLNDKRRSHSITRVPVPTGPLTPPPNLVEQSSSPTSVS
                     TPPSRPSLGSRHTNESARKLIARTAKIIQEQDEEEELRGATRSEKESLFGLLADDTFV
                     ALESKQTPTKRTVPAVILGTPPPPPPQPPASASSGMRKAALGPINSPSQTKSPSARVK
                     EAFYITPFASNASDADVPSEDDEFVHVQRRNRTEAQELADFFNSEPPPGLMADDESHI
                     GQPKSSKSKGFRGFISKVSLSSKKQDDDKYRPPPAVKQHSRTQGQPLSSTSLSQPNSH
                     SSTAQGKGGRMLEVRKQKSMGNMMTGMQSVFRNDQSEPPLPPAPLAAIEYSAPIFQQQ
                     HVSPPRTQTPPKVAPVREPAPAFGENMVYRSPGATFHQTVQSRFGIGSMEKIAGPDVT
                     HASVINPIDPVNMSSESRVRLSSPNRNEKKPLVIGKTTSLTAATTFLTPSKNLSVTPF
                     ESPTVSSPACTLSFTTANEGSDGEHSPILARAKPEDQRSSESDQPTLIPASSGVPTEE
                     VGPQSVSLIPRELTSEPVTPRDAVPKQDLVPLRNLLDHATSASECRLLLNAILTQFGV
                     PYPDLEPGQGEGKRGGVEMPEGRVIAWLLAGREGPVGDYLRQPQAVVPVSVAKEDDKK
                     DDTSTTDHDRLITPTRIHSAALPSRFLPLPRGEDTVPPSATTTEFTTDGEISETVEGQ
                     VEYVKTGEREEARLVEA"
     gene            complement(680430..681716)
                     /locus_tag="CNB02350"
                     /db_xref="GeneID:3255827"
     mRNA            complement(join(680430..681121,681192..681639,
                     681703..681716))
                     /locus_tag="CNB02350"
                     /product="pantetheine-phosphate adenylyltransferase,
                     putative"
                     /transcript_id="XM_024656511.1"
                     /db_xref="GeneID:3255827"
     CDS             complement(join(680475..681121,681192..681633))
                     /locus_tag="CNB02350"
                     /codon_start=1
                     /product="pantetheine-phosphate adenylyltransferase,
                     putative"
                     /protein_id="XP_024512205.1"
                     /db_xref="GeneID:3255827"
                     /translation="MASKIDLQDHTILVLPFTPSLLRDPSPLYSPILDILPRSSKKSF
                     TVFFSTPAGAISSEQSAIQSISGVGSNQEQLYSLLRRAPQESFKALQSFLGHIYTALW
                     TAQWKCENVLLDVEVHFEGESGELDAKLLRGKDGEEEYQLIKVEGVQETDLVASLDQI
                     IPSPFTSLSLPYATLSSHQSEPYILEERQSPGFPVVALGGTFDRLHAAHKLLLHLGYF
                     LAREKLIVGVMADDLLHTKTRADLVQPLNQRLDGVNAFLGRLGDGSIKLNVVEIHDAL
                     GPTRSDPNVQALVVSRETLSGGEYVNSTRKEGGLQELELFVVDVIAENGDVNLKEEMD
                     EGKLKKMKMGSTGVRNWIAERGTGEQDR"
     gene            681976..683363
                     /locus_tag="CNB02360"
                     /db_xref="GeneID:3255988"
     mRNA            join(681976..681996,682199..682254,682312..682656,
                     682708..682909,682963..683363)
                     /locus_tag="CNB02360"
                     /product="ribosomal L10 protein, putative"
                     /transcript_id="XM_024656512.1"
                     /db_xref="GeneID:3255988"
     CDS             join(682208..682254,682312..682656,682708..682909,
                     682963..683019)
                     /locus_tag="CNB02360"
                     /codon_start=1
                     /product="ribosomal L10 protein, putative"
                     /protein_id="XP_024512263.1"
                     /db_xref="GeneID:3255988"
                     /translation="MGRRPARCYRYCKNKPFPKSRYNRGVPDPKIRIYDLGRKKASVD
                     DFPFCCHLVSDEYEQLSSEALEAARICANKYIVKNAGKEAFHMRVRVHPFHVIRINKM
                     LSCAGADRLQQGMRGAWGKPYGSVARVNIGQVIMSIRCRDSNKAVIIEALRRARYKFP
                     GRQKIIVSKKWGFTPLDRAEYEALKANKQVINDGAYVQFLKPKGPLLKNLRTAERA"
     gene            complement(683332..684850)
                     /locus_tag="CNB02365"
                     /db_xref="GeneID:36392733"
     mRNA            complement(683332..684850)
                     /locus_tag="CNB02365"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658499.1"
                     /db_xref="GeneID:36392733"
     CDS             complement(683371..684402)
                     /locus_tag="CNB02365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514211.1"
                     /db_xref="GeneID:36392733"
                     /translation="MRLQFFPLRQSSVQPGLHTHHYSDTGVFDNLGTIYFTMLSQYFD
                     PFILTQEYVASAEDACPTLVSEDPPAILSIPPTPDISNATLTSGLRDMDKSLSSLYEP
                     QDPNKLPDSAVFTSTMDPQYLILDSPPRKYPTESWKLSPDEELRKAYGRIRGSLWSNK
                     PIDSDESELEPLDPSHYEPMTPEEAAAAPAWKQNDKDEFEIVLGEFPIPRAVKACGGK
                     SKPWKRLPVTDDDIKKQNKWLEKKRKLKYRQEEKSKMGKAMERSKGKLKTAESNNQKV
                     VVFERPLHTGAYQDEIRVVRLQWKPKPHPSSLRLKMEEEKKRAHHAEGRQERDDSGLS
                     MNCCDLTLT"
     gene            685467..686961
                     /locus_tag="CNB02370"
                     /db_xref="GeneID:3255814"
     mRNA            join(685467..686489,686544..686961)
                     /locus_tag="CNB02370"
                     /product="transcription factor, putative"
                     /transcript_id="XM_569320.2"
                     /db_xref="GeneID:3255814"
     gene            complement(685507..691028)
                     /locus_tag="CNB02380"
                     /db_xref="GeneID:3256011"
     mRNA            complement(join(685507..686457,686532..686559,
                     686614..686850,686945..687139,687191..687505,
                     687561..687852,687920..688070,688127..688220,
                     688276..688366,688430..688533,688602..688684,
                     688739..688985,689049..689168,689228..689272,
                     689326..690028,690093..690405,690469..690567,
                     690632..690692,690748..690820,690890..690899,
                     690985..691028))
                     /locus_tag="CNB02380"
                     /product="transcription factor, putative"
                     /transcript_id="XM_024656513.1"
                     /db_xref="GeneID:3256011"
     CDS             join(685608..686489,686544..686762)
                     /locus_tag="CNB02370"
                     /codon_start=1
                     /product="transcription factor, putative"
                     /protein_id="XP_569320.1"
                     /db_xref="GeneID:3255814"
                     /translation="MSDPTSQYNFYYQIPVTDDNRNQGTQVRPPTVPSQQEGSLHGPQ
                     PSYIPIRPTPILGYPPLPSPSQAFVNPGEIFLSAHAGVNQTVTPSTESVFSDERPAQL
                     LDSNIDESTTFGGHSRFGQPGTQSSLSIDPFLLERRDSQGPLLHPSEPWSFRADTVHA
                     GPSTGFQGLALPPKSGIDTDVLEDVIEVGEADEVVEEEEKEGEGGGNESESSEYIDPS
                     SKAKGKGKARQEAPKETAVKRKRGRPRKNVEQPSARAEEENRAGQKKKGKGKGTSGKG
                     GWNRRPKACTACNNRHIRCIGGPPCNYCVSRNKTCILDTDSLEKKRTPPLTTSHPFEG
                     PSASSSSNVPLTRHQQSQAEEIPPKKKKKSSS"
     CDS             complement(join(687115..687139,687191..687505,
                     687561..687852,687920..688070,688127..688220,
                     688276..688366,688430..688533,688602..688684,
                     688739..688985,689049..689168,689228..689272,
                     689326..690028,690093..690405,690469..690567,
                     690632..690692,690748..690820,690890..690899,
                     690985..690999))
                     /locus_tag="CNB02380"
                     /codon_start=1
                     /product="transcription factor, putative"
                     /protein_id="XP_024512264.1"
                     /db_xref="GeneID:3256011"
                     /translation="MTTRAIVKYVMSGDTVVVRAKEAPEKGKVPKERILHIAGIQAPR
                     LGSMTREDEPHAFSAREYLCSLLLGKEVAFTITHTIESSTGPNREFVSLCIAPAGPGS
                     PPQDVASLILAQGWAKMRDGVGEGDEAVRRLGAEEAKKRENLRVIEAQAKSEGKGIWD
                     EQPENQRTVAFQMPTDPQAFIADHKDEEIDAIVEQVRDGTQLRVRLLLDEHNHQFINL
                     VLAGAKSPRSGNPRDGEASNAEPWGDEAKYFTEVRMLQRHIKVRLLSAPASLGASPLQ
                     QTQPSKGSGAGLPGSNGLPAPSTGSTVIIGTAIHPKGNIAEFLLAAGLAKVVDWHVGL
                     LAPYGGLDKLRAAEKAAKDKKQGIWENYQPQRATATNSAASAAPTAVATTKGTDFEAT
                     VVRIWGSDQVSVVEKGEGGKERRVQLSSVRGPKGVDAKQTYWANEAKEFLRKRLIGKQ
                     VNVHVDYVKPKEGDFEERECVTIRYGNQNNNVAEQLIEKGLATVIRHRRDDEDRSLEL
                     DKLIVAEQTAQTEGRGVHSAKDVSMPRIVDASERASMASSYLPQWKRQGKHNAVVEFV
                     SAGSRFKLYMPKEHTKVTFVLAGIRAPRTARNASEKPEPFGAESLKFASRYLQRDVEI
                     AFDSTDRSGGFIGTMYASGGVNVAVELAREGLAFVHERSAELLPFGKELLAAEEQAKK
                     EKKNIWSLVQEEETSTAAAVDESSALPVDYKDVYISSVKESEPFTFSVQILEKDSVAA
                     LEKLMSDFSLHHRQASAAATSSFTPKTGDLVSAKFSKDDRWYRARVKRASAIKKEAQV
                     YLIDYGDEDTVPFSKIRPLDEKFKSLPGQAKEARLSFVKLVPRSSEYGPEAYRRFEYL
                     TEGLKLIANIDQREGNLLHLRLIDPADPNIKEDPLACLNADLVREGLATIDKSCKYLN
                     SYPQIVRKLQDAGEGAKADRLGIFEFGDVSED"
     gene            691197..693346
                     /locus_tag="CNB02390"
                     /db_xref="GeneID:3256027"
     mRNA            join(691197..691400,691480..691540,691595..691714,
                     691770..692051,692102..692160,692215..692393,
                     692449..692483,692537..692638,692703..692975,
                     693042..693346)
                     /locus_tag="CNB02390"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569164.2"
                     /db_xref="GeneID:3256027"
     CDS             join(691529..691540,691595..691714,691770..692051,
                     692102..692160,692215..692393,692449..692483,
                     692537..692638,692703..692975,693042..693200)
                     /locus_tag="CNB02390"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569164.1"
                     /db_xref="GeneID:3256027"
                     /translation="MCRLLVYKGTESIQISHLVTRPRHSIINQAFESKLRMPSSRPLN
                     ADGFGIGWYDPLPAIPASAAPRPATSPVPSSTPCTCPNVVTAQASHSQAYDVQGNYPV
                     DADGQMDENTLEVMKEREVERELENERPCLFKSISPAWSNANLTRLAEKIRSSLVFAH
                     VRASTMSGAPSEDNCHPWMFDKLMWMHNGEINDFPKIKRALQQSLPEELFLYPSGYTD
                     SEWAFMVFLSKLKNPHARSFTHVELRDAMMETIHCINKLCKEAGCTGPSLMNFVVTDG
                     STVVATRYISSRTSEASSLFFSSGTSFDEYQGSGRGLYRMTKADKRENIIMIASEPLT
                     FERSDWMEVKTNTMMVITPKMNLLQIPIIDEYWVPPQDPASLTRSRDFAIKRGYGLGF
                     ASEEAAKHEIAAAT"
     gene            complement(693367..694257)
                     /locus_tag="CNB02400"
                     /db_xref="GeneID:3255624"
     mRNA            complement(join(693367..694088,694146..694257))
                     /locus_tag="CNB02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656514.1"
                     /db_xref="GeneID:3255624"
     CDS             complement(join(693460..694088,694146..694188))
                     /locus_tag="CNB02400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512265.1"
                     /db_xref="GeneID:3255624"
                     /translation="MSSAFTSSKVRRSLKQKLLGVAYSHAGLIPKKDPMHPSLAKVRT
                     TYESIPKGYIVTSISRDPFTYFGLSIQVAVRLPVSVTASYKDVKDCYVLEQTLIRIAW
                     DAALSKLENGKSPRKAVKNAKKVLAQAIKSIQSIIGTAGYFRFAHVHYNKIATYQAIV
                     CTFKKPSVAERWVGRLEKKRVEFMKSLECASGALARDQWTREQKEISSKLIAYHKMEN
                     RLFRW"
     gene            695361..696776
                     /locus_tag="CNB02410"
                     /db_xref="GeneID:3255799"
     mRNA            join(695361..695697,695751..695986,696038..696776)
                     /locus_tag="CNB02410"
                     /product="expressed protein"
                     /transcript_id="XM_569166.2"
                     /db_xref="GeneID:3255799"
     CDS             join(695602..695697,695751..695986,696038..696734)
                     /locus_tag="CNB02410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569166.1"
                     /db_xref="GeneID:3255799"
                     /translation="MGKTGLQDLPPEIVRHIIDEVERKHSLLLVCKQTSLIASEYLYA
                     SLISGEEERHSIDGYTPPLSKLIEGLQHTEPTRDAPFGSDVKLSFLKRAKKMQHAFGT
                     YICFRESSSDEKVLEKITSVFQSLQRRCIVAFPSLDELHLHCTGWSSITPPNRRCAFA
                     LAAVSQPLLCYWPFIFSLDELPSLPLPESETRSGGKISREGKEGYMELKFAQGHIPDR
                     VIHVPYKVPCIPSVCYGTLNVVSYSQLWSHPAWSVAETIDYLKSILRYAHPEVFSPED
                     DVVQKVGEKEKHTRDKTMWAFLWVGRFTKKEGKTYGTMMKLVEEGLYEAVPCMKERVK
                     FCVGDVGK"
     gene            complement(696143..697874)
                     /locus_tag="CNB02420"
                     /db_xref="GeneID:3255953"
     mRNA            complement(join(696143..696824,696900..697164,
                     697214..697300,697358..697447,697635..697776,
                     697832..697874))
                     /locus_tag="CNB02420"
                     /product="structural constituent of ribosome, putative"
                     /transcript_id="XM_024656515.1"
                     /db_xref="GeneID:3255953"
     CDS             complement(join(697054..697164,697214..697300,
                     697358..697447,697635..697775))
                     /locus_tag="CNB02420"
                     /codon_start=1
                     /product="structural constituent of ribosome, putative"
                     /protein_id="XP_024512266.1"
                     /db_xref="GeneID:3255953"
                     /translation="MPTRFSNTRKHRGHVSAGHGRIGKHRKHPGGRGLAGGQHHHRTN
                     FDKYHPGYFGKVGMRHYHLLKNHYYRPTINLDKLISLPEAKVDAPEGNVPVIDLVHLG
                     KFKLLGKGRINKPFIVKTRFVSKLAEEKIKEAGGVVKLVA"
     gene            698125..707241
                     /locus_tag="CNB02430"
                     /db_xref="GeneID:3255936"
     mRNA            join(698125..698598,698648..698861,698909..700841,
                     700896..701079,701131..701495,701545..701665,
                     701718..701915,701975..702495,702546..702863,
                     702911..703518,703567..704372,704422..704540,
                     704592..704832,704883..704971,705029..705171,
                     705221..705461,705519..705793,705854..706348,
                     706404..706563,706625..707241)
                     /locus_tag="CNB02430"
                     /product="regulation of translational elongation-related
                     protein, putative"
                     /transcript_id="XM_569168.2"
                     /db_xref="GeneID:3255936"
     CDS             join(698298..698598,698648..698861,698909..700841,
                     700896..701079,701131..701495,701545..701665,
                     701718..701915,701975..702495,702546..702863,
                     702911..703518,703567..704372,704422..704540,
                     704592..704832,704883..704971,705029..705171,
                     705221..705461,705519..705793,705854..706348,
                     706404..706563,706625..707128)
                     /locus_tag="CNB02430"
                     /codon_start=1
                     /product="regulation of translational elongation-related
                     protein, putative"
                     /protein_id="XP_569168.1"
                     /db_xref="GeneID:3255936"
                     /translation="MSSKAKVGSWLEHNDKSQAEAYESASENDDLDDGRINGKHPIDV
                     DEEDEDDAEIAGEVIGRREDDISWEELGQSMRLSLSDPSKKRRRAFISRYLYVSEQSP
                     PPAQVPMVLTTLLSCLSLSGDIDHSDDIVSVLQELVRRDEKMEEGKMKLGDKLVKWSS
                     MEVEKMANPAKSITPVNLFPFLVLLVSLISTLSSTRSPADQFISSSQGQDLFLSLALV
                     LDAMRSGEKELSSEGRVRRLRKKSGIRIWRLLREHRASLPLILHSLVTRTCSTPARLS
                     VLISHVVGVALRLKALPKGIEGPSGREIVEHEKDAILNYYSTNILGAKSAIARHSSTV
                     FQEFVSEFVSYQVLSEKLIPQAEKMLLRSPEVALELLADLLTFCTHDISPLLPAKLLN
                     PTLSASKSSNADTRNKSRILLRAIIERCSDKTVQGKIASEIIALPKGGKTASPEHRTV
                     LFNMLTDLPVSDAVSPSVVDTLPTLIAKEGNEPAFQTLCSALGHHLFHTFSSNQSMAA
                     SASQALLKELASTKIPTRRALSNAVGQAIWEIGSKGQQFSMEGEKLISAIAPALENNL
                     KAASVCPPANPTGFLEGYVALALALGPLKGMPSAEKLTSSPAMEGILATSPKPSFVLN
                     DKVYQRLPSSEDNLWLLRSLEGIVGGSSSKINTDGARISIGLAFIHLVFESKSSPVRR
                     GALEVLSKLTKAQPQVIGRIVRFALQSWLQAQDERRAAAKPSSEEEETVTSKSRDIGR
                     LLSSIFVADIDTPKDILENLAVDFIVLAHHPEISPEAQTSWVGLVQALGLDPAAVARD
                     AKDRILVELWEAAGTPPSDVRLAEAAYHAATTLAFICPSVYVDAFVHQLKEDLNPASL
                     AFIGLEERGIWATPEDQTFVDVLAQKKDGVPENKNRKDYATEKWEQEVRESLAKKRTA
                     TAGVKHSKQDQALINAQLAKESATRQQIRHVQGALNRGIELVSALTKAGNVEVERCVG
                     GMAAALLSSVFAAGSFLVDGRAFDVFSQLGNLASERLGETRRLLMATILRFSESPFVP
                     SDYLDEPLGEVTTRIMHQIHFIAAQSPLDSTTYSLTSLLLSVVVESGGVGVEGQSDEA
                     LEQLTLVVAIIATCVGEFENGTYPRLETIRALLHILTTYTKLSKDAASALADLGAAIK
                     DVATQGEIREMISGTLSKESYVRNAALQALTPVDITDFDYLEELWIAMHDDDEQNANL
                     ASHIWEDNGLDLPENYLASLLAYLCHDSAAVRLGTAKALAESADQYPQQVEPTINGLE
                     VLYVEKAKLLVPEYDQFGMIIPETVNRPDPWESRVAIAAALEKMAPLLSTDMITPIFD
                     FLIKQETLGDRHSAVRSAMLNAAIKIIDLHGGLTVTSLMKMFEDHLAANLPASETNDY
                     IKEAVVILFGRLARHLDSTDPRIPKVVDRLVEALNTPSELVQSAVADCLPPLVRDMAE
                     ECEYLVDRLFSTLTTGAKYAARRGAAYGLAGVVKGRGLQSLKEYELMDKLKDAAEDKD
                     KSAYQSRQGALFAYETLSGTLGKVFEPYVIEIIPQLLALFGDANADVREATQDCAQVI
                     MSRVSGHCVKLMLPTLLDALEEKQWRTKKGAIELLGAMAFCAPRQLSLSLPTIIPHLT
                     GVINDSHAQVKSAANTSLKRFGEVLNNPEIKAIQSTLMKALADPTAKTNTALSSLLKT
                     TFEHYLDAPSLALVMPIIDRGLRQRSSETKRKSAQIVGNMASLTETRDLVPYLDQLMP
                     LVHDVLIDPVPEARATAAKSLGTLVERLGETNFPNLVNELLQTLRSDTSGVDRQGAAQ
                     GLSEVLSGLGMERLEGLMPDIITSTASPRPYVREGFISLLVYLPATFGHRFAPHLSRV
                     IPPVLNGLADDSEYVREASMRAGKMIIANYSGKAVDLLLPELEKGMLDPSWRIRQSSI
                     SLTGELLYKVTGISGKVELEEEDAPTQSADHARRALLEALGAERRDRVLAALYIVRQD
                     AVGVVRQASIHIWKALVQNTPKTTRDILGILMQILMSLLGSSHVEQQETASRTIGELC
                     RKNGERILGSIIPILQEAISSPDAKTKEGACLAFADVMASTNKDIISEHEDAIISSIR
                     AALVDSEPSVRAAAAKTFDSAQHYMGTKAIDQTIPTLLEAMRHPGESSETALQALQEV
                     MSVRANSVFPVLIPTLIAQPITAFNARALGQLVKVAGSALNRRLDTVLNALVLSLEKE
                     TSEEILEELNAAIESLLESVEDSEGIHLLEMLLLGWARDVNPTRRSTACDIFGTFCQV
                     NDSDTSEYRIDWIRVLISLMDDDVEEVVTSAWEALDHFVKTIDKSELEDLVVPLRRAI
                     ESAGAPGRPVPGFSRPKGVQSIVPILLGGVLSGTQEQKEQAALGIGELVQRTTEAAIK
                     PYIIQLAGPLIRVISGQAIAPQIKTAILTTLTVLLEEVPQLVKPFHPQLTRTFVKSAQ
                     DPAALSVRNKAASGLGELMKHQPRVDPLITELIGGVRSGDSDIAPSMANALAAVCSSA
                     GKNIGAAAKASIVELAEEAFEEKRSESYNLAISRVVAGLARTDPQCIKEIIDSFVAPA
                     LPPTPLVSIMILTVLEESPDVFYDLDCVEDIVRRVMSSISADSSAAARPAREARELMR
                     KGRYGDDEKVQTLLR"
     gene            complement(707233..711108)
                     /locus_tag="CNB02440"
                     /db_xref="GeneID:3255673"
     mRNA            complement(join(707233..707821,707875..708268,
                     708333..710670,710752..711108))
                     /locus_tag="CNB02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656516.1"
                     /db_xref="GeneID:3255673"
     CDS             complement(join(707397..707821,707875..708268,
                     708333..710585))
                     /locus_tag="CNB02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512267.1"
                     /db_xref="GeneID:3255673"
                     /translation="MDILHKFSNIRGRSHTTSADDVPPRPTADEWYIPYTGRISPPSQ
                     VQTNETEAKSHRAPHKSASHGNLLSVMCGGGLGDVATLKPHGKGNRRGQEDFVNAAAG
                     GRKYHSRHQRGASTSALSPSSHLNKSHHASLSPSYTSVPTGLAEPNILFSPLNRQLRE
                     STKGTRDDTPRYARGSFLDHQDMDREKRQRTVSAPHRPKHQQHDLYTTKEEPRQWEPS
                     SSSELFIFPRPNLLAQPLQDRHGRRSSIGSLTTMTTSDDTEKVLENGKARMREREEWA
                     GYVERRGRAISLGCRAEPPPDALPVGNTKARERERRRSRERGKSNSMSSLNLGIIQGR
                     KRSTSLGNRWTRHSGGSSVSEKDIRKNDRNRGLLEPVASEKPSEIPERFTFAKSASTI
                     KRDGFPAKRPDASNSVSRHRSESPVPQGLYTPGHTRSHPNLLNSFASSKPSCNQPPAP
                     HSGPSLHFKQPSVADRGLVVVVGRGTPTQRATKMERTNNILPPLDLSKPLPNLPPEAD
                     LLVIPNDLPVSPCPDSIGVAISPDTGGFEAPQAPVERVDTPSPATANADEGLALPPLS
                     PVVDTSRIAPESSVRYSQDSRHSIEEKRLSNGSTGSSKARAFLAKQHQRARLKQAFQS
                     PLQSPLGYRRQEYNISPVKPLAVSTSTNISNVNTTATSAAFEAANNSSAVLPVPSLRS
                     VNGGYTNARKGETAASVGVMDEQEKSGPTAFGGANDEMACTKAEMKGRKKEFDPKLGD
                     TPSTAADEDFQGLFFRTPIDSQTTSSLPSHDTSSLPAIPYTRQTSSPGEVKQSQTVVY
                     QTEQELSEGKFRPVSEGSDDGTYLEIGTPEMPLNDQTLAADDVISSGPKKLLAPITIG
                     EPLDIQPRKLNAKKNGGSEEAANSFETFSAQNTPSTPPRVSVSTDSISAPVSPSLPES
                     GTIPAQNPSILPSPVTFSVSHQRYLVNPAYPSYSLNFPSPQQKGRSPSWTRRRDSRGD
                     IPLSPTINGYRDSMAISFVDKFPSPPQRYQQEGEAEEKIYSPVRATHEIDP"
     STS             707791..709472
                     /standard_name="ha3112"
                     /db_xref="UniSTS:515652"
     gene            complement(711163..712949)
                     /locus_tag="CNB02450"
                     /db_xref="GeneID:3255935"
     mRNA            complement(join(711163..712226,712284..712949))
                     /locus_tag="CNB02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_569170.2"
                     /db_xref="GeneID:3255935"
     CDS             complement(join(711320..712226,712284..712909))
                     /locus_tag="CNB02450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569170.1"
                     /db_xref="GeneID:3255935"
                     /translation="MPNSKTIQLILPPPIPSRTPPPSLDVLLEAQRIAAKNGQKLDIQ
                     SLLSPDQLEEYRVRYLKLPPGPHQGDKDDDLEKRDEKEKQQHSIPHVDDSVGGTPGSP
                     ISAATALHAGISTPVANPGTPSASIGTPTASPATLEARLKYQLPDLSHLHWKRRQKRL
                     AEIAREQEMLANGEVPEVSTIVVEETKPKGEKKLTEKEKEAIKKSTSYWNSLLVQARK
                     DRGPQWDFSTQQLLYDRRSDEYYTHGRSPPPTPPSKKRKVSTAEAGPSIPNGSVKNPE
                     SETSNTQPTPTINPPSLPSSTPSTNTRPISRGNPQPVDGAQSTPGTTSNVSLPPPPPP
                     AQPQAQLPYQAPQPPAPSQTPNLTKPPPMPVPPGAQGLNPSFLSQLQSLNPAQLAALQ
                     SSNSSLSNLPGFPGNLQGNGGGASGQGGDQFMTGTNGLQLRAGGNLNTLRQNQMPMQM
                     QMQLAMQKMGKGNHSASQGLNSVFGLGGMNSTGVMGPPLGGQQGGQGPMVGGNWRSDS
                     SG"
     gene            713132..715420
                     /locus_tag="CNB02460"
                     /db_xref="GeneID:3255950"
     mRNA            join(713132..714054,714114..714590,714671..715420)
                     /locus_tag="CNB02460"
                     /product="calcium channel, putative"
                     /transcript_id="XM_024656517.1"
                     /db_xref="GeneID:3255950"
     CDS             join(713316..714054,714114..714590,714671..715326)
                     /locus_tag="CNB02460"
                     /codon_start=1
                     /product="calcium channel, putative"
                     /protein_id="XP_024512268.1"
                     /db_xref="GeneID:3255950"
                     /translation="MPAREVYFKRPATRCQLEEIRTRHDGQQRIMQLDCEKGCSKGTQ
                     PRQRLNRRYKSPDLINISVMVVLLCILSMLSSAVAQTATGSSSSKATATSILPRQAFP
                     ATVSLPPLNSSHPLLQLALPSTSSLYLTFSVCSLTSNTTILPTVLISTSSPASFNLGS
                     KPIRDASAGGVPTSSGGKGYNYKSGKNGATWELAWSSGFGNWTLNGTSETQVHLLLGL
                     GLGSDGSTLNTTGVGNGNVVVQMGASTSGPLHALSAVYPRLGDTTSTSALIFSPLLYS
                     SPQPEPSYPNYTLPGAQLAFPDFSYSEPLNSSLSSNLTLIVVPTNSSPTSTGLDNSIC
                     AINAASANSSVSGANNTILQSFQPEWMTVGDEQGFRSYWVLGDLTEQGNYTAWLSDDN
                     GVLSQPAWFATKPADFPCQLVLPNDVCPNLGYSAPLDANSTTVTSPSGETISSTSPIQ
                     TLPDELLELIIQNLEAFSTTLLSHACGRDLFSHVSSCLDCYSAYRDWLCRIVVPQCGD
                     ANGTTSATAIETATSTSTSSGTFPTPSTVLRTPSSPRNPSLPIPAYSYYELLPCMSTC
                     NRADRSCPVTMGIRCPKRKVNAAKSYAFVGDDHSYGDGSAEQGVTAQDRWGNRWCNG"
     gene            715597..718300
                     /locus_tag="CNB02470"
                     /db_xref="GeneID:3256098"
     mRNA            join(715597..717622,717685..718300)
                     /locus_tag="CNB02470"
                     /product="expressed protein"
                     /transcript_id="XM_569011.2"
                     /db_xref="GeneID:3256098"
     CDS             715628..717601
                     /locus_tag="CNB02470"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569011.1"
                     /db_xref="GeneID:3256098"
                     /translation="MPSPKSPLSVLPANPIHSRNSHHKRVPRPLAPPGQQVPATDAPG
                     HARDAAETGMAMTVGMVPSPAGPMRTLAEAYADAHTHLHPYPNHPPPAAPSLAPRRSE
                     TLPVKDAKERERERERDRDREKKPLFDWLARKLTTAGRRPGIETTMSPKQPRSRTRLT
                     SMPKPRALGLSGGKEEKETGRGESRARMSRADTFPSVSFSISSAANTLDRERRREANN
                     PYPSLPLGQGLRGRHKQGFMDDAMTLSTTLSGGYSAENDGASGSGHGTASRRSSQSGV
                     LDGFEEGDSGRADDDASLRPFPPSVRESPTLSSYRSRSNSMLHHSAYRRTIYSVSSAG
                     GLDEDGASCDGSEDDADEDAQGADEGRSRQRRVSRDGSTSTKPTTCISFDSGPGIAHI
                     AQGSHPNASHRSASQHSLTQTGGGESIPNIHTSEASTPVSPTSPTSTSPASPPQPALG
                     LLQAPKHTNPHPGHNPHPSSPPDPNASTLTLASSNFASSHTPGAGGTRSRDNGPSSVI
                     ASPSVLTWAEPSSTPLSVAGGVERERDRDRSAAEYPPSIQTMGHLSLYAPSVSVSLRG
                     GLRGVSGERGEGGRADRDASVRAVRRKGSWESYESRWSWRGAGAGVGPGAGPSNAGTS
                     QIAGAMTSGERDKGAAGANEGKELERVPESPLL"
     gene            complement(<717756..718975)
                     /locus_tag="CNB02480"
                     /db_xref="GeneID:3255583"
     mRNA            complement(join(<717756..718188,718246..718271,
                     718325..718400,718446..718480,718539..718638,
                     718703..718796,718856..718975))
                     /locus_tag="CNB02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_569172.2"
                     /db_xref="GeneID:3255583"
     CDS             complement(join(717756..718188,718246..718271,
                     718325..718400,718446..718480,718539..718638,
                     718703..718796,718856..718940))
                     /locus_tag="CNB02480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569172.2"
                     /db_xref="GeneID:3255583"
                     /translation="MSIAPLRPSMSESYAINMPSVAAQTAPSPTDKYSVILPTYNERK
                     NLPVIVWLLAKTFETDGINWEIVIVDDASPDGTQEIAKQLAGIYGEDKIVLKPRAGKL
                     GLGTAYVHGLNYCTGNFVIIMDADFSHHPKFIPEFIKLQKLHNLDIVTGTRYSSHPSP
                     KPTASSLSIGLGPGGVYGWDLKRKLVSRGANYLADTVLTPGVSDLTGSFRLYRLHVIK
                     DIISRCTSKGYVFQMEIIVRARALGYTVGEVPITFVDRIYGESKLSGNEIVGYAKGVA
                     SLWWSV"
     gene            complement(719137..720805)
                     /locus_tag="CNB02490"
                     /db_xref="GeneID:3255954"
     mRNA            complement(join(719137..719368,719426..719628,
                     719682..719981,720042..720143,720192..720250,
                     720316..720350,720414..720805))
                     /locus_tag="CNB02490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656518.1"
                     /db_xref="GeneID:3255954"
     CDS             complement(join(719343..719368,719426..719628,
                     719682..719981,720042..720143,720192..720250,
                     720316..720350,720414..720447))
                     /locus_tag="CNB02490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512269.1"
                     /db_xref="GeneID:3255954"
                     /translation="MSSTDLGGQAAVITGGGKNLGALIAKTLAKQGVNVAIHYNSASS
                     KSETEATLKTLGSYGVKAAAFQANLTTEASVEKLFSDAAAALGVSKFDIAINTVGKVL
                     KKPIVETTEQGFDDMFLVNSKCAFFFIKHAAKNLNEGGTIISLVTSLLGAFAPGYSTY
                     QGSKAPVEWFTKSAAKELQPKNIRVNCVAPGPMDTPFFYGQETEDAVAFHKSQALTGR
                     LTDIKDIAPLVEFLCKDKWITGQVIFSNGGYTTR"
     gene            complement(721338..722945)
                     /locus_tag="CNB02495"
                     /db_xref="GeneID:36392734"
     mRNA            complement(join(721338..721724,721782..721913,
                     721978..722157,722212..722270,722329..722486,
                     722538..722689,722743..722945))
                     /locus_tag="CNB02495"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658510.1"
                     /db_xref="GeneID:36392734"
     CDS             complement(join(721468..721724,721782..721913,
                     721978..722157,722212..722270,722329..722486,
                     722538..722689,722743..722875))
                     /locus_tag="CNB02495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514212.1"
                     /db_xref="GeneID:36392734"
                     /translation="MSHIKPLTIPYSALAFDGKKEDLQQQVFHALGTHKGALGIVLIS
                     DLPPQFHYLREKLFRLAHRFANMPERERAKLEKPETSYMFGWSHGKEIMNGRPDVQKG
                     SYYANPLMDYPIVSDETRLAYPEYYAGNIWPKGMPGLEDFEQTFKALGKLIFDVGILL
                     ARVCDDFVTPTLANPEGTLSSLIAKSKSSKARLLHYYPEDPNLLINNNMFNDALCGAH
                     LDHSLLTGLCSAMYFDTSDPPQIVPNPSDTTGLWIYPRESDTPVKVSIPEDCLAFQTG
                     EALSLLTSHRLSATPHFVSGRSSSTILFSRETFAFFLQPDVEDVIGENGETFGQFTKQ
                     VLGRHYLDGDIKKVNVAHIAVP"
     gene            723168..727932
                     /locus_tag="CNB02510"
                     /db_xref="GeneID:3255669"
     mRNA            join(723168..723239,723280..723690,723744..724483,
                     724537..724654,724710..724852,724906..725149,
                     725207..725314,725378..725648,725707..725768,
                     725840..725906,725981..726410,726496..726662,
                     726725..727168,727216..727333,727399..727932)
                     /locus_tag="CNB02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656519.1"
                     /db_xref="GeneID:3255669"
     CDS             join(723219..723239,723280..723690,723744..724483,
                     724537..724654,724710..724852,724906..725149,
                     725207..725314,725378..725648,725707..725768,
                     725840..725906,725981..726410,726496..726662,
                     726725..727168,727216..727333,727399..727813)
                     /locus_tag="CNB02510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512270.1"
                     /db_xref="GeneID:3255669"
                     /translation="MNSYPGEFLAHPQPLMFIAGLSPPVVSNPNVGRERSSSTVTTDS
                     TRRPSGGAFLDTTVPAPSPSPTAEESLPKSPNVDTDQIGEGILDVQQRDEEGKWQVDE
                     RDQQFDELVVNLRGALSKMAAKGRVWLDPKGRKEFRILLVEKDVRLPMRKVSTSTTAP
                     SLSDPSAPTAPHSPLSPLVPSSPLYPDGLIAPVWVRKHAELIPSVFVLFLRLYELPTR
                     HITSDETAEEIQAREAEEKQKEREMDDLLIKEIGDRRRRLGERGIKLTVVLMASSQTL
                     DSPALDPRLSYLRRASALSSKASLFVLSPVSADQLPDFVLSLQDALYESSMDYYNAHA
                     KRVRRKRSRVPASMPIHAPTTTAQGFKVLGPQGWAVRYDWKMGWFAEVRGEIDVARRH
                     YEDCWNELAKMFSSTTTLPPRTKRWAEAKVLADCVAVRICKLSLYEGDGSRALNSFHV
                     HLKRFGDLSRGWGIGEETFEFWSWVARQYRVFAELLEMAQQHNLRIITPPPTFPTLES
                     SAAPQSLSYLATPISSQNPTQVLQHPAYYYYTAACGTLKRQERFQEALDAENDAMGSE
                     AAKTSGYVSSTAPGFANEKKVDHAALVIELFSKAYSLLKDLPSPSNRTALYIAYRIAE
                     TYNFSGQHEMAIRFFDRISHSFKNEKWTELVQGIRKMWYESAKAAGSVDGVGKLLLEM
                     MCAGSGINDQEREGLQEEFVTLLKTTSPSSTDPKVIDMDGPSDSELLDVRAGFWQAES
                     VVSKSVPYQVTLRCPDNVIIGDLEFNNLGIRFSDERPPVTIVSSNSVEDEPIQVITAD
                     SGQASLRWRPKQILVINGQLASSLESEVQITSIKLVLKQGSWAFEFVFIPGEISEWTT
                     KKGVSDCGERLATSVFFGPQPHAVDLQVSHHPLAFVGETLPIEVKVANNDDRKMNVAL
                     SVFLQPTDDGEDDGSSIEAGENRTSTLLQNISLGLLEPGASSSQSIKLFVPKECTKIV
                     DFSVQSTTSIPSPGNSLDTFPTLDRTEEVSRTVVIPVPRPFVVETSVKLTHKGKIGGE
                     GVVGMTVKVGGPRVMIVEGLELVGNADDREVKMRSSSLEGAQFPEEWNDETAYGVWAV
                     FDLAPGHRGAAGNPVQIPAELVFTWRSSASSDLLITTRHPLPPLFIPPPTDSFLISTL
                     HLPTPPIVPPHSTFPLSVTVLNTHPNYTSSQVSVTVDTAENFVWVGDRNVRLPDILPG
                     KEVEVKLECIALGGSGWVKVPKISIWDGTGEEREEVQIRGDGTIYIQP"
     gene            728397..730013
                     /locus_tag="CNB02520"
                     /db_xref="GeneID:3255567"
     mRNA            join(728397..729014,729078..729542,729592..730013)
                     /locus_tag="CNB02520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569175.2"
                     /db_xref="GeneID:3255567"
     CDS             join(728575..729014,729078..729542,729592..729970)
                     /locus_tag="CNB02520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569175.1"
                     /db_xref="GeneID:3255567"
                     /translation="MSDRQLIDDFAENDPVEFEEDDVNACNEQEFLIILVIVLAIYTT
                     YHGKFRTLPKERFPDRSNSVLTSSLKVQEYLEHRGRSMRHHLGVGLEVFMLLLREFEE
                     HGIQLASHDATAAEHLAIALAYLRKKTSVNWIGEEFKKSNEFISFCIHDVVNALTSKV
                     IYDRWVKYPTGREPPNAKVADDPLNRYRHFHGAVGSIDGTHIAVKVSPRMQPAYRNRK
                     GVVSINVLAACDFDLKFTYIIAGWEGSANDSFTFNQAVHRYNFPQLPSNRYFLADAGF
                     PICDQLLTPYRGTRYHLADFHPSRGAPQSEKEVFNLAHAQLRNSVERIFGITKQRWGV
                     LSGGLEKFKGGMQSQIILACCVLHNMCISIKDRVPERDVGEADEGGDMEEEVEGDEEL
                     RVVGETSKSRGEARRAEISRSIFEAHSRGQGRIRR"
     gene            complement(729853..731297)
                     /locus_tag="CNB02525"
                     /db_xref="GeneID:36392735"
     mRNA            complement(join(729853..730578,730633..730815,
                     730878..731106,731158..731297))
                     /locus_tag="CNB02525"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658521.1"
                     /db_xref="GeneID:36392735"
     CDS             complement(join(730036..730578,730633..730815,
                     730878..731106,731158..731270))
                     /locus_tag="CNB02525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514213.1"
                     /db_xref="GeneID:36392735"
                     /translation="MPAKNKQPSQPKLEKKVNAKWSLSETRLMLEHLAELQRQAPIPI
                     KPWTSRHWDEVAALFSDPLKTSYACCNKYAYLHNDYYAPMLKLSKKSGWGMNEDLGCI
                     EATDELWQEVIEETPSNKRFYNNPWPLFAIFGKTCTDTTATGRPVFIPGDGLVNEEES
                     GNDGDEEDGGGHHDSVLLAGDTAGVSEASIPSSGQNRFRTGFASQEPGPSRLTTTLPS
                     TGSKKRKATSSPAADTQITQQKSAATARAGRRDRAKETHEVELAQSDLDRANLIKVLD
                     TLVTKGLPANNVVSAVFEEKKACRQYLVGAEFLSEEEKVEVLEMCMESQTHRQTVLLA
                     KENPEDEMCRQLVSRLLTKNK"
     gene            731548..737294
                     /locus_tag="CNB02530"
                     /db_xref="GeneID:3255963"
     mRNA            join(731548..732176,732570..733166,733227..733583,
                     733636..734853,734906..735131,735184..735324,
                     735382..735726,735872..735889,736022..736651,
                     736706..736892,736956..737294)
                     /locus_tag="CNB02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_569176.2"
                     /db_xref="GeneID:3255963"
     CDS             join(731935..732176,732570..733166,733227..733583,
                     733636..734853,734906..735131,735184..735324,
                     735382..735726,735872..735889,736022..736651,
                     736706..736892,736956..737056)
                     /locus_tag="CNB02530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569176.1"
                     /db_xref="GeneID:3255963"
                     /translation="MESHPSTMAHDGTNTHRYPHPPIHQHGLDFSPRTHPFATSRPPR
                     IDNSDPTSEFIYQMPLMRGFGKSLSEGGNMAYSGPLDLNALNERLQGLGPNFDEQSES
                     LGSLDIANQSHPLKANGRSEPYSPSRYERSPNRANQLPQPQLTKQTPATKLTSITNPP
                     LTTHTGYISTPLLDPNEPDPNQPYRWAYPSVTELAPNDSVSMYRPARAPSRVRSGRRG
                     GTNVDPGEGDITPGKMYNEVHEQDGESFWSEDNITQGTPKTSRRFEEEMTMGPTSVWT
                     RGDIGRNMYDMRDRLLDAEARRDQEAMSSLRRQISEAHNLAATTARLEAAEKQLRELQ
                     ARLIAEQVARTQTEQVAGLREDEVKNYQNEWASAVRALRRAREEGKKTDEEKRRIQRC
                     FEEARDKLWKYHEALRVREARAQGKEEGRAEAWQEAERWMGGSPPIPGVDPIPAVPGA
                     VLHQTPMTGPLYLQSPQLQSPTTNLFQPQTQNVQAHPSRQHPQQQQQQQQQQPITPAQ
                     LPMQSIAQLLEWLASNPGAFSQASGNQGQPQAHQNIHPQQQFAQHDGTTAQYMGKAST
                     PSQIHQQQQPAMVPGMMPIAQSQLLGHSSQVQQQMPQQMYRTPGTQQHSQPRQPASAL
                     SQGKRLHHNIPNTQTASSHVNAPLPDPALNPHTADSYLERVDHDPGLKKMMAGARSKT
                     VHTSQVPTAATAGLEPGRQPLTGTRSQFDDKPLPPLTLDTPGVSRSHTVRAPHKDPIA
                     SNNRLPRRMSLSEGLHNYDHHHQRPMSQIPDGDRYPIFPLPGKNEGKNGHHGFGTVES
                     THIDHAVPLELSNFRSPNSEYRDGRASEWSTPARRNRGPAALSAARSKVAGALRKDMD
                     IEPELRDNEEMGERERFIDMHAGQVRPPMEQHGESGMPPQMFRPMPSQGGRSPSGPPR
                     PAPSMPNIRHRIQPVMPKPLGHSRTRSESHHGVGHPQPHSIAALYNARQTGPAARAND
                     RLPEPESLYHPLKSHNLFIPPQLATEAVSNEVEDVQGGRHSALGLSGVRRNGQGSDGI
                     AGMDMGRMKAPTITVQPPSSRTRSNNPTIAVIPSQASPQSLISPTAFQPTNSFAAATG
                     DGDGMHTGRVPISLDTPPGQKSHSNAVDILPSPSVLSSRPKSHSHRIPFFHHRSDSQS
                     REPCEVQPPSFGSDASTAHTRAQNSHSHTLSRLHPPPIVPCPPNHTYQSRQPYEVPLP
                     ASKSVAPTAYSRTPDDTQISVDTLTNEVRTIDFAREIPLPTKGETVYDAKTTVVTEGG
                     SEHPAFPQWTSSRQLRRRPIASNTGRSNKGNGNSVNGKEVDPRSYPLPPSRSTMKKAS
                     TYAASVPPIEEVTEPESGRDTIRRSRVSGTVAS"
     gene            complement(737309..739031)
                     /locus_tag="CNB02540"
                     /db_xref="GeneID:3255678"
     mRNA            complement(join(737309..738357,738422..739031))
                     /locus_tag="CNB02540"
                     /product="cytochrome-b5 reductase, putative"
                     /transcript_id="XM_569177.2"
                     /db_xref="GeneID:3255678"
     CDS             complement(join(737708..738357,738422..738689))
                     /locus_tag="CNB02540"
                     /codon_start=1
                     /product="cytochrome-b5 reductase, putative"
                     /protein_id="XP_569177.1"
                     /db_xref="GeneID:3255678"
                     /translation="MASVFARRPVLITATAVAVAGTAFYFSLPAPTRLDSAYNEVSRA
                     LSFPRNMVFSRDLKVRTVERVNHDTKKITLELPGGDSQISGVPASAAILTQHTSATSW
                     FPILRPYTPISSPETPGILQLLVKCYPSGRASTRMHSLQPGDVLTVRGPLPGYTYTPS
                     LTQPRSVLLVAGGAGITPIYSLAREILTAHAGDQTQVQLLWGVNGMNDIVLKDELEEL
                     ERRYPERFKVTYAISGIGKMGEGEKYRKGHVSREMLEEAIKRCEGRLGDARGMKVFLC
                     GPPKMEEALDGKKGVLRELGLGRKEIYKF"
     gene            739222..740528
                     /locus_tag="CNB02545"
                     /db_xref="GeneID:36392736"
     mRNA            join(739222..739582,739642..739760,739892..740528)
                     /locus_tag="CNB02545"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658531.1"
                     /db_xref="GeneID:36392736"
     CDS             join(739700..739760,739892..740349)
                     /locus_tag="CNB02545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514214.1"
                     /db_xref="GeneID:36392736"
                     /translation="MFSSLRVAQIVGVSGAMWLSGNIATLSLISIPALQRSALEDGVS
                     ALTLAKQWRQNFEAGKAQNPPVAAVIASAFAYLAWSARSGSAFHKFFPRNATIWYSTA
                     AVLTLGIVPYTILAMTKTNNALIQASNAKPGEKVDDLEARALTSKWIQLNAVRSCLPL
                     AGGIVALVAALA"
     gene            741686..744862
                     /locus_tag="CNB02550"
                     /db_xref="GeneID:3255949"
     mRNA            join(741686..741995,742043..742344,742394..742576,
                     742630..742752,742809..742959,743011..743386,
                     743432..743578,743629..743924,743970..744211,
                     744263..744862)
                     /locus_tag="CNB02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656520.1"
                     /db_xref="GeneID:3255949"
     CDS             join(741756..741995,742043..742344,742394..742576,
                     742630..742752,742809..742959,743011..743386,
                     743432..743578,743629..743924,743970..744211,
                     744263..744800)
                     /locus_tag="CNB02550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512271.1"
                     /db_xref="GeneID:3255949"
                     /translation="MAFSSIPSQIRTLTQPPPPNALASQIRAHVDAHFSDVAALIKPT
                     YRDQTQPSSGLRKKRREGLDDEISHWEGKDTKAAKELQETSKALPSLLSNTQDSLQQL
                     LQSAQELSLQRYNLADKLSELIGDISGSVEGQGTLDAEAKIRNKQRTILNELEGLQND
                     LGNLQAGLAWTNMLEEAVALSDSTLNPQNHKPSPLVALPHYRRLHALVEGMTKSLPKE
                     MGLLHVVMDIKEQTWQGLKDIMSENLLIASEALGWPKQVVYENVPLEARRLFERAFQD
                     LLYLQAEKESLEETGASRHPQWSLGTGLYPVQALVHPIELRFRYHFMGTKGTNRIDKP
                     EWAFANILDQTYIHQTFLATYIQTLTSQAGYTSVSVKSEFTLLLLPILLSLLRARIPH
                     LLDHPALLAHTVYQTVVFDEAVRGGGFDLKATSLYEGRDAPAWEGLVGVVLREDDWFE
                     RWLTGEKKFANARLQDIISANDAWVISEELPEEDEGLSNMRPTISSRQVKGLVEQIID
                     RYAPLPELEYKLPFLLTVQFPILATYQTRISGSLDAFETLSSAFVRAVPGALSGNTRS
                     GINFDQRALTSGKIGVERLVKALLSSDWVGEAMRKWADGIFFVELSNDLHNSTALKWK
                     IQSDPLVPQSIKAPTAADTSYQTASIFDVLIGQYEQLSRRAEDMIVKLVTVEVENELK
                     QHLTRRWDNPPSAEPINPSAHFVSALTTYTSHISTLLSLLPSLTAARLYRRIVDELSR
                     HILQRGVYSGWSKFSEKGGQDFREEINEWKEVTAQVFRSNRWNKDVWAIPYDAPWNKL
                     VHVSKLLSLPTAPLPQSENDQEPTFSQAMAVAWTDSSNLVEFEERLGVEIGKEEMQRI
                     LRRRMECWR"
     gene            complement(744835..748627)
                     /locus_tag="CNB02560"
                     /db_xref="GeneID:3255985"
     mRNA            complement(join(744835..744965,745022..745156,
                     745219..745890,745945..746082,746138..746216,
                     746278..746650,746699..747207,747255..747560,
                     747613..747725,747778..748627))
                     /locus_tag="CNB02560"
                     /product="cleavage stimulation factor, 77kDa subunit,
                     putative"
                     /transcript_id="XM_569179.2"
                     /db_xref="GeneID:3255985"
     CDS             complement(join(744919..744965,745022..745156,
                     745219..745890,745945..746082,746138..746216,
                     746278..746650,746699..747207,747255..747560,
                     747613..747725,747778..748600))
                     /locus_tag="CNB02560"
                     /codon_start=1
                     /product="cleavage stimulation factor, 77kDa subunit,
                     putative"
                     /protein_id="XP_569179.1"
                     /db_xref="GeneID:3255985"
                     /translation="MSHEHPAEIVHQLQSIDSIQQDLADTAAAVVDAASQSLPPQHAA
                     QDQKSHSTLLDNAEAMESILESAIPAAPGSSSTAAASDAIGDNNFTASGPPPISNTVV
                     APSAADDETGDVIVVESETPTTTNVVEAVVNPENDGDVPIESTEQSSGQPAEQPTEQP
                     TEQPTEQPAEQPAVETPQAPQSTPAAPAASAVESIPTTLEETHLEQIVQAPAPTVHTE
                     PLTPVVDIKMEEKPMIEHVAWIPPQGIHSDVFLPEGLTEYSPSVSQNGELIRSWRADP
                     SNPTLLLSLFNWAVQKTEVEDARAWYRVLAVDNPTAAQPLLALINLELALSNFAEVEA
                     IFASTLKGSAGITTAADVSIWAAYLHYIRRQNPLTEGSANAADVRSTITEAYEFALRE
                     CGFDRESGDIWDEYIKFVASGPATNQWDTQAKNDNLRKIYQRAVCIPLNNIEALWKSY
                     DNFESSLNKLTAKKYLAEKSPAYMTARTALRELRALSDPIPKPILPPYPTFTEQDRQV
                     VGAWKACLRWEEGNPLVIENHELLQSRIGYALRKCLGEMRHFPELWHYAASYYSKLGK
                     QDEAAEILEAGVNACPKSFLLTFAYAELQEERKAFPTCHSLYTTLISKLNPEVDELRQ
                     NVAREIDIARGPPIPGSEKAAVAAAVGDSIDADGNDISDIQRLVEEREQRGALVAQRR
                     GKDIEELMVGISVVWIMYMRFARRAEGIKAARGVFGKARKSPHLTWQVFEASALMEYH
                     TNKDAAVAIRIFELGLKQFSEDVDYVIKYLQFLLSINDDNNARALFERSVVRIMGDKA
                     RPLWDAWARYEYTYGDLSAVHKLEARMSEVFPEDAPLKRFAQRWSYNGIDQIAIRDLG
                     FNRARMGVAAPPAFAIAPVLPPVHASIPAPIAVPTPVQPPQESYKRPAPEDIPPRRPS
                     SAEFSRSPKRHRAQSPPRRYPERDDRPPPGRYRDSLPPVKAPSSIPPPPLAGPAYATP
                     SSGAYGGDKDRSGLEKPLAWFMAQLPNARSFDGPVFRPDDIMKLFGGLSLPGAGMPPA
                     PPISRGPPPPPMQSRGYYEPERDRRYGGHGSGRY"
     gene            complement(748859..751911)
                     /locus_tag="CNB02570"
                     /db_xref="GeneID:3255646"
     mRNA            complement(join(748859..749499,749553..750763,
                     750812..751198,751248..751718,751769..751911))
                     /locus_tag="CNB02570"
                     /product="RNA methyltransferase, putative"
                     /transcript_id="XM_569180.2"
                     /db_xref="GeneID:3255646"
     CDS             complement(join(748934..749499,749553..750763,
                     750812..751198,751248..751718,751769..751860))
                     /locus_tag="CNB02570"
                     /codon_start=1
                     /product="RNA methyltransferase, putative"
                     /protein_id="XP_569180.1"
                     /db_xref="GeneID:3255646"
                     /translation="MGKHDKKTGKGRLDKFYRLAKEQGYRARSAFKLVHLNRKYDLLS
                     KARCCIDLCAAPGGWLQVAEKYMPKGSLIIGVDLNAIKPLPHVTTFVADITTPHCRQT
                     LRQHMHDWKADLVLHDGAPNVGSAWVQDAFTQNELVLQSLKLATEFLAKGGSFVTKVF
                     RSQDYNSLLWVFGQLFKSVEATKPPSSRNVSAEIFVVCRDFIAPKHIDPKFLDPKHVF
                     KDIASLPTSITEPTDTSIAPTSSSTASAAAAAARLAANSHAHSNVYAPEKKRRHREGY
                     AEGDYTLHHTASAEEFVRGQDPVLLLGNMNKIEFRNETEKGWLKSRHTTPDIIANFED
                     LKVLGKGDFKALMKWRLAIRLEIGLDVKADKTQDATEEVVVEPMDEEEQITEELQKLQ
                     QAKLAKTKRERKRANEKKARELLKLQLNMTVPDDLDQNDLALQGEEEIFDLEEGENEA
                     RRRGKNGGLATLVDDGEGMDLASESEEEEDEDEEDDEVLDSDEERERKTAALEGELDG
                     LYDSYVERKKERDAKWKVKQDRLKDKNFDAWHGIQEKSDEEGSDDDDGQDDDEEGGWD
                     VIAQKKAKYGEGDSSDSDSDAEPETEVPKKIKKVSFEKPARSEKSSGLMTSLREPELR
                     AQRSKQAQLWFDQPVFKEVGDLAALDGDDEEEEEEDESEEEESDDEDVDMEDASESSS
                     TLEGDDDFEIVPQAPEDDGPEWDVDDEDQDEVKKKVIQDKGLLTAEAVSLATALVNRK
                     TTADKLIDQGFNRLSAHNKDGLPTWFLDDESQFYKPNIPITKEAVDALRARQRALDAR
                     PIKKVAEAKGRKKMKAVARMEKAKKKADGVMESEEMGDGEKARQVRRMLARAAKGKEK
                     AKEKKIVVAKGVNKGVKGRPTGVKGKYKIVDARMRKEVRALKRIKKAGSKRR"
     gene            752084..759625
                     /locus_tag="CNB02580"
                     /db_xref="GeneID:3256008"
     mRNA            join(752084..754492,754554..754631,754684..754760,
                     754809..754876,754932..755060,755116..756809,
                     756867..757058,757109..757232,757287..757402,
                     757450..757535,757588..757784,757833..757972,
                     758027..758153,758209..758455,758509..758906,
                     758959..759219,759273..759625)
                     /locus_tag="CNB02580"
                     /product="cytoskeletal protein binding protein, putative"
                     /transcript_id="XM_024656521.1"
                     /db_xref="GeneID:3256008"
     CDS             join(752273..754492,754554..754631,754684..754760,
                     754809..754876,754932..755060,755116..756809,
                     756867..757058,757109..757232,757287..757402,
                     757450..757535,757588..757784,757833..757972,
                     758027..758153,758209..758455,758509..758906,
                     758959..759219,759273..759289)
                     /locus_tag="CNB02580"
                     /codon_start=1
                     /product="cytoskeletal protein binding protein, putative"
                     /protein_id="XP_024512272.1"
                     /db_xref="GeneID:3256008"
                     /translation="MSNDPQHSPPRGASGLGRSSSIFSYQTRLLSRDNNTTSPSNGRQ
                     TPTNISSITASPAYASLASIAGKGALADSPPSTPIRRAVAKMIIDSSPSPTSTPTART
                     VTKHVRTAKSVDLVRNQWEAKIAGAQDGGTTHTMQKCGRGISATPRTAPIPSTAQLPP
                     PSPLPSTEPTEQAATKVEVSPTQVPNDFDSEKDGPSRFSSSYMARQVAKRSTVYGASE
                     FDSIRIPSTASMACASTNPIDRPASPSVASTGSLLSPNATGESIAPSVRGQSVEERLA
                     IARSNALKRRQAREQAKTAVTHNQPAIQPVIYKGTTSEQQKAMVDNESGIAKKMSSQD
                     KVTNGDLFQSEMANGKIEANTNQAIKPMSDAVGAKQSSPSIPLASKVAASPFRDLFTP
                     SSRQTERTAPAPSTARDSNHLYSRSSLRSIVTSPSASASTSSKVPSDLSSSVASASQT
                     EPPALSNGGGKYGSISRTDRRRLGRHLPRIASGEKGWEDDAASKGKDNASEGRRVPSI
                     LGKHSTIPADSEEENKPPRPVIGKKTDEYVSTNSTPKSSISRATRPPDILAPSVNENQ
                     PQLPASRVPSTPSKRRSQFMPFTHKSAITDAINPKSPRPELTGEEMKGLMNAVGSLPA
                     RGDQKDEDDGVTGMSNRLRLTKSRLPPSASSASVAPAPLPSKRLIQTNWMDKHRHALG
                     SYEYLCHVGEAQQWIEGCLEEELPFGVTEMEEGLKNGVVLAKLARVYEGEEVVKKIWT
                     ETKHRYKQSDNINYFLNFVRNVGMPETFIFELTDLYNKKNIPKVIFCIHVLSHLLARL
                     GRAERIGNLVGQFEFTNEQIAAAQKDLQGIAMPNFGDAGKSLAKEASWVPEEPEETDD
                     ERRDRLLQEREDSIVGLQRHLRGHLARMRSSRIQAQLELAEPITRRLQAHARGTLCRR
                     ALLAELDKRKHLHSMAQSIQAAVRGQIVRRSWEKRVREVRNLEVVGLQAHLKGLLART
                     KRKTDEKRLGNTMKGVTGLQAHCRGCLVRRGRTTYKNLLEEPQTVQSISSLQALLRGR
                     LHRQTVATQQRKIVSQTATFTSLQSHLRGAIVRRNIRAQEQKMDDATNYVVAVQAVAR
                     GVLARNKKRTFTRQLQQSASSTISFQALARARIAKQSHKSMQKALAKVEVAGSVGGLQ
                     AFLRTKLAKKQTTEQKKKLEFVQPDVIGFQAMARGYLAREEYHFWRDYLHDGKTIGAL
                     VFLQSLMRGFIARRRHYIRTSFIHRNVDKVVKIQALWRGRQQRVSYEKLITGIDVDVP
                     TIQSYMHLLDDTESDFADQVRIEALRGQVVDLIRENQTLETEVKDLDTKIALIINNQM
                     TFQELARAKRRTETATYHAPNNDPFSSAVHLDRTNQRKLELYEQLFFMLQTKPEYISR
                     LLRVLSIEDETAEKDRRLVEGVTMILFAFGHERREEYLFHKLLQLAVHEEVLRAPSLQ
                     DLVHSRFPIMPVTAQYIKPSLTPYIHDVIAPHVMRIVDAPELDLCTDPVRIYIGTINA
                     EETQTGTPSALPRDRNADQILQEHAITRALFIRNLQELRNLTDFLLTDLLQSHDKLPY
                     TIRLMAREALLALQRKFPEAMDDDLVPVVARTVILPFLLPAIIAPEQFGMAPDGVGAV
                     ERRNLSELANLLTHVAGQAYTDTPDQRLMRTPLEAFITAMALPFREWLLDVADVEHAE
                     GHFHAHELFESTIEAKPIKITRKDIYGTLSALIQHVDVLTHGSKKDPIVPILEELEGP
                     PIDYDKSKNQVNLRLTNRLAEPAPGDPKAGAKADWIQAKRHVLAVLRVQTGKTLFDVL
                     VSRPEDIHEQLWIQEVHRDIALENARKAKHGLPPAPVEAEYQIESIRSLPFHEVKSRA
                     IEFCMKLERSGRLSREDNLQGLLVSIASDIRQKHHLRKLRKDNLAGMIKAHEDMSKKK
                     EEFEGRVKAYHDYIDGAMAELQAKGKKKPLFMSKQYRHQMSQKKQGKQAKFGSYKYTA
                     ADLYGKQILLSVNQFSPRQFDKLFIVISSNEVGVFNLELSYPSSTTVPGGLLGQDEVR
                     MEDLLGAQYENKERLDMFEGQAAFSLNMLIHQINKKFYNS"
     gene            complement(759882..763146)
                     /locus_tag="CNB02590"
                     /db_xref="GeneID:3255887"
     mRNA            complement(join(759882..760276,760328..760537,
                     760590..760850,760908..761103,761157..761296,
                     761357..761583,761640..761776,761829..761916,
                     761968..762667,762726..763146))
                     /locus_tag="CNB02590"
                     /product="expressed protein"
                     /transcript_id="XM_024656522.1"
                     /db_xref="GeneID:3255887"
     CDS             complement(join(761006..761103,761157..761296,
                     761357..761583,761640..761776,761829..761916,
                     761968..762660))
                     /locus_tag="CNB02590"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512206.1"
                     /db_xref="GeneID:3255887"
                     /translation="MQGLKHATKNNSRRPADRTIRENAQKRRKKFVANGSSIKNFFHR
                     SGSAGSRPAVGRPREEVASNFIPPISSTSSTSSTSPNSVHSPSDPQAPITHAFQESSL
                     LPLLDNQTTSSPIPQSPTHSAQSNHVTVEASGSTSRFSSSAAAIPITNAMPFSPSGAS
                     EPGALSEREQDEDADYVEAGDSDEDEEIFEETTPGRDLSKVEVAEEMYDKIENLLKTS
                     LGRGKPLNLARQHVKIYYQMQAVLTLIQRGWTKKDTSNHVALAIFPSIDVMASSQKPV
                     VQATTLSAPCCLMSNSVRSSLSLLTTLRKYVRVTDAKDGVERIVYPEVFGAESTLTVH
                     VTTVRRWLILVGYRYSRIKKRVYVDGHERDDVREYRIWFLDQMATYERYMTWYTPDSN
                     GILQPHPPALRPGEKEIIAPFHDESSFHGYDMPIMAGPRMVTCPSGRKVMVVSSWYQI
                     LFSNQPAPSY"
     gene            763581..765158
                     /locus_tag="CNB02600"
                     /db_xref="GeneID:3255938"
     mRNA            join(763581..763939,764003..764228,764294..764373,
                     764429..764564,764625..765158)
                     /locus_tag="CNB02600"
                     /product="integral to membrane protein, putative"
                     /transcript_id="XM_024656523.1"
                     /db_xref="GeneID:3255938"
     CDS             join(763806..763939,764003..764228,764294..764373,
                     764429..764564,764625..764837)
                     /locus_tag="CNB02600"
                     /codon_start=1
                     /product="integral to membrane protein, putative"
                     /protein_id="XP_024512273.1"
                     /db_xref="GeneID:3255938"
                     /translation="MKENYAVENALGTIGAVLWMIQNIPQVIKSYREKSTKGLSASLM
                     FIWALGTVIHGAYIVAQNFSIPLQVQPQVFAALATVSWCQCLHYDRGYSVKSVWAIFI
                     VLCGIFAGFEVGSVYALWAGQRNGVEWPVLMYGYLSAVLLAVGLLPQYWEIYKYREVI
                     GISMLFMAIDILGGVFSFLSLLFRKDLDIAGFVSYALVVVLDGIIVVLYFILNPIAKR
                     RRAREAEKQRPGDEAGIEGRSTTPVSTSPTLIAHGFTVEKQDAR"
     gene            765423..769132
                     /locus_tag="CNB02610"
                     /db_xref="GeneID:3255670"
     mRNA            join(765423..765498,765637..766381,766431..766907,
                     766957..767449,767498..768248,768319..768463,
                     768526..768647,768709..769132)
                     /locus_tag="CNB02610"
                     /product="trehalose-phosphatase, putative"
                     /transcript_id="XM_569183.2"
                     /db_xref="GeneID:3255670"
     CDS             join(765685..766381,766431..766907,766957..767449,
                     767498..768248,768319..768463,768526..768647,
                     768709..768993)
                     /locus_tag="CNB02610"
                     /codon_start=1
                     /product="trehalose-phosphatase, putative"
                     /protein_id="XP_569183.1"
                     /db_xref="GeneID:3255670"
                     /translation="MDSMHPDPTPDIPPSLPDLKAQVARLEASHKEKGLPLSGRIIHV
                     MHHLPVEIVRIVPADALESAGSGFLSPPMTPEFKPEDAETTVESADAKWRIHARTAHP
                     ALVSGIKSLSETHDQLLVAWTGEVLIQPDNTQSPQQPSQATFSSIASNLLAPFSGGAG
                     DATPQPQPPPQQGSLMVFGGEFNEADQKEIASELDRFAEAESKFDPTDKLKYVPVFLP
                     PDVSKGHYEGFCKKTLWPLFHYLLWLDSTATVPSPDPSWLAYQKTNQMFAQRVAQIYK
                     PGDLIICHDYHLLLAPKMIRESLGQVFHPNAGWGTAHPSPSLHHAQRKGFDWESNQQT
                     PTPEKAKGEKIGAFMNHVGTALGNHLGTMEHGLQNEIMIGMFMHTPWPSSEIFRCLPK
                     RREILDGMLGANLVSFQTYSYSRHFVSTCIRVCGYESTPGGVDANGQVTAVGYCPIGI
                     DIKRVVHDRAQPGVLPKMQALRDLYKDKKIIVGREKLDVAKGVYNKLQAFEKFLQVYP
                     EWRGKVVLIQVTTPALSESPKLERMTAELVSHINGTYGSLDFTPVHHYHQALEKDEYF
                     GLLSCADLALITSLRDGMNTTSMEFILCQDKTSKSPLVLSEFMGTAPSFASALQINPH
                     DLLGVAQAINKGLTMREEEKAERHANLLEGVLAHTSHTWAATILKQLLENVGGEHTAH
                     HTPALDTAQFADAYKKANKRLLLFDYDGTLTPIVKVPAHAVPTERTRNAIAALCKDPK
                     NIVYLISGRDGDFLEEHWGHLDRLGLSAEHGSFVKQPGEEDFINMTEALDMSWMSEVE
                     EIFKYYTERTTGSTIEVKKASITWHYRNSDPDFGEFQCKQALDLLESSLAPRRPIEVL
                     VGKKNLEVRPLAVNKGEIVRRLMYENPDVDLIFCAGDDKTDEDMFRALRTVFPPGGVV
                     DNNPVVMKPPVAVTSALEPEEVAELPDVELSIRTKGVFATTVGPPAKRTLAGWHVTCP
                     EEVVEALESLLEEIQVV"
     gene            complement(769062..770197)
                     /locus_tag="CNB02620"
                     /db_xref="GeneID:3255952"
     mRNA            complement(join(769062..769815,769870..769931,
                     769988..770197))
                     /locus_tag="CNB02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_569184.2"
                     /db_xref="GeneID:3255952"
     CDS             complement(join(769260..769815,769870..769931,
                     769988..770053))
                     /locus_tag="CNB02620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569184.1"
                     /db_xref="GeneID:3255952"
                     /translation="MAQTSGKNLWVAASDGDIERVKYLIEQENCTANDKDANSYTPLH
                     AAASYAHIDLLSYLLSIGGDPNLTDDDGETPLYVVENIEVAKFLIDSGADPKWKNQEG
                     LTAAEQLEEDHPEVAAFLRGLTGEVAPTRPEAMVDEREAVDGDISNGQISQLALDNYT
                     STQTVALLQEAQRIMEECARDGVEPDERLREVVERAVRDGLAFGREAGEDEAPAPAGG
                     DQQKRARED"
     STS             771124..772598
                     /standard_name="RH99290"
                     /db_xref="UniSTS:90932"
     gene            771206..772976
                     /locus_tag="CNB02630"
                     /pseudo
                     /db_xref="GeneID:3255886"
     gene            complement(773204..778372)
                     /locus_tag="CNB02640"
                     /db_xref="GeneID:3255644"
     mRNA            complement(join(773204..773282,773341..773425,
                     773479..773619,773673..773797,773855..773978,
                     774028..774233,774294..774410,774468..774870,
                     774925..775223,775282..775421,775479..775577,
                     775630..775867,775924..776194,776247..776335,
                     776375..776552,776607..776679,776739..776910,
                     776960..777073,777125..777244,777295..777463,
                     777526..777717,777774..778063,778122..778372))
                     /locus_tag="CNB02640"
                     /product="cohesin complex subunit psm1, putative"
                     /transcript_id="XM_024656524.1"
                     /db_xref="GeneID:3255644"
     CDS             complement(join(773271..773282,773341..773425,
                     773479..773619,773673..773797,773855..773978,
                     774028..774233,774294..774410,774468..774870,
                     774925..775223,775282..775421,775479..775577,
                     775630..775867,775924..776194,776247..776335,
                     776375..776552,776607..776679,776739..776910,
                     776960..777073,777125..777244,777295..777463,
                     777526..777717,777774..778063,778122..778175))
                     /locus_tag="CNB02640"
                     /codon_start=1
                     /product="cohesin complex subunit psm1, putative"
                     /protein_id="XP_024512144.1"
                     /db_xref="GeneID:3255644"
                     /translation="MPLQRLELYNFKSYREKQVISFGDVPFVSIIGPNGAGKSNLMDA
                     ISFVLGVKSAQLRSTQLKDLIYRGRRAAAQEAESETQTQSESGDNSGDARSAWVMAVY
                     MDDAGKEWTFRRSVSMSGSSSYFLDGRSVAWKDYNAQLAKFNILVKAKNFLVFQGDVE
                     GVASQDSKALARLIDRISGSLDLAPSYEAAKAAQEKATEASSTNYAKKRSMLTEAKHF
                     REQQEEIKQWERLNDSKDALTQRLILWKLYHLANKISQSTQKVEEANDRLAEFRAASS
                     EADSNLSDVKREQAKAQLNVKKREANLKKAEKVFEDKKPELVAIDTQIAHSQKRASGA
                     AAQEEKVKKDEKRQADTVKELEKGLELITKNMEEAGERQRQRSQASGITLSGADLNEY
                     RQLRASANLHAVQERQQLETLRREEKNLRDALASVEDQIQQARRRREKLTGEVGNLAE
                     REETMTAKMNEMNDERERIKGQLDHAQAERRRINMRETEINERLQDTYHKLLQAGADR
                     RENEREAKLKETLASLKRIFPGVHGRVVDLCRPVATKYDTAVMTVLGRNIDAVVVEHE
                     KVAIDCIEYMRNQRAGQATFIPLDTIQVKPVPERLRNFARGARLAIDCIEYDPAVERA
                     MQHACSSSLICDTMDIAKYVCYERGQEVKAVTLDGTVIHKSGLITGGQGSGGGRKFDD
                     KEVEGLNKLKETYLGQLQELYRSKPQDKGDEALLESLSRLDAESNIAKDDLHAIQVRL
                     HGLREELTHVISTIERLTPDVEARSRSVASSEERLAALVETIEQADDEVFDTFCQRIG
                     VSNIREYEDVQLRIAKEANDAMESFAAQQARVKHQIDFESSQLRNTRERIAHLRNLAS
                     KAESNVTELRSRREEVQAELESLQAEIDRQRGKLNDANDVRDEVIRRVDEMRERSRKA
                     QKTLDRVIKEIATWNDEILKYASDRHAIYRRCRLEEIDLPLVKGRLDKVPIEEPTKDE
                     DVVMRDEEATQKPVQVDDYGLEPDFDVLEEEDRENEDEEVGREFEAQISKMRNDLERL
                     APNMKAVERLDEVERELDDAEREAEETRKESKRAKDDFQAIKKKRCDLFNKAYNHMSE
                     VIDKIYKDLTKSQNQVGGTAWFTLEEAEEPYLSGVNYSTMPPGKRFAEMEQLSGGEKT
                     MAALALLFAIHSFHPAPFFVLDEVDAALDATNVQKLARYVRSQADRNVQFLIISLKST
                     LYEKADGLVGVYREQEENSSMTLTLDLRKYGN"
     gene            778488..783116
                     /locus_tag="CNB02650"
                     /db_xref="GeneID:3255875"
     mRNA            join(778488..778710,778806..779157,779212..779219,
                     779269..779402,779454..780464,780520..780582,
                     780637..780707,780762..780812,780867..781105,
                     781155..781174,781229..781368,781421..781543,
                     781599..781668,781722..781863,781915..781951,
                     782003..782122,782175..782601,782655..783116)
                     /locus_tag="CNB02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656525.1"
                     /db_xref="GeneID:3255875"
     CDS             join(779013..779157,779212..779219,779269..779402,
                     779454..780464,780520..780582,780637..780707,
                     780762..780812,780867..781105,781155..781174,
                     781229..781368,781421..781543,781599..781668,
                     781722..781863,781915..781951,782003..782122,
                     782175..782601,782655..782832)
                     /locus_tag="CNB02650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512145.1"
                     /db_xref="GeneID:3255875"
                     /translation="MKPDTDNDGDYSHDETDFDTRKESGRNGKGKDDGKDGKEKRGTI
                     NRVNRACNNCRRMKMRCVGADEPPCKRCRNSGLECIMEKPGKSTIGGEPGEDRIRSLE
                     SQVSSIQNTLSDLVTTLRAGISSGASNASGQTPVGVSTTTPDYAPPMGGIHIPGTVSS
                     LVLNSSLSPSVPSGTVDPTAHFRHSSVGTPASTYMGPPTSAGFVHHQNSADPFRPYTS
                     NSRVQPIGLTHTTQNSDSPAPPRFPPALDEASRRQNVSAIPTNNAAWHSPAPSRNEGP
                     KHPTRHMSLPPSRAGSMGPPDIFGAEEIINPLGEMSNMAGLVEAAVERAREEQAAQTT
                     GKAPTPADPGSGKRGAADMERGPSLDNNEGSSKKARLASPPPASPPPLGPTVIETQNL
                     PPRAILPGLWPIAKRLHQHAYPDVVTAGYVTEEEGRELMKVFYSGSSNFIPCYDPAVD
                     TWESLRVRSPFSITAIVWVGARVRDGGGPHSEVQKACLAHAERLAKGTLFHPVHRIEA
                     VQSMILVSAFQDNGWLPGGHAVRMAVDMGINRSFIHLLRTGMGKGKSKEELEQERTLV
                     VHSRVWFGLYLMEHQMAYGSGRPAIIREDETIHQCRRLLDHPLSITSDARLVSTVELT
                     ALRSPLHIELTAAPDLPIAESTLRRLKQANQDFDAWERYWDRILTDRFAKSKGDFFRE
                     SLIIQRQYAELFVNSQLLRGIKEPSDVVGMPEEKRALAIRAMRNAQKCLDICLHGENY
                     RNGLRYAVHYTHVCAAFAASFLIRIARLFPYELNLKKTAKDIEELACILSEIPAGRYA
                     RSLRLILRKARRQKVIPAPSVISSPNRLNVPLPGGHPGKTGDAPGASGITAFSPSQLV
                     NPSFYPAASPATSVAAGANVNSAQAHISPNSSMLLNATNQIINDSPSSVELFEFDSLF
                     AHETMEKAGIPLGENDQLPLFLDGQSLGGSAAPTDTAPYVGLEQFFMPQDVDSRLVDP
                     SLRTEDQQAQSSGMPMDVWW"
     gene            783458..786007
                     /locus_tag="CNB02660"
                     /db_xref="GeneID:3255870"
     mRNA            join(783458..783564,783629..783891,784008..784043,
                     784173..784279,784339..784444,784495..784654,
                     784704..784913,784964..785022,785082..785119,
                     785178..785660,785721..786007)
                     /locus_tag="CNB02660"
                     /product="hexokinase, putative"
                     /transcript_id="XM_024656526.1"
                     /db_xref="GeneID:3255870"
     CDS             join(783713..783891,784008..784043,784173..784279,
                     784339..784444,784495..784654,784704..784913,
                     784964..785022,785082..785119,785178..785660,
                     785721..785809)
                     /locus_tag="CNB02660"
                     /codon_start=1
                     /product="hexokinase, putative"
                     /protein_id="XP_024512146.1"
                     /db_xref="GeneID:3255870"
                     /translation="MTLPEVCKQFEPYFILDDAKLVDIVKHFRKEMEEGLASYGKDMA
                     MIPTFVTGVPDGTEEGVFLALDLGGTNLRVCLILLQGHNQFKIKQQKYKVSEELKTGQ
                     ARVLFDYIAESVDNFLTEVESHEDIAIPATGEPMHLGFTFSFPVEQTAIDAGKLLTWT
                     KGFNTKNAIGHDVVRLLQDAFDRKHMHVRCSALVNDTVGTLLSRSYQSGPALIGAIFG
                     TGTNGAYIDKTRTISKLGKEKIEDAEEGGEHAGEFMVVNMEWGAFDNKRQCLPISIFD
                     NKLDRESINPRKQAFEKLVSGMYLGEITRNMLLYMIDSSLLFGGHSSEIINTHYGFDT
                     SFVSGIEGISSPEEVKKLIVKELKVDPKHVTDKCPEIVQWAVRLVSDRACKLAACAIA
                     AVVLHTGNDKAPEGEEDKGVDVGVDGSVAEFLPMFSERVMAALKAILGEKSAARVKLG
                     LAKDGSGVGAALTALQAKKALDRRSDRSIKFVPGERGP"
     gene            complement(785981..786619)
                     /locus_tag="CNB02665"
                     /db_xref="GeneID:36392737"
     mRNA            complement(join(785981..786157,786211..786297,
                     786360..786419,786468..786619))
                     /locus_tag="CNB02665"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658540.1"
                     /db_xref="GeneID:36392737"
     CDS             complement(join(786080..786157,786211..786297,
                     786360..786419,786468..786515))
                     /locus_tag="CNB02665"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514215.1"
                     /db_xref="GeneID:36392737"
                     /translation="MNHLPPLIQRTLEGRIDPQSQQLVTSYTQTTFIVLTALSFVLSY
                     LSGSVLLGVESFAAGFAVLIIATVPPWPYLKRYPVKFLPVRKLHAL"
     gene            786822..789504
                     /locus_tag="CNB02670"
                     /db_xref="GeneID:3255758"
     mRNA            join(786822..787803,787860..788663,788720..788793,
                     788847..789154,789207..789504)
                     /locus_tag="CNB02670"
                     /product="DNA binding protein Ncp1, putative"
                     /transcript_id="XM_568854.1"
                     /db_xref="GeneID:3255758"
     CDS             join(787373..787803,787860..788663,788720..788793,
                     788847..789154,789207..789302)
                     /locus_tag="CNB02670"
                     /codon_start=1
                     /product="DNA binding protein Ncp1, putative"
                     /protein_id="XP_568854.1"
                     /db_xref="GeneID:3255758"
                     /translation="MDRRSNRALDASAQRPSSITSATPQPVIPVTETNNMAIVPANSE
                     NDTLLANRAAGINLNERPASRTTRRSSRANGIKPGAGQGVWDLEDGETNGGKGASDYV
                     EDGDRTSVNRGENGTNPGLESVLNADPKDFRDETYGDTERPAMNLRPSRSYVKPVPIV
                     TTYEPQLPDGASAKRRSVAGSTRAPSYKRAPSRAASIDNEAAQKPMSPRREASKAGSV
                     HSNTYAADMGPNGYDNQPPRPVSRTASARNRHFDQAGAAGVGAAAGGLAVGEFISQQR
                     QQELQGGNSRHNSGVALQDGGPVPRATTFEEPSDNQQGAARTLSPRPQSSFGHRPQPQ
                     LLAINEGQGDYQPQDGRDSRAGVLGRNGTVMSRANTLGRNGNLSRGANGGTVGSRKGA
                     FGRGAGASIGTQPEEVLGRDDIHTRAELSERILDDATLHRLSTMEKKDARRLTKIIKK
                     EAKTEAQAVQASIKELERLCSLQKEAANAERKSQLRLTKWTTKEHKARMRFLKEKERY
                     EKIEGELRNAENDFEERRDHAAGLTAQVAEKTQDLDDLRAQKAADDREREVKILALKN
                     PAHS"
     gene            complement(792956..795219)
                     /locus_tag="CNB02680"
                     /db_xref="GeneID:3255906"
     mRNA            complement(join(792956..793324,793374..793806,
                     793863..794174,794227..794366,794416..794505,
                     794559..794850,794914..795031,795084..795219))
                     /locus_tag="CNB02680"
                     /product="glucose transporter, putative"
                     /transcript_id="XM_568855.1"
                     /db_xref="GeneID:3255906"
     CDS             complement(join(793052..793324,793374..793806,
                     793863..794174,794227..794366,794416..794505,
                     794559..794850,794914..795031,795084))
                     /locus_tag="CNB02680"
                     /codon_start=1
                     /product="glucose transporter, putative"
                     /protein_id="XP_568855.1"
                     /db_xref="GeneID:3255906"
                     /translation="MPGGPGVLSAPLSPERVEAPVTVKAYLLCVFASFGGIFFGFDSG
                     YMNGVLGMNYFINMMTGLPIPGADADQATKDAFTLPAWEKSLITSILSAGTFFGAIIA
                     GDLADYFGRRITIVSGCCVFIVGCCLQTASTGLGLLVAGRLIAGFGVGFISAIIILYM
                     SEIAPRKVRGAIVSGYQFCITIGLLLSSCVCYATQNRTDSGSYRIPIAIQFAWALILG
                     GGLLLLPESPRWYVKAGKIEQARKALSRVRGQPVDSDYIKDEIAEIVANHEYETELTP
                     NVTYLSSWAACFTGGIRNPGSNLRRTLLGISMQMMQQWTGVNFIFYFGTTFFTDLGTI
                     SNPFLISLITTLVNVCSTPVSFWTIERFGRRPLLIYGALGMLICEFIVGIIGVAKPGD
                     TTVVKVQISFICIYVFFFASTWGPGAWVSIGEIFPLPIRARGVGLSTASNWLWNCIIA
                     VITPYLVGTDEANLGSKVFFLWGSTCILCFIYAYLFVWETKGLTLEQVDRMMEECGSP
                     RRSAGWKPHTTFAAEAAQGTHGLDQNEKAKVGPVLSQSEMLEQV"
     gene            complement(798700..802472)
                     /locus_tag="CNB02690"
                     /db_xref="GeneID:3255592"
     mRNA            complement(join(798700..799090,799141..799276,
                     799328..799390,799439..799641,799689..799825,
                     799874..800044,800094..800205,800257..800457,
                     800514..800548,800606..800660,801855..802134,
                     802261..802472))
                     /locus_tag="CNB02690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656527.1"
                     /db_xref="GeneID:3255592"
     mRNA            complement(join(798700..799090,799141..799276,
                     799328..799390,799439..799641,799689..799825,
                     799874..800044,800094..800205,800257..800457,
                     800514..800548,800606..800660,801855..802167))
                     /locus_tag="CNB02690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568856.2"
                     /db_xref="GeneID:3255592"
     CDS             complement(join(799036..799090,799141..799276,
                     799328..799390,799439..799641,799689..799825,
                     799874..800044,800094..800205,800257..800457,
                     800514..800548,800606..800660,801855..802114))
                     /locus_tag="CNB02690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512147.1"
                     /db_xref="GeneID:3255592"
                     /translation="MSFRAPLLRARLPQAVLSRHAPLSTFSRALPAPVTLKTSGLRSS
                     LFARAFTSSPISKLEASLPLGDGGMEEAPHSGINVDKPVRMDTQPPPEPGADFNVVMI
                     GAGNIMFGSDEGPWNHSFRFEHKLGPRLKVTALIDPSLERAEKVLDGKRQSFVESAYK
                     DTKVYKTIEDYHADLKNQGIQDPNAIVVGCPPAYRGGTTKGQDLEIQMLKLFPKTAYF
                     IEKPVGTGTVQAAKEVTQRLVENGNIVSVGYMLRYLQCVQKMKQIIHENNLTVMATNA
                     RYSCAYEAIAKPAWWNKAIDMGPVIEQGTHFCDLSRYFGGDVDMNSIASRSVEWYEEP
                     GKLSKIPIDESKIDEDLRVPRLTSAIWKYENGAVGSFQHAVALQGTAYSCELEVWADG
                     YHMRLIDPYNSPTLYVRRPGDDHEERHSYTDDDPFFSEVSSFIDCIEGGPDPHILSSF
                     EDATKSYELTWAIRMASEASRRPRA"
     CDS             complement(join(799036..799090,799141..799276,
                     799328..799390,799439..799641,799689..799825,
                     799874..800044,800094..800205,800257..800457,
                     800514..800548,800606..800660,801855..802114))
                     /locus_tag="CNB02690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568856.1"
                     /db_xref="GeneID:3255592"
                     /translation="MSFRAPLLRARLPQAVLSRHAPLSTFSRALPAPVTLKTSGLRSS
                     LFARAFTSSPISKLEASLPLGDGGMEEAPHSGINVDKPVRMDTQPPPEPGADFNVVMI
                     GAGNIMFGSDEGPWNHSFRFEHKLGPRLKVTALIDPSLERAEKVLDGKRQSFVESAYK
                     DTKVYKTIEDYHADLKNQGIQDPNAIVVGCPPAYRGGTTKGQDLEIQMLKLFPKTAYF
                     IEKPVGTGTVQAAKEVTQRLVENGNIVSVGYMLRYLQCVQKMKQIIHENNLTVMATNA
                     RYSCAYEAIAKPAWWNKAIDMGPVIEQGTHFCDLSRYFGGDVDMNSIASRSVEWYEEP
                     GKLSKIPIDESKIDEDLRVPRLTSAIWKYENGAVGSFQHAVALQGTAYSCELEVWADG
                     YHMRLIDPYNSPTLYVRRPGDDHEERHSYTDDDPFFSEVSSFIDCIEGGPDPHILSSF
                     EDATKSYELTWAIRMASEASRRPRA"
     gene            complement(803880..807416)
                     /locus_tag="CNB02700"
                     /db_xref="GeneID:3255840"
     mRNA            complement(join(803880..804351,804403..804722,
                     804776..805330,805381..805500,805554..805634,
                     805687..805752,805815..806211,806273..807416))
                     /locus_tag="CNB02700"
                     /product="Golgi to plasma membrane transport-related
                     protein, putative"
                     /transcript_id="XM_568859.2"
                     /db_xref="GeneID:3255840"
     CDS             complement(join(804409..804722,804776..805330,
                     805381..805500,805554..805634,805687..805752,
                     805815..806211,806273..807313))
                     /locus_tag="CNB02700"
                     /codon_start=1
                     /product="Golgi to plasma membrane transport-related
                     protein, putative"
                     /protein_id="XP_568859.1"
                     /db_xref="GeneID:3255840"
                     /translation="MDIDIDRWSEDERMDEDLGGKHMHEERQDGDGDEVMGDGEGTAD
                     VYEEEEERIDMDPPTRAEPVDVAPAQASIFSHPPSEVQNASSRTPELEMRAATPGLLD
                     AEQRNLPQSSAADDEPLAVDPLVAAHFPADSVASIATYEQEVTHSDTKSGESNIHETG
                     KQELLGEVNDVLAADSTALEEGTDVALAPDARVSVDGSTTDPVRNDFVATSSSAIAAP
                     QRDSSMIKEEKIAPTSNDVYEDDAEYDGEQDYYDDEPLTPENLPSIILHLPASALPAS
                     LSPARALFASVESDPGQIPVWLKNRQLELAEASLADVWGAIRAECAKEGLINSAGDGM
                     VITEKLMDLKMSEDDVNLQSITFLELMNLYHGCDLPEPVQLHLSWESSRFITRFNAIQ
                     SELEAARSRSTSEEPPHDQENQDYSGVKGHTEKKLESSGGDDDDDEYEEYVEEEAAYD
                     DEPENIGESVEDEYTDEEGRQAASDKNHDGELQDFDLSVDNSKDVSARALHRPLETTQ
                     VRPLELPVTDSKPAVNAAGREGNEDKNDIVEVLDNSEADVDAVWPEESEEKDPADNLL
                     PESLAAGSPQATERNQADSTRESVVDASSTPGDGQADFDAGAEDDGSSNEYQDFSERS
                     KENFDFREEDSPVSKDASSSVAHLSPKVSAGQDSLSSYTVSDEAGFVLVSESDKSKLT
                     AEQAEPSRLPAIVEKSDPKNAETGAGMEMKVEETSKSARHAGVGENDDADHLSSRLEV
                     ENDAGLVGDTAEAGPRRDALADVEVTPNEDEAIGDVEYEDEEELVKDIGDDDEGGYET
                     NEGTLDDDEEGKAIRASIPEEETAVNADLIVENDDTTTAPKRSYDSEGEEGENKRTRK
                     D"
     gene            807616..810424
                     /locus_tag="CNB02710"
                     /db_xref="GeneID:3255767"
     mRNA            join(807616..807815,807858..808171,808234..809226,
                     809285..809813,809871..810205,810279..810424)
                     /locus_tag="CNB02710"
                     /product="phospholipid metabolism-related protein,
                     putative"
                     /transcript_id="XM_024656528.1"
                     /db_xref="GeneID:3255767"
     CDS             join(807647..807815,807858..808171,808234..809226,
                     809285..809410)
                     /locus_tag="CNB02710"
                     /codon_start=1
                     /product="phospholipid metabolism-related protein,
                     putative"
                     /protein_id="XP_024512148.1"
                     /db_xref="GeneID:3255767"
                     /translation="MAHGLFHAYPPPSRACLLEWLAENLVYTSPSLTIQPMSSSSGYR
                     IVAERDIEIGELLLSLPKHSILSHQTASLSAITHLSSASHTILNLSLCLLHEIRLSVN
                     SKFYGYLQSLPRDMGAGLPLFWQTGEGVEVEDGERGLQWLKSTEAEKELRKSERQGLS
                     LSDVYAFYLRTSHLLPPTPTDPLPSPFLAFVHAYTLISTRAFLIDLYHLTALCPFADL
                     LNHSAVPHTCLASDDFVCYICGSLNVCEHDLSRPDGLDENGTPRRLAHLSQMEIARLK
                     NENDNIEMRLERPVRKGEEVFNTYGDVGDGRLLAEYGFIGEEFADKGLTWEMEDIFPN
                     SRELHFNITGQGWVDLCKQLSSVTCHGDGLSNWTEGFGDVDDGLLCPQEPSDPGLLNL
                     DQSARLSIVMFALCHLRVDQGAIPSDEHLIIEYFQYVTAGVVPELARSWTELQQTGVI
                     KTYQPSTTTIRTARFVYQLLQSRLNAMYKPQLSQAELLDFRDSLDPIKDKRQILGLTL
                     AINERGLLQSASNKWLQFLSAFEEQ"
     gene            complement(809267..811786)
                     /locus_tag="CNB02720"
                     /db_xref="GeneID:3255708"
     mRNA            complement(join(809267..809573,809623..809670,
                     809721..809836,809899..809939,809993..810072,
                     810124..810314,810364..810421,810477..810562,
                     810609..810632,810688..810773,810825..810862,
                     810917..811786))
                     /locus_tag="CNB02720"
                     /product="expressed protein"
                     /transcript_id="XM_568861.2"
                     /db_xref="GeneID:3255708"
     CDS             complement(join(809516..809573,809623..809670,
                     809721..809836,809899..809939,809993..810072,
                     810124..810314,810364..810421,810477..810562,
                     810609..810632,810688..810773,810825..810862,
                     810917..811737))
                     /locus_tag="CNB02720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568861.1"
                     /db_xref="GeneID:3255708"
                     /translation="MSSRPELRLPSPSAIFDEDSGDGLSFAAPSTSTIVTSHSASSRR
                     SSTIRNHLNDSDIIRQSSTAPNYRAASSIAGSSTRIITPSVLESPSISIGIERGNAPS
                     YKRKEVNSKHSQYDVAEKTARQDVKMRKSVKKENTDLKSADHKPVAHVDQMGSSQVAS
                     SSSRKRGQPHDTDNTIKAIEAGRIKRKHGMKTQSDGEARFEAYQAQLRQQSDAIVTQQ
                     MQMDTKGRQRQQYQKKSPHSLSTLDKSTVIPSQPATSVHKRAKKAKVDPMYKRPARGR
                     SHCPKTIMDRCDRAMSQRMFMIERVPYANAPNQVDFFKVLGSTGNVYTVTIGNFPNCD
                     CPDCIKGNSPCKHIIFVFLKVLKVPEDSSIWYQKGLTAAEVQWVFRHAPPAPTGSVAV
                     PPSVRDAYLRATGNLPEQVTSTSGDNEHFDGKRIKAIGEDCPVCYEEMTQQDDVNEKL
                     VYDDSLSGCGRPLHAECFRMWAVTAKKSGKDVTCVWCRNEWPTGTTGGKGKSKMNEPS
                     YDSMGYLNMASIAGMRRSRDTSTYHRGWRFRNDDSDDDCF"
     gene            813995..816264
                     /locus_tag="CNB02730"
                     /db_xref="GeneID:3255649"
     mRNA            join(813995..814339,814403..814566,814624..814637,
                     814690..814797,814860..814971,815033..815429,
                     815497..815639,815695..816264)
                     /locus_tag="CNB02730"
                     /product="expressed protein"
                     /transcript_id="XM_568862.2"
                     /db_xref="GeneID:3255649"
     CDS             join(814121..814339,814403..814566,814624..814637,
                     814690..814797,814860..814971,815033..815429,
                     815497..815639,815695..816262)
                     /locus_tag="CNB02730"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568862.1"
                     /db_xref="GeneID:3255649"
                     /translation="MATTPVSTDLGPVTASVTATLFDVIATSISSVSVGETPYETQTL
                     AGSNDTTLFDGGMGMPDTASGDSEGSYILNTFIGLFIVLASSVFNALGLNMTKLDHVR
                     QQSIPKGQRKKEYLRLLWLSGMGMYIASQVFGSPLALRYLRPDWVAPLGSSSLVFNFL
                     FAYWLVGTPVTTSDIRGTAVIILGVILIIVFSSINHGLQQSLSIERLNSLWSRPAWLA
                     YFIVVVLFTASAYIVSLLLQSLLSSRASFSPLASPSLELPVSRSSSPNPFVKTYRKLT
                     GNWGKFERFAVGKLEVIFQRTDDVKVTWLQGIGWAVAGGSLAGLCLVFTKAVVKIMWL
                     PGHPLVHPSALISLLLVILTAVLQIVCLNRAIVCADTVVVVPLFYAGYTVFGFVNSLI
                     FYDEIKQYARWVLIVVFLSIAVLISGVVLLSLKSSANTSSDPYTVSTQPTGSMRLRPR
                     APKSETIAETENDEAGPSAYRKEEDDEEYEGVSGPRDVLWEVGSVSDHSGDDGHDAEE
                     EGTGRGVGGVKGGTGERRGLLGEEEQDVHEGEDKEGAAGNPFEEGDDGFGEYEGVNVE
                     EEQSTEHR"
     gene            complement(815088..817795)
                     /locus_tag="CNB02740"
                     /db_xref="GeneID:3255565"
     mRNA            complement(join(815088..815678,815742..817107,
                     817160..817258,817307..817410,817463..817685,
                     817730..817795))
                     /locus_tag="CNB02740"
                     /product="ribosomal protein L4, putative"
                     /transcript_id="XM_024656529.1"
                     /db_xref="GeneID:3255565"
     CDS             complement(join(816352..817107,817160..817258,
                     817307..817410,817463..817685,817730..817768))
                     /locus_tag="CNB02740"
                     /codon_start=1
                     /product="ribosomal protein L4, putative"
                     /protein_id="XP_024512149.1"
                     /db_xref="GeneID:3255565"
                     /translation="MKRAARLVPAVSQPLRPSPRLAYILRPTPGPSSSPLALHAVRFA
                     STAVPPAAAQPLESPQDVPPNISFEGLADEADGEIERALAESDANLATWFPTLSGRHE
                     PILLPVSSLASSTPTLPSGSNVVIALPPDVFAQPIRRDILHRCVVWYLSQLRSGTKST
                     KSRSTVAYSGRKLIPQKGTGKARAGDASSGTRRGGAPIHPIFPKNWAQALPRKVRELG
                     MRVALSSKLKAGLLRVVPNLNEAGWKGTNEAKRALADALTFPEVEDSEMQATKTNTEP
                     VAQDAVQAVEKVNELEGTVPEATSSAIKPGFIPRFGPAKDLSVLFLYSPFKPSDEIAD
                     FVRVTRNIPGVEVLSTEEVQVYDILKYRWLVMEGEAVDWFGDDVFGVDGFEGYEDTMG
                     AEAVDVAREEALKA"
     gene            818083..819207
                     /locus_tag="CNB02750"
                     /db_xref="GeneID:3255683"
     mRNA            join(818083..818112,818263..818298,818352..818431,
                     818561..818710,818764..818911,818968..819207)
                     /locus_tag="CNB02750"
                     /product="PRCDNA95, putative"
                     /transcript_id="XM_024656530.1"
                     /db_xref="GeneID:3255683"
     CDS             join(818266..818298,818352..818431,818561..818710,
                     818764..818911,818968..818979)
                     /locus_tag="CNB02750"
                     /codon_start=1
                     /product="PRCDNA95, putative"
                     /protein_id="XP_024512150.1"
                     /db_xref="GeneID:3255683"
                     /translation="MSSVQTFGKKKTATAVAHVTPGRGLIRLNGSPISLVEPVVLRYK
                     VYEPVLVVGPERFANMDIRLRVKGGGHVSQLYALRQAIAKGVVAFYAKNEDAASAIEL
                     KKALVAYDRTLLVADPRRMEPKKFGGRGARARRQKSYR"
     gene            819349..822882
                     /locus_tag="CNB02760"
                     /db_xref="GeneID:3255584"
     mRNA            join(819349..819703,819774..819848,819898..822130,
                     822185..822246,822294..822483,822537..822882)
                     /locus_tag="CNB02760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568865.2"
                     /db_xref="GeneID:3255584"
     CDS             join(819585..819703,819774..819848,819898..822130,
                     822185..822246,822294..822483,822537..822560)
                     /locus_tag="CNB02760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568865.1"
                     /db_xref="GeneID:3255584"
                     /translation="MPPRTVAPRPSPARSTRSARSLTREQAREEDDWEAESMTSGSFK
                     VPRSRSKKGGNAIGLKDTSVNIAAAFHAAQTGHLPPPSHPNNSVSSNSSSSRSLQVPR
                     AISPAEQLAQSARALSPVRFFLRPTEEDGDDYTSFSSVGIENAGELNTSGEGESYDYR
                     QEEEYVRQAQQQKMAKAKARAEASASLKNRRVKALDEDMPYRPAEEDTVSLASSDSGG
                     GEEGVVRNGALQGRAGTRGKRLERGEGYLGMGLGIQPRRRRKSRKNGMDGDESEEEGT
                     PGTGRAWTPAVEVDGHKRSPTPLQLLRGRSPMMDRKSPVPLGAYQQRRRPSDIRTIVT
                     NVLHGVVIGLQFVVELGTTVLYRIIVRPLEKAFGSSKGFVRRAKADWWKWLGILLGIS
                     LALRFLDNAFRTKGIYTAPDAPPSTIDEMSIRLTSLEHATATLSDLLRAISEGDNELH
                     QSAIAMRSKIDEMEDAVSAERKRVEGVRGELKNEKVIMQSEIDKLRSEIHILSSQIGK
                     QENSISSDRSAKSLQAVEREITQLKSRMGQVEQNVHAALEDGRLVAAVERILPQWMPI
                     RTDSQGDFVVEPAFWTEMKKVMVGKGEVEQIVRRLIGEAGVSDNKIKESPVDEHKVVE
                     WMENAFDRHVQGGVWVTREEFTSTLKEKLQELARETAEKPISKRPAAPSMVTIKSSKG
                     EDLTSLFNSLIDTALLRYSKDTIARADYALFTAGARVIPHLTSDTFTLQKASAFGKLL
                     WASKDVQGRPPATALHPDTSVGSCWPIKGSEGSLGVMLVDRVVVSDVTIEHAPRELAL
                     DIATAPKVVKVLGLVDYAEGLEKLAEYRATHQADLNNEEDTNYLPLGTFTYDPSSYSH
                     IQTFPVSSDIVDLGIRIGVVVFKIESNWGGDLTCLYRVRVHGNA"
     gene            complement(822718..824695)
                     /locus_tag="CNB02770"
                     /db_xref="GeneID:3255745"
     mRNA            complement(join(822718..823910,823977..824090,
                     824212..824282,824345..824449,824508..824695))
                     /locus_tag="CNB02770"
                     /product="expressed protein"
                     /transcript_id="XM_568866.2"
                     /db_xref="GeneID:3255745"
     CDS             complement(join(823679..823910,823977..824090,
                     824212..824282,824345..824449,824508..824579))
                     /locus_tag="CNB02770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568866.1"
                     /db_xref="GeneID:3255745"
                     /translation="MFTKAAIVVALAGTVNAALSINTPASLIECQPAALSWSGGSSTP
                     YYLAVLPGGQVSATALENIDTVDTESYTWTVNLASGTNITIRVTDGSGNIAYSSPVVI
                     QEGSSSSCLTSSSSSSATAAAGSSSGDSSASTTASGSSASSGSSGSSASTTASGSSAS
                     ASSSSSSSDSGALLTKGNAGVAASLVGIVAAAFAAVA"
     gene            complement(826985..829358)
                     /locus_tag="CNB02780"
                     /db_xref="GeneID:3256024"
     mRNA            complement(join(826985..827465,827535..827942,
                     828006..828211,828378..828480,828538..828915,
                     828975..829358))
                     /locus_tag="CNB02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656531.1"
                     /db_xref="GeneID:3256024"
     CDS             complement(join(827008..827465,827535..827942,
                     828006..828211,828378..828480,828538..828915,
                     828975..829188))
                     /locus_tag="CNB02780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512208.1"
                     /db_xref="GeneID:3256024"
                     /translation="MSSIPDLSTGSYIPHHWRTAPGSSTGTTSVPTISSLLADKFKHA
                     RNSTLDSLGGARNWLANTMSNLGDSIKVPSPPAEPVYGRNVSFPSYLTSDDSTTTTNS
                     SLGTQIATETPTPSSVTTPSVEPTNAVSSSASSRRMPANAIESTNGASSCNVTRTPEG
                     CTSFDIDIRQINLEEGVAIISTGDDGPAHSVIITRDINNVINIDVNRLTADQTTSNSS
                     TAPTAPRGILRRPHLLDIASKSSLSYSGPLLVSGGPPTPGDDGQRVFQDVSVHDYCTS
                     TNGLSGLDKPLTAFENISSFIQRRYRQDDGSLIFSRTEANELAPYLLQSGNDGTEESR
                     ALIGFGLDDLIINSVLPSKYESEGDTSRSRTVLVDDTEVPTTTEAGSGVDVSAWKGHS
                     LNEWLSERVASTDTFGLQSDISSLSDGKELLNDVRSLGSQMCRRHGIDSDPDLTTYFS
                     TRIGTYMTDRMLSSGTREVTPGILADADHILFKAISALSGMSEDARISTLLGRNAPTY
                     SRHTSQSAASRTPSTESVTSQYPDHSLYSDSSWWAPSSPTSQSSSYVESPLTSSTSFS
                     DVPSSTSRSVRFNPYVEAVHYE"
     gene            complement(829467..833981)
                     /locus_tag="CNB02790"
                     /db_xref="GeneID:3255771"
     mRNA            complement(join(829467..830185,830239..830365,
                     830420..830506,830557..830662,830712..830812,
                     830870..831207,831256..831825,831873..832083,
                     832137..832414,832474..832561,832602..832692,
                     832730..832811,832859..833164,833232..833396,
                     833739..833981))
                     /locus_tag="CNB02790"
                     /product="alpha,alpha-trehalase, putative"
                     /transcript_id="XM_568867.2"
                     /db_xref="GeneID:3255771"
     CDS             complement(join(829973..830185,830239..830365,
                     830420..830506,830557..830662,830712..830812,
                     830870..831207,831256..831825,831873..832083,
                     832137..832414,832474..832561,832602..832692,
                     832730..832811,832859..833164,833232..833261))
                     /locus_tag="CNB02790"
                     /codon_start=1
                     /product="alpha,alpha-trehalase, putative"
                     /protein_id="XP_568867.1"
                     /db_xref="GeneID:3255771"
                     /translation="MSSQPLEKAKLPVPKNLLFIENDVPPSTTPSAATTPTDHELDPL
                     AHAGDKAELLTQALHESQVPTKPKSPPNNVSRLGKLGQLETRLPDINAEPNEYYGGAQ
                     VTSRARTFSNVGVEGEFKRRPMQMGGEKISRNRRLSHDESTPSAPRRYLIDVEETMRL
                     VLEQEDTDNNFQISIYDSGPKLLSLGTASSNAHKTFDIRGTYMLSNLLQELALARDYG
                     RKRIVLDEARLAENPVDRLSRMIKNSFWNSLTRRIDAEGLEIACADPKNRSQHMRARI
                     YIPHGEDEMAEHYRQIAKEKPNLKLEVDILPKECDNPAFVKTLNDKPGILALAMDKKV
                     DADGKSHLEALPFIVPGARFNEKYGWDSYFMALGLLVDGRVDLAKSIVEHCIFEIKYY
                     NKVLNGNRSYYLCRSQPPFLTDFALQIYNQLDRSKPAENKAWLKRTIQAAIKEYHRYW
                     MQEPSLDLVTGLSRYRPSGLGIPPETEASHFTHILQPYAQKIGISVNEYIDGYNDGTI
                     KEPELDEYFLHDRGVRESGHDTSYRLDRKCADLATVDLNSLLYKYEFDIASAIQVAFD
                     DELYLDEEFELSPWPITAEAFKAGATYQLSTKTPQTSRHWFERAAKRKATMDELCWND
                     GQGMYFDYDTKLRKQTRYESVTTLWPLWAGSASEEQALKLVRNALPKFEVAGGLVSGT
                     EESRGVISLDRPNRQWDYPYGWPPHQIMAWVGLERYGFVDDASRLAYRWIYMMTLSFM
                     DFNGIVPEKFDVVELSHMVDAEYGNQGTDFRYVPREGFGWMNAAYQIGLQCLSTGMRR
                     AVAACVPPWVFFNLPAPDFTSARKRRAEREARDAEAAASGHGGVPKNEVHNEPPSLEQ
                     AIASLKLELTAPYSKSVNK"
     gene            834424..836432
                     /locus_tag="CNB02800"
                     /db_xref="GeneID:3255698"
     mRNA            join(834424..834596,834668..834723,834785..835093,
                     835131..835219,835259..835275,835321..835443,
                     835495..835515,835569..835759,835816..835959,
                     836030..836245,836295..836432)
                     /locus_tag="CNB02800"
                     /product="lysophospholipase"
                     /transcript_id="XM_568868.2"
                     /db_xref="GeneID:3255698"
     CDS             join(834574..834596,834668..834723,834785..835093,
                     835131..835219,835259..835275,835321..835443,
                     835495..835515,835569..835759,835816..835959,
                     836030..836245,836295..836386)
                     /locus_tag="CNB02800"
                     /codon_start=1
                     /product="lysophospholipase"
                     /protein_id="XP_568868.1"
                     /db_xref="GeneID:3255698"
                     /translation="MPLHNPIWEVIEPHLVRHNLYTVKDPTYGRYLLPHHPPHLELVN
                     DPAVSHNYRRVFLRPFNSFRSYHEAYDTTQIIHAENISLIPEELDSGVKRGGRWVAYS
                     TWEMHEPPEGGWEGGGRGKGKDLVLVHGLGDYGLRYAPHIKFFLKAGFRVIIPDLPSY
                     GRSTGINSYLPSLLLLTAAVHVVLTDVVQNDLSQGREQRKVFLNGSSMGGWTVLYYLL
                     KYPPTAQPEKVASQGQKPDIAPPEEGSGQGYDQLERSRRDEKVRIHVAGAFVLCPMIE
                     VSKESRPNILLEYLGRGVNSFAGSLPLAKAVRGNVSDDPRVEEDFFADPLCYHGMLRV
                     GTGLACLEGMTELQERAEEVNVPIRLVHGNKDRATSHKGTLRLFDRLPNEDKEIEIYD
                     GYEHVMLKLGVDAMDDEKRQRVLADWRSWLVQRC"
     gene            836569..838892
                     /locus_tag="CNB02810"
                     /db_xref="GeneID:3255992"
     mRNA            join(836569..836653,836812..836860,836918..836936,
                     836994..837049,837101..837205,837276..837381,
                     837431..837746,837799..837957,838010..838448,
                     838504..838892)
                     /locus_tag="CNB02810"
                     /product="alpha tubulin, putative"
                     /transcript_id="XM_024656532.1"
                     /db_xref="GeneID:3255992"
     mRNA            join(836569..836680,836812..836860,836918..836936,
                     836994..837049,837101..837205,837276..837381,
                     837431..837746,837799..837957,838010..838448,
                     838504..838791)
                     /locus_tag="CNB02810"
                     /product="alpha tubulin, putative"
                     /transcript_id="XM_568869.1"
                     /db_xref="GeneID:3255992"
     CDS             join(836843..836860,836918..836936,836994..837049,
                     837101..837205,837276..837381,837431..837746,
                     837799..837957,838010..838448,838504..838632)
                     /locus_tag="CNB02810"
                     /codon_start=1
                     /product="alpha tubulin, putative"
                     /protein_id="XP_024512151.1"
                     /db_xref="GeneID:3255992"
                     /translation="MREVISVHVGQAGVQIGNACWELYTLEHGLSPDGRLMEGSPSAN
                     DDGFSTFFSETGSGKHVPRSLYVDLEPNVIDEVRTGTYRSLFHPETMITGKEDAANNY
                     ARGHYTIGKDLVDSVLEQIRRLADNCSGLQGFFVFHSFGGGTGSGFGALLMERLSIDY
                     GKKSKLEFSVYPAPKMSTSVVEPYNSVLTTHTTLEHSDCSFMVDNEAIYDICRRNLGI
                     TSPSFTNLNRLIAQVVSSVTASLRFDGDLNVDLNEFQTNLVPYPRIHFPLATYAPVIS
                     AEKAFHESNSVYEMTMSCFESNNQMVKCDPRQGKYMACCMLYRGDVVPKDVNAAVANI
                     RTKRTIQFVDWCPTGFKIGICNEPPALVPGGDLAKVSRSLCMLSNTTSIATAWARLDN
                     KFDLLYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSIDAEEEEGEY"
     CDS             join(836843..836860,836918..836936,836994..837049,
                     837101..837205,837276..837381,837431..837746,
                     837799..837957,838010..838448,838504..838632)
                     /locus_tag="CNB02810"
                     /codon_start=1
                     /product="alpha tubulin, putative"
                     /protein_id="XP_568869.1"
                     /db_xref="GeneID:3255992"
                     /translation="MREVISVHVGQAGVQIGNACWELYTLEHGLSPDGRLMEGSPSAN
                     DDGFSTFFSETGSGKHVPRSLYVDLEPNVIDEVRTGTYRSLFHPETMITGKEDAANNY
                     ARGHYTIGKDLVDSVLEQIRRLADNCSGLQGFFVFHSFGGGTGSGFGALLMERLSIDY
                     GKKSKLEFSVYPAPKMSTSVVEPYNSVLTTHTTLEHSDCSFMVDNEAIYDICRRNLGI
                     TSPSFTNLNRLIAQVVSSVTASLRFDGDLNVDLNEFQTNLVPYPRIHFPLATYAPVIS
                     AEKAFHESNSVYEMTMSCFESNNQMVKCDPRQGKYMACCMLYRGDVVPKDVNAAVANI
                     RTKRTIQFVDWCPTGFKIGICNEPPALVPGGDLAKVSRSLCMLSNTTSIATAWARLDN
                     KFDLLYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDSIDAEEEEGEY"
     gene            838948..841034
                     /locus_tag="CNB02820"
                     /db_xref="GeneID:3255892"
     mRNA            join(838948..839610,839681..840028,840086..841034)
                     /locus_tag="CNB02820"
                     /product="expressed protein"
                     /transcript_id="XM_568871.2"
                     /db_xref="GeneID:3255892"
     CDS             join(839348..839610,839681..840028,840086..840827)
                     /locus_tag="CNB02820"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568871.1"
                     /db_xref="GeneID:3255892"
                     /translation="MPFPPSMPVGQQPLAITPSSDVAQQAFGFNSTGNSFPRQNSFGM
                     QSQGGPSRWDPASQSAQGIGQTNGNAGMVSGLSALMRSRGTDVELNSSPPGGTQSSLS
                     SNPHAGFHPSSYGPNIGFTAFALGSSAQGAGSYLGTSNLGMSISPPNWGSLGSGSFVG
                     SMGAFGTSLNREREGRERELEARYVKDFSCCGKRLNGLHELLEHYEEEHANMAPNVRI
                     AALNAAQGVSNSPRNVGNPFSAIPPTPAPLVPQQSQTPQVAATSDAPQPPGMMDIEME
                     DSAVYSQPISMSQIQQQPQFGVRTPGLSGPPSGTNPWAAAFRPQLLATPPQCVPPSLL
                     SYAPPTSGIAGAPSIPSSAPSPAPLTPEQQAAKAERKARKRAERAAKDEGSASETEGV
                     AVAGEKRFPCPIEGCGKVYKQANGLKYHLTRSINSGHGTIPPGGLAALLGEKGGEVEG
                     "
     gene            complement(840926..842011)
                     /locus_tag="CNB02830"
                     /db_xref="GeneID:3255777"
     mRNA            complement(join(840926..841140,841198..841403,
                     841468..841603,841670..842011))
                     /locus_tag="CNB02830"
                     /product="ribosomal protein, putative"
                     /transcript_id="XM_569321.2"
                     /db_xref="GeneID:3255777"
     CDS             complement(join(841033..841140,841198..841403,
                     841468..841603,841670..841957))
                     /locus_tag="CNB02830"
                     /codon_start=1
                     /product="ribosomal protein, putative"
                     /protein_id="XP_569321.1"
                     /db_xref="GeneID:3255777"
                     /translation="MPKSKRSKLTTLSKTPVRSTKASKQALVNEIRENVDKYDYCWMF
                     SVGDMRNDGLKEVRAQWRGTGRFFFGKGKVMAKALGETPETEYQDGLSQIAKRLKGQI
                     GLFFTSHPVDETVEWFDSWHKPEYARMGAKSTMDITLPAGPLLTPFTEPPSGDPFPHS
                     MEPQLRALGLTTSLVRGIPSLNNPHVLCVKGEKLSSEKCRILKLLAIQMADFRIHLGS
                     RWSKESGFVEGKELDEGSEKEDEMEED"
     gene            842174..843724
                     /locus_tag="CNB02840"
                     /db_xref="GeneID:3255655"
     mRNA            join(842174..842370,842430..842515,842566..842697,
                     842751..842885,842936..843597,843652..843724)
                     /locus_tag="CNB02840"
                     /product="expressed protein"
                     /transcript_id="XM_568872.2"
                     /db_xref="GeneID:3255655"
     CDS             join(842232..842370,842430..842515,842566..842697,
                     842751..842885,842936..843597,843652..843685)
                     /locus_tag="CNB02840"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568872.1"
                     /db_xref="GeneID:3255655"
                     /translation="MSHPAADAPPPYPGTTDDAQYDLTPLPHTANRPRLPEDKRNPHL
                     NNLPEDTKIVKFQTIVRENKEIVVGRIKVPTENANGTHHAFILRRYDTNAISLTTMYK
                     VAFPSATEEEEKREMDWVKSSFDTRGTNGGRDSEVVRLAGQWVSRNLAIHIAPAYNLV
                     QLVAALSRAVPDPNVAYRKSQRSQAAADELARTKAKQSQAPSSVPAISNVPVRKPQAA
                     IPSMATEISSPASKRQRKDSVTEASGSATQTITEAQPSADTSETDDTRHITIEATTTI
                     TSPSGANVDMDAEIEQAKQLVKDLRQEIQLRNEAGDSLEDQGVAVADDVRGVKRGKHE
                     DEAVVISGGAGGKDRVVRTNKRIPQTAGGDVGQRFGWGAFVFSIGLGASLTLFSQYAS
                     SLL"
     gene            complement(844033..847824)
                     /locus_tag="CNB02850"
                     /db_xref="GeneID:3255619"
     mRNA            complement(join(844033..845831,845869..846620,
                     846671..846888,846929..847029,847076..847204,
                     847248..847317,847356..847824))
                     /locus_tag="CNB02850"
                     /product="Ser/Thr protein kinase, putative"
                     /transcript_id="XM_024656533.1"
                     /db_xref="GeneID:3255619"
     CDS             complement(join(844155..845831,845869..846620,
                     846671..846888,846929..847029,847076..847204,
                     847248..847317,847356..847720))
                     /locus_tag="CNB02850"
                     /codon_start=1
                     /product="Ser/Thr protein kinase, putative"
                     /protein_id="XP_024512152.1"
                     /db_xref="GeneID:3255619"
                     /translation="MSAVPQPAGSPDQRYSLKSPTTLQPGPSDRPHSLRRTASHASQA
                     SAQVPSPRPTARSSSKGQFTPRILSRRASAQTGTAGTEYPFKALSRTSSARDPPSHTP
                     VSVHEEGWKSPATDSTPAEVIETQAVRVKRDHESGKWMINQYRVLSEIGSGTHGRVRL
                     GQDMTTEIPAADDDGELHPPASPESSFYAIKIVDRNPKRKRLTGLGRHKGSSGGAKLL
                     NENEIRKEIAIFKKVNHPNVVRMKEIIDDPESSKIYMILEWCQNGEIKWKDGEGLPAL
                     TVGETRKIFRDTLLGLEYLHHQGIIHRDIKPSNLLRSGDNTVKISDFGCSHFSEALRA
                     AAAQPGPEGDAYVDDIELAKTAGSPAFFAPEMCYSGLDSEGPSGPPSHPSPNQEVPSF
                     IIRPPSSVDTSADTSSSLMSLPRSSTTFPLKPTDSNDSAGSRRPLSFRSQSSSATIQR
                     RERLPITNAIDVWALGVTLYCLLFGKTPFNAPNEYLLMQVIVSESYIVPPFMGKDRLP
                     TGTGGLPAAEEAVECLDLLKRLLEKDAGKRITLEQAKQHGFTLHGLADSATWLAKTDP
                     HTHTFVTVSNDEVAAVITKSVRFRDRFRKGIKTISQKLQLLGTGRTRSRSFGDGESTG
                     TTNTEYSLTPAGSGSGTPRSNKLSALLPVSTPNKDVSPMNSPLPHTSIGRRFSLLNGR
                     SPDYPISPQTTTPVAQMVSPGLSKNPSALDFKNEPAGRVTSNPGPIGLGSMIHRRLSS
                     HLVPQAKPSIVPLLDETTHSPRPATSSVSLDKFKLSSEQQSISGSFRRRKSIEAEMEG
                     RRRSHSNASSISSKLARLLRTGSQRSHPRVLEKESLAGSDTEDLAVEPSVGSSSPADA
                     LGRMSLDGSLPRQSLEHIETGSRSSSQGYIPSPDRPLPAGWESRFRTNAPRRGSNLSE
                     EFTNRVAEEEIDWDGSISDEDDYDDTTSQSVAAPTPVAGMNPLWRRARNDNLGVDAQS
                     SAPIVSAAPSLEPIPDGSPSAPTTLPARSPSKPTLPEINTGSSDPLYQTSSRTSSRLS
                     PSPFRNNFAEKARSPFAGHHDDTRNSPRRKGLNWQTSAPGLVDNDEDEGLAISFGGKR
                     GRKGSVQKPTMSEDK"
     gene            <847942..849752
                     /locus_tag="CNB02860"
                     /db_xref="GeneID:3255775"
     mRNA            join(<847942..848133,848172..848417,848471..848737,
                     848793..849107,849145..849429,849471..849752)
                     /locus_tag="CNB02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656534.1"
                     /db_xref="GeneID:3255775"
     CDS             join(847942..848133,848172..848417,848471..848737,
                     848793..849107,849145..849429,849471..849698)
                     /locus_tag="CNB02860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512153.1"
                     /db_xref="GeneID:3255775"
                     /translation="MLLARLVATVSRPVASTVASIRTMSHTVTLSPAEATFVALLDDF
                     ANRLSPPVECRIAGGWVRDKLLSLPSSDLDIALSIPSGHSFAVAFVDFLKAKDVPTGS
                     VGKVVANPEQSKHLETGTTRIMGLECDFVGLRSETYADSRIPQVKPGTPFEDASRRDL
                     TINALFYNVHTRQVEDYTKMGLSDLENRIARTPLPPRQTFQDDPLRIVRCVRFASRFN
                     LAIAQEVVDSIKQEDVKVGILSKVSKERIGIETIKMLHNNPFHALSLIHSLDLHPYIF
                     SCEVDPPRQEAFAAAQILNEVAKRKSVDEVLWLATAATPFRGLTVKRKGRDVPASSVV
                     IGEGLKLSTELKTSVTNLFDAVNIINLDATRRSDIGISLQHQAVRPWERSLTFAAILA
                     ILPVWKGEWDDGAEGIYQQYEAFEGKIRDLGLPEDIDRPLLLNGNDIQQLLSIPPSSL
                     ITTIRQSLNAFQLDNPLATKEECEKWLKSMWEGEGRDLWEKNSQPPRPSKKAGKGEKR
                     KR"
     gene            850009..851475
                     /locus_tag="CNB02870"
                     /db_xref="GeneID:3255811"
     mRNA            join(850009..850276,850332..850360,850399..850806,
                     850854..850908,850956..851475)
                     /locus_tag="CNB02870"
                     /product="mitochondrial 40s ribosomal protein, putative"
                     /transcript_id="XM_568875.2"
                     /db_xref="GeneID:3255811"
     CDS             join(850060..850276,850332..850360,850399..850461)
                     /locus_tag="CNB02870"
                     /codon_start=1
                     /product="mitochondrial 40s ribosomal protein, putative"
                     /protein_id="XP_568875.2"
                     /db_xref="GeneID:3255811"
                     /translation="MGAKAQILRDIRKRLSAEQMEVQRRAFLYVARNTTLPATVRHKA
                     QLGLNTLNGGEGRMGAVKNRCWETGRGRGVISKFGLCRFQFRTKALSGELPGVHKASW
                     "
     gene            complement(850461..852258)
                     /locus_tag="CNB02880"
                     /db_xref="GeneID:3256015"
     mRNA            complement(join(850461..850741,850779..850789,
                     850845..850898,850953..851172,851222..851519,
                     851573..851735,851774..851795,851840..851936,
                     852008..852258))
                     /locus_tag="CNB02880"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_569015.2"
                     /db_xref="GeneID:3256015"
     CDS             complement(join(850618..850741,850779..850789,
                     850845..850898,850953..851172,851222..851519,
                     851573..851735,851774..851795,851840..851936,
                     852008..852230))
                     /locus_tag="CNB02880"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_569015.1"
                     /db_xref="GeneID:3256015"
                     /translation="MTLPLQEILSTTWSAVQAAISVMLVLGYGYYARKLKILSRPGEE
                     NSSHVCVTLFLPCLLFSEIGPLSSWSNLKHYWIIIVYSLLFQFISWMAGLLGVAIFKL
                     PKWIVPCMIFNNATSLPVLLLKSLGDNGTLDSLVGSGSVEAAMKRGRVYILINALVCN
                     LTRFTFGPGMLDGKSINLIHPWSESEPYPEYSEAHPYNDVDHPSTESSPLLARAENDI
                     RRAPKAAKTILRRLDGFMNPPMYGGAAAIVTGIIPFLHKWFYGDQGALSSFTRSIENL
                     GNLYPALQMFVLGAHLRSKNGPRPPIFALCYLYAFRFLIMPAISSTIVWGVRRIIGSK
                     IIQDPILDFVMIVSPVGPPALTLAAIVAMSDAGEDTTAVVTKTLVISYILTPLISITV
                     TAAISIVKTLY"
     gene            complement(852306..853767)
                     /locus_tag="CNB02890"
                     /db_xref="GeneID:3256018"
     mRNA            complement(join(852306..852804,852861..853245,
                     853284..853767))
                     /locus_tag="CNB02890"
                     /product="purine-specific oxidized base lesion DNA
                     N-glycosylase, putative"
                     /transcript_id="XM_569014.2"
                     /db_xref="GeneID:3256018"
     CDS             complement(join(852394..852804,852861..853245,
                     853284..853720))
                     /locus_tag="CNB02890"
                     /codon_start=1
                     /product="purine-specific oxidized base lesion DNA
                     N-glycosylase, putative"
                     /protein_id="XP_569014.1"
                     /db_xref="GeneID:3256018"
                     /translation="MSRPPFPAGWASVRMDPRNLSLANTLPVGQAFLWHRLPLPASDP
                     PFEEYSRAVHSPPRVVCLRQSPTHIYYTAVYPSGSAPEPERSNLSTRQWLEDYFQLVR
                     YPDLEALYLDWRRRDPELFGKVHVNDRATGIRVLRQDPWECLLAFITSTNNHIPRITS
                     LLHKFSQSFTKPVLTLKHPSNGILIPYHLFPAPHQIPTRLEKPLRDMGFGYRAPFIEA
                     SLQLLRNKFGDKEGDIEAGLVAWRNEDVDIVRENLIALKGVGRKVADCVMLMCLDKPS
                     LIPIDTHIAHIAARHPAFPSRLKNKAMSKQVYEETQEFLLGRWGPMGGWCQAVLFAAD
                     LPQSRGNIKVKTKVESIVKTVVKTETSLDNVGNVRRKRGESEEEKLPVLKRTRSATKQ
                     AQQVLVGVDVKYDENTDR"
     gene            853852..855449
                     /locus_tag="CNB02900"
                     /db_xref="GeneID:3256103"
     mRNA            join(853852..853961,854002..854271,854322..854438,
                     854497..854664,854721..854780,854818..854863,
                     854913..855008,855059..855244,855312..855449)
                     /locus_tag="CNB02900"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_024656535.1"
                     /db_xref="GeneID:3256103"
     CDS             join(853870..853961,854002..854271,854322..854438,
                     854497..854664,854721..854780,854818..854863,
                     854913..855008,855059..855244,855312..855350)
                     /locus_tag="CNB02900"
                     /codon_start=1
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_024512207.1"
                     /db_xref="GeneID:3256103"
                     /translation="MDSDAAAIALDRLKFYARDALLTITQCICKPDATLKINGRSYKI
                     EKLLGEGGFSFVYLIRDLSSDRLYALKKILVTSGQEGVKEAMREVEAYRRFRHPNIIR
                     ILDSAVVQDESGDGKIIYLFLPYYSKGNLQDAMANASVTGQRIPERKLLEIFHGTCLA
                     VRAMHQYRLPNISASYPPTREDEPLVGETVFDHDEELTQEDRGELVPYAHRDIKPANI
                     MISDEDEPILMDFGSTIKARITVETRQQALLEQDIAGEHSSMPYRAPELFDVKTGRTL
                     DEKCDIWSLGCTLYAVAYGHSPFEVDGQSIAMAVGSGRYRHPSGYSQDFVQLIDSMLV
                     VDPEHRPDIQKVIELTENILKKT"
     gene            856409..862548
                     /locus_tag="CNB02910"
                     /pseudo
                     /db_xref="GeneID:36392738"
     gene            complement(865736..877066)
                     /locus_tag="CNB02920"
                     /pseudo
                     /db_xref="GeneID:3255926"
     gene            complement(878806..885495)
                     /locus_tag="CNB02930"
                     /pseudo
                     /db_xref="GeneID:3255925"
     gene            885496..890169
                     /locus_tag="CNB02940"
                     /pseudo
                     /db_xref="GeneID:3255853"
     gene            complement(890393..896167)
                     /locus_tag="CNB02950"
                     /pseudo
                     /db_xref="GeneID:3255924"
     gene            896257..897579
                     /locus_tag="CNB02960"
                     /pseudo
                     /db_xref="GeneID:3255855"
     gene            903368..903655
                     /locus_tag="CNB02970"
                     /pseudo
                     /db_xref="GeneID:3255856"
     gene            complement(905038..907266)
                     /locus_tag="CNB02980"
                     /db_xref="GeneID:3255889"
     mRNA            complement(join(905038..905417,905474..905503,
                     905567..905630,905681..905876,905919..906264,
                     906321..906424,906477..906558,906617..906666,
                     906724..906794,906858..906928,906993..907266))
                     /locus_tag="CNB02980"
                     /product="calcium:hydrogen antiporter, putative"
                     /transcript_id="XM_024656536.1"
                     /db_xref="GeneID:3255889"
     CDS             complement(join(905374..905417,905474..905503,
                     905567..905630,905681..905876,905919..906264,
                     906321..906424,906477..906558,906617..906666,
                     906724..906794,906858..906928,906993..907146))
                     /locus_tag="CNB02980"
                     /codon_start=1
                     /product="calcium:hydrogen antiporter, putative"
                     /protein_id="XP_024512154.1"
                     /db_xref="GeneID:3255889"
                     /translation="MASLETSPLLPSQASGHPSVSKPFDLLGSTRYLLLGSWINVLLI
                     CVPLSFTAEALGWSAAARFTTSFLAIVPLAKLLGECTEQLSMKLGQTLGGLLNATFGN
                     AVELIVAIAALRQDELDLVQRSLLGSVLSNLLLVLGMSFFAAGFFFYESTFQATAAQA
                     SSSLMTLACITLILPAAYHASEVDKSSSLVGTLLGKEVSDSSDRSLKGLLVLSRGTSV
                     ILLLTYFGYLYFQLRTHSGLFEAENEEAEEMEVAEMDQWSAGTWLLIITVITAFCADI
                     LVGSIDETAQQWNIPKRFIGLILLPLVGNAAEHVTSVWMACKGKMELTIGVSVGSSIQ
                     IAAGMIPLLVIIAWPLQKDLTLFFANFETIVLFVSVMLVNLLLQDGRSNYMEGVMLMS
                     LYLVIALSYLV"
     gene            complement(907475..909293)
                     /locus_tag="CNB02990"
                     /db_xref="GeneID:3255687"
     mRNA            complement(join(907475..907662,907717..908010,
                     908064..908209,908261..908497,908546..908817,
                     908857..909074,909136..909157,909230..909293))
                     /locus_tag="CNB02990"
                     /product="acyltransferase, putative"
                     /transcript_id="XM_024656538.1"
                     /db_xref="GeneID:3255687"
     mRNA            complement(join(907475..907662,907717..908010,
                     908064..908209,908261..908497,908546..909074,
                     909136..909157,909230..909293))
                     /locus_tag="CNB02990"
                     /product="acyltransferase, putative"
                     /transcript_id="XM_024656537.1"
                     /db_xref="GeneID:3255687"
     CDS             complement(join(907569..907662,907717..908010,
                     908064..908209,908261..908497,908546..908817,
                     908857..909073))
                     /locus_tag="CNB02990"
                     /codon_start=1
                     /product="acyltransferase, putative"
                     /protein_id="XP_024512156.1"
                     /db_xref="GeneID:3255687"
                     /translation="MAQKPLYTIPINDRPPHGPWTSKILFPVIFTLAQLSINSAQFLL
                     VPLLLVPFVGKRLFSRAIGWTKDGYGRLLIAITVLFGPTQFAITTDTPPPHGQTLVER
                     DMNGQVVKINLPDRLVIMANHQAYLDWIYIWILACYAGHSAGLIILLKASLKNIPVIG
                     WGMRFFNFIFLRRSWVADRDNLTLALRQLGQEAQSGQENSETATLLPLRKRSPLWLLI
                     FPEGTIISDEERVKSIKYAKKEGVDDFATLLHPRSTGLLFCLRTLLPQIPDLNLLDIT
                     IGYPGVPFGNYPQNWYGLFSVFLKSVPPPTVYLHLHVYSHLGEPECKIPSLVPRRSSN
                     VSGLSTDSGLANAEEARAFELWLRNLWTAKERRMEQFYESQRFGGPCDIVPIQQIKWY
                     HWISAIGGGGLGTVVLLAFCIWFAVCR"
     CDS             complement(join(907569..907662,907717..908010,
                     908064..908209,908261..908497,908546..908725))
                     /locus_tag="CNB02990"
                     /codon_start=1
                     /product="acyltransferase, putative"
                     /protein_id="XP_024512155.1"
                     /db_xref="GeneID:3255687"
                     /translation="MNGQVVKINLPDRLVIMANHQAYLDWIYIWILACYAGHSAGLII
                     LLKASLKNIPVIGWGMRFFNFIFLRRSWVADRDNLTLALRQLGQEAQSGQENSETATL
                     LPLRKRSPLWLLIFPEGTIISDEERVKSIKYAKKEGVDDFATLLHPRSTGLLFCLRTL
                     LPQIPDLNLLDITIGYPGVPFGNYPQNWYGLFSVFLKSVPPPTVYLHLHVYSHLGEPE
                     CKIPSLVPRRSSNVSGLSTDSGLANAEEARAFELWLRNLWTAKERRMEQFYESQRFGG
                     PCDIVPIQQIKWYHWISAIGGGGLGTVVLLAFCIWFAVCR"
     gene            complement(909442..912129)
                     /locus_tag="CNB02995"
                     /db_xref="GeneID:36392739"
     mRNA            complement(join(909442..909780,909851..909935,
                     910016..910042,910099..910327,910382..910462,
                     910518..910624,910683..910703,910746..910763,
                     910801..910871,910923..911011,911244..911279,
                     911319..911331,911407..911476,911536..911547,
                     911588..912129))
                     /locus_tag="CNB02995"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658568.1"
                     /db_xref="GeneID:36392739"
     CDS             complement(join(910020..910042,910099..910327,
                     910382..910462,910518..910624,910683..910703,
                     910746..910763,910801..910871,910923..911011,
                     911244..911279,911319..911331,911407..911476,
                     911536..911547,911588..911681))
                     /locus_tag="CNB02995"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514216.1"
                     /db_xref="GeneID:36392739"
                     /translation="MSTSNNELRCNHLKCRSFLSMEGQAVVTTCSHIFCISCATTLFA
                     SSLACPACNQSLQGPDDIVMTTLNPTNEYKASILAGLPPSTILEITARAISFWTYQLS
                     QESAYQALVLKNAQDRQVCTEKQLNNAFEDLQIANKKIVSLENELDVNRRKVQGLINE
                     THRKGRELSRLRDNLEKVKRKNPFNGVAQAGEKIVEQSHPEQIFSASINGSTPIYRST
                     GRYTVTPHSTHNQIPFRSQSSGPHGGPIVPPLFSGTNVGASNSAISDNRSAERRFRAP
                     GMAANSGRGHF"
     gene            complement(912372..914691)
                     /locus_tag="CNB03000"
                     /db_xref="GeneID:3255759"
     mRNA            complement(join(912372..912662,912709..912836,
                     912886..913273,913315..913485,913540..913577,
                     913625..914275,914338..914353,914418..914691))
                     /locus_tag="CNB03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_568879.2"
                     /db_xref="GeneID:3255759"
     CDS             complement(join(912498..912662,912709..912836,
                     912886..913273,913315..913485,913540..913577,
                     913625..914275,914338..914353,914418..914576))
                     /locus_tag="CNB03000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568879.1"
                     /db_xref="GeneID:3255759"
                     /translation="MDAAFAIPSSTQSPVVGGLPKAQDMTRHLNRLTKHREPSSLKEL
                     YKYMTVPGMITMAGGVPHPEVFPFETVSASILSYDAFPLDPPRVPEKPKKSLISWLFS
                     SSQSQSNTISFTIPKYGSNSSDPATIQLSTSLQYQSATGPPALPLFLRQYVAKVYKPA
                     YADWDVLINIGATDGWSKICGMLLEVGDAVLVEEWTYPGAENTFMPYECVRVPIKMDG
                     QGLLPEHLESVLGGWNESERGKKRPRVLYTIPTGQNPTGATMMAERKKAIYDVCQKYD
                     VIICEDEPYYCLYTGEWTPKGAESEMSILAQRRLKAEKENGPDGNQAFLDALPPSFLA
                     FDTDGRVIRMDTFSKTSAPGSRLGWITTSPIFIERLTRATEASTQAPSGFATALTTKM
                     IQQWGFDGYIRWLRGIKATYNMRKTWLCDTFQDVFHLEFDSGNDLFPERSRTITCYSK
                     QCRSLWDEKRGLRGPALITFIPPTAGMFVFLGIHFSEHPDYYELLRKGEDATLILTDK
                     LWKELADNLVLFAPGWGFDAGGEHAIGGKGYGYYRLAFSVASYEEIRDGIYRFSQVLN
                     KFFRI"
     gene            complement(915264..917775)
                     /locus_tag="CNB03005"
                     /db_xref="GeneID:36392740"
     mRNA            complement(join(915264..916241,916314..916652,
                     916691..916855,916897..917245,917284..917416,
                     917455..917775))
                     /locus_tag="CNB03005"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658579.1"
                     /db_xref="GeneID:36392740"
     CDS             complement(join(915577..916241,916314..916652,
                     916691..916855,916897..917245,917284..917416,
                     917455..917747))
                     /locus_tag="CNB03005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514217.1"
                     /db_xref="GeneID:36392740"
                     /translation="MPTRATRSTQEAPPPSPLAAAAEAPMNKRKRPSHDPPRRPSPDQ
                     KRPRVVSQPEPAGADEEHGEAGHSSPARSPPPAASAPNVLSTEVREALMDIISQMALD
                     LPEPLEKALTLWLPPDFVEDEKNTLQYILRQPSLTWEELVDVIHVFSENLLFPVRYPN
                     PIPPRASFNIPPPPLPSHYPPHKIYNFCAALYGLLLDVQPARDQSSHFRAERWALVQK
                     TSQGGGEWFTGSVDHNETAKTGVSGENANTLETMTTQSRLGNATPITLNSILCEKNRD
                     VPLLGESVIRRASLKMNRWKELRRRKTGGGFGSIARGVTIPSVGFSIFTPTFGPAYDS
                     SGTTAGQGYYFTVEAMHERARHREWTQRALAMDQTLEEEVSGERIEENIQQRAPTVDG
                     ALVENGRLIEELQTWQQIRLRKGIKNATQREQVLAQELLSSLSQLTQVVSPAQLLPAL
                     LTRPGWSHILGRRILSTPSPSIRGTLDPRRPHALHDNTTIQLRSSLAKNGASTISNGS
                     LPHNTPSLVKTSSMPPPPSPQFNAPPPHILPISSPHSLSPVVTYNVPGRTHSPYLSPA
                     TPQPQHHTYSSFSPMPPAMPAAPLVHNRAVQAIPPTGTYLRSGPGPSSLRQSLHQMPM
                     GPQGSGVYGSPAGPANNEYMWRL"
     gene            917931..919044
                     /locus_tag="CNB03010"
                     /db_xref="GeneID:3255873"
     mRNA            join(917931..917975,918035..918158,918210..918364,
                     918418..918655,918765..919044)
                     /locus_tag="CNB03010"
                     /product="mitochondrial ribosomal protein L23, putative"
                     /transcript_id="XM_024656539.1"
                     /db_xref="GeneID:3255873"
     CDS             join(917955..917975,918035..918158,918210..918364,
                     918418..918609)
                     /locus_tag="CNB03010"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L23, putative"
                     /protein_id="XP_024512157.1"
                     /db_xref="GeneID:3255873"
                     /translation="MSATKGNTALALTRVWHHTSAQNRVLGTLASRIAWVLMGKHKPT
                     YDPAVDAGDYVIVSDALQVRLTGKKATDKVYHHHTGFMGGLKKVPITRLRERRPEEII
                     RKAVSGMLPKNTFRDRRLERLKIFPGAAPETYKGNVLTTWRENSAKIERSPSVSSVPQ
                     TEA"
     gene            complement(918685..921576)
                     /locus_tag="CNB03020"
                     /db_xref="GeneID:3255801"
     mRNA            complement(join(918685..918984,919048..919392,
                     919438..919574,919635..919778,919841..919982,
                     920033..920099,920150..920277,920330..920435,
                     920490..920586,920643..920765,920818..920895,
                     920951..921154,921354..921417,921493..921576))
                     /locus_tag="CNB03020"
                     /product="cAMP-dependent protein kinase, putative"
                     /transcript_id="XM_568881.2"
                     /db_xref="GeneID:3255801"
     mRNA            complement(join(918685..918984,919048..919392,
                     919438..919574,919635..919778,919841..919982,
                     920033..920099,920150..920277,920330..920435,
                     920490..920586,920643..920765,920818..920895,
                     920951..921154,921354..921576))
                     /locus_tag="CNB03020"
                     /product="cAMP-dependent protein kinase, putative"
                     /transcript_id="XM_024658590.1"
                     /db_xref="GeneID:3255801"
     CDS             complement(join(918924..918984,919048..919392,
                     919438..919574,919635..919778,919841..919982,
                     920033..920099,920150..920277,920330..920435,
                     920490..920586,920643..920765,920818..920895,
                     920951..920977))
                     /locus_tag="CNB03020"
                     /codon_start=1
                     /product="cAMP-dependent protein kinase, putative"
                     /protein_id="XP_024514218.1"
                     /db_xref="GeneID:3255801"
                     /translation="MGAGCCKPEAIDFEGEVNLFHFYLLRSVGKGAFGKVRVVQHKHT
                     KTLFALKYINKQKCVKMRAVANIVQERRLLEEIDHPFVVNLRYAFQDDENCFFVLDLM
                     LGGDLRFHLDRAGAMSEEIVRFYVAEIALAIDYLHSKRIVHRDLKPDNILLDEKGHAH
                     ITDFNIAVHFSDRRLLTGVAGSMAYMAPEVLTKRGYSAPVDFWSLGILAYELLFGKRP
                     FRGRTNSGLTNSILNEPLSWPEDAPGRCSSDGMHAIRGFLERDPNKRLGYRPGGGGMD
                     DIKNHPWFRNINWEQLYDKDVVPPFEPDSKRANFDATHELEELLLEENPLKARKRKEG
                     QDIALLSPEMRMMEQHFKVFDYTKAQRRSYYIPNPSQDSTLSAAAAISSSNAIRQSPQ
                     IDITRPETPSDQTGVISKTGMDVEAQILDGGGMANMGGRGGWRSSDLLERGHTVSDIR
                     PTSTKLLTTSQHSSSEPSPTLEEHVVDRYGENAF"
     CDS             complement(join(918924..918984,919048..919392,
                     919438..919574,919635..919778,919841..919982,
                     920033..920099,920150..920277,920330..920435,
                     920490..920586,920643..920765,920818..920895,
                     920951..920977))
                     /locus_tag="CNB03020"
                     /codon_start=1
                     /product="cAMP-dependent protein kinase, putative"
                     /protein_id="XP_568881.1"
                     /db_xref="GeneID:3255801"
                     /translation="MGAGCCKPEAIDFEGEVNLFHFYLLRSVGKGAFGKVRVVQHKHT
                     KTLFALKYINKQKCVKMRAVANIVQERRLLEEIDHPFVVNLRYAFQDDENCFFVLDLM
                     LGGDLRFHLDRAGAMSEEIVRFYVAEIALAIDYLHSKRIVHRDLKPDNILLDEKGHAH
                     ITDFNIAVHFSDRRLLTGVAGSMAYMAPEVLTKRGYSAPVDFWSLGILAYELLFGKRP
                     FRGRTNSGLTNSILNEPLSWPEDAPGRCSSDGMHAIRGFLERDPNKRLGYRPGGGGMD
                     DIKNHPWFRNINWEQLYDKDVVPPFEPDSKRANFDATHELEELLLEENPLKARKRKEG
                     QDIALLSPEMRMMEQHFKVFDYTKAQRRSYYIPNPSQDSTLSAAAAISSSNAIRQSPQ
                     IDITRPETPSDQTGVISKTGMDVEAQILDGGGMANMGGRGGWRSSDLLERGHTVSDIR
                     PTSTKLLTTSQHSSSEPSPTLEEHVVDRYGENAF"
     gene            complement(922123..923701)
                     /locus_tag="CNB03030"
                     /db_xref="GeneID:3256019"
     mRNA            complement(join(922123..922645,922724..922983,
                     923040..923701))
                     /locus_tag="CNB03030"
                     /product="histidinol-phosphate transaminase, putative"
                     /transcript_id="XM_568883.2"
                     /db_xref="GeneID:3256019"
     CDS             complement(join(922207..922645,922724..922983,
                     923040..923573))
                     /locus_tag="CNB03030"
                     /codon_start=1
                     /product="histidinol-phosphate transaminase, putative"
                     /protein_id="XP_568883.1"
                     /db_xref="GeneID:3256019"
                     /translation="MPILGLKATGPSAPPHFDLEPLIRPNILALQPYRCARDDYSAGI
                     LLDANENAIGPSLPSITHDQGDKATVIASQTLSLLSDEEIANLNRYPSPTHDELKREI
                     AKLRGVPDENWVFLGVGSDEVIDMLYRVLCVPGKDRVITCPPTYGMYKVTANVNDIGV
                     LEVPLITENGSFQLDESALDVAFKANPDVKLLFICSPGNPTGTLIPLDVIKRILNNSL
                     FKGVVVVDEAYVDFSPEGSSAASLVNEYANICVSQTLSKSFGLAAIRLGYLLAPPPLV
                     QILSNTKAPYNVSLPTASIALKAVSTEGVAAMSRSVATLNKNRQTLMDDLSTIKGVGG
                     LLGGNHANFVLCQIVDEEGRPCNKRAMMIYKTMAENKGVVVRFRGTERGCEGCLRITV
                     GTKEECKQATEHIAALLQ"
     gene            924406..925321
                     /locus_tag="CNB03040"
                     /db_xref="GeneID:3256023"
     mRNA            join(924406..924642,924722..924837,924896..924916,
                     924971..925070,925123..925321)
                     /locus_tag="CNB03040"
                     /product="single-stranded DNA binding protein 12k chain,
                     putative"
                     /transcript_id="XM_024656540.1"
                     /db_xref="GeneID:3256023"
     CDS             join(924621..924642,924722..924837,924896..924916,
                     924971..925070,925123..925190)
                     /locus_tag="CNB03040"
                     /codon_start=1
                     /product="single-stranded DNA binding protein 12k chain,
                     putative"
                     /protein_id="XP_024512209.1"
                     /db_xref="GeneID:3256023"
                     /translation="MSRLGPEPRINSKHLSQHRGEIVRLIAKVATLSGDTATLETSDG
                     GTIGIHLPRDMHIADQYVEIIGTVKEDLTIRAHTHIGLGNNLDLKAVNNVIEFSHSPI
                     GQGVLN"
     gene            complement(925354..926169)
                     /locus_tag="CNB03050"
                     /db_xref="GeneID:3256044"
     mRNA            complement(join(925354..925541,925597..925631,
                     925686..925747,925825..926038,926096..926169))
                     /locus_tag="CNB03050"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_569020.2"
                     /db_xref="GeneID:3256044"
     CDS             complement(join(925522..925541,925597..925631,
                     925686..925747,925825..926038,926096..926100))
                     /locus_tag="CNB03050"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_569020.1"
                     /db_xref="GeneID:3256044"
                     /translation="MSQYAHVPKSELDEAQIRELEEYEISQGPLSVLQQSVRNSSQVL
                     ISLRNNKKLLARVKAFDRHCNMVLENVKEMWTETPKGKGKKPVNKDRFISKMFLRGDS
                     VILVLRNAA"
     gene            complement(926382..928021)
                     /locus_tag="CNB03060"
                     /db_xref="GeneID:3256034"
     mRNA            complement(join(926382..927038,927092..927316,
                     927370..928021))
                     /locus_tag="CNB03060"
                     /product="expressed protein"
                     /transcript_id="XM_569019.2"
                     /db_xref="GeneID:3256034"
     CDS             complement(join(926601..927038,927092..927316,
                     927370..927819))
                     /locus_tag="CNB03060"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569019.1"
                     /db_xref="GeneID:3256034"
                     /translation="MPSVLSPNNPVSRSYAPLADETNPSIATSAPTKTVPHNGSVIYG
                     QPSFPPMVAASSSVRLNDLQKAGMSMRNDSEETLSPSASRKGKERAKTLTFDEGALGE
                     VKRASYTGKERVRDIEEGRIYSEEQLASENSRYPPTNEAEEEERRIQENLTKLAARDM
                     ARRRAARESKQLPTPSTASTSPRSSYSISSAARRPFSFFSTSSKKGSLLGLDNSWIGK
                     KDTDVGELPMSRPRSQGEQYMNPYEAQPTFSPAPKASDSPTTSMRSPFADPSPPLPAA
                     ADPSAYRRASIVSAVSSGSPHTAYRSPLISPSSPTDETGFAYGGPTWRGGQAVQQREN
                     VERRGPDRWWHALCAWGDDLDGGHDVPEAGRTNPFE"
     gene            928284..929367
                     /locus_tag="CNB03070"
                     /db_xref="GeneID:3256083"
     mRNA            join(928284..928458,928508..928585,928638..928944,
                     928999..929088,929153..929367)
                     /locus_tag="CNB03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656541.1"
                     /db_xref="GeneID:3256083"
     CDS             join(928399..928458,928508..928585,928638..928944,
                     928999..929088,929153..929328)
                     /locus_tag="CNB03070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512158.1"
                     /db_xref="GeneID:3256083"
                     /translation="MANINSVDISRLKNGEVNLGTSIMAVQFDGGVVIGADSRTTTGS
                     YIANRVTDKLTHIHDRIYCCRSGSAADTQAVADVVHQHAQVYTSVYGSPPTVATAAAL
                     FEKLCYENKDQLSAGIIVAGWDKENGGSVYNIPLGGGMFQQPWAIGGSGSTYVYGYCD
                     ATYQEGWSKEETVKFVKNTLSLAMARDGSSGGCIRMCVITQDKVERHFIPGNELPRFW
                     EGKEVLGSMNAGSTAVVA"
     gene            929777..930991
                     /locus_tag="CNB03080"
                     /db_xref="GeneID:3255879"
     mRNA            join(929777..929845,929893..929975,930025..930061,
                     930112..930178,930228..930991)
                     /locus_tag="CNB03080"
                     /product="nucleolus protein, putative"
                     /transcript_id="XM_568885.2"
                     /db_xref="GeneID:3255879"
     CDS             join(929832..929845,929893..929975,930025..930061,
                     930112..930178,930228..930959)
                     /locus_tag="CNB03080"
                     /codon_start=1
                     /product="nucleolus protein, putative"
                     /protein_id="XP_568885.1"
                     /db_xref="GeneID:3255879"
                     /translation="MVSFQCDACADTVKKPKLDQHRSRCFASFTCLDCSKTFKNPSEY
                     KGHTSCISEAEKYQGALYKGSKKEQSQSQPQSLTPVSEAEPAASAPGIHPSRLRQMTS
                     SSSDSHQGGFQDRGTRGMRGGRGGRGGYQSRGGHNPNGGERSYASAMNKLESTVGMRS
                     WGSPAITETASENVEVREEAGEKKEEKKRKKKGDKGGTGSRANSKNARSEEPSSAPPE
                     TSEPKSKKRKIDDVDIVADAEDPSSAVSTEPISSKTIKRLKKRLSKLEEKKEMSLGEL
                     VDSLQKDEKKAVEAAEIMKGIKISFRDGSWVLNV"
     gene            complement(930980..935461)
                     /locus_tag="CNB03090"
                     /db_xref="GeneID:3255736"
     mRNA            complement(join(930980..931597,931643..931951,
                     932006..932130,932183..934283,934322..935128,
                     935174..935461))
                     /locus_tag="CNB03090"
                     /product="two-component response regulator, putative"
                     /transcript_id="XM_024656542.1"
                     /db_xref="GeneID:3255736"
     CDS             complement(join(931139..931597,931643..931951,
                     932006..932130,932183..934283,934322..935128,
                     935174..935386))
                     /locus_tag="CNB03090"
                     /codon_start=1
                     /product="two-component response regulator, putative"
                     /protein_id="XP_024512159.1"
                     /db_xref="GeneID:3255736"
                     /translation="MGLIWSSLAHLAQPCYLPRASARDSHPHRPLSHPTAAPDMWGSN
                     ASTAASESTDSLSPSPSQSAAVEFPLPMSASSSSTSSQPLFDWPVSKPTSPRTRTDPF
                     DTFDPVSSSSEDDPVPQETRRAGHHRSVTDPLLRDGQPLDMEFTTAGPPVQGYDFEQP
                     PTFSRALSSPLPAKVGSLRHPMPFTIGGLGSRNVNSAHRPLPTTPLHSISVELADSLQ
                     SAIQTLLHLSPPHLLDSAKEQYSGCAVQIPATSLSALLTSMRSLNFLSAHAEELVDMG
                     AGGDQIVLHREDFDIGELLQNVADMLSGEAAEKRIDFVLFHGDVAMKHVSVYGDSDGI
                     SYALSHVIRQILAVANYDDTIELGLQVIPQSPSLISAVGLPIASVDVSGGGGGKSAST
                     SRSGSPSNSLSRSNSAQDGPLLCVFEIVHNIYQPPPSSASATPKAELNPFTHLAEESE
                     SLRPRLDTAFCKNLLRRQNAVLKVDVPPSSPLGSGMPRRAYMLSVLLPRGKPITEPAI
                     LSKEEQEVRQPFSSRLLAREPTLNELSEFAESLRGRKVFIHANLSSVFARHLTSYLAA
                     WGMDISHLPTDGDEADKTKDLAAKRDSAYTGSMGVLDGSTSSAETPYSVKPIGMTAVQ
                     PGHFVIVDDDIAVLRRELARIRAGLLPIPLKPRLSKRPTMTSRTRSSPSVRQVPPRSP
                     GAVLIHFTSLANYNRVKDVIASFVGAPGLTNAETYVQPEVMVIPKPVGPRRFLTALHT
                     AVKQPMVDPFFSPIATSPRSPGGGYFGGLRTPTERESGFFDSVAEEPHEEADPRPDYG
                     TVQKARSPLGEFPPSAAQIVRTNQGLHLSLPTPNEIVTTPAPEYFSGASKSPSSGASG
                     IVMQSPDGRPFGMFFEPPIKNERRGSTHRTPSDSIRRKQANRRASASDEPFSSPSTAL
                     PPRRSSTISTAGNEEHRSSPIANVTDRPTHSRVNSRRKNNLPATEEPILAVGRAKGRE
                     RSETVTKGGDSGSRKGTPAASPRTEEKKELERGEKAVMPKSVAPLTAPAKKNAKVDVV
                     VPPINVLIVEDNPINQNILSMFLRKKKIKNSSAKDGAEAVEKWRTGGFHLILMDIQLP
                     VMDGIAATKEIRRLERHNNIGVFPSTPAAELPRGPNVADSPAPSSPFRSSVIIVALTA
                     SSLQSDRVAALAAGCNDFLTKPVSLKWLDKKIVEWGCMQALIDFDGWRRWKSSDTKNP
                     SETKQGFSVGPQQAARSLASRLRIERKGSRSPAAPVSTPRLNLQSATPDRPETPADST
                     SQMPKAPPVAASDPPLSPKSLNKTINDVFEQADARLENAREEQGVSSRKENASLTDST
                     NTTITIAPSKTYPAPPS"
     gene            935614..937336
                     /locus_tag="CNB03100"
                     /db_xref="GeneID:3255766"
     mRNA            join(935615..935644,935692..935818,935892..935933,
                     935982..936034,936088..936355,936409..936494,
                     936549..936629,936677..936776,936825..936893,
                     936944..937109,937162..937336)
                     /locus_tag="CNB03100"
                     /product="sterol 24-C-methyltransferase, putative"
                     /transcript_id="XM_024656543.1"
                     /db_xref="GeneID:3255766"
     CDS             join(935692..935818,935892..935933,935982..936034,
                     936088..936355,936409..936494,936549..936629,
                     936677..936776,936825..936893,936944..937109,
                     937162..937201)
                     /locus_tag="CNB03100"
                     /codon_start=1
                     /product="sterol 24-C-methyltransferase, putative"
                     /protein_id="XP_024512160.1"
                     /db_xref="GeneID:3255766"
                     /translation="MPAETRSADRVSNYNKFWEKKSANDNDTHRANRLDQYTEVVNGY
                     YDGATELYEYGWAESFHFCRFYKGEAFLQALARHEHYLASMMQLKPGMRVLDVGCGVG
                     GPAREIARFSDATIVGVNNNDFQIGRATAKSKKAGLSDKVSFVKGDFMKLSEQFGENS
                     FDAIYAIEATCHAPNFEGIYGEIFKCLKPGGVFGVYEWCMTDAWDPSNPEHKEIAHGI
                     EVGDGIPEMRNLAAARSALKTVGFEIEHEEDLADRDDAVPWYYPLEGDIWKAQTTWDM
                     FTCWRTSKMGYTITQNAVWFLEKFGLVPKGTYSVGQSLIVASKALVAGGRTKLFTPMA
                     LWVARKPAN"
     gene            complement(937325..940591)
                     /locus_tag="CNB03110"
                     /db_xref="GeneID:3255836"
     mRNA            complement(join(937325..937489,937561..938315,
                     938368..938766,938824..939759,939813..940211,
                     940267..940591))
                     /locus_tag="CNB03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_568888.2"
                     /db_xref="GeneID:3255836"
     CDS             complement(join(937450..937489,937561..938315,
                     938368..938766,938824..939759,939813..940211,
                     940267..940539))
                     /locus_tag="CNB03110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568888.1"
                     /db_xref="GeneID:3255836"
                     /translation="MAPSQLAQLKAALNTAGLSRKTHSKKDKKAYKKGGARETDRAKK
                     VEKLEEIRKNLNKFDERETRVKHDVGGRNLKGVVGRPSASKQAGLEQRKKTLLPEHQL
                     RDHRGTFRDRRFGENDPSMSIEDRMLERYTRERQRGQGKKGMFNLEDEDEDEPFGELD
                     DGFALGGLTHGGRSVMDLPGDDFVAQGLADEDEDEEENRAGRIDKRVVSKVHFGGFEE
                     AMDEDLPEKKKSKQEVMAEIIAKSKEHKYERQQQREMDAELREELDGDIADLQMLLAE
                     NAPTTPAATLFPTTSKLHPDPMPVPGGEVIGDGEYDQIVRSLAFDARAKPKNRTKTEE
                     EIALEEKENLEKAEAKRLRRMRGENVSDGEEEEGSRKKRKADDKKPDADDLEDDYVED
                     EALLGPGLTREEIETMVLSGSEAGSDDEQDDEDGREEEESFDEDAEEENESDAESAME
                     DLTENEELSVSESEEVEPVVKRTKGKKTARTEKVKEIPYTFPCPANIEEFEEIVDPLE
                     DSALPTVVQRIRALHHPSLAQGNKEKLQEFLGVLIDYVLILSSRPSPPFSLIQTLVPH
                     LTALVKLNPITAAAHFVEKIKLMQKNLSRGLARGAARPDSKTFPGAPELALLRLVGLF
                     WSTSDYSHPVVVPAVLLMGQYLSQSRVRSLRDLASGLFLCSLLAQYESLSKRILPEAV
                     NFVASSILILLPRRKGAEVNRTYPDLKAPSTSLYLNLPSSVVPSQPLDLGSAITAVGD
                     QDEEEAEQLKGGLLVVACKLVDKFAGLYLDSEAFVELMSPVKQVLEQSRAKKLSSELN
                     MVLTSTLTALSKRLSNTLSTRRPLTLQSHKPIPIASYAPRFEENFAPGKHYDPDTERN
                     ASAKLKALYKKERKGAMRELRKDNRFLAGEKAREQGEKDKEYNARMRKAEGSITVERA
                     EEKAMEREKAKEKRRAGRD"
     gene            940696..944171
                     /locus_tag="CNB03120"
                     /db_xref="GeneID:3255809"
     mRNA            join(940696..940827,940874..940960,941006..941107,
                     941154..941297,941350..941476,941533..941619,
                     941671..941994,942054..942338,942391..942678,
                     942721..943369,943418..943507,943557..943801,
                     943865..943977,944033..944171)
                     /locus_tag="CNB03120"
                     /product="phosphatidylinositol 3-kinase, putative"
                     /transcript_id="XM_024656544.1"
                     /db_xref="GeneID:3255809"
     CDS             join(940748..940827,940874..940960,941006..941107,
                     941154..941297,941350..941476,941533..941619,
                     941671..941994,942054..942338,942391..942678,
                     942721..943369,943418..943507,943557..943801,
                     943865..943977,944033..944054)
                     /locus_tag="CNB03120"
                     /codon_start=1
                     /product="phosphatidylinositol 3-kinase, putative"
                     /protein_id="XP_024512161.1"
                     /db_xref="GeneID:3255809"
                     /translation="MQPGPSKDRDYSFARLCHLAPHLALKITSLQGSLPKHPFSRTLH
                     SPALAHQGLQQQTPSDLYVTCQLWADGKQYSLPFRTAHKDFPRGYTWNSVVVFPITYP
                     SLLLSSQIAFTIWDVQGSGKAVPVGGTTMSLFNSKRTLKRGQQRLHVHRGVQADPSLN
                     TTTPSELPDEEEDEMGRLERLVKDFERGDILKIDWLDRLTFRQIEKAHSAEAEKSDSL
                     YLYVDLPKFDFPVVFSEQESLITLPPQPVIHPPSQNSQPTSALPPNLLSNDPHLWKTY
                     DPEAWRENPVEIKHRKLLRSQRLGDEGRDLKPGPADRDRLNEIFRLPPTASLSTVDKD
                     LLWKFRFSLFRSPRSLTKFLKCITWSDPVEAKQAVEKLLPLWGQEVGMDDALELLGPN
                     FTHKKVRAFAVKRLERAEDDELLLYLLQLVQALKFEHKSSLDVQRGHRSHRKRERELA
                     SQDEQGSGLSQFLINRSVANPILGTSFHWYLMIECDNRSSVGKMYAQVAFNFMKKLSE
                     TPKGQAQRDILRRQGELVQILSTRAKDIRASKDSRSKKIEKLKAYLSDSKHGLASLPE
                     PLPLPLNANIFVTSVVAEKSSIFKSNLLPLLIWFETIDSTRPTDDDSPDAVVSITPDY
                     PIIFKNGDDLRQDQLVIQLFTLMDRLLRKENLDLRLSPYSVLATSTTEGMIQFVPSKS
                     VASIMAEHGSLQNYLRIEHADDGALGSYGIEASVMDTFVRSCAGYSVLTYVLGVGDRH
                     LDNLMLAPDGHFFHVDFGYILGRDPKPYPPPVKVCKEMVDAMGGPGSAHYGRFQSLCY
                     TAFIGLRKNANLILNLVALMVDAGIQDIQLEPDKAVWKVQEKFMLDLSEEDAIKQFEV
                     LLNDTSYLTAVFDRIHDWAQYLRD"
     gene            944884..946488
                     /locus_tag="CNB03130"
                     /db_xref="GeneID:3255746"
     mRNA            join(944884..945290,945354..945388,945445..945666,
                     945725..945804,945865..945923,945988..946488)
                     /locus_tag="CNB03130"
                     /product="tafazzin exon 5 and exon 9 deleted variant short
                     form, putative"
                     /transcript_id="XM_024656545.1"
                     /db_xref="GeneID:3255746"
     CDS             join(945074..945290,945354..945388,945445..945666,
                     945725..945804,945865..945923,945988..946376)
                     /locus_tag="CNB03130"
                     /codon_start=1
                     /product="tafazzin exon 5 and exon 9 deleted variant short
                     form, putative"
                     /protein_id="XP_024512162.1"
                     /db_xref="GeneID:3255746"
                     /translation="MSSPSLASALTLSTIGLASRSFLRLTTKEFKIEGLPILLDALNI
                     PHGEKGKGKIKTDDGSDPSLKPRRGILTICNHNSVVDDPMMWSLLPLSTYFPFTSPSH
                     TCRNNRWTLGASDIMFTNSVHSKFFNLGQVIETHRGAGIFQEAIDRAVKLLQEGNWIH
                     IFPEGKVNQQLTNPEGGLLRFKWGVGRIIMDSEIMPEIIPMWISGFDQIMPETRGFPR
                     FVPRPGAHISITVGQPLTSQIQPLVKTWKDMASKEKGTLGIGGEWEQKVKGEGLAGQQ
                     QREVRDKGQLIHGREKEVRIKIVEALQEGMRKLGHDVERREGRFERGLWSHSTRQSV"
     gene            complement(946465..947362)
                     /locus_tag="CNB03140"
                     /db_xref="GeneID:3256060"
     mRNA            complement(join(946465..946561,946610..946625,
                     946678..946726,946792..946820,946873..946965,
                     947029..947056,947150..947362))
                     /locus_tag="CNB03140"
                     /product="ubiquitin-protein ligase, putative"
                     /transcript_id="XM_024656546.1"
                     /db_xref="GeneID:3256060"
     CDS             complement(join(946528..946561,946610..946625,
                     946678..946726,946792..946820,946873..946965,
                     947029..947056,947150..947227))
                     /locus_tag="CNB03140"
                     /codon_start=1
                     /product="ubiquitin-protein ligase, putative"
                     /protein_id="XP_024512163.1"
                     /db_xref="GeneID:3256060"
                     /translation="MEVDQIANPGKSAAENDKKPRFEVKKWNAVALWAWDIAVDNCAI
                     CKSHIMDLCMDCQANQGAESENGCTVAWGICNHAFHFHCISRWLKTRQVCPLDNRQWE
                     LQKYGR"
     gene            complement(948009..949637)
                     /locus_tag="CNB03150"
                     /db_xref="GeneID:3256072"
     mRNA            complement(join(948009..948204,948259..948388,
                     948450..948598,948661..948772,948823..948889,
                     948942..949030,949084..949265,949339..949358,
                     949413..949637))
                     /locus_tag="CNB03150"
                     /product="phosphate transport protein MIR1, putative"
                     /transcript_id="XM_568892.2"
                     /db_xref="GeneID:3256072"
     CDS             complement(join(948095..948204,948259..948388,
                     948450..948598,948661..948772,948823..948889,
                     948942..949030,949084..949265,949339..949358,
                     949413..949531))
                     /locus_tag="CNB03150"
                     /codon_start=1
                     /product="phosphate transport protein MIR1, putative"
                     /protein_id="XP_568892.1"
                     /db_xref="GeneID:3256072"
                     /translation="MATENAKAVAKELAGTPLTPNFTSKDYGIFFTAGALCCTLSHGG
                     MTPIDVIKTRIQIDPGLKGYSLIKGGRHIVATEGTKGLLTGFGPTAVGYLLQGGAKFA
                     GYEASKKYLVELSGSRENAIKNRTAIYLGGAAIAEFFADILLTPLEATRIRLVSNPKF
                     ASGLVSGLTKIATTEGFGSLYAGFIPILAKQVPYAIGQFTVNERCTEFIYNRMTPETK
                     KSLSSSAQFGITLGSGIIAGFAAAVLSHPADTLLSQINKGHGPKGSMIYRLGALGKEA
                     GFRGLFAGLGPRMIMTAGLVSSQFIMYGWIKTALGARPGIEIHKETQTK"
     gene            complement(951049..952399)
                     /locus_tag="CNB03155"
                     /db_xref="GeneID:36392741"
     mRNA            complement(join(951049..951309,951371..951408,
                     951470..951580,951636..951745,951803..951996,
                     952056..952399))
                     /locus_tag="CNB03155"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658599.1"
                     /db_xref="GeneID:36392741"
     CDS             complement(join(951150..951309,951371..951408,
                     951470..951580,951636..951745,951803..951996,
                     952056..952135))
                     /locus_tag="CNB03155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514219.1"
                     /db_xref="GeneID:36392741"
                     /translation="MVFTYKFPYGAHVIILFVLSLASLVLIILCTFSSPFIPSISWLR
                     NPSLAGDTTFGSFGWCSPDYCLQNRVGYEYGTQVNRALTGGMMLWAVAIIFVFLTVLS
                     VVPLLFVHESKALRTVGNRMFFLIMERIGTTITVTAWTFSIYGWSIAHRAFEVSNVEV
                     HMGSALWMGLTAAILMIILFFIGWPPEAWDGPSTRANNGAGARGVPIPPGVPANGYYH
                     YKRTTREVVPRY"
     gene            complement(954916..957103)
                     /locus_tag="CNB03160"
                     /db_xref="GeneID:3255895"
     mRNA            complement(join(954916..955307,955363..956777,
                     956837..956975,957026..957103))
                     /locus_tag="CNB03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656547.1"
                     /db_xref="GeneID:3255895"
     CDS             complement(join(955130..955307,955363..956777,
                     956837..956938))
                     /locus_tag="CNB03160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512164.1"
                     /db_xref="GeneID:3255895"
                     /translation="MSPSAPSTPHGRGSGSEPGTPAPSVAAGGSYTIDDVVPGVKIYV
                     IKPLSNGQAEQRRAEILSTRPKPKPSAFAPPPPPNAPSPDPRDDTEYYVHYVEFNKRL
                     DEWVGGSRLVLSKEMEWPKSKDEPKKKDRPAKAQPSKAPSRATGSPIPSDSLLKKAAN
                     KAAMAAGKATPGKAMPSSKLGKASKIGKAGKFPQKRKAKTEADTEAEEESNEDNDALG
                     EEEDMDEDGDVTLITSDGAIDPSREVVAAPSNPRAAPQVFSKKQEIEKLRTSGSMTQS
                     HSEISRVKNLNKLQIGKHEVETWYFSPYPIEYAHLPVLYICEFCLLYYPSATQLRRHR
                     AKCTLLHPPGNEIYRHEGISFFEIDGRKQRTWCRNLCLISKCFLDHKTLYYDVDPFLY
                     YCMTVKDDYGCHLIGYFSKEKESAEGYNVACILTLPQHQRKGYGRLLIEFSYELSKVE
                     GKLGSPEKPLSDLGLLGYRAYWQEKIVELLLDSDYEISLDEIAQKTSITHGDIMHTCQ
                     ALQMIKYYKNSHIIHLTDAVIEQHKKTKAKPRRAINPAYLKWKPPVFSRAQLAFGF"
     gene            957519..960898
                     /locus_tag="CNB03170"
                     /db_xref="GeneID:3256031"
     mRNA            join(957519..958228,958287..959117,959168..959338,
                     959389..959922,959977..960898)
                     /locus_tag="CNB03170"
                     /product="expressed protein"
                     /transcript_id="XM_024656548.1"
                     /db_xref="GeneID:3256031"
     CDS             join(957559..958228,958287..959117,959168..959338,
                     959389..959922,959977..960722)
                     /locus_tag="CNB03170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512210.1"
                     /db_xref="GeneID:3256031"
                     /translation="MPSYFPFTPQQQPAARVHSPLLDDPHLELTVTPAASAFYAGETF
                     SVTITFRNTRTPHTDAPKAPLSTNSTSSLASATSQIRHFPSTDPRHSPSVPRLPRRLN
                     QIGPDLPETPLVSARRHESAELGPSRTSSSVVSIPQFATEDLGYPYSPGANPVNRAHG
                     WQKSPSPQREGPMNYRSPDGWGNQESECTIKSNGHTRRARSLALGKGTMSPQELVWAL
                     GGGKDTPPALPTRRPQGGIQIPAKHPHSRKISIANTSALERSGEPSRDSPEVSSPPLI
                     SVPERPSSVAKNGSASLSQSRHPADGAVTIEPYETCSSPTVKPSHSRAPSYQNAYGAS
                     YMGISNDDLPTPPSHPHVREHALTEPKGTTTVLWAYTRLVGHFHPSIAYIPPDPLLPL
                     RTALLHQPVGSGSLSTPSQDSSGNVAGRPSGSSRWQLSFGTGTIGNSTQPSLTGSLFG
                     LAKDLVTGGSGGSLEEERKRVWNLKDLPVLETTRSLLAVDMKLKEGETKEFNYTLQLP
                     TNLPPAHRGRAFRFSYDLVVSLSVALPGGDHRQKSKDIVVPIRVWANVSLGNPLRTYD
                     VLKPIIQNKDEGHVEDVGNSVDFQSPYVREGRAQIPVQRRQTNIPDQLRIKSVDTSES
                     LQAYALHLLEILNDGEINTLPLSPSTPKSLHRLRTSSPSSPAFCIPILPPVLASQPTE
                     LLDIPSSASRLQDRNIRLKEDNFIEGDNGLSDEMGDAESCGEAVEILSRHSAKASYDI
                     EKNGESVAILTLVKTTYRLGESVLGIVTFNKPQTPFPVLKFSAYLFSHELIPEPLLPP
                     SLSSRGSAQPPLYRLHAEHHTLYALSAQRLAFSLDIPSDATPAFNLAAGEGEKGGLQW
                     KLKLNFTVGVPPRDWKRKTGESNLKSESDVDTKGTMKSSGVHLLPIQRSRNIDEGDNI
                     FYSASTGITPMIPRHRQNASSTSGSKSDVKNEEAVNWYESRTESVECEVPVRVLAGST
                     AFLVRPLVYAV"
     gene            961583..963665
                     /locus_tag="CNB03180"
                     /db_xref="GeneID:3255585"
     mRNA            join(961583..961820,961892..961991,962049..962339,
                     962387..962549,962595..962698,962766..962959,
                     963012..963111,963164..963665)
                     /locus_tag="CNB03180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656549.1"
                     /db_xref="GeneID:3255585"
     CDS             join(961692..961820,961892..961991,962049..962339,
                     962387..962549,962595..962698,962766..962959,
                     963012..963111,963164..963558)
                     /locus_tag="CNB03180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512165.1"
                     /db_xref="GeneID:3255585"
                     /translation="MPSVAAVPVKLDYQSFLSQEAKGRVRSPLRDLRYFHAIPGMISF
                     GGGLPHPSTWPVNAMTLSVPFAKKSIFIPGYESNDPTSLYPLAPYIPPTKLNSVTEPL
                     IPDLARDLQYSSNFGLPYFVDWLTQHVKRIHDPPYPENQWQVLATAGNTDASDGVVRT
                     LCSPGDSILLEEFAFPGSLTHYKSLGIKCAGVPMDGEGIVPSALEKILAEWDDEARGG
                     PKPKVILIVPTCSNPSGITYPASRKREIYAVCRKWNLLIIEDDPYCYLQVRPNGADTP
                     LIPSFLSLDLDGRVVRLDSFSKFIAPGSRCGWITGAKELVTTIMVKAEASSNGPSGFA
                     VASISAVIKAWGGHEGLERDYLPHISDTYSKRSNLMVSLIRKYVPAEAAECPDGSGGM
                     FLWVRLRVESHPQLSTLSPEEISDKVFHTLIGEKVMVAPSSYFKTPGGPVWSKDEESK
                     RIFVRLSFSLSTADEMEEGVKRFARGLRKEWGIRNLDEAEH"
     gene            963887..966344
                     /locus_tag="CNB03190"
                     /db_xref="GeneID:3255617"
     mRNA            join(963887..964093,964155..964370,964453..964465,
                     964522..964535,964593..964729,964783..964866,
                     964923..965008,965069..965178,965233..965358,
                     965426..965748,965798..965809,965861..965933,
                     965984..966049,966103..966344)
                     /locus_tag="CNB03190"
                     /product="expressed protein"
                     /transcript_id="XM_568895.2"
                     /db_xref="GeneID:3255617"
     mRNA            join(963887..964039,964155..964370,964453..964465,
                     964522..964535,964593..964729,964783..964866,
                     964923..965008,965069..965178,965233..965358,
                     965426..965748,965798..965809,965861..965933,
                     965984..966049,966103..966344)
                     /locus_tag="CNB03190"
                     /product="expressed protein"
                     /transcript_id="XM_024658610.1"
                     /db_xref="GeneID:3255617"
     CDS             join(964161..964370,964453..964465,964522..964535,
                     964593..964729,964783..964866,964923..965008,
                     965069..965178,965233..965358,965426..965748,
                     965798..965809,965861..965933,965984..966049,
                     966103..966210)
                     /locus_tag="CNB03190"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514220.1"
                     /db_xref="GeneID:3255617"
                     /translation="MLRMAFFRIQPLHFGKTLLARSGVQHYASSVSRLRGFSTPAIVN
                     DDRPLAGIKVVDLTRILAGPLATMMLSDLGADVIKIESPKNGDDTRSWLPPSAPVPPE
                     GYPRPDLPPESAYFLQANRNKRSLTLNLKSAEGQKIIKKLIEKADVLVENYVPGKLKK
                     FGLSWEEVKEMNPRLIYCSITGYGSTGPYSQSPGYDVVIEAEAGLMHITGEKGGKPVK
                     VGVAVTDVLTGHHAQSGILAALLKRQKTGKGSRVECSLFESQIASLCNIGANYLIAGE
                     EATRWGTSHPSIVPYQVFPTKDSFIMLSAGNDSQFAILCSSAVLNKPDWLNDDRFSSN
                     RKRVEHRDVMIALIEEVLSEKTTEEWCQKLVGKGLPFAPINNIAQTFSHPQAIAREVV
                     EEVIHPRAGKIKLAAPAVTYDGSKPKLYRPPPYLGEHTEEVLTELGCSSGEIKKMKLD
                     GVI"
     CDS             join(964161..964370,964453..964465,964522..964535,
                     964593..964729,964783..964866,964923..965008,
                     965069..965178,965233..965358,965426..965748,
                     965798..965809,965861..965933,965984..966049,
                     966103..966210)
                     /locus_tag="CNB03190"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568895.1"
                     /db_xref="GeneID:3255617"
                     /translation="MLRMAFFRIQPLHFGKTLLARSGVQHYASSVSRLRGFSTPAIVN
                     DDRPLAGIKVVDLTRILAGPLATMMLSDLGADVIKIESPKNGDDTRSWLPPSAPVPPE
                     GYPRPDLPPESAYFLQANRNKRSLTLNLKSAEGQKIIKKLIEKADVLVENYVPGKLKK
                     FGLSWEEVKEMNPRLIYCSITGYGSTGPYSQSPGYDVVIEAEAGLMHITGEKGGKPVK
                     VGVAVTDVLTGHHAQSGILAALLKRQKTGKGSRVECSLFESQIASLCNIGANYLIAGE
                     EATRWGTSHPSIVPYQVFPTKDSFIMLSAGNDSQFAILCSSAVLNKPDWLNDDRFSSN
                     RKRVEHRDVMIALIEEVLSEKTTEEWCQKLVGKGLPFAPINNIAQTFSHPQAIAREVV
                     EEVIHPRAGKIKLAAPAVTYDGSKPKLYRPPPYLGEHTEEVLTELGCSSGEIKKMKLD
                     GVI"
     gene            966439..968333
                     /locus_tag="CNB03195"
                     /db_xref="GeneID:36392742"
     mRNA            join(966439..966669,966718..966780,966930..966953,
                     967013..967150,967213..967319,967378..967443,
                     967518..967594,967642..967926,967969..968019,
                     968066..968333)
                     /locus_tag="CNB03195"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658620.1"
                     /db_xref="GeneID:36392742"
     CDS             join(966643..966669,966718..966780,966930..966953,
                     967013..967150,967213..967319,967378..967443,
                     967518..967594,967642..967926,967969..968019,
                     968066..968139)
                     /locus_tag="CNB03195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514221.1"
                     /db_xref="GeneID:36392742"
                     /translation="MDYQQYFSQSEVDLGGAIHHAADHTYPLYEHLGAYPKKGSNRAG
                     HPTGKSEISFSRKGGPNKKVFGLDPRVEEIDSVVLHDLHWWTSDRDLVELCAQLGVVI
                     EEKDILFMEHKVNGKSKGQAVLNCHSKENSLKVNEWLQCNAFQGKKVISTLAASIMGN
                     PFHPNNQDFPAPRPLSSAIHNTMGQPTNSHGGVNFNRVNKSLRISHQAGLGNGRPMDV
                     RQNVNLQPSQANHQPQMPLQAHNQINMASLPLPNQSMMMGMFPMDPSVSWPTPMDFPL
                     PEYSSFKSGPHLSSPGYLMNGMLHTGV"
     gene            968888..>969627
                     /locus_tag="CNB03200"
                     /db_xref="GeneID:3255685"
     mRNA            join(968888..969102,969186..>969627)
                     /locus_tag="CNB03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_568898.2"
                     /db_xref="GeneID:3255685"
     CDS             join(969011..969102,969186..969627)
                     /locus_tag="CNB03200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568898.1"
                     /db_xref="GeneID:3255685"
                     /translation="MRFQNSVILASLLTALAAYSLPQNENGGSDTSESSAVESGDGSA
                     DSTGTAISGDATSSAANDESTDAATVSNTSADSTASETLAVATASSAVTGVSGSSEKE
                     DVVATSVTGSALSSKGSGTASGANSNASGTSNSSSNSTESSAGFQVAGLPAGFEWVIG
                     SGAMVVGALGAGVATLF"
     gene            complement(969801..971812)
                     /locus_tag="CNB03210"
                     /db_xref="GeneID:3255843"
     mRNA            complement(join(969801..969877,969938..970011,
                     970066..970271,970327..970419,970470..970577,
                     970636..970717,970767..970872,970931..971028,
                     971092..971192,971262..971463,971520..971812))
                     /locus_tag="CNB03210"
                     /product="alpha-1,2-mannosyltransferase, putative"
                     /transcript_id="XM_568899.2"
                     /db_xref="GeneID:3255843"
     CDS             complement(join(969841..969877,969938..970011,
                     970066..970271,970327..970419,970470..970577,
                     970636..970717,970767..970872,970931..971028,
                     971092..971192,971262..971463,971520..971567))
                     /locus_tag="CNB03210"
                     /codon_start=1
                     /product="alpha-1,2-mannosyltransferase, putative"
                     /protein_id="XP_568899.1"
                     /db_xref="GeneID:3255843"
                     /translation="MMIPRWKYIAMAGGLVFLLHVILSVHPTYREKTSFLNLLPQQDG
                     WREGQPPPESSIPPVVGDLAENEAALEGRRRANAVFVVLARNSDLWPFLDSMRQMEDR
                     FNHWAKYDYVFLNEEDFSDEFKRYTQSMTKAKCYYGKIDPEHWYQPEWIDEDKASKAR
                     EEMIRKKVIYGHSVPYRNMCRFNSGFFFRHPLLANYDYYWRIEPSVKFFCDLAYDPFL
                     VMQDQNKVYGFTISLFEYIETIPTLWDAVKEFIGEHPDYLPEGNAMQFLSDDGGETYN
                     KCHFWSNFEIGDLNFWRSQPYMEFFDFLDKKGGFYYERWGDAPVHSIGAALFAKKEQI
                     HFFDDIGYRHEPFQHCPQGDAHTRGNCWCDQANNFDWEWYSCTKKYTEMF"
     gene            complement(972315..973799)
                     /locus_tag="CNB03215"
                     /db_xref="GeneID:36392743"
     mRNA            complement(join(972315..973365,973425..973799))
                     /locus_tag="CNB03215"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658632.1"
                     /db_xref="GeneID:36392743"
     CDS             complement(join(972363..973365,973425..973678))
                     /locus_tag="CNB03215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514222.1"
                     /db_xref="GeneID:36392743"
                     /translation="MHENPQHPSDKSLSNIFDPVRSRSPAIPSEPAPAYSALPNCDTD
                     FFLAPVLGGKVGDIELVTVDDKRFLVHRKLLEQETVFFHIYYGFVPIWRLNNVGSTQS
                     TQPRVVPIELPSNSHRPAQSRERDATPLSNILCLPKLLAAHLSRSPGAASLLTSHQRQ
                     NGDSPCDDLSAPLITNERIPDSPPPAFQDLPPLPPPKDVTAPTPTSSPYTWAVPESST
                     VLTAFLSLIYPSGIISASPTSLLTSLELTGRVVRAALGYQSAKALSTARDHMVHWVDE
                     SPVQVYSMASFFKFGDLARLASIKAVSVPPSQWPEDARVLMGRTSASKLVALHSTRLS
                     RLKQILNGPMEEDEHAHTCVRFPMARDVWRRMAGEISRKVCADSDLIELLDVDLRGGH
                     CGECLVLLGRSVQRCLYEARELPSMI"
     gene            972412..974648
                     /locus_tag="CNB03220"
                     /pseudo
                     /db_xref="GeneID:3255593"
     gene            complement(974095..975984)
                     /locus_tag="CNB03230"
                     /db_xref="GeneID:3256056"
     mRNA            complement(join(974095..974716,974770..975138,
                     975191..975984))
                     /locus_tag="CNB03230"
                     /product="sphingosine hydroxylase, putative"
                     /transcript_id="XM_568900.2"
                     /db_xref="GeneID:3256056"
     CDS             complement(join(974593..974716,974770..975138,
                     975191..975738))
                     /locus_tag="CNB03230"
                     /codon_start=1
                     /product="sphingosine hydroxylase, putative"
                     /protein_id="XP_568900.1"
                     /db_xref="GeneID:3256056"
                     /translation="MASFFPYQHAYAHNSTMLSSITPTALHAPFYHTTRPNLLSFMSD
                     KYVSLAAPVLAYWLYSFFFHFLDTAQFSYFEKRRIHDSPEVLARNKVTVAQVIKAVIL
                     QHVIQTVLGMFWLEDDEVIFRREVMKDHLAAMGNLAPWVADGVLLVLGRRIGEQVLKS
                     NGEAIVRWVYWWGIPALQMLFAFFVIDTWQYFWHRSMHTNHWLYRNFHSHHHRLYAPY
                     AFGALYNHPVEGFILDTLGAAIAEEVSFMTIRQATLLFTVSTLKTVDDHCGYRLWWDP
                     CQLFFANNADYHDIHHQGYGIKSNFSQPFFTNWDKLLGTRMTREEADSKGRWRSVGGE
                     HVLEQGPAKKLD"
     gene            976160..977711
                     /locus_tag="CNB03235"
                     /db_xref="GeneID:36392744"
     mRNA            join(976160..976207,976256..976334,976393..976491,
                     976554..976710,977308..977711)
                     /locus_tag="CNB03235"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658642.1"
                     /db_xref="GeneID:36392744"
     CDS             join(976182..976207,976256..976334,976393..976491,
                     976554..976688)
                     /locus_tag="CNB03235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514223.1"
                     /db_xref="GeneID:36392744"
                     /translation="MSINTVNPYADNSQLSQLEQELLWEFAKLSDKVKRAASLAKLTA
                     ESPNESLLAELRTLEKRMGLVLTLVKASVWAVIVDSQAAEEARQQQSAESAPEISYNE
                     TRSWDDSIMR"
     gene            978516..982201
                     /locus_tag="CNB03240"
                     /db_xref="GeneID:3255647"
     mRNA            join(978516..979293,979699..979934,979990..979999,
                     980050..980450,980498..980548,980607..980842,
                     981413..982201)
                     /locus_tag="CNB03240"
                     /product="expressed protein"
                     /transcript_id="XM_024656550.1"
                     /db_xref="GeneID:3255647"
     CDS             join(978803..979293,979699..979934,979990..979999,
                     980050..980450,980498..980548,980607..980842,
                     981413..982066)
                     /locus_tag="CNB03240"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512166.1"
                     /db_xref="GeneID:3255647"
                     /translation="MLPRPPPKDQFLSPNSDYINQDLAEAVRDSVRIKSSPSSNQSHN
                     SYSSAQPPDDPYTHTGTRRTPSPNPPRPIDVFNPTKPSYDEVSPSWPEVDNFDAMASG
                     PASDQPALPSARMQQLQNPFEEDEIEPVGTGPVKPPGFRNFTLEENGTVHPRRTKFSR
                     AQTGTTTSSSSTSYLLGSSPPSGHTNKIRTRRSLSTNSYGFSGDAPAMAALTEGQRKG
                     VDEKKGSRHADVIDTWDPTGLGSAMWHHAGPYDAAAPSRNANLPTTKAPMKAFHKSAS
                     PVVPPRGPNTISLSPPAPPAKDTPRDIPESDRRRPSRGISTGRRSAGGGLTGQYSTSV
                     PKDGGYFPNIGEEDPQDEATLARIERQRERESKRKALKAAWGIDTPEPFEDYGGTPND
                     GPIDVTDDDYFPESVSAPLPIGRSIRSPGFRLGSDPRTPSIKEDSMSPTLESPPPFRA
                     VVTATNVPPGGIKRTKSLMQKIKTMRENPNIPFRGQSRDNRPYSPNREPSPMPSEAPS
                     DDVVSPAGSATAARYPHLFDKGSGRPPSNKRSASSAATFTSSFQAESPRSVPITSGEE
                     SLIAVAGDDKPSPVNGAVKREGIPSTAPDGYTIVESPSSKGRAIRALQREAEHHTRSA
                     SYGATPSPRGVMAAPPVAPVLPNFDDYWSRREKVRSGSDTLDSGDLRETKELKRKTSM
                     VKKLRDRIVK"
     gene            complement(982184..983567)
                     /locus_tag="CNB03250"
                     /db_xref="GeneID:3256100"
     mRNA            complement(join(982184..982294,982339..982420,
                     982478..982542,982594..982642,982704..982957,
                     983017..983159,983211..983278,983347..983400,
                     983482..983567))
                     /locus_tag="CNB03250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656551.1"
                     /db_xref="GeneID:3256100"
     CDS             complement(join(982379..982420,982478..982542,
                     982594..982642,982704..982957,983017..983159,
                     983211..983278,983347..983400,983482..983517))
                     /locus_tag="CNB03250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512167.1"
                     /db_xref="GeneID:3256100"
                     /translation="MAWLSSGRTNVELIENMKSSGLIHSSRVAAAMMKVDRKHYVPLR
                     TFAYEDSPQKIGFGATISAPHMHAHACENLLELLPQTQNGGEEPPRILDVGSGSGYLT
                     AVFHYLSPKSLVVGIDHIQGLVSQSIRNLADDGVKVLDKHNVEGGGVLMLCGDGRKGS
                     KEYAPFTVIHVGAAAPEFPDELVDQLAKPGRMFIPVGKGSQDVWQVDKSANGDVTKKK
                     LFGVMYVPLTDADKQWQE"
     gene            983743..987091
                     /locus_tag="CNB03270"
                     /old_locus_tag="CNB03260"
                     /db_xref="GeneID:3256117"
     mRNA            join(983743..984227,984281..984650,984715..984812,
                     984888..984946,984994..985059,985118..985190,
                     985243..985340,985395..985489,985540..985927,
                     985990..986046,986111..986126,986205..986229,
                     986305..986621,986678..987091)
                     /locus_tag="CNB03270"
                     /old_locus_tag="CNB03260"
                     /product="expressed protein"
                     /transcript_id="XM_024656552.1"
                     /db_xref="GeneID:3256117"
     CDS             join(984560..984650,984715..984812,984888..984946,
                     984994..985059,985118..985190,985243..985340,
                     985395..985489,985540..985927,985990..986046,
                     986111..986126,986205..986229,986305..986621,
                     986678..986917)
                     /locus_tag="CNB03270"
                     /old_locus_tag="CNB03260"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512168.1"
                     /db_xref="GeneID:3256117"
                     /translation="MLKLTRSLDGATPLPITQIAVLMVVRLAEPISYTVIFPFINQMV
                     EELQVTDNPDHVGFYSGLVESVFAFVQFFTVYHWAQLSDCIGRKPVLLLGLTGVAISG
                     SLFGLASSFWMMILFRSLNGALNGNVAVVKAAIGDITDESNSTEAFAMYGLTWTVGSM
                     IGNAMGGLLSHPFERFPEWFGSVYLLQSYPYLLPCLVGAGLTVLGILFSLLFYRESLP
                     GLSIPPISLSSSFFIDSRLSRRLSWVLPSSFSRTSNHERQVSTASLMSETETLVDSDT
                     RDFLALRKGIELVDENVEQAKVTRWGFWELMRFKKVKIMTATVFLNSFVQGAWNAAVL
                     LFFFDRNHGLGMSASAIGIAMVAYKLLSLGWPLVWIFMPLLRNVLMSTESPLPPLQDV
                     PDTKTSHHRYHPVIYPEERAWPTTICVNLYLMFVTVVGMSSSLLMVLVNYASPDKTAL
                     GAINGIGTAAGCMARVIGPSSVSALFAFSMDGQVMGGRLWWIFMVGMSLVNFGICSLV
                     ASDSNGTRGDLADEFDEEVELDSGIRERVGAE"
     gene            complement(987176..990588)
                     /locus_tag="CNB03280"
                     /db_xref="GeneID:3256115"
     mRNA            complement(join(987176..987406,987472..987738,
                     987787..989118,989164..989291,989339..989697,
                     989749..989899,989960..990150,990323..990588))
                     /locus_tag="CNB03280"
                     /product="transcriptional repressor, putative"
                     /transcript_id="XM_568905.2"
                     /db_xref="GeneID:3256115"
     CDS             complement(join(987390..987406,987472..987738,
                     987787..989118,989164..989291,989339..989697,
                     989749..989899,989960..990150,990323..990499))
                     /locus_tag="CNB03280"
                     /codon_start=1
                     /product="transcriptional repressor, putative"
                     /protein_id="XP_568905.1"
                     /db_xref="GeneID:3256115"
                     /translation="MPLPSIHPLPPNPTTGHQPLASLGGTRSTIHPPPASTSSAGVSR
                     ETLKSLQDVYWSDDEDDPDCLLCAEPLDLSDLNFKPCQCGLQICQFCYNKLLSTDARC
                     PGCRRTYDTKAVVFQPVDWEEVKKAKEKKAKKAKTIKQLTGIGRRHLLGVRIVMKNMV
                     YVVGMKLPAIGDEALSVLRSNDYFGQYGKISKLYLADTKSSTSVPSLGSDNSDSTGIY
                     IVYIRREDAARCITSLDGIPAPQGPPGAVLKASYGTARYCETFLKGAKCDNSNCHGLH
                     EWGGESDTFTKEDMEIALTRPSEYDARQKQQSQAQPQQTIPSLSSKIAWPKPSGEDGH
                     SVSSATGLPSAASWGKGIGAKISGRGSAGAIARPTKANGLFPLSKNNASFPLPTPSPT
                     VPIIIKEKKEKKSATMARARSTDSTQSTTPSSNQTSPKRKANALPNLATTKSTTSSAP
                     VPPLSRNIVPSASASVPVLAPSSPAPAPETEPVSEGTDGSADEHLSAESDAGPSSESP
                     APQTPAHIIENIPPPPVSSEPIIIHSPYPEPVIFPFPADDKDFAFVLGLDDRELQRMQ
                     AQAEGYEPSPFSKTLEGLAELGVHAPEIPDLFVAPTSPPVDHYSGLFRPFEADEPSPA
                     MSNDTPGPSRISEDDHNAQRTESRFGFARGSVNVSAQSPFSNGRRSVADLNFRDGWYR
                     NNDASLSSHAQHDANNGAFAAQMNNNFSSSYDSTAGVTENGWNGESVYSASPSLQRQN
                     VATVGLHGYEVRPSGRLEQTLLQGQYMQKGIRDREEYDNTLLTMLQYGNPPQLFSSQH
                     HQQQQQQQRVIFSPDSTSHALQEDGPFQSPMAFSQLQQAQQTPLQHHPDARQLMQMHQ
                     RRGQSPAPMAAHGYRRF"
     gene            990746..992230
                     /locus_tag="CNB03290"
                     /db_xref="GeneID:3255971"
     mRNA            join(990746..990827,990884..991086,991149..991714,
                     991781..991877,991934..992077,992136..992230)
                     /locus_tag="CNB03290"
                     /product="bud site selection-related protein, putative"
                     /transcript_id="XM_024656553.1"
                     /db_xref="GeneID:3255971"
     CDS             join(990796..990827,990884..991086,991149..991714,
                     991781..991877,991934..992031)
                     /locus_tag="CNB03290"
                     /codon_start=1
                     /product="bud site selection-related protein, putative"
                     /protein_id="XP_024512169.1"
                     /db_xref="GeneID:3255971"
                     /translation="MSDLKAYLAAKYMSGPKADAILARSSDPTLKKKRKKQQTNEDYI
                     GGSVKAEASGGLMLRDEDEVWGRSKNEDEEDDAPVIGKDLATFKGSKSSWATVANKSA
                     LPLPQAEPTSPQDIKPDIKEEPDIDGPAASAPVQMTKRRGGLRTAAQLKEDTERELAE
                     QRSPSPAEGEERPDPTETVHRDATGKIIDVKKRQEEERIREEEERRKEAERKEWTKGM
                     VQRRDREERRRLEKKMAEADVGRSKDDVRMNKEMKEEERWNDPAAAFLTKKKKKGPRR
                     PKYEGPWAPNRFGIAPGFRWDGVDRSNGFEKKYFQAQNTRARREYEHNQWSVEDM"
     gene            993848..997437
                     /locus_tag="CNB03300"
                     /db_xref="GeneID:3256113"
     mRNA            join(993848..994377,994429..994489,994549..995848,
                     995905..996126,996176..996491,996545..997437)
                     /locus_tag="CNB03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_568907.2"
                     /db_xref="GeneID:3256113"
     CDS             join(994215..994377,994429..994489,994549..995848,
                     995905..996126,996176..996491,996545..997068)
                     /locus_tag="CNB03300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568907.1"
                     /db_xref="GeneID:3256113"
                     /translation="MVALAPSLPSPSGTSVRSSRHVPLLSLAPPALALGDELAVGEPG
                     EENSVGEIWNVITRAADLVKDGERLENLAWRHWGQPRHASFGRRLSASSHGSASDASI
                     QTPNEPSYFTRVERRTFGGALQLLVEKGEGSFKDWVEDAKKALPQTRVPTISVPETPV
                     ANGVEIRLVEPTPAPSRVGSLGGSINASIFPSREIPPVLKEEVEAEEDENSSSKINIT
                     GRRVAISPMTANRDNASSPRRNRKFFVQSSPSKGSASDSPLPSPVTNAALNPPSRTKH
                     GRRSSGDSSSASTSHRRDSTHVSHKRHISLTTMRGKFQAEKRKAAENMAKKQEEDVEE
                     EESGWEDEDQVNEDDENEPEDDENWSDEEEAEEIAEDEPVEEPLPAPSPQDDRERKNK
                     DPNRRRSSSRPRPSRGSVSQPNIGAVLSRRVSWHGDRSREHLAMTRPIPPPPAPTPLQ
                     KMSKKERQAAAAERAQIEARLEAQRKREMFAKQQIFGTRPSSGLLASALQRGASMVNL
                     PSASNDARTVLRNSPTHGQLTSLAQSPSFAGPSLLRSKSAAAMPVQTGVSVTIPAGHI
                     SKVAGKHEASSQESQSKARASAELESENEDSEDDDANYLNTTQTRQKLAALNSRQETK
                     TKVKTAEVEDRPDVEPAPAASPNVAQALPVGPRLNEFGVVEPMTPTTRRRNIIMAEMS
                     ESLRRNVVLEREKSSGGLSRILSGGANRQRSAPSMQPSHHSAVNLTQYAQDQSLEHQP
                     TAQTSQSSQDVSTHSQSHASGLPPPAPDVRRRPAPNVLGGGNILRPLTRVGTDDELSG
                     INRTQSTGILESGQSSRGTNVPQPQAPTMIRSVTDGNSMQGGREKREWRRINLMDTSY
                     RIHGW"
     gene            997630..1000245
                     /locus_tag="CNB03310"
                     /db_xref="GeneID:3255955"
     mRNA            join(997630..998006,998076..998939,998990..999211,
                     999262..1000245)
                     /locus_tag="CNB03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656554.1"
                     /db_xref="GeneID:3255955"
     CDS             join(998118..998939,998990..999211,999262..1000215)
                     /locus_tag="CNB03310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512170.1"
                     /db_xref="GeneID:3255955"
                     /translation="MSLHRYFPPPPLALAIHPAPTSRPKVTNKDKHDKAKVNLQAKAE
                     KGKQDQKGQGGKADKCTPTKCDAIVKIKDGAVLTPISPGSNLPEPPTSALGAVVSDND
                     KEADAKKSQPEQKDNDQIDSTSKLTDQVPEALAEKKDDGSEHIHKETDLEPEPLILLS
                     PAPYRPLRTRLDLHPSVVYPPVNTDPRGAYHKYAKAVGAEVIYVDVTKDGWLTQQWKE
                     RNEREALKRLMGEWEKEVQKEIEKERKRVIKKTVPKTSEGILLNLWNELVEANNHELS
                     ANEFWNMYDWNDSEARKHLRSDVKRPEIFSQQDNKTDSPARTTAQKPEIEWTKEGVED
                     ILSTVGIQCVYNIERPPSRHWSEPAAAFLLFTHGFFLLRLDIAITWKPEDRIKQGFQV
                     LITNSNDRVFGEMVKAQQAEDRKRKEKEYRERKEKERKERKEKEEKEKQHGKTGIDEA
                     PVMTASDANALDGEPPVITAKPPLGKAITTIPVITPSDDADSKNQNQQGDQQAVKKDV
                     KQEIEAEHAPGPKAADRTANPAGVEKNKKLNEADAKALARAIKPNGAVGLDGINMTMK
                     ALELAVDDNNLTTKSNDTKPLAKDKPLVKKDPVPLFWTWTEKCEKWRWRNYDAGVHLV
                     GPGGWEERDWQVFADGRQIEYWDAEQEKIEKEEIDIHDWSL"
     gene            complement(1000278..1004282)
                     /locus_tag="CNB03330"
                     /db_xref="GeneID:3255594"
     mRNA            complement(join(1000278..1002898,1002954..1003051,
                     1003110..1003253,1003310..1003544,1003598..1003651,
                     1003698..1003786,1003831..1003936,1003994..1004282))
                     /locus_tag="CNB03330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656555.1"
                     /db_xref="GeneID:3255594"
     CDS             complement(join(1000400..1002898,1002954..1003051,
                     1003110..1003253,1003310..1003544,1003598..1003651,
                     1003698..1003786,1003831..1003936,1003994..1003996))
                     /locus_tag="CNB03330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512317.1"
                     /db_xref="GeneID:3255594"
                     /translation="MKSLPPNSHLVQYLGSSHTRSPAGQHEVFILMEFCAGGGIIDLL
                     NKRLRDRLKEIEILNIFTDVCEAVAAMHSLKQPLLHRDLKIENVLSQPINIPPTPQRP
                     TSLIFKLCDFGSTTFPADRPPQTKLEADALAMDLNRHTTLQYRSPEMVEPMLGLPVGL
                     PSDVWALGCLLYKLCYYTTPFEEHGPLAIVNAKYTFPPMPQYSPRLQHLIASMLVEQP
                     ARRPTVFEVLRVAHEMSGTRPEVDYPITLKSLPIPAQPRPTKPQSHSSNNLLDFTGSP
                     SSMGKSPSLQPSLASTVQPQRRGRPTRDTARESPRPTAVQTQQARWQQSPVQQAQQKP
                     QMTSGSANVRAPSRLHITGESASLSSGSAPLSTTSPPPVDAFGMPIVSSTQPTATGFG
                     DSFGAGASLVRPTGTTGSSQQSQSRYGSNFIKRPTGFGDSFGSGITRTPSISSRSSAP
                     VKRVPSGATTVISKQHSPAVSHKSPEPPSAGVVPEGDLSFESRFPSIETLNSEATLSP
                     PEKLISPVVSPPSSSDNANTTPGSTTTARGAASYFGALRPRPLVNSRPSMSRNLTGGH
                     TRVPDEDGQTMQGEAEKHGHVHVQPRSTQVTGTAFRGQVSGLAPNLAQGGGREGRGYY
                     HGEEEDAERERREEMMKRGNGEQGEKWNVSEKKIDKKTITTPEDLMGSEETGSLRIPS
                     IVPVRSISPASATSAAMSATSAMNRGPPPLDIDAAKTGGGTNILSDNWSPLAEMRKRD
                     VAERAEAAVRKKEAEAERAQLERQNAADQPPFIDDGKLKSPKSAASTVQPTVAPSEAV
                     SPEPIKSTTLPAPTSRLEPSTGQVSQRIPSRERARPQSMFLPSTSSNSVPSRSSLLSP
                     PLRSEPSSLLPSSQSPPKTSISSPSRPSQGHQKKDSINGMVSKYESISIGKPGEDTNK
                     RSVRQHVPKPSEGTNALASKPFVASKPVGLRKPSADLDNSAPVNTTTARNEPANPTKP
                     RVASKPSTFRQDPGVGVGYIRPGMSANPSVRPNPVVSTSFNSSNPDHRGKEDEVVEKD
                     SLKSAVGSSPEKQQPVNLLIQRWNKGEVNNASGNAAAKFKKGGYI"
     gene            1004376..1008129
                     /locus_tag="CNB03340"
                     /db_xref="GeneID:3255948"
     mRNA            join(1004376..1004861,1004926..1005011,1005069..1005229,
                     1005279..1005645,1005705..1005809,1005881..1005894,
                     1005946..1005972,1006035..1006196,1006276..1006321,
                     1006378..1006462,1006524..1006533,1006599..1006617,
                     1006668..1006728,1006784..1006871,1006943..1007110,
                     1007196..1007326,1007388..1008129)
                     /locus_tag="CNB03340"
                     /product="nonselective cation channel, putative"
                     /transcript_id="XM_024656556.1"
                     /db_xref="GeneID:3255948"
     CDS             join(1004539..1004861,1004926..1005011,1005069..1005229,
                     1005279..1005645,1005705..1005809,1005881..1005894,
                     1005946..1005972,1006035..1006196,1006276..1006321,
                     1006378..1006462,1006524..1006533,1006599..1006617,
                     1006668..1006728,1006784..1006871,1006943..1007110,
                     1007196..1007326,1007388..1007871)
                     /locus_tag="CNB03340"
                     /codon_start=1
                     /product="nonselective cation channel, putative"
                     /protein_id="XP_024512171.1"
                     /db_xref="GeneID:3255948"
                     /translation="MSSLGTAPAAPPQPLPDTVFPLIHEVHAIVTHAIDTALDWDQLN
                     SPPVNYTLVRPIVQRFAPRLEHRANATGLAESTAPDAGELGASPRPVYQGPSLGEVLY
                     ALMANRIQFITLSAGDLSSAPLQTCRAAFCELLAIKVLRSQPYAQDEAALVGQLVHAY
                     CAFEGASDEVWASLGEDRKDVEEMTSSALELAIVSTSKNLLSLPLIQHLVNLIYSGHL
                     IYSPISSRSIISDSYISERTRQRRRAYGQSGPSDFTSVHSHAHINDEDLREVYVYNPY
                     QAGWLDHSRLKVPKWRKSMEFTSFVILLALFVSTLAWRDLHHLTVVEIIYIVFSFGFI
                     LDEFAASKEHGWAVYAANAWNAFDMGYIAIFLLYFGLRVIALASHSTKSSDLAFDILA
                     CAACITFPRLVFFVIKENVVILALRGMVASFVSFMTVTILAFTGICFCLWTLGRATWT
                     VKQIVWLMAQIWFGSSYLGFSASESFHPIFGPIVLISYAALCNVLLITMLIAILSNKF
                     AAINQNAQQEHLFQRVVKTVEGVKTDALFSYLPPINILAFAILVPLSWIVSARTLHRI
                     NVFAIRLTNFPILIAISAYERYTYRAKQRAIHLGASTMDRGGTDVQRPSLLDSWLGGG
                     SEFLIASAFEVGPPVFPSPTSSANQNSPGGPKATTMPFVEDDGAATTTTTTRAREAPI
                     LKAVKKEKDKKKIKTYDSPLAKLFGRPTFSASPEEETTLKDKGVDKGKEIRAVEQQQV
                     ISGKEGDVEQLKKEVELVRQSQLRMEEMLAGFLAGKSA"
     gene            complement(1008037..1010307)
                     /locus_tag="CNB03350"
                     /db_xref="GeneID:3255896"
     mRNA            complement(join(1008037..1008367,1008456..1008574,
                     1008635..1008651,1008716..1010142,1010197..1010307))
                     /locus_tag="CNB03350"
                     /product="multidrug resistance protein fnx1, putative"
                     /transcript_id="XM_024656557.1"
                     /db_xref="GeneID:3255896"
     CDS             complement(join(1008128..1008367,1008456..1008574,
                     1008635..1008651,1008716..1010097))
                     /locus_tag="CNB03350"
                     /codon_start=1
                     /product="multidrug resistance protein fnx1, putative"
                     /protein_id="XP_024512172.1"
                     /db_xref="GeneID:3255896"
                     /translation="MSSTDGPAAGPATERTQLLSTISTHHNIAGLTPSKFRLVCASLW
                     CATFLVAFDSTLVSTLLSDIGSAFNASTQVSWLGTAYLLSVCCFTPIYGRLSDLIGRR
                     NAHLTGLTLFTLGTFGCAIAPSMPFLIVARFLAGAGGGGVASVSAILMTDLVDLRHRG
                     LFQGWANVTYGVGAGLGGPVGGWISDNFGWRLAFHIQVPLLILNAILIYTFVIVPQQE
                     PLAPTPSTSSSRSGILDTLPTAKPANRPQIWKTKLARIDYLGSFTLALAVSSLLLSMS
                     IKTSATKPDGSDYAFSDPVIWGLFVCSALFAIAFLLVESCYSPEPILPLKLLKRRTPA
                     AVALSSFTMVTVQFSVLYNIPLFFTIVQQRSSSSSGAHLLPNSILIGAGSLFVGWIMR
                     RTGRYWWLGVECAVLIVVTSIGMCFWHKDSPEWLTWIAQAPGGFGYAGVLTTSLVALM
                     THVQLAGKGETAVATSMTYLFRTVGQVLGVAISSAIVQSVVQKDLVRTITGPEAPYII
                     YLIRHSTSAIQTLEPQYKIPAIQAYDHALRFVWIFNLVLSVFTVLTLMMVKEEEMPDR
                     QVMKKRIEQTSESAFEEFE"
     gene            1010402..1012820
                     /locus_tag="CNB03360"
                     /db_xref="GeneID:3256048"
     mRNA            join(1010402..1010589,1010693..1010766,1010816..1010868,
                     1010925..1012145,1012205..1012820)
                     /locus_tag="CNB03360"
                     /product="vacuolar membrane protein, putative"
                     /transcript_id="XM_569021.2"
                     /db_xref="GeneID:3256048"
     CDS             join(1010486..1010589,1010693..1010766,1010816..1010868,
                     1010925..1012145,1012205..1012699)
                     /locus_tag="CNB03360"
                     /codon_start=1
                     /product="vacuolar membrane protein, putative"
                     /protein_id="XP_569021.1"
                     /db_xref="GeneID:3256048"
                     /translation="MALHLLFDLSQSTKVFVASILGYASIAFWLCAQLPQVLKNLSLQ
                     SCEGLALPFLVNWLFGDITNLIGCLLTDQLPFQTFLAAYFCIIDVTLLGQYFYYRKNQ
                     IVPAPTPAYGYASLSDSPRRVFSNLPATAPLGRTRSTSANLVTSPLSPAPVSRSRPRK
                     GVYQSTSSYFSPPDISVTTPSVDGSYAAIYEAALDVARAAERASARSLSRKRKLSRRS
                     TFNSLLAEAGREGDNDDGMLDSFHSDMSARSASTTRGSPKKMGLNVAGDYRGRSLHRV
                     GLDHLQGGTVGYASNSGNAALSSNSASGEFHSEAEDRFDDLPTYAQGGQGLINQQGGN
                     GRVSHRERSEESHKGRSLSLVRGSGGKGSRRAAGMTFMSLGLLVGWGGFGHTVTGGMN
                     KQVGRSTGIVLDQATRWPTIRHPHILHSSPTTSLDLPVFLEFSAINPDLQPHEDYPRP
                     PADSQSYQRIIGRISAWSCTTLYLTSRMPQIWKNFQRKSVEGLSILLFLFAFCGNVTY
                     VFSILFNPSGGSDPVESSHYLLEALPYLFGSGGTLIFDLTIMIQSLIYGSAPPLPQPL
                     TPLDRSSRRRSLPTKRRMRHMEDGWASSVLQSQSHERGERAALLSGSMSALPSHGHAH
                     KKQGTKRERSTSPTVHKRARSVAG"
     gene            complement(1012908..1014097)
                     /locus_tag="CNB03370"
                     /db_xref="GeneID:3255872"
     mRNA            complement(join(1012908..1013178,1013229..1013554,
                     1013607..1013721,1013786..1014097))
                     /locus_tag="CNB03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656558.1"
                     /db_xref="GeneID:3255872"
     CDS             complement(join(1013096..1013178,1013229..1013554,
                     1013607..1013721,1013786..1013867))
                     /locus_tag="CNB03370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512173.1"
                     /db_xref="GeneID:3255872"
                     /translation="MFVIQLLIIASLLGTRSALAATCYNRLGQSYYCSNGMSWGARLG
                     IGLGVAFGVVLLFALCGYWRRRKLRSQFSKYKPPALPFAGHNQNQNPYVNNPPPPSGF
                     NNNPYGSNPAPPPQAYQPSMAGQYGSYQGQTQESEGHEHGYEWEQARQEEEERRKQAG
                     QTSDIPPPGYDVATSTQNTGSNAATYAPPPGPPPSKREGTV"
     gene            1016406..1019091
                     /locus_tag="CNB03380"
                     /db_xref="GeneID:3256057"
     mRNA            join(1016406..1016748,1016815..1017204,1017257..1017312,
                     1017381..1017953,1018037..1018429,1018486..1019091)
                     /locus_tag="CNB03380"
                     /product="expressed protein"
                     /transcript_id="XM_024656559.1"
                     /db_xref="GeneID:3256057"
     CDS             join(1017639..1017953,1018037..1018429,1018486..1019004)
                     /locus_tag="CNB03380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512211.1"
                     /db_xref="GeneID:3256057"
                     /translation="MPDPNCHSPNDTTPLPTSSVSFSDTSDYSPTSSVTSSEMRLSDQ
                     LPSPKFATSRGFPLLPPSHPLRAQLCTQVEGEMSPPRTPKGHPIDQLPNSYFPFPPSK
                     AIKHRSQGIANPYGSDNPSYPVGITYLLRIPRRLRPYLLVSFCLFIFGFILVNRAVSV
                     SQGTRAVTMQKHFSHSTHKYIPIDRLYGTNDGSSYLLSSQRATEAGIAEVNARARKKD
                     AELFRFESMEEELAALISFVTSTTSNVIPQLDPSVPLDPSVILDFDPSHPNARDDLLL
                     LQAEINAVYPLVLFGRMRDPHHRAIKRLLSEVKITPAPLVIEVDQRKDRKVFIPTVAR
                     LLGDELPVITLQGKRLGGYKEIMAMHEAGTLNDRLQKDGAVLVREIKKKKKGAKEQER
                     MENERVLGPAPVVDDE"
     gene            1019591..1023285
                     /locus_tag="CNB03390"
                     /db_xref="GeneID:3255864"
     mRNA            join(1019591..1019828,1019912..1020061,1020119..1020188,
                     1020248..1020323,1020375..1020429,1020479..1022994,
                     1023066..1023285)
                     /locus_tag="CNB03390"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_568913.2"
                     /db_xref="GeneID:3255864"
     mRNA            join(1019857..1020061,1020119..1020188,1020248..1020323,
                     1020375..1020429,1020479..1022994,1023066..1023285)
                     /locus_tag="CNB03390"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_024658653.1"
                     /db_xref="GeneID:3255864"
     CDS             join(1020026..1020061,1020119..1020188,1020248..1020323,
                     1020375..1020429,1020479..1022994,1023066..1023129)
                     /locus_tag="CNB03390"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_024514224.1"
                     /db_xref="GeneID:3255864"
                     /translation="MSDVDGKRRKIQRACDVCRRKKIKCEGPMNSLSDAKCAHCEEYG
                     MDCTYVEAAKRRGPPKGYVETLEQRAGRLERMLQQIYPGVDLNEYVGPKPDREDFDIS
                     AYHGTLRSLNIPPYPALKPLHSEHLVTPHTSRSTSVGTSPAAPAPSPSMQALGPSPWR
                     MYERDPAKPAENESDVEEEAAAQLSIATSMSQLDIRDSHWRWHGRASGAFLMRQFEDL
                     KSATGNTSSIIQDINNHKRQQFWHVPEWELVIANEGLRPLDYSIWPEKGLDQRLIDAY
                     FDNVNLHLPLLNRKFFQRQYDSGMWRNNPGFSRVCLLVFANGSRFVDDPRVYWPANLS
                     MTEEGSERLATDKDGTLRYSAGWKYLRSLLRMGRSIMQGPNLYEFQTQVLICQFLQGS
                     AVPHLMWILSGFGLRSAQELGIHVRATLLHADPTERALYNRAFWCLYHIDRYNCAAIG
                     RSVAIQDSDFNADYPIEVDDEYWDTGDTERDFKQPEGKISLITSFVQTLKLDHIMGAI
                     LQNVYAINKLPEQRADIAAQRAIVVELDSALNSWADNVPHELRWDPSCSDYQLFRQSA
                     VLYIYYYYCQILIHRPFIPGPRNQHAADLPSLAVCVNAARSICNITYAALKRGRQEGC
                     LPGRALNVSFMLPTWIAAIILVINIYSGRQTAAEREKALIDIGRCVSASKELELIWRQ
                     SGKYTDFLLQLAREGGMPNADKVPMVEKRLRENNPQLSERSRRPESVQGSTAGTPDHN
                     SPSTSYPYSHGRSNGQNSRSSGEHSRQPSAAPVTGFDLRNFTCPETYGDTSATPQFPY
                     SRDDLPFTHMPSPSSSQTGFQNMFQPSSQSSQYPSNTRNVPPHFTPSSQAHTQYNLQT
                     PNNEHPLPSQNDGELASSNIYDSLIDMTSFESQLLDMSTTAFGGPENTSNGDWWSRLF
                     NDYMGPDLHTNMPPACGRSSNSGV"
     CDS             join(1020026..1020061,1020119..1020188,1020248..1020323,
                     1020375..1020429,1020479..1022994,1023066..1023129)
                     /locus_tag="CNB03390"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_568913.1"
                     /db_xref="GeneID:3255864"
                     /translation="MSDVDGKRRKIQRACDVCRRKKIKCEGPMNSLSDAKCAHCEEYG
                     MDCTYVEAAKRRGPPKGYVETLEQRAGRLERMLQQIYPGVDLNEYVGPKPDREDFDIS
                     AYHGTLRSLNIPPYPALKPLHSEHLVTPHTSRSTSVGTSPAAPAPSPSMQALGPSPWR
                     MYERDPAKPAENESDVEEEAAAQLSIATSMSQLDIRDSHWRWHGRASGAFLMRQFEDL
                     KSATGNTSSIIQDINNHKRQQFWHVPEWELVIANEGLRPLDYSIWPEKGLDQRLIDAY
                     FDNVNLHLPLLNRKFFQRQYDSGMWRNNPGFSRVCLLVFANGSRFVDDPRVYWPANLS
                     MTEEGSERLATDKDGTLRYSAGWKYLRSLLRMGRSIMQGPNLYEFQTQVLICQFLQGS
                     AVPHLMWILSGFGLRSAQELGIHVRATLLHADPTERALYNRAFWCLYHIDRYNCAAIG
                     RSVAIQDSDFNADYPIEVDDEYWDTGDTERDFKQPEGKISLITSFVQTLKLDHIMGAI
                     LQNVYAINKLPEQRADIAAQRAIVVELDSALNSWADNVPHELRWDPSCSDYQLFRQSA
                     VLYIYYYYCQILIHRPFIPGPRNQHAADLPSLAVCVNAARSICNITYAALKRGRQEGC
                     LPGRALNVSFMLPTWIAAIILVINIYSGRQTAAEREKALIDIGRCVSASKELELIWRQ
                     SGKYTDFLLQLAREGGMPNADKVPMVEKRLRENNPQLSERSRRPESVQGSTAGTPDHN
                     SPSTSYPYSHGRSNGQNSRSSGEHSRQPSAAPVTGFDLRNFTCPETYGDTSATPQFPY
                     SRDDLPFTHMPSPSSSQTGFQNMFQPSSQSSQYPSNTRNVPPHFTPSSQAHTQYNLQT
                     PNNEHPLPSQNDGELASSNIYDSLIDMTSFESQLLDMSTTAFGGPENTSNGDWWSRLF
                     NDYMGPDLHTNMPPACGRSSNSGV"
     gene            complement(1023213..1026918)
                     /locus_tag="CNB03400"
                     /db_xref="GeneID:3256022"
     mRNA            complement(join(1023213..1023503,1023569..1023597,
                     1023690..1023992,1024075..1024221,1024275..1024336,
                     1024409..1024549,1024638..1025615,1025681..1025769,
                     1025832..1026210,1026271..1026401,1026481..1026541,
                     1026598..1026669,1026717..1026809,1026856..1026918))
                     /locus_tag="CNB03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_568915.2"
                     /db_xref="GeneID:3256022"
     CDS             complement(join(1023373..1023503,1023569..1023597,
                     1023690..1023992,1024075..1024221,1024275..1024336,
                     1024409..1024549,1024638..1025615,1025681..1025769,
                     1025832..1026210,1026271..1026401,1026481..1026541,
                     1026598..1026669,1026717..1026809,1026856..1026861))
                     /locus_tag="CNB03400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568915.1"
                     /db_xref="GeneID:3256022"
                     /translation="MKYLLNFLGDVPDAPNLADPAFQQLLVDVQSVKGAVKISADAFY
                     ESLENIVNELKTSPESIPFQKPVSKREAPDYYDVIKRPMDLSTILRNAKARKYKSKAE
                     FAADLDLIWKNCFEYNSQESHPLRAAARFMKQKADHHLEYLADRAERNKQLQSFLPSA
                     TGTASPSLSAIGHSALGGSGLTILLGSRLRDEGLGGDEDAAGESDDAFGEGDAEGEVD
                     REGNDVLDVRSQDFREGGAETRGERGETPSRGKDERGRGTSVASSSRMNGRPNGTNRR
                     SPSAKRPPLTTNLDNVPALLRTPYTIPSLSSLSLAHAGPSFSDKGKARESLSGYPAPA
                     WYPAPPATAAAAAAAASFQEAGDDDESTLEGSWWGKMMDDETLVAGMPAIPKMSPPEP
                     VRRCRPKPPPPAIPPAIPPAIPPPLPNGFASGAQSPPPGLSSSSTATTTATAAKPHDH
                     TKDGPSDRTVSVSVKAVVRRTINNLNAARQAMHRITEFQRIEAEGGILPPRGLSPTPA
                     EKEKEHEEQAERRDFRRIENRAARERRKEGGEVGQEEAVRIMKKCSAGMLAHAGFEGA
                     NETALDLFTRVAVDHLDGLGKTFRLLLDGFSHKMTPEEIILHALHENGQVQPRDLEAH
                     LKDDIEREDVKIAEVQRKMRQTFYEVATAPVIQDDMMFADDGEMLLDGNFADELGEDF
                     LGLRELGIDREYGLASLTVPQSLFYGKRKRLANSANGASGKSDLPYPPPPSFIPLAAA
                     TLSTHVPALLHAFYAARIEAGLSLDEDDAFEPAHSQIGSLGQILIKGKMGDGKGDGKG
                     KGKKRERGEGEDENGERKKSGKKQPGVGKGNWTRPSKEEKARLAGEKNAAKGETAAVA
                     GDEDAVGEEEDAEGEEE"
     STS             1025360..1025604
                     /standard_name="AGC1"
                     /db_xref="UniSTS:470756"
     STS             1025360..1025542
                     /standard_name="CTG7"
                     /db_xref="UniSTS:470822"
     STS             1026338..1026813
                     /standard_name="Sac2"
                     /db_xref="UniSTS:470820"
     gene            1026985..1029186
                     /locus_tag="CNB03420"
                     /db_xref="GeneID:3256038"
     mRNA            join(1026985..1027322,1027402..1027479,1027541..1027694,
                     1027749..1027965,1028031..1028110,1028172..1028279,
                     1028358..1028516,1028566..1028692,1028760..1029186)
                     /locus_tag="CNB03420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656560.1"
                     /db_xref="GeneID:3256038"
     CDS             join(1027199..1027322,1027402..1027479,1027541..1027694,
                     1027749..1027965,1028031..1028110,1028172..1028279,
                     1028358..1028516,1028566..1028692,1028760..1029107)
                     /locus_tag="CNB03420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512174.1"
                     /db_xref="GeneID:3256038"
                     /translation="MRIVKRRRKRAAGDERAAGDAAHGVFRAEMVGTVNHTVRFVSMA
                     DYQWTPDADGPTASLINSLKALDYNAILNYSFPPLAEEYIEPRPDATDQQPRFRSKLD
                     LQPLPIFSTRNLPAVYNFKMPPQVVPVEVAHPITGRLRTRYANNTREHGLAPHIIQHD
                     HTLGDVPREPNVIVQGKMPRLNQTLLQKLKQAFEKRPVWVKQSLLAQFSEEEQGEMKR
                     EKAYFPSVAYVINTGVYSKCLVKYGYDPRLDIESRKLQHIFFYAHKKTVKNPMNTNPE
                     NDEEADRREGWWEDEQARLIAENKRPPIDPSKANTFDGQYLHKAKADYQLCDITDPFI
                     MRYVNDTKHLSSVCTLKSGWYTFPWITLIKGLVRVKYMYMLETGLPAPDDICHPVIEE
                     YNKGKMNGGDSSGRRAAGRGHNRHTEEEQDDIPDSGEDGAVPEDELEDDNEDEGDRDD
                     EEGVDNQDKADDDL"
     gene            complement(1030793..1032046)
                     /locus_tag="CNB03430"
                     /db_xref="GeneID:3255850"
     mRNA            complement(join(1030793..1030986,1031039..1031262,
                     1031383..1031559,1031614..1031674,1031740..1031783,
                     1031839..1031853,1031902..1031932,1031983..1032046))
                     /locus_tag="CNB03430"
                     /product="SAR small monomeric GTPase, putative"
                     /transcript_id="XM_568917.2"
                     /db_xref="GeneID:3255850"
     CDS             complement(join(1030981..1030986,1031039..1031262,
                     1031383..1031559,1031614..1031674,1031740..1031783,
                     1031839..1031853,1031902..1031932,1031983..1031994))
                     /locus_tag="CNB03430"
                     /codon_start=1
                     /product="SAR small monomeric GTPase, putative"
                     /protein_id="XP_568917.1"
                     /db_xref="GeneID:3255850"
                     /translation="MFIINWFWDVLASLGLMNKSAKLLFLGLDNAGKTTLLHMLKNDR
                     LATLQPTLHPTSEELAIGNVKFTTYDLGGHIQARRLWRDYFPEVDGIVFLVDSADAER
                     FAESKAELDSLLSIESLAQVPFLILGNKIDAYGAVSEEQLRHELGLYQTTGKGKIPLR
                     DIRPIEVFMCSVVMRQGYGEGFRWLSQYI"
     gene            1032196..1034981
                     /locus_tag="CNB03440"
                     /db_xref="GeneID:3256052"
     mRNA            join(1032196..1032357,1032413..1032531,1032582..1032793,
                     1032865..1033194,1033247..1033306,1033378..1033690,
                     1033753..1033917,1033986..1034349,1034419..1034981)
                     /locus_tag="CNB03440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656561.1"
                     /db_xref="GeneID:3256052"
     CDS             join(1032308..1032357,1032413..1032531,1032582..1032793,
                     1032865..1033194,1033247..1033306,1033378..1033690,
                     1033753..1033917,1033986..1034275)
                     /locus_tag="CNB03440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512175.1"
                     /db_xref="GeneID:3256052"
                     /translation="MSPFPQTAKLNNPVCVFCGSSPGNKPLFVKAAESVGKGLAKANI
                     PLVYGGGRRGIMGVVSQSALSANGYVHGILPRALVEPASEPTPAPWSTTNGDTARSKE
                     GTGKDVVEDDNQAKLTVEVVGTMHQRKLAMAKLSTGGFIVLPGGYGTLEEALEMITWN
                     QLGIHRLPIIILNIGNFFTHLYKQFENSVEAGFIAPSNLSLLRLVDLEGGEEANIDET
                     RADEWGQAALKALKEWSVDEDVGYNLNWKEEDDGGTQDTFRSPSYLFTTMRCTFPSAT
                     STSISEADLPLIGYHLERLREAHAHFAERDTHYWGEWPGDDSVTDKCLQVLREKAQEG
                     EGDYRVRIVICPKGIVKVEVPPAPKDAGPFSLEIPTASMARARPLVLDPAVTDVRGED
                     PSNRKFRLYKTSQRELYDLAYERGSTLSPCHPEVLLHTSTHLLETTTSNIAILSPSGQ
                     WITPSISSSTPLLNGVVRRFLLESGVIEEGELTLADFERVKAEGGRIIGFNGLRGIWE
                     GKII"
     gene            complement(1034247..1035779)
                     /locus_tag="CNB03450"
                     /db_xref="GeneID:3256055"
     mRNA            complement(join(1034247..1034883,1034946..1035428,
                     1035484..1035779))
                     /locus_tag="CNB03450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568920.2"
                     /db_xref="GeneID:3256055"
     mRNA            complement(join(1034247..1035428,1035484..1035779))
                     /locus_tag="CNB03450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568919.2"
                     /db_xref="GeneID:3256055"
     CDS             complement(join(1034328..1034883,1034946..1035428,
                     1035484..1035713))
                     /locus_tag="CNB03450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568920.1"
                     /db_xref="GeneID:3256055"
                     /translation="MLRTKNSQIILLSLALHLALILYADHVDSHPERYGGLRYTDVDW
                     RVVTDGARLIFIPTEKEQAKGWLVKKIGLSIGDPYDRATFRYTPLLPLFLSPALIHPL
                     LGKCLLALPSLLIPLLLLTGPDPAPFWPTHLLWTINPFVLSITTRGSPEAAICFLVVT
                     LHYFLRLGSRNEKKGAGETRAAIVLALAVSWKIYPAIYIPAIWKELSARWGWFGMRVW
                     RFGLIVASSFVLINGALWSIWGQPFLDHTYLYHLSRLDHRHNFSPYFYPIYLSFFPSP
                     TASPLPSALLAVIRHPLTSFLPQISLIITTSLSTSSLCFAMFLQTALFVAFNKVCTSQ
                     YFTWFLPLLPPVIPQLRLSRQKTAALVVAWILAQGVWLGSAYLLELRAQSVYIFVWAA
                     GLLVFGVSIYLLGNVVDGWEPARTSKTKLE"
     CDS             complement(join(1034717..1035428,1035484..1035713))
                     /locus_tag="CNB03450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568919.1"
                     /db_xref="GeneID:3256055"
                     /translation="MLRTKNSQIILLSLALHLALILYADHVDSHPERYGGLRYTDVDW
                     RVVTDGARLIFIPTEKEQAKGWLVKKIGLSIGDPYDRATFRYTPLLPLFLSPALIHPL
                     LGKCLLALPSLLIPLLLLTGPDPAPFWPTHLLWTINPFVLSITTRGSPEAAICFLVVT
                     LHYFLRLGSRNEKKGAGETRAAIVLALAVSWKIYPAIYIPAIWKELSARWGWFGMRVW
                     RFGLIVASSFVLINGALWSMWVHFCELTHYCRGIPLIMKVDGDSPSLTIPISTTCPDS
                     ITDTTFRHTFIPSTYPSSRHQPPRLYLLRSLPSSDIL"
     gene            1036143..1038464
                     /locus_tag="CNB03460"
                     /db_xref="GeneID:3256075"
     mRNA            join(1036143..1036381,1036451..1036602,1036740..1037261,
                     1037324..1037446,1037505..1037707,1037753..1037901,
                     1037961..1038032,1038085..1038167,1038230..1038464)
                     /locus_tag="CNB03460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656562.1"
                     /db_xref="GeneID:3256075"
     mRNA            join(1036143..1036381,1036454..1036602,1036740..1037261,
                     1037324..1037446,1037505..1037707,1037753..1037901,
                     1037961..1038032,1038085..1038167,1038230..1038464)
                     /locus_tag="CNB03460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568921.2"
                     /db_xref="GeneID:3256075"
     mRNA            join(1036143..1036381,1036466..1036602,1036740..1037261,
                     1037324..1037446,1037505..1037707,1037753..1037901,
                     1037961..1038032,1038085..1038167,1038230..1038464)
                     /locus_tag="CNB03460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658673.1"
                     /db_xref="GeneID:3256075"
     CDS             join(1036519..1036602,1036740..1037261,1037324..1037446,
                     1037505..1037707,1037753..1037901,1037961..1038032,
                     1038085..1038167,1038230..1038247)
                     /locus_tag="CNB03460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512176.1"
                     /db_xref="GeneID:3256075"
                     /translation="MTAIIKLLNLLPALALAGMALTGFENVPGTLAHRPDSRDQHRHL
                     AARLADNIVKHEKKRSSNGRILRRRADGTVCRAKDQSFVAVASSAVTSTPASTTSTVD
                     VEATSSPSVADVTFTDDSATSSSSSEWVQSTSSSSVEAQATAQSLATTTTSSGGGSVN
                     VGSKFGLAWPNGDWAASTDPNYIGNYIGSKASWYYTWSPFSVGSGDSLGLEFVPMLWG
                     PKQVSDWHAQMSQWPSTVENALFFNEPNQVGQCDISAADAVTYWVTDYLPVRASGIRL
                     GGAATTSAPDGLQWVLDFVKACTDAGNSAADCAADFIPLHWYDVDIENFKSYVENFHT
                     QTGSNIWITEYACQNFNGGAQCTDQESWDLHIAIAAWFDEQSYVERYSPFGVMQDMQG
                     VNQNNALMNPDGSITSLGGWYISSA"
     CDS             join(1036519..1036602,1036740..1037261,1037324..1037446,
                     1037505..1037707,1037753..1037901,1037961..1038032,
                     1038085..1038167,1038230..1038247)
                     /locus_tag="CNB03460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514225.1"
                     /db_xref="GeneID:3256075"
                     /translation="MTAIIKLLNLLPALALAGMALTGFENVPGTLAHRPDSRDQHRHL
                     AARLADNIVKHEKKRSSNGRILRRRADGTVCRAKDQSFVAVASSAVTSTPASTTSTVD
                     VEATSSPSVADVTFTDDSATSSSSSEWVQSTSSSSVEAQATAQSLATTTTSSGGGSVN
                     VGSKFGLAWPNGDWAASTDPNYIGNYIGSKASWYYTWSPFSVGSGDSLGLEFVPMLWG
                     PKQVSDWHAQMSQWPSTVENALFFNEPNQVGQCDISAADAVTYWVTDYLPVRASGIRL
                     GGAATTSAPDGLQWVLDFVKACTDAGNSAADCAADFIPLHWYDVDIENFKSYVENFHT
                     QTGSNIWITEYACQNFNGGAQCTDQESWDLHIAIAAWFDEQSYVERYSPFGVMQDMQG
                     VNQNNALMNPDGSITSLGGWYISSA"
     CDS             join(1036519..1036602,1036740..1037261,1037324..1037446,
                     1037505..1037707,1037753..1037901,1037961..1038032,
                     1038085..1038167,1038230..1038247)
                     /locus_tag="CNB03460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568921.1"
                     /db_xref="GeneID:3256075"
                     /translation="MTAIIKLLNLLPALALAGMALTGFENVPGTLAHRPDSRDQHRHL
                     AARLADNIVKHEKKRSSNGRILRRRADGTVCRAKDQSFVAVASSAVTSTPASTTSTVD
                     VEATSSPSVADVTFTDDSATSSSSSEWVQSTSSSSVEAQATAQSLATTTTSSGGGSVN
                     VGSKFGLAWPNGDWAASTDPNYIGNYIGSKASWYYTWSPFSVGSGDSLGLEFVPMLWG
                     PKQVSDWHAQMSQWPSTVENALFFNEPNQVGQCDISAADAVTYWVTDYLPVRASGIRL
                     GGAATTSAPDGLQWVLDFVKACTDAGNSAADCAADFIPLHWYDVDIENFKSYVENFHT
                     QTGSNIWITEYACQNFNGGAQCTDQESWDLHIAIAAWFDEQSYVERYSPFGVMQDMQG
                     VNQNNALMNPDGSITSLGGWYISSA"
     gene            1038940..1040078
                     /locus_tag="CNB03470"
                     /db_xref="GeneID:3255786"
     mRNA            join(1038940..1039460,1039528..1039714,1039790..1040078)
                     /locus_tag="CNB03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_568925.2"
                     /db_xref="GeneID:3255786"
     CDS             join(1039054..1039460,1039528..1039714,1039790..1039924)
                     /locus_tag="CNB03470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568925.1"
                     /db_xref="GeneID:3255786"
                     /translation="MKLTLPLAITVSLLSSIAFASPAPVVVGSTTERHLARNDNSIPH
                     DVARSIAGAFHASGMNAVKRQEDASSSGDSSTDDGSDDTSDDDGTTDDGTADSGTTDD
                     GTTDDGSDSSDGTTTDDGTDDGTEDSTTTDDGTDDSSAAVTDTDTDTAVATNTAAATT
                     TSAANTTASTSTRTGLTNYNTTTRSSTVPVSTTMAAQTTAAVASSDSTSGSGRGISVP
                     SGLNVIPVLSFFIASGLGAAHIFI"
     gene            complement(1040042..1041606)
                     /locus_tag="CNB03480"
                     /db_xref="GeneID:3256063"
     mRNA            complement(join(1040042..1040615,1040662..1040710,
                     1040760..1041075,1041136..1041209,1041307..1041606))
                     /locus_tag="CNB03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656563.1"
                     /db_xref="GeneID:3256063"
     CDS             complement(join(1040297..1040615,1040662..1040710,
                     1040760..1041075,1041136..1041209,1041307..1041430))
                     /locus_tag="CNB03480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512212.1"
                     /db_xref="GeneID:3256063"
                     /translation="MMFDKSSLLVALFFTVFDMAHKAQAVPQPAGQVGEILAGSFNDG
                     ITVYANGVVQCGYSNISWTGASPPVTLEIGQGGYYIGTTSVANLTAGWDNHTEWLVNQ
                     PEGVDLIFQVVDSSGKTGYVQNIKVGAGDSDCLENSASNSSLTASSGSTGDATQIASS
                     TSISEIVGGTSETASVTAISASKDASESVSLSSSTETTESASSAITSEIQTPAAASST
                     SPIASAASTSAVSSASASTGDSTTSSNGSSPSLAAANDSTAGGSSSSTSSSGAFPGVF
                     VSGLSIVFAAVGTFAIL"
     gene            complement(1041608..1045446)
                     /locus_tag="CNB03490"
                     /db_xref="GeneID:3255794"
     mRNA            complement(join(1041608..1041675,1041730..1042934,
                     1043003..1043429,1043491..1043743,1043793..1043957,
                     1044009..1044770,1044863..1045446))
                     /locus_tag="CNB03490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656564.1"
                     /db_xref="GeneID:3255794"
     CDS             complement(join(1042176..1042934,1043003..1043429,
                     1043491..1043743,1043793..1043957,1044009..1044735))
                     /locus_tag="CNB03490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512177.1"
                     /db_xref="GeneID:3255794"
                     /translation="MYASTSKQIDQPAQLFQHSRAEAPVSSTHSQHYCMPPSQTVFRS
                     IAVPPSPSFSLSPEVQHTPAHHSYPPSFLPSRSSYLSDSPPMIHYGINSPIIGRYPES
                     ESSPRVSSRARDSYVTVHRWGPVQGISGSQITVRCDIEMAFLSRPGRSATPLSVNGPG
                     QMTKALRVVFGSYPVLTKVENLKEGTERNACFLQVTVPDWSLTGAVSDGMGEVRIVPV
                     SLQVLADNTNVLETVSLGHFVYVEGITRKRNGDHLETTRHTSPNRVIQRRAVSGPVST
                     SELQSYSSPQHLMYGRPLAVRHISESHVPSIQKTYAQSPPVPVSQTSMLPPNTSNTAV
                     FHLQPSLMRSSHVVGGIPAQPTSTTLINTGHKAALSIAGDLSAVGKGWTTEEWHTRRR
                     LVQFWRRQEGATIHTQFRVISQSEWSASQSSIVVSCVFWDEKNSCYITSVDIIYLLEA
                     LVGTHFTVEEKNRIRRNLEGFKPITVDKSKPDTENFFGQIMNLPNPRPRNIEKNVKVY
                     AWNCLEAALQKIIGKYSASFPTTQSSSVEPIITPCPPSTSISIPSNGLPTPSSISEFG
                     SPLRSYNDLPNPLSATPAQHTYRGMPPPLTSRSSDESFYGAQQLNPRQPPSTRTSSSS
                     SVIQITTPAQPFISRTTSSPSSIYSSNFAVSTARVTQKDEKTEGNTDMGLYFDMPPVY
                     SQGVSTAGNANLLHSGPITPSPSLSEMYPGPLHYASPSSHIQFQPPYTPTVARPEQKQ
                     AAQYHESLRQNHEARMVYPMYPAIQGQRAWGDGNED"
     gene            complement(1048866..1050486)
                     /locus_tag="CNB03500"
                     /db_xref="GeneID:3255958"
     mRNA            complement(join(1048866..1049454,1049511..1049586,
                     1049701..1049835,1049889..1050197,1050295..1050486))
                     /locus_tag="CNB03500"
                     /product="cytochrome-c oxidase chain VI precursor,
                     putative"
                     /transcript_id="XM_024656565.1"
                     /db_xref="GeneID:3255958"
     CDS             complement(join(1049795..1049835,1049889..1050197,
                     1050295..1050373))
                     /locus_tag="CNB03500"
                     /codon_start=1
                     /product="cytochrome-c oxidase chain VI precursor,
                     putative"
                     /protein_id="XP_024512274.1"
                     /db_xref="GeneID:3255958"
                     /translation="MLSSVSRALLRTRPVVAAPLRPVAFTAVRFASGGAHGNETESYE
                     SFNARYETFFKSVSDLFELQRGLNNAFAYDLVPSTEVINAALQAARKVNDYATAVRIL
                     EGVKEKVENKGQYQAYLDELKPTIEELGISTKEELYGQTL"
     gene            1050721..1051847
                     /locus_tag="CNB03510"
                     /pseudo
                     /db_xref="GeneID:3255999"
     gene            complement(1051715..1053574)
                     /locus_tag="CNB03520"
                     /db_xref="GeneID:3255710"
     mRNA            complement(join(1051715..1051807,1051902..1052029,
                     1052084..1052137,1052186..1052271,1052324..1052518,
                     1052569..1052725,1052788..1052861,1052931..1053164,
                     1053219..1053232,1053303..1053314,1053373..1053574))
                     /locus_tag="CNB03520"
                     /product="protein arginine n-methyltransferase, putative"
                     /transcript_id="XM_024658684.1"
                     /db_xref="GeneID:3255710"
     mRNA            complement(join(1051715..1051849,1051902..1052029,
                     1052084..1052137,1052186..1052271,1052324..1052518,
                     1052569..1052725,1052788..1052861,1052931..1053164,
                     1053219..1053232,1053303..1053314,1053373..1053574))
                     /locus_tag="CNB03520"
                     /product="protein arginine n-methyltransferase, putative"
                     /transcript_id="XM_569187.2"
                     /db_xref="GeneID:3255710"
     CDS             complement(join(1051801..1051807,1051902..1052029,
                     1052084..1052137,1052186..1052271,1052324..1052518,
                     1052569..1052725,1052788..1052861,1052931..1053164,
                     1053219..1053232,1053303..1053314,1053373..1053440))
                     /locus_tag="CNB03520"
                     /codon_start=1
                     /product="protein arginine n-methyltransferase, putative"
                     /protein_id="XP_024514226.1"
                     /db_xref="GeneID:3255710"
                     /translation="MSPATETATQGLPPVDQMTSRDYYADSYAHFGIHEEMLKDSVRT
                     LSYRNAIMQNPHLFKDKVVLDVGCGTGILSMFASKAGAKLVIGIDMSNILDQAEKIVR
                     ANGFSEDQIVLLKGKLEDVELPVKQVDIIISEWMGYFLLYESMLDTVLLARDKYLAPN
                     GLLFPDKATIFLAAIEDQDYKEEKIDFWNDVYGFDYSCIKEIALREPLVDCVELRAVA
                     TNPCAIRHIDIRTVKKEDLAFDVPFKLKATRNDYIHAFLGWFDISFSCCHKPINFSTG
                     PQAKYTHWKQTVFYTSETLTVSEGDVIQGTLHCAPNSRNNRDLDIIIDYEVAGSNPEK
                     GKMEYKMY"
     CDS             complement(join(1051843..1051849,1051902..1052029,
                     1052084..1052137,1052186..1052271,1052324..1052518,
                     1052569..1052725,1052788..1052861,1052931..1053164,
                     1053219..1053232,1053303..1053314,1053373..1053440))
                     /locus_tag="CNB03520"
                     /codon_start=1
                     /product="protein arginine n-methyltransferase, putative"
                     /protein_id="XP_569187.1"
                     /db_xref="GeneID:3255710"
                     /translation="MSPATETATQGLPPVDQMTSRDYYADSYAHFGIHEEMLKDSVRT
                     LSYRNAIMQNPHLFKDKVVLDVGCGTGILSMFASKAGAKLVIGIDMSNILDQAEKIVR
                     ANGFSEDQIVLLKGKLEDVELPVKQVDIIISEWMGYFLLYESMLDTVLLARDKYLAPN
                     GLLFPDKATIFLAAIEDQDYKEEKIDFWNDVYGFDYSCIKEIALREPLVDCVELRAVA
                     TNPCAIRHIDIRTVKKEDLAFDVPFKLKATRNDYIHAFLGWFDISFSCCHKPINFSTG
                     PQAKYTHWKQTVFYTSETLTVSEGDVIQGTLHCAPNSRNNRDLDIIIDYEVAGSNPEK
                     GKMEYKMS"
     STS             1053424..1054251
                     /standard_name="Pst8"
                     /db_xref="UniSTS:470819"
     gene            complement(1053793..1055702)
                     /locus_tag="CNB03530"
                     /db_xref="GeneID:3255943"
     mRNA            complement(join(1053793..1054297,1054349..1054807,
                     1054866..1055129,1055180..1055275,1055336..1055514,
                     1055565..1055702))
                     /locus_tag="CNB03530"
                     /product="Protein tyrosine kinase, putative"
                     /transcript_id="XM_569188.2"
                     /db_xref="GeneID:3255943"
     CDS             complement(join(1053944..1054297,1054349..1054807,
                     1054866..1055129,1055180..1055275,1055336..1055514,
                     1055565..1055673))
                     /locus_tag="CNB03530"
                     /codon_start=1
                     /product="Protein tyrosine kinase, putative"
                     /protein_id="XP_569188.1"
                     /db_xref="GeneID:3255943"
                     /translation="MSAPSGIKVADDLTAAFTAALANPQDTRALVFIIDGESFKHHAT
                     VKPKGSYKDDIALVPEVLPSPKTPASFAYRLDSKDSGKWDWMMVTFVPDDAGVRAKML
                     QASSRSGLMKVLGANNFKHDWFATSISDLSPSALTAHLNHLSSPPPLSASEAALAEVR
                     EAEAAEAKRAALDPESQARRNKAVVGLGGKMNWGEGVVEALQKVAQRSDDGWVVVLEI
                     PSSNPGSIALLKSEACIPSQLTSKLPGKSPCYVFYSHPTPPSTRNVPKSPSAPIGAPR
                     NTFQGSQGGVRVVNASFGSPAVEAGENVESEEPEPGASPTQEETAEAVGKGRVIFVYC
                     CPSNSPVKYRMIYSTTVRGMQQDAIDKAGVEIVAKLETSDPSELTESHLKSSLPSYKP
                     THSSSLPTPTSTTLGGRSFGTPTMFGQPRPSLPVRSATQVPLPPSGASTPATEGGKEG
                     EEDGKDSIRKAFDAFGPRINNASGGGFARPRPAGRR"
     gene            1055848..1057531
                     /locus_tag="CNB03540"
                     /db_xref="GeneID:3255552"
     mRNA            join(1055848..1056224,1056439..1056928,1056982..1056994,
                     1057043..1057273,1057332..1057531)
                     /locus_tag="CNB03540"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569189.2"
                     /db_xref="GeneID:3255552"
     CDS             join(1055928..1056224,1056439..1056928,1056982..1056994,
                     1057043..1057273,1057332..1057440)
                     /locus_tag="CNB03540"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569189.1"
                     /db_xref="GeneID:3255552"
                     /translation="MTPSSSPKNIVVIGGGIAGVSTAYFLSTHPQRSSSTSITIVEGT
                     KIAAAASGFSGGFLAKDWHGTSTSSLSEFSFDLHASLAEEFGGKEKWGYRTVETLSIE
                     TDATSMSKKASPLPWLRNGLVHSSRTLGSHTTTAQVHPRLFTTFFANKFLEQPSTSVV
                     IGTVKSLNLEGGASKSIGIVSPEGDKTEIDADVVVIAAGPWTGRLAGQLLGEKIGSRL
                     GVQGHRAHSIILKTKEELSATCLFTSMTLEDGSVGEPEVYTRPDGTTYICGAGDGVPL
                     PPSAAEVSPSKSAIAKLHKQSQSLSPVFTLERGAEVISEQACYLPIADRGRPLIGKVR
                     GVEGVYVGSGLSCWGITQGPGTGKVLSEMILEGKAKSADVSKLAP"
     gene            complement(1057518..1059842)
                     /locus_tag="CNB03550"
                     /db_xref="GeneID:3255962"
     mRNA            complement(join(1057518..1058302,1058357..1058467,
                     1058520..1058892,1058946..1059035,1059088..1059222,
                     1059276..1059400,1059459..1059842))
                     /locus_tag="CNB03550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569190.2"
                     /db_xref="GeneID:3255962"
     CDS             complement(join(1057784..1058302,1058357..1058467,
                     1058520..1058892,1058946..1059035,1059088..1059222,
                     1059276..1059400,1059459..1059683))
                     /locus_tag="CNB03550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569190.1"
                     /db_xref="GeneID:3255962"
                     /translation="MASPPIPTFQNGRSICLATSTATLVEPTERTPLLKEVQNGTGKP
                     VSPPQYDHEEEGTEGKEVELLVPGKSNFSQTLLNVLGDLIGTGLLACPIAIAHAGWVL
                     GPLLLCLVSGITLWTLKILIRIIEKDRSMRNFADVARYSLGARAEKWTTAMFVSDCCI
                     WIIALIVLFSDSFEVVLPMFTSNQWKVIGLVVIVPLNFIPLRFLAWTSALGITSTWTL
                     VAILIFTGLATPTSPGSVLDPAPTDLWPAHGLVKLGLSFGLLISGFGGHFLVPNLIRD
                     MKHPEQAERVCEVGYGICIIVYALVSVFGYLMFGRDVSDEISRDLAKTSAFSPLMAQI
                     AVWMVAINPLTKLPLGLRPLTDIVYSALRLQSTTFVPKIHVSYAESSEPDEEDDELCS
                     PITSNAPTVLSSFSASTISAATSITLEDEHYTHALSNAQRRHDRREQLKAIFRALITI
                     VLLGVFVLGALAFPSFETLMSIMGGGMSIITCILIPIAAGANIWGWRWYSILLFGLSA
                     VVCVIGVVCACLNNGDA"
     gene            1060509..>1061310
                     /locus_tag="CNB03560"
                     /db_xref="GeneID:3255679"
     mRNA            join(1060509..1060755,1060802..1060926,1060998..>1061310)
                     /locus_tag="CNB03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656566.1"
                     /db_xref="GeneID:3255679"
     CDS             join(1060579..1060755,1060802..1060926,1060998..1061310)
                     /locus_tag="CNB03560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512275.1"
                     /db_xref="GeneID:3255679"
                     /translation="MFPGIAILTFCLSALLASATPFKERSGAPINGMTLSVDSGKLCE
                     GHQVNISWGDTSLGASPYHLQIGIGGYYTGVNWTNSFDNVTESSFLWNVSNPAKTSLV
                     FQVSDALNATTYVQNQIVRPGNYCDIATQPSHTVTPVASFVKPIVTVPTISSDQNRVD
                     QVDPPIPVSSLSPKKSCHIRKSKPRNVNNVNRSVDSGLGQRTAH"
     gene            complement(1060950..1062861)
                     /locus_tag="CNB03570"
                     /db_xref="GeneID:3255933"
     mRNA            complement(join(1060950..1061417,1061470..1061519,
                     1061580..1061703,1061753..1061883,1061947..1062165,
                     1062220..1062312,1062371..1062565,1062651..1062861))
                     /locus_tag="CNB03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656567.1"
                     /db_xref="GeneID:3255933"
     CDS             complement(join(1061507..1061519,1061580..1061703,
                     1061753..1061883,1061947..1062165,1062220..1062312,
                     1062371..1062565,1062651..1062787))
                     /locus_tag="CNB03570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512318.1"
                     /db_xref="GeneID:3255933"
                     /translation="MFKKRSRPTSVRDKSRIEEAEGSGNEEKVASGSGTPIVDEQEDD
                     TGRTVEELLMLKKLKKSQSRQGIDLEKLNRGEEMKRKGKKKEDPAEKYGLQPGRGMGR
                     GDGEKEKDEEMEDEAERAKRLVRVNNFTQQTNALDVDKHMMAYIEAELAKRRGQAADT
                     TDKSAIEDNDPQAELYRIAEKYQFETRKKKADDEGNVTNSLGMLTSIPEVDLGMDNRL
                     KNIEMTEKAKRDMLEQRKQEAAAAAAAAKEAEDPGYSAARFYRPNQKSASDIYVNSEK
                     RRTTGVPRQESATDEQVYERFKKRMKR"
     gene            1062955..1063894
                     /locus_tag="CNB03575"
                     /db_xref="GeneID:36392745"
     mRNA            join(1062955..1063057,1063137..1063203,1063292..1063449,
                     1063514..1063894)
                     /locus_tag="CNB03575"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658692.1"
                     /db_xref="GeneID:36392745"
     CDS             join(1063036..1063057,1063137..1063203,1063292..1063418)
                     /locus_tag="CNB03575"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514227.1"
                     /db_xref="GeneID:36392745"
                     /translation="MALPNLRSIFASSRTSEEERQLSRTTFYKFTAFVGACLVISLLA
                     ARNSGRDLRGTARGVVGMVSGTPGKLV"
     gene            complement(1063620..1065277)
                     /locus_tag="CNB03580"
                     /db_xref="GeneID:3255844"
     mRNA            complement(join(1063620..1064642,1064703..1064723,
                     1064774..1064881,1064949..1065277))
                     /locus_tag="CNB03580"
                     /product="expressed protein"
                     /transcript_id="XM_569192.2"
                     /db_xref="GeneID:3255844"
     CDS             complement(join(1064325..1064642,1064703..1064723,
                     1064774..1064881,1064949..1065110))
                     /locus_tag="CNB03580"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569192.2"
                     /db_xref="GeneID:3255844"
                     /translation="MAAGEGAFQAGDGRAPGRAPGNERAREPDHRMWACRALCLKEGK
                     NGTEGEEAFQLVECFSDDGEKFGGERVLKVLREQNAVDVLSVCCRWYGGDMIGPIRFQ
                     HIATTVQTSLKSLIKLVQLRDLRQALDALDEEIASLRARSTDLGSSQTGPSPSMVSRN
                     DNKDSRQGKYDSIQDVTKLQRLVSAKEKTVAVLLKKQNSTSA"
     gene            1065386..1067589
                     /locus_tag="CNB03590"
                     /db_xref="GeneID:3255845"
     mRNA            join(1065386..1066125,1066170..1066237,1066289..1066404,
                     1066472..1066490,1066552..1066699,1066764..1066998,
                     1067076..1067332,1067391..1067589)
                     /locus_tag="CNB03590"
                     /product="delta 8-sphingolipid desaturase, putative"
                     /transcript_id="XM_569193.2"
                     /db_xref="GeneID:3255845"
     CDS             join(1065470..1066125,1066170..1066237,1066289..1066404,
                     1066472..1066490,1066552..1066699,1066764..1066998,
                     1067076..1067332,1067391..1067499)
                     /locus_tag="CNB03590"
                     /codon_start=1
                     /product="delta 8-sphingolipid desaturase, putative"
                     /protein_id="XP_569193.1"
                     /db_xref="GeneID:3255845"
                     /translation="MTLAQKPVWDRNQIASRITQGQQLVVYHDRVLNVTPWAPYHPGG
                     ALALLHFVGRDATNEIEAYHSDAAIEMMNKFTVARVDIGKKGWPPLTPPIALGLVRHP
                     DGVKGHWAREGPVTLGQTILQQSISLDPSSAPIPPVPNPNPPSSNPAVITLEPAQLEP
                     PASAVDMEKEEQRSEDYRQLKKRLVEAGLFKPPGPLAGYGTDIIRYSLLAFGALYLYF
                     NTTGWLGQMGSATCLGLLFHQLAFVVHDAGHTEVTGVWWWDRVIGMTVASWIGGLSCG
                     WWCDNHDIHHLVTNHPEHDPDIQHIPFFAISKEFFNSLWSTYYKRTMLLDAFAKIMIP
                     FQHNLYYIVLSLARFNLYANSYMYLLGPKPRRNAFWAYEIAGIVFYWVYYGSMLRHLP
                     SWQMRLGYLLISHIMASPVHVQIVLSHFACSTEDLGPAESFPSRQLRTTMDVICDQNV
                     EWIHGGLNLQVTHHLFPRLPRHNLRAASMLVKEYCKEHDIVYREHLFIEGNRHVLSTL
                     RDVANQLNLLKKVADKEIDERMGRRRD"
     gene            complement(1067569..1069672)
                     /locus_tag="CNB03605"
                     /db_xref="GeneID:36392746"
     mRNA            complement(join(1067569..1067971,1068031..1068079,
                     1068143..1068542,1068617..1069056,1069106..1069166,
                     1069213..1069462,1069515..1069672))
                     /locus_tag="CNB03605"
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase, putative"
                     /transcript_id="XM_024658702.1"
                     /db_xref="GeneID:36392746"
     gene            1067767..>1068852
                     /locus_tag="CNB03600"
                     /db_xref="GeneID:3255918"
     mRNA            join(1067767..1067907,1067988..1068091,1068158..1068292,
                     1068380..1068401,1068470..1068558,1068624..>1068852)
                     /locus_tag="CNB03600"
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase, putative"
                     /transcript_id="XM_024656568.1"
                     /db_xref="GeneID:3255918"
     STS             1067899..1068130
                     /locus_tag="CNB03600"
                     /standard_name="AAT2"
                     /db_xref="UniSTS:470818"
     CDS             join(1068168..1068292,1068380..1068401,1068470..1068558,
                     1068624..1068852)
                     /locus_tag="CNB03600"
                     /codon_start=1
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase, putative"
                     /protein_id="XP_024512276.1"
                     /db_xref="GeneID:3255918"
                     /translation="MAEAVLKHQVTLRPESFSSKFDIRVDSAGTGAYHEGESPDSRTV
                     AVCRKHNVPISGVARAVDKRDFQEYDYILAMDRHNLETLLHRQPASSKSHITLFGSYD
                     PSLPQSAIGLPKTRAPAIEDPYYGGRDGFDKSFESCVKFSNGFLDWLERNRN"
     CDS             complement(join(1069039..1069056,1069106..1069166,
                     1069213..1069462,1069515..1069578))
                     /locus_tag="CNB03605"
                     /codon_start=1
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase, putative"
                     /protein_id="XP_024514228.1"
                     /db_xref="GeneID:36392746"
                     /translation="MDWPNPMQGPETVESVMYRLYAVVVHVGDMTFGHYVAYVLVDPE
                     MVFGKDQPKEEGDSSEASVNGATSQDAPAERSDTSINEEQKSTKADNAPKKDRRVWAF
                     CSDEYIREVDVEEVLRAKAYLCFYEKEH"
     gene            complement(1070380..1073108)
                     /locus_tag="CNB03620"
                     /db_xref="GeneID:3255578"
     mRNA            complement(join(1070380..1070482,1070533..1071947,
                     1072007..1072819,1072874..1073108))
                     /locus_tag="CNB03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656569.1"
                     /db_xref="GeneID:3255578"
     CDS             complement(join(1070422..1070482,1070533..1071947,
                     1072007..1072819,1072874..1073011))
                     /locus_tag="CNB03620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512277.1"
                     /db_xref="GeneID:3255578"
                     /translation="MSTTKATESSNAPFSDDPSSGPAYRYKPVGIANEYNTCFLNSTF
                     QALSATASLTSLLSASPVSPLNPLSNSILPAPVVPRSQIPSLHEEILEPELYDKLPIT
                     IAFTSALHEGYRRKDRYIGDEGCMRLTNMLRTVSAKHPQYNDFDQQDAHEFLRHLLDL
                     MELEEKDAIKILQPKDLPEKKGRRKKRAAIQPSQADVETQGLQLHDHISPMVSPLPSP
                     AHSLPATPGLSARIDPMSRLKPDDVDLGVVTGKVLTEEPSANPAEVEVKITDEESGDH
                     SVEKSVETLVENTVNEKLTPFVDVLFGGLLASVVICEKCKALSHTYEGFLDISLQMPN
                     EGERTRKRDKVLAFAQRLMPGRSSTAKNSPDIPPTSPSQPLPSALSDNELSDSETNPN
                     TSHFGRRKTLSIPESEGASLGRTGSTKFNLFSRRKRAHSRPSSASSSVNATPTLEAEK
                     THTVPPSPSLLSERLRHHHFHNKRQATPTPAQAAYIARILAPPQAAEQQDPIAKLRAA
                     QNGSGPVNSEPPKVETGLERCLREFTTVEILEGSNAFACHKCWRIKHGRYDHHEATVK
                     EEDENIVPGDSTPSLSTSAGPPLKHPEGSTKNSSHSEEMANSVEQALLLSSPRLPPPS
                     ISIRPGSASDSPTPHNGRSDRVGRNPSLGSVSGAGDPDTRAHSPLKRQIEDDDTLVDL
                     MASTHVDQSFAYQDSNSGSIILPSEADTGEDADARDRSESESDDLSDSESESEGESGK
                     PKRKKSKHFVMGRAYKRYLISKSPEVLVFHLKRFKQLSSAFNTFASLKKMEDIIGVDK
                     MHAISMIILN"
     gene            complement(1073658..1074732)
                     /locus_tag="CNB03630"
                     /db_xref="GeneID:3255739"
     mRNA            complement(join(1073658..1073866,1073978..1074047,
                     1074099..1074157,1074206..1074628,1074680..1074732))
                     /locus_tag="CNB03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_569196.2"
                     /db_xref="GeneID:3255739"
     CDS             complement(join(1073841..1073866,1073978..1074047,
                     1074099..1074157,1074206..1074628,1074680..1074683))
                     /locus_tag="CNB03630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569196.1"
                     /db_xref="GeneID:3255739"
                     /translation="MSNFLNQVTEAASNVANTAVNTASNLATQATNLATQAANSDAAA
                     NVASQAKNLGSQATNVAGNLASQAQAQAHDLVPDIVPTPSSTGTSATSSSGTRGVPAE
                     GEVDRSHDLSPKNEMDKAKFERLYERRGSADELQDKGILKGSPGDVLAGKKADLEKAM
                     NMDVLDQEIAQRPPPEELVRKGILNPSEVPTPQ"
     gene            1077730..1080083
                     /locus_tag="CNB03640"
                     /db_xref="GeneID:3255730"
     mRNA            join(1077730..1078143,1078212..1078835,1078894..1079036,
                     1079089..1079553,1079606..1079685,1079739..1079822,
                     1079864..1079899,1079966..1080083)
                     /locus_tag="CNB03640"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_024656570.1"
                     /db_xref="GeneID:3255730"
     CDS             join(1078008..1078143,1078212..1078835,1078894..1079036,
                     1079089..1079553,1079606..1079685,1079739..1079778)
                     /locus_tag="CNB03640"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_024512278.1"
                     /db_xref="GeneID:3255730"
                     /translation="MSQSSMRTVVVLGTSYGGCHASKMLAEELPPNWRLIAIDRNSHF
                     NHVYAFPRFTVMSQHAPKGFIPYKRMLEPQPKASSDPLTPPQTPPAESATLPDEFAAR
                     SRHQFIQACVTKLTSREVTFIRPTQQASSSNSTAENMTYGEFDGVEETIKFDYLLYAL
                     GSTLPDPVNVWQPIDEGAVDEERKPGTKKRGLRFMKLQMEKFKQADRILIVGGGALGI
                     EYASDLKDLYPEKKITLLHSRSRVMPLYPLELHMIIIEALTKMGVEVVLGERVVTWPD
                     EPETLDGKTKYVTTDKGRTFEADIVLPCTGQKPHVSLMAEVNPALISPTTSRIRVLPT
                     QQVHPGPIPPAKVESAADQLAQLSLGPAPITPPVSDVGSFETSSGIGHNEVVQGEDYS
                     HIFAIGDCAETKAIQAGHTAYWMGEVAVRNILRLIAKEEGGEKKDEPLEDYKPGPPAI
                     KITLGISNAVVANGNGVTTNNDGVEDMHSLVMWPTCNAEGMDINE"
     gene            complement(1080068..1082082)
                     /locus_tag="CNB03650"
                     /db_xref="GeneID:3255819"
     mRNA            complement(join(1080068..1080278,1080331..1080493,
                     1080550..1080661,1080716..1080933,1080989..1081005,
                     1081062..1081109,1081157..1081429,1081482..1081598,
                     1081725..1081786,1081849..1082082))
                     /locus_tag="CNB03650"
                     /product="UTP-hexose-1-phosphate uridylyltransferase,
                     putative"
                     /transcript_id="XM_569198.2"
                     /db_xref="GeneID:3255819"
     CDS             complement(join(1080195..1080278,1080331..1080493,
                     1080550..1080661,1080716..1080933,1080989..1081005,
                     1081062..1081109,1081157..1081429,1081482..1081598,
                     1081725..1081786,1081849..1081909))
                     /locus_tag="CNB03650"
                     /codon_start=1
                     /product="UTP-hexose-1-phosphate uridylyltransferase,
                     putative"
                     /protein_id="XP_569198.1"
                     /db_xref="GeneID:3255819"
                     /translation="MSAAHLEVPYFEPTEHPHRRYNPLIGKHVLVSPHRTKRPWKGQT
                     EEPVLTTLPEYEATCNLCPGNERSNGNKNPKYIDTFTFENDFPALLPGPLPTLQQPSK
                     VNSSDSLFASEPIRGRCKVICFHPKHDLTIARMNVDDVVRVIGEWKNVYVEEGRMLQE
                     SSGQGYVQIFENRGAMMGASAPHPHGQVWSLSYVPDEPQTELNNLAASTLVSSGNTPV
                     RGDGCPCLLCTYAAEEVRRKERVVEIDVESGWVAVVPFWAVWPFETLLLPYKRHIPSL
                     IQLNDNEIIGLARILQRLLVRYDNLFSCPFPYSMGLHQSPLPPSNPDGDVAHIHFHFY
                     PPLLRSASVRKFLVGFEMMAEVQRDLTPEQAASRLRALPGTHYLDQKIAV"
     gene            complement(1082284..1085205)
                     /locus_tag="CNB03660"
                     /db_xref="GeneID:3255750"
     mRNA            complement(join(1082284..1082685,1082741..1082829,
                     1082888..1083075,1083132..1083274,1083328..1083407,
                     1084726..1084791,1085035..1085205))
                     /locus_tag="CNB03660"
                     /product="RHEB small monomeric GTPase, putative"
                     /transcript_id="XM_569199.2"
                     /db_xref="GeneID:3255750"
     CDS             complement(join(1082597..1082685,1082741..1082829,
                     1082888..1083075,1083132..1083274,1083328..1083388))
                     /locus_tag="CNB03660"
                     /codon_start=1
                     /product="RHEB small monomeric GTPase, putative"
                     /protein_id="XP_569199.1"
                     /db_xref="GeneID:3255750"
                     /translation="MSSTSGPLKRKVVIMGSTSVGKTSLTQQYVAPPTYTASYYPTIE
                     DTSHKIVKYKGADYDIEIVDSAGLEEYSLFPGKYAVGVHGYMLVYSIASRQSFDMVPT
                     IYDKILDYAGLESVPLVIVGQKTDLRDERSVTKEEGEALAKKLRAGFIESSAKDNANV
                     SGAFEVLLEEMQKVYNPQPEKKKSSWWPW"
     gene            complement(1085544..1087769)
                     /locus_tag="CNB03670"
                     /db_xref="GeneID:3255740"
     mRNA            complement(join(1085544..1085645,1085708..1085893,
                     1085948..1086227,1086280..1086424,1086489..1086627,
                     1086679..1086801,1086867..1086985,1087038..1087150,
                     1087210..1087442,1087515..1087769))
                     /locus_tag="CNB03670"
                     /product="adaptor complex subunit medium chain 3,
                     putative"
                     /transcript_id="XM_024656571.1"
                     /db_xref="GeneID:3255740"
     CDS             complement(join(1085722..1085893,1085948..1086227,
                     1086280..1086424,1086489..1086627,1086679..1086801,
                     1086867..1086985,1087038..1087150,1087210..1087442,
                     1087515..1087555))
                     /locus_tag="CNB03670"
                     /codon_start=1
                     /product="adaptor complex subunit medium chain 3,
                     putative"
                     /protein_id="XP_024512279.1"
                     /db_xref="GeneID:3255740"
                     /translation="MSKIDGIIILDTNGKPIICSNFASYLPSYATAHIDTFNAARKRA
                     LVNGPGRGMDPVLWVNTLDNGRTGMLGGGLCHSERNGLYFLVPIGQEVNPLFAFSFLE
                     SLLDILRNYLGDVTETTIKDNFDIVYMLIEETLDEGHPMTTETEMLKEIVLPPSLVRK
                     IFGAAGVSGLQSTTTAPFTAPIPWRRPGVRHNNNEIYFDIEECLDAIVDRRGNTLTAS
                     VWGRINCNSRLSGNPDLLLNFSDPKRMHQCSFHPCVRYSRWMKDGVLSFIPPDGKFRL
                     LEYESVINNARTSVPIQLKAGLTIGDYGGRFTLTLSSRLNTRPLEDINVSIFLGKGAT
                     SVSANASGERRPLHTQIGKEEAAEGFVGGGNWEFDPHTQILKWHLASLVSTERSPTLT
                     GTFTSSEARPIVSPSFDVGFTIQNYSYSNLRVNQLKVQGDVMYKPFKGVKMIGRAGKI
                     EVRW"
     gene            1087907..1089511
                     /locus_tag="CNB03680"
                     /db_xref="GeneID:3255662"
     mRNA            join(1087907..1088199,1088250..1088398,1088450..1088917,
                     1088970..1089511)
                     /locus_tag="CNB03680"
                     /product="expressed protein"
                     /transcript_id="XM_024656572.1"
                     /db_xref="GeneID:3255662"
     CDS             join(1087966..1088199,1088250..1088398,1088450..1088917,
                     1088970..1089486)
                     /locus_tag="CNB03680"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512280.1"
                     /db_xref="GeneID:3255662"
                     /translation="MAIDRQRPVLIITMVRTYNFLAPSLYPNTLVDISFPEPTIGVVN
                     VSPADPVVHNLPVKYGEYSALGGVRKMVNVGNNKVVVADDKFQISTLELSSIGTEAPP
                     PPIITSQESVKARANDVWAGLVPVENGTVSALTSGLLTFHPTSGSSSSSRSVPSPLAC
                     LASTHLAPNKFAMGGKEVDVSIWDVERTFASSSDSPMVDAGKRKKNALEPGQLWQAKN
                     MPNNYLKLRPPVYHLALSWLNSPDALVSGTKMGTVRRFDTRQRKPVADWKVAREGGVS
                     CLMPGEENELFFSDRSNYLGALDLRTGKVLYSYSSLTATPHHLLPISSENSSPLLPST
                     KRIGFASVSSDASIRLHTCTTPPPEDQKGNWGSEGKKGDIVGMVGGIGLGGAIFRGYD
                     ERELEVRKEAKEDDVGEDESDDEEEMWEGMNEVEDAGEGSDSDEDDNDSEEEAPKKKS
                     KRSRL"
     gene            complement(1089480..1092082)
                     /locus_tag="CNB03690"
                     /db_xref="GeneID:3255803"
     mRNA            complement(join(1089480..1090571,1090626..1091162,
                     1091233..1091414,1091463..1091874,1091928..1092082))
                     /locus_tag="CNB03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656573.1"
                     /db_xref="GeneID:3255803"
     CDS             complement(join(1089582..1090571,1090626..1091162,
                     1091233..1091414,1091463..1091874,1091928..1092047))
                     /locus_tag="CNB03690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512281.1"
                     /db_xref="GeneID:3255803"
                     /translation="MPPTLTDLPSEVILEQLLPLLPLKDVLRLSQVNHQLHTLTLDPS
                     YWRHKTTSDFSFSPSSHPPFPSSDWWRRVYFGLLQPRAFVWGSSNNSRLGGAENNKGA
                     RKFGSFVDCPAEIRLNERESGGKTWTESLKDSLVGLTHGIVGDAPSELGGAGVVELHA
                     GGWSFTARCSDGSVWVWGQLDGRTMSFREKSWENKYCIVPEPTRIPLPCKAESISPGR
                     SHLLILDSDNLVWELTAWGLAYHHTATELTSPAHYGSNRHPPHVVQLSTGWTHSAALT
                     SGGTIYIWFPFSDPYKQSLTPDAELNVLNPHGVEDDADNGARGLRWGTVTGNVLYELP
                     AVPVRPEYVTLPAEDFNSDAKEVLGGLDAEWKEYDTTHTAEILEEGQKIVKIASGLEF
                     ILALKKNGEVWFTPVKDGVPPVWYFVPYFSSPAITHITAQFESITSYATATQQKQSSA
                     VYHTRVPADTVPPPSFTSEPTVLLHRPDFLPDLQNKGIIQVALGDYHYAALTNRGEML
                     TWGQGGNGQLGLGAEGRRGDGTVPKLVKFEEEEAGKEDPGFVFSITAAGWHTGALLLG
                     NNEPKRKVGDESAAQSPIHRTVDTVSNSQHQRGSPDIAPYEQNPPVTNGNHPPPFRIG
                     YPGRHMFRGVRGGHSQMPAPVQGQIDPSTANELSARANQGETSASSDQAASNQPASIQ
                     HDTNSADYGSQLPMPQHHVSSRAVRAMPFFRVGFAGRGSFRGRGRGQPGINDGNGVGF
                     NPDGPQ"
     gene            1092364..1099367
                     /locus_tag="CNB03700"
                     /db_xref="GeneID:3256006"
     mRNA            join(1092364..1093189,1093241..1093803,1093858..1094573,
                     1094647..1095947,1095999..1096027,1096081..1096195,
                     1096250..1096573,1096624..1096969,1097022..1097154,
                     1097203..1097446,1097508..1097635,1097689..1097739,
                     1097791..1097892,1097946..1098283,1098331..1098462,
                     1098520..1098959,1099014..1099367)
                     /locus_tag="CNB03700"
                     /product="zeta DNA polymerase, putative"
                     /transcript_id="XM_024656574.1"
                     /db_xref="GeneID:3256006"
     CDS             join(1092463..1093189,1093241..1093803,1093858..1094573,
                     1094647..1095947,1095999..1096027,1096081..1096195,
                     1096250..1096573,1096624..1096969,1097022..1097154,
                     1097203..1097446,1097508..1097635,1097689..1097739,
                     1097791..1097892,1097946..1098283,1098331..1098462,
                     1098520..1098959,1099014..1099294)
                     /locus_tag="CNB03700"
                     /codon_start=1
                     /product="zeta DNA polymerase, putative"
                     /protein_id="XP_024512282.1"
                     /db_xref="GeneID:3256006"
                     /translation="MEDTAVVNQGPSSSLPVGSSQSLSLSSPRLRVKITHIVSDQAAP
                     IPTLRQHYAPSRLATAIPLGNLPHSVPVIRIFGTTSSSQKICANIHLCYPYFFVPYPM
                     DSQDPLRPERVVKLCQRFAVSLNHAICLALRQNPTSAANNTNYGGGVDPKHLHVVSVI
                     LVKGTPFYGYHLGFDYFLKINLANPARLHIALEQLRKPNVLGREWQPHEAHLNHVLQF
                     MCDFDLYGCGWLELGGGTFREPVPEADPFDSLSETVTDGTLGLLNCRTIPTSMLYPPG
                     LSPAKDSFTSLEIDILPHQILNRQRLMPRLLHHDFIELLHKPLDPNEKLVPAVAELWE
                     DERRRRAAKGLGTGTNDMMPGSGGMDGRSMEELGYRGNQVDGKKNKGGDWKISDELWA
                     ILEERMGAERKRKGKLTFQKYSRDVSAGREGEKLQWDKWIMTTFDALSAHWPKQAKKV
                     TKTTQMSRKSHMTLPADTSSIYYGSSQDKNALFGESTSVTLEEPGMDSRLEKEDEEIN
                     PFEAFAMTQASQHPQPVPELSQHVQAVPFKEVEDSDQYYVGEDEGDIDEYKQAEGARV
                     HAQETDKIRATQMASEMEGHYDEYDDKELEELFRQTVAAGLGIQSVPTTPHKPKDQDQ
                     EGNSRWSGWTPTSKGSSKSSVGTFESRKRKRNQRLLEDAGLGDLSTIIDRSSLSLSPL
                     KNPYDERGHGVSTPENANTPSREMATPSSLMRNAFAKSRQQSPNLSPAKRSESSRSKH
                     LRSDTVILPLERKNPGAITSSPSLSPRDKVIDGDHGNLQRKLAEAKKPLQGQFPSASA
                     KKNLVVGPEPGQEVVQLSLPPAGAGLYEPVANVVSPVVSNSSRPIGLVESHLSSTLLN
                     PSFRDKTSDLPLSATLLNAPSAKPALSPTFQDPSANDERLPISPSIVATHRDDREAKV
                     RPHKRVKLTEPGHASQESLLPLIRNFSHPSHGDRHRSPQNAASDHQENLSSCLASKAW
                     QYYILPPQRHEIADTMELHGVSTVDYQPPFFGQLADVPKRSKTLAGRVFNLKSHSVRN
                     LQKFESTIGSGPLLENAKGKERAKAGWLKTNSDNDSVGKVRWNLGWEYAPRPPSKREV
                     KRWCEKIEDKAKIAREKYEEKTSQLAHPTQKSKYGFKYSQKGKVRDSSGDPQNMSILT
                     MEVFAQSRGTLLPDPEKDAVTAIFYCYSNTDDDLPDTTIYPGYHAGYVVTSALANPAR
                     LRLDDIPFEIVEDELALINWVIDIVKFWDPDVLAGWELHNSSWGYLAARASGEFAMDM
                     MDQISRIISGRTGPRNDGYSAHHSSTFKVVGRHTLNIWRICRSEINLTQYTFENVVFH
                     LLHQRIPHYSPSSLTALWKSKYPSHACRVLKYFFQRTVMCMEILDQAEIITKTAEFAR
                     VFGVDFASVLTRGSQYKVESFIFRIAKPESFVLVSPSKQQVGLQNAPFAVPLIAEPES
                     KYYTHPVIVLDFQSLYPSIMIAYNICYSTCLGRVEMFKGTNKFGFTNLKVTEGLLELL
                     KDYLTVTPNGMIFVKPAIRKSLLAKMLGEILDTRVMIKHAMKGARGDKSLTAMHNARQ
                     LGLKLMANVTYGYTSATYSGRMPCIEIADSIVQTGRETLEKAQELIHSRVDWDARVVY
                     GDTDSLFVALPGRSKEQAFKIGYDIANAVTALNPKPVKLKFEKVYMGSVLMAKKRYVG
                     FKYEHPDDTEPSFDAKGIETIRRDGFPAQQKMEEVCLKLLFRTQDLSKVKEFCLKEWT
                     KILQGHVSMQDFIIAKEVRLGTYSEKGIPPPGAAVAYRRILKDPRDEPQYAERVPYLI
                     SNADGRRLIDRARMPEELLSSRSLSIDAEYYIRNLLIPPLSRIFNLVGADVEEWYDSM
                     PKTKRLGKYDKAGGKMTNRGNGKGKQGEAKGRGSRIDSHFRSSHCVVCGIESSDVLCH
                     PCRLDPSTTSHALLSRLHIAQDKLIVLQKICASCSSVPPAEKILCDSIDCPNTFARVA
                     AEREVEDLEDVGELLLELKLEDERPEIDLSW"
     gene            complement(1099454..1102383)
                     /locus_tag="CNB03710"
                     /db_xref="GeneID:3255551"
     mRNA            complement(join(1099454..1099859,1099912..1100240,
                     1100288..1100356,1100417..1100530,1100589..1101838,
                     1101891..1101952,1102016..1102232,1102290..1102383))
                     /locus_tag="CNB03710"
                     /product="expressed protein"
                     /transcript_id="XM_024656575.1"
                     /db_xref="GeneID:3255551"
     CDS             complement(join(1099599..1099859,1099912..1100240,
                     1100288..1100356,1100417..1100530,1100589..1101838,
                     1101891..1101952,1102016..1102232,1102290..1102297))
                     /locus_tag="CNB03710"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512319.1"
                     /db_xref="GeneID:3255551"
                     /translation="MARDPPSSLGSTELRDISFTPTAIRPAKITIIHPQLRDLILPLS
                     RGRVLYPRGLNIDEIRWFPNDEDGDSASKSNGDGTTRTVFKLDFAANCVVSNSNMFAC
                     GGQHGELFVSSIPQPNAYIPERFHVAPKIKPFKISTNLPHSRSINNSIIIPPSWPKEW
                     TRQSVERKIGYVGRGSRSWEEIERGDSITGKAERGEWVTRKVRSRNDAHTCSENGDEE
                     AYTPPDGDDEDDDMYDFEKDNLSSSPATYPNTLPIRYVSSHLPTIFSRKSGTKDKLKR
                     RQYTEEPRLVISNNDRTVKFFSLPLQNEDAHQAVEEGYPHYGIPSLARFPHPVNFRPS
                     VLPLEELMELNGPPLDFPDTLRFETGIREVDLGISDDGRPSLALYDVVATEYATNILG
                     GDQNRLARQILEGYRDRELARGGRGLGRTEQRQLVREDSFGELVDYSRHRRYRNIVGN
                     SSSHQSPEQQSRGWTRITSRARDDEDDEIEDGLRWPPEDYSQKETRTLRTICSTQFDV
                     AANHSSLSPDLRYLVSVGDSTDVNLFEVINEGRDLRKIAVYNAATDAGFSSAWSKDGR
                     KFAVASQDGQVTVWDHRSSRPLAIFQTSPSSIHSSPSFMHDISATHRGGNTASPGSPH
                     SSGSGNWERWESATGSEMILRDPVTGIPRTGSSTSGKEAARVVKFSPEGSSRDLLVFT
                     EEESNIHIIDARTLTTHVVVPVPHVPNATTNPEVLRRPRKGVEGGTWGISGVAFDPTG
                     DFLYSGTESTVVEWDIRRLGNHGGTWSMR"
     gene            complement(1103320..1105022)
                     /locus_tag="CNB03720"
                     /db_xref="GeneID:3255922"
     mRNA            complement(join(1103320..1103417,1103522..1104036,
                     1104097..1104409,1104465..1104505,1104554..1105022))
                     /locus_tag="CNB03720"
                     /product="expressed protein"
                     /transcript_id="XM_569205.2"
                     /db_xref="GeneID:3255922"
     CDS             complement(join(1103537..1104036,1104097..1104409,
                     1104465..1104505,1104554..1104827))
                     /locus_tag="CNB03720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569205.1"
                     /db_xref="GeneID:3255922"
                     /translation="MSSYTLLVGGYRPNYSLISFDPSSAQLKVISDSPAPENASWVEP
                     ASLSEENDGSRIFYSLSESKGKAVSLKVEGEKVTVVSERDTHGGSCHVHVMKDRSGIA
                     VANYLGGSIIFFPITSDSTLSSSSASPLLKFSLVYEEQQQIAPNPERQDAAHCHQIIE
                     GDEGTLYVPDLGNDRVWVVWREGESGLSIKGWCQAPPGSGPRHACISNDGKHLYVLTE
                     LSNSLITFPLSDPTYPIIPRPDSQLSVIPPSVPKKYHKYMNAAELVAHPVHPVLYASN
                     RLEMDLSESTKGEFKPSVTGDAVAIATLTSDGKLGSVQHVRTGCNAVRAMQLSPDGKF
                     VALAGQNGGGMEIWNVGDDGKAWTLVCRNEKLEGITDVAWL"
     gene            1106252..1110645
                     /locus_tag="CNB03730"
                     /db_xref="GeneID:3255959"
     mRNA            join(1106252..1106828,1106885..1108142,1108190..1110645)
                     /locus_tag="CNB03730"
                     /product="expressed protein"
                     /transcript_id="XM_024656576.1"
                     /db_xref="GeneID:3255959"
     CDS             join(1106686..1106828,1106885..1108142,1108190..1110484)
                     /locus_tag="CNB03730"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512283.1"
                     /db_xref="GeneID:3255959"
                     /translation="MDQPPSPRGGSVHSIPIPAYSPLDTQFNAIAGPSSEGAICRRSD
                     ELDASSQPLSPSSAPSIPSAISVTHPPQFIHTHHPRRGSLTPLGLNIISPVPPQALRE
                     RENINPTRNVGFHPNYSPKQSFLATATAFNAGAPSSAGLQQSNRRSSAASTASRLSLS
                     RPPIAHASHSFCPLNQHPGRRRSSLTPSISTLAPPSPTHTHANGISFRPTSNDEGRHP
                     AHADSAIGFLELMNKGGNYVRRGSLPHIGHRGWAGHSQRVWNPILPPPRGSVGKDDSG
                     ELPIENFRFGSGISSTISTPRSVSQLGSDRRPSESKRREDMSVFEQAEAEEAERQRRA
                     FLAATYGADGRRARERLSIGGQSINSGQGKGLRRQSLMLWESMGMFRGSGDESAVSAP
                     VGPSRSANATGLLSGEDEVPLRRGSLPVAIPGTLERSASRRQKKEANGGKERSKSGDE
                     DAAAYEEDDERRGGIGESLSPLRPLPPLLPLSDPGPRLLPSTLALHRANHLLNSRNLQ
                     SDPLPPPLPPSLHPPDPVDVTEFDIDFILSGSQTQLGQNLAGDASADAVDAHGVPLAQ
                     TLKLGGEEEDSFAKFVGENDDEYGDRRGEWTFRACPTPSKKGASQLVPKAEWESLGAG
                     KYELFHNDEVRSSVTGRVWRVKKLGAREYELEEVRPSGLVVPNKTEKAERLTLAGKAV
                     HRDQGGVKLPSFNVNAFFPPFVNPTSRSPAAMHRNGPAGKLRASMSEGFPASGKSKSP
                     LMPTGYSEGEDFTNTTNSLSQSMPFTSAMSVLKAKKKDERSREVKDDVFAVGVSTSGK
                     KLLRDGNKESEGEKKDRSIGGVLKRGLSNLKNSGLVGTSSSEERRLAREERERERVQA
                     HSWNGSSSPNGYQSWNPHSQYALEAIKDYHPTHPRLMKGDEMKGLWQEERRVIKWIEG
                     NAWGGVPEDAVAMIIPLEGDNSAPDTPFSPTPPSPSSETAKDLNALLKSYDNTVIPHP
                     FFSSGTKRALLVWYVPFNSDLDGESRPSTAFQSSNSISSTNSNASANDSSPPGSLPKF
                     QKLLRKRASKDKETMKRELAQGSNWARPTDEVRPLKRHVSSTQALPFRSFRVVARVVD
                     CKELKSKLEGREDDEQRVNGGGIEWSKGGNVFAESSAVDHPSTTSATDPAIPPFLRES
                     FSTDNSSRPLTGRNFPTVIAVCHSRSQGVEFVLEGLDRLGLCKGESAWGPTGYEEWRG
                     TGLSEHGRKMLDLLWAGCTGVMGLIGV"
     gene            complement(1110795..1112153)
                     /locus_tag="CNB03740"
                     /db_xref="GeneID:3255909"
     mRNA            complement(join(1110795..1111021,1111085..1111224,
                     1111303..1111363,1111423..1111452,1111508..1111530,
                     1111586..1111710,1111763..1111814,1111870..1111889,
                     1111965..1111992,1112059..1112153))
                     /locus_tag="CNB03740"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569207.2"
                     /db_xref="GeneID:3255909"
     CDS             complement(join(1110896..1111021,1111085..1111224,
                     1111303..1111363,1111423..1111452,1111508..1111530,
                     1111586..1111710,1111763..1111814,1111870..1111889,
                     1111965..1111992,1112059..1112083))
                     /locus_tag="CNB03740"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569207.1"
                     /db_xref="GeneID:3255909"
                     /translation="MVVFFTSKVVSPPVTIYMGKDKVENEELLRYGLPTDVWFHVDKL
                     SSAHVYLRQPDNQPHGEWDKLPAVLVNDLAQLVKANSIEGNKKDNITIIYTPFTNLKK
                     TGDMPVGQVSFHSDKMVKRAHVSTRDNAIVNRLNKTKIEKEIDHEAERQERLRLEGRK
                     KKAEAIERAKKEQEQKKAWEEEKQARSYDNLYSEDAFAEQEQFSDDDFM"
     gene            1112377..1115476
                     /locus_tag="CNB03750"
                     /db_xref="GeneID:3255638"
     mRNA            join(1112377..1112495,1112553..1112709,1112756..1113072,
                     1113126..1115309,1115392..1115476)
                     /locus_tag="CNB03750"
                     /product="expressed protein"
                     /transcript_id="XM_024656577.1"
                     /db_xref="GeneID:3255638"
     CDS             join(1112487..1112495,1112553..1112709,1112756..1113072,
                     1113126..1114946)
                     /locus_tag="CNB03750"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512284.1"
                     /db_xref="GeneID:3255638"
                     /translation="MAIADQFAIPITILRHFDLSSSPWSSEVEGYTKRRERSPNGKLF
                     FDRLLEIAGIDGPSLYPPKSPADVRRLLHSIQSTELDRLKKDCYFYYLLLDYDGQPEA
                     RKPNGHVEGMDVDDEDAVLIVKSVEATKVADKFARKRCMPRHWRIFIDGYWALDHGLW
                     KIAVDNLSDPSISEVNFMSEIVQTLSTSVSPPQLACSLLHSFLLSTQPNFPNPSLESD
                     VRLIATASATSIFAALGCTRQESSPEQRKRMREVVWSWMLGAPRTPCGAGNHVVQSKA
                     LKELIHAPLLPEEETHLTEFLSHPPRSVPSSALSRLHDLVTIRLIHQGHYNQVIQLDK
                     KLAGNGAGTQGDRQKRREMVREFISILPEAHRRVLLTDVEGSLRRAEKEINGFSEDMD
                     MIGSWLQVDGVDESTPTPTFALVSPSVPVTVPASVPVPVTVAPTPIRSVPSSSNLVHL
                     AHAASVASPSQRPERTHSPFGGPPRFAQGATVSSSSPRQSQAFTGSPFSLPQKTAAAK
                     AHASPEKPRPKMVINDDQEAEETLKKKPVKGKDKDTTGGNGGLRRSRRQVSMSVEPEE
                     LPVDENHPIEPIAEDSAWSPSYAVVEEPKSTRKGGRRTRDKTPPMSISPSRRSTRARK
                     SALPPSTSDDEPRARRTRGASAHPEPSATPVTHGRMTRSVSRALLEDSDHESVDMDMS
                     VPSSKRNGTAASGSVRKKRRGSVAASEITDDGLATLMETPRVRRSNRKAAPSPTPSVQ
                     GSEAGKIRRKRENPAPTPRMATRSRRV"
     gene            complement(1115027..1116025)
                     /locus_tag="CNB03755"
                     /db_xref="GeneID:36392747"
     mRNA            complement(join(1115027..1115338,1115401..1115854,
                     1115915..1116025))
                     /locus_tag="CNB03755"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658712.1"
                     /db_xref="GeneID:36392747"
     CDS             complement(join(1115210..1115338,1115401..1115854,
                     1115915..1115919))
                     /locus_tag="CNB03755"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514229.1"
                     /db_xref="GeneID:36392747"
                     /translation="MQSLSPECTPLKHRYDSCFNLWFEGYLQPALDATRSVSYPAPTA
                     SPSSPQVQPTAIVQQQAEPQTQKRTLITSWANAFPSRRSTALPQTKARQSSSSTVEGT
                     SLPMSDYPDPVYENSQIMNIDTAGKSRAQIKAEEYERACGQLWKNYQGCLLKAIGENE
                     SLTQLLEQAREEHPLKDMDKLEGTAWDPKANPASP"
     gene            1116180..1120483
                     /locus_tag="CNB03760"
                     /db_xref="GeneID:3255920"
     mRNA            join(1116180..1116399,1116455..1116568,1116623..1116943,
                     1117004..1117170,1117210..1117683,1117723..1117885,
                     1117926..1118148,1118197..1118698,1118756..1118983,
                     1119040..1119123,1119174..1119365,1119424..1119617,
                     1119657..1119828,1119884..1120483)
                     /locus_tag="CNB03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656578.1"
                     /db_xref="GeneID:3255920"
     CDS             join(1116207..1116399,1116455..1116568,1116623..1116943,
                     1117004..1117170,1117210..1117683,1117723..1117885,
                     1117926..1118148,1118197..1118698,1118756..1118983,
                     1119040..1119123,1119174..1119365,1119424..1119617,
                     1119657..1119828,1119884..1120303)
                     /locus_tag="CNB03760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512285.1"
                     /db_xref="GeneID:3255920"
                     /translation="MEGGSQTNMDAVLAELSNLLAELEEQPENIFFLRRQIVLMRSLG
                     MTAEVLDVYAKLSSLIMLQEEEWLTYLDDFVNNAVKPLDVTAFMDIMEKYVQAERDYL
                     SLSIILQHVKFIIACFKAGHTPQSSEEALEVPVDEEVSAFLDVGTTRGLIKAAVDLGN
                     GLLSESQQLWQLWIDWELRLLEGAKGTEKQEAIESVHDVYLQRLAIPHSTIDQTTSSY
                     SSFCSTYCNEEYEQRLVKATEASQTAKYKWSGERRAGKSREDFELQILYATDLAAQAQ
                     VFVEYYKWESNARIKPTAHGKGPNVDITLTRAVFERAVVPYAKLAAMTQSSLDEINLQ
                     LQKQSKSKKGKAKGKKKEDELEATTLAEQKQMAEEAIRAYKDAEAGIWAKYASWSEEA
                     IHAMTGTEVRKKAVRAVPHCGGAWADLFQDTEKVTADLQQLDSLFETALSLGLLFIPE
                     GRTTEITELFLARAAYEARLASVNVALGAVHPTLATITRGLETITKVNKSGDASLKLE
                     KFALDWAETIAPEYLDQTLLVLDKPVKCRSSSYQFALLRANVEVRRDDVDRAREIFEK
                     SIQRTDLDWPEAIYEAFIQLEVVHGTPQTLQDTRKKIEKEQEKVAKRREKAAAEANAY
                     QEQYTTAAIQGAAAGAVDAVMGDGESKGADPTQEATDMAVAASADLSAAPVAVVQSGK
                     DNGEEVHLKRDREHTTVLVSGLPKGCTPERIENFFFECGPVRETTILVDEDAMHDSAL
                     VEFKKAEAIPDVLEKDKKKFEGTPVSISMLWRSTLFVTNFPREMDDGGIRNLFRQYGR
                     ILETRWPSRKYADSRRFCYVTMESPAVAQEALVLHDYKVPGASTNFGLTVLISDPSAK
                     TKRSDAANSTLFVGGLNSKSTEVDIKGLFNEFGTISHIKLGWDPLKRICKGFAFVEMS
                     TEAEAKAALKLHGTQYKGKYLKVEISDPNHANKKSQERKPDQAAEKRLRSVRLSNLPE
                     GTQEGLLQQALEKIVPVRRLEMFVRSHEALAELESQADVGKLLLRTEPFIFNGNEITF
                     TEQNKRLPPAKEIKEDSGNDRNVKLSSTPSGPSTMFAPRAARKALAKPRPTAVAAAKA
                     VAASPGISAQGQDDFRALVAAKNKQREEKLNSAREGSSTSGEKRKLEDGQEGEESKRT
                     RT"
     gene            1120556..1123241
                     /locus_tag="CNB03770"
                     /db_xref="GeneID:3256068"
     mRNA            join(1120556..1120877,1121189..1122890,1122943..1123008,
                     1123056..1123241)
                     /locus_tag="CNB03770"
                     /product="expressed protein"
                     /transcript_id="XM_024656579.1"
                     /db_xref="GeneID:3256068"
     CDS             join(1121202..1122890,1122943..1123008,1123056..1123193)
                     /locus_tag="CNB03770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512213.1"
                     /db_xref="GeneID:3256068"
                     /translation="MMSLKSCLSRSESSGLFKQSRTVIMSNDTFELQFGEEGPTPIIL
                     DTQQKDVNYRDIANCSVPVFFNPTDTPDVVCYGIAYPQPNTGHCSRQTYNLWHFVTYK
                     KNVQNGQWRNQQWQPIARTEGEYTTMTVWPTRMIVKSIGLSTPEQAVSEEILVCEVYP
                     LSNLRTTHASVDNREPWVEGASFTALYTAISSVGTGQHQSSPLTPERIGSSLVSSRKT
                     LTQPSASVDGRRPSTGHRRSRPSGFPTLPRRMHPLLNAVNDYITCKGAEYRSFEQGMS
                     SANIAAGMSSFDLNGTNSHAIHIRDNGSRGLSGMPDGLQERVISWARHVERHGAVNEP
                     KGMPQERESGQTSTIASRGVETPERQGQDLPLTQGISQLHRSATLPSSWAAWRSDILT
                     EEWVEAAGGEQMLSQLNARLGDVSFSNVQDLLGEASNSSPNTILSHSAVQSWTPFPDF
                     SPWKPISQNSYNFSYRLCANEGLWEFHGDIPIDITLETVFKLMVQEWLKCSIDPVDSP
                     ASVGSGRKLATAVRFTRGLPMAMKKVLLRDVLKDYLWKHIEDAAAQKDCPICQEKYQS
                     FTCVTITPCQHMFHKACLDQWTMEESTCPMCRRDCAVMRFLQCLEELQHLTGGVEEWH
                     SHVLSA"
     gene            complement(1123253..1124994)
                     /locus_tag="CNB03780"
                     /db_xref="GeneID:3255780"
     mRNA            complement(join(1123253..1123957,1124014..1124394,
                     1124525..1124994))
                     /locus_tag="CNB03780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569210.2"
                     /db_xref="GeneID:3255780"
     CDS             complement(join(1123384..1123957,1124014..1124394,
                     1124525..1124919))
                     /locus_tag="CNB03780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569210.1"
                     /db_xref="GeneID:3255780"
                     /translation="MTDLTAEAAISPSDDILLPALASLREGHPDKGILKLLAQLKIDH
                     PEWAVSEKRFRKALQLAPCPGGGEADPKEKALVADTGLDPSIDVKSIAPKVEVKMFAG
                     GKGKGLVAKEELKQGEMLWQEEPWIVTSDPGHYSLLTQSMMCSQCFSLFARPSPPLSV
                     PCPHCTTAHFCNRLCYTKSLSSSHPPLLCPGLNPDASSLMNFIRKRGERSVEGVAKIL
                     ARWRGEREWDAKGKAEEMEKRIWKGMARVSQKRKEMERREWSYISKARMEEWHLIHIM
                     LTNVLNPSPTHENYKPFQRLLISQHPRRSKPVPLTEKEVKRWFSFESFLELLGLVGLN
                     QEDSGGLYALHAHMNHSCEPNIQVRNLPKSYTPPTQDTLPVNLPPPIQAGDRVSNKLT
                     ILARHEIQPGEELTISYVNMKMSRDERRQALREGYGFWCACDRCMREKEQPNGEKAE"
     gene            complement(1125091..1127228)
                     /locus_tag="CNB03790"
                     /db_xref="GeneID:3256114"
     mRNA            complement(join(1125091..1125640,1125706..1126530,
                     1126595..1126817,1126870..1126963,1127013..1127228))
                     /locus_tag="CNB03790"
                     /product="heat shock protein, putative"
                     /transcript_id="XM_569211.2"
                     /db_xref="GeneID:3256114"
     CDS             complement(join(1125236..1125640,1125706..1126530,
                     1126595..1126817,1126870..1126963,1127013..1127211))
                     /locus_tag="CNB03790"
                     /codon_start=1
                     /product="heat shock protein, putative"
                     /protein_id="XP_569211.1"
                     /db_xref="GeneID:3256114"
                     /translation="MNPLRSRAALPRPARLIQNAAVQKRGFASKDVVFGNDARQGMLK
                     GVDVLAKAVAATLGPKGRTVIIGQSFGGPKITKDGVSVAKAITLKDPVENLGARLVQD
                     VASKTNDTAGDGTTTATVLARAIYSEGVKNVAAGCNPMDLRRGAQKAVDKVLEVLAAN
                     KKVITTSEEIAQVATISANGDTHVGAIIAQAMEQVGKEGVITVKEGRTIDDEIEITEG
                     MRFDRGFISPYLITDTKNQRVELEKPFILLSEKKISALQDILPSLEIAAQTRRPLLII
                     AEDIDGEALAAVILNKLRGQLSVAAVKAPGFGDNRKSILGDIAILTGGTVFTDELDVK
                     LEKATPDMFGTTGSVTITKEDTIILNGEGDKSLIQSRCEQIRALINDSSTSDYDRTKL
                     QERLAKLGGGVAVIKVGGSSEVEVGEKKDRYDDALNATRAAVEEGIVPGGGTALLKAS
                     TALEDIAVDNFDQKLGISMIRQAIRRPVRTIVENAGEEGSVVVGRLLSEEFAAPEKFN
                     WGYDAQTSQYRDMIAAGILDPLKVVRTALVDASGVASLLTTSEACVVDAEEKTPPSGM
                     GMGGMGGMGGMPGMM"
     gene            1127387..1128163
                     /locus_tag="CNB03800"
                     /db_xref="GeneID:3256064"
     mRNA            join(1127387..1127429,1127477..1127554,1127640..1127825,
                     1127913..1128163)
                     /locus_tag="CNB03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_569027.2"
                     /db_xref="GeneID:3256064"
     CDS             join(1127427..1127429,1127477..1127554,1127640..1127825,
                     1127913..1127963)
                     /locus_tag="CNB03800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569027.2"
                     /db_xref="GeneID:3256064"
                     /translation="MAATFKNIKALQPLLDRVLVQRFKPETKTASGIFLPSSTTQSPL
                     PEATVIAVGPGARNKDGDVTPVSVKPGDRVLLPGWGGSPIKVGEEEFHLFKDAEILAK
                     INE"
     gene            1128473..1131592
                     /locus_tag="CNB03810"
                     /db_xref="GeneID:3255784"
     mRNA            join(1128473..1128857,1128911..1130470,1130552..1131071,
                     1131135..1131592)
                     /locus_tag="CNB03810"
                     /product="MAP kinase phosphatase, putative"
                     /transcript_id="XM_024656580.1"
                     /db_xref="GeneID:3255784"
     CDS             join(1128557..1128857,1128911..1130470,1130552..1131071,
                     1131135..1131399)
                     /locus_tag="CNB03810"
                     /codon_start=1
                     /product="MAP kinase phosphatase, putative"
                     /protein_id="XP_024512286.1"
                     /db_xref="GeneID:3255784"
                     /translation="MQPQQHSHNNNPSPVARPHPLHVVYSPTIPPPNRGTRNSELAQG
                     SKIPLTAPLPSRTAAATSPNRKRPTPLVLGKPREAGQEDWEIQLERPVAASSGASDDH
                     SLDNELQDLSKLRKAVRQNLLARPIDSPLEPSDSDKSAFNTPGQQSSFSSSSKPMESI
                     PIELVFDRVESGSVLLVDTRPLASFLNSHLPNSIPLSVPTLLSKRFQKSQSQSNPSAI
                     SWATLSPFVSLPSARERWDSVDQNKVEIAVICQGEEGRVVEDILKSLINDRTKVVKGG
                     WAAVLNYERARRTLVSGQATTRPCLDVGVSETDSKPRPEPTSILLPPKSAPPCEIPLP
                     PIPASPSPSSPKSLNHRPSLPSLRPPFAGPTRNLPSLSINAGQASQRRTPKLSLNLDR
                     PLKSATLGGYHDIPPTPHGFLCTRTRPQRSPGLSLNIPHTPFQPQQGQVQDRIVGDSR
                     SNGSASIQTRAYEQSHFPPSASTFGDAKQIENEGEDMAPNQYDGRTPRAPISHSPRKS
                     QEYQAARFYSSPPSMNGALPSSPPTIRTAVAPFNPSVILPSFLYLGPDIQSESDVQYL
                     LRLGVKRILNVALECDDNQGLSLKERFKYRKVGMRDIVEENGVGKGMRDACEFLDDAR
                     LHSAPTYVHCQAGKSRSVTIILAYLIHANAWTLKTSYAYVAERRKGISPNIGFVAELM
                     QWEETELGVKQSGGVHGDGNGRAKTAGCGGGGGSSRHKEDGDDDEGRAKTHLRDSLPP
                     TWSSSVDTYTRPAKVYSPVGGDDGGEEEGGREGRIAVGDEREVRKNGVWVHHRRAPVD
                     RTTLQPGRRVSKAGLESLQPFLITSADPSSPSAAPNNGDNIDNEHQLNNNNDSETRPS
                     PRAISGMGMRGHAMTPAGDGPLRWI"
     gene            1133152..1137329
                     /locus_tag="CNB03820"
                     /db_xref="GeneID:3256077"
     mRNA            join(1133152..1133922,1133990..1134209,1134274..1134398,
                     1134461..1135299,1135365..1135666,1135729..1135863,
                     1135930..1135959,1136030..1136194,1136245..1137329)
                     /locus_tag="CNB03820"
                     /product="expressed protein"
                     /transcript_id="XM_024656581.1"
                     /db_xref="GeneID:3256077"
     CDS             join(1134527..1135299,1135365..1135666,1135729..1135863,
                     1135930..1135959,1136030..1136194,1136245..1137074)
                     /locus_tag="CNB03820"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512214.1"
                     /db_xref="GeneID:3256077"
                     /translation="MLLESDYSEMGREGHRSPEKHRSEDRRPSGEEHLVSRYNNPPIS
                     EQTRNSPSREASTTGHEAQPLAPSSAEQNLPTHYVVRPIQTPDAHQQSGSSDRIETAT
                     EVRQSEPSAHQQPIEGLLLLRQQLPISPARKRSRSPPPFGRIDKFGRSRSSSPSGSKS
                     GEDKARSRPNTGDELKSSMRGREMQSRSPHNVTDFLTEPPSSALRSTVHSSLSFFERE
                     LVDVKSPCLPAISDWKPTETPPSGLIKPTLSSLVSDFRSLPPPFPSAPLSSARSFFGQ
                     SRAGPSSQSQESSNPRRRSEDVHHHLPSLELPLQPLVEEQTLQPPRPPLDRQQHLDIP
                     SPSLSDPAKGPGEQPPSAVKGSRAERTSSTKGMREKGGRFEQGGSGSGKKKAKHQSAE
                     LLSPKGSDTKNVADAPGPSVNARLSTESTGHESASGRAFDIHWTPDNVKAYWMGYDSA
                     MRDVKFGRGDVRVNMPKEGRAVAMEVSVDEQHQQHSKTRAGATAAESPQNLGFRAAYR
                     PPPSPQTVTQPQLQTQRLAPRMRPHGENQPEPLSQGTTISPSMRTLSHPIFAPFGWEP
                     SNPVVHPQQRRSTYPVHMPNFVAPIHPAYHQIVADPPKKQVQVPIGTRFHPPQMHPPP
                     IYSLSSSESSTNYREGSGLEPAGSHRQRKRQLISCYPCRKRKLRCDGRRPVCEQCERR
                     KVADQCGYAESIKRRRRTKNAEDDDIEMRDEGDDEIEEGKEEEIQAGPSRRENLDREE
                     RDQV"
     gene            complement(1136688..1138337)
                     /locus_tag="CNB03830"
                     /db_xref="GeneID:3255632"
     mRNA            complement(join(1136688..1137644,1137709..1137958,
                     1138009..1138184,1138297..1138337))
                     /locus_tag="CNB03830"
                     /product="expressed protein"
                     /transcript_id="XM_024656582.1"
                     /db_xref="GeneID:3255632"
     CDS             complement(join(1137575..1137644,1137709..1137869))
                     /locus_tag="CNB03830"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512287.1"
                     /db_xref="GeneID:3255632"
                     /translation="MPLTPYPSSFFKTFHNPAIHILFRLKFASDSFAPNEEISNRESQ
                     QSWKQIRGSKPLPFRLTPFSIHRHGHLRTHSA"
     gene            1137584..1139859
                     /locus_tag="CNB03840"
                     /pseudo
                     /db_xref="GeneID:3256079"
     gene            1140279..1141513
                     /locus_tag="CNB03850"
                     /db_xref="GeneID:3255653"
     mRNA            join(1140279..1140462,1140511..1140563,1140623..1140809,
                     1140859..1141248,1141298..1141513)
                     /locus_tag="CNB03850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656583.1"
                     /db_xref="GeneID:3255653"
     CDS             join(1140355..1140462,1140511..1140563,1140623..1140809,
                     1140859..1141248,1141298..1141447)
                     /locus_tag="CNB03850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512288.1"
                     /db_xref="GeneID:3255653"
                     /translation="MPSNPSLEAVSAANATKRKNAPRDDEDSASESGSDVSMINVDFD
                     FYNLNPDVDLIAVKRLLRQTLSYDEERIDVHSLAELLLAEGVRLQAGSSIKTDGEESD
                     PWGLVAVIDIVRHKDHPALKPFLDYLGSVMANSNSPLQSVFSPSSPNTRPALVFSLRM
                     LNLPLPLIPHLYRMLLEELETKEEGRFTHFLVWGRGYRLEGTEEGMGLDMNVVEKSSK
                     KKKALGNETVALSAGSFPYHPEEEFMDKVASQVHTYNFKTAAPRDAESFGVEQFGRLV
                     LLEKAKLVSAIQSMQAACQ"
     gene            complement(1141460..1142565)
                     /locus_tag="CNB03860"
                     /db_xref="GeneID:3255830"
     mRNA            complement(join(1141460..1141726,1141777..1142147,
                     1142202..1142274,1142325..1142565))
                     /locus_tag="CNB03860"
                     /product="phosphoadenylyl-sulfate reductase (thioredoxin),
                     putative"
                     /transcript_id="XM_569215.2"
                     /db_xref="GeneID:3255830"
     CDS             complement(join(1141501..1141726,1141777..1142147,
                     1142202..1142274,1142325..1142473))
                     /locus_tag="CNB03860"
                     /codon_start=1
                     /product="phosphoadenylyl-sulfate reductase (thioredoxin),
                     putative"
                     /protein_id="XP_569215.1"
                     /db_xref="GeneID:3255830"
                     /translation="MSSEDILTPQYTPEEIERFNAELDGKTPQEILTWAVDNVDGLYQ
                     TTAFGLTGTAAVDMISKISLDREETHLVPLIFLDTLHHFPETLALAQTMADTYLAPLH
                     IYTPPGVSTAEEFAVKYGEKLWETDEGAYDYLVKVEPAARAYKELGVRAVITGRRRSQ
                     GADRADLKVLEIDERGLLKINPLIGWSFKEVKEYIDKEGVPYNPLLDKGYRSIGDVHS
                     TAPPDPNAASDAAERSGRWQGKAKTECGLHSNYFEMKKKFEEKAAAAGEASKQS"
     gene            1142735..1145643
                     /locus_tag="CNB03870"
                     /db_xref="GeneID:3255923"
     mRNA            join(1142735..1142986,1143034..1143807,1143856..1145304,
                     1145352..1145643)
                     /locus_tag="CNB03870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569216.2"
                     /db_xref="GeneID:3255923"
     CDS             join(1142762..1142986,1143034..1143807,1143856..1145304,
                     1145352..1145594)
                     /locus_tag="CNB03870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569216.1"
                     /db_xref="GeneID:3255923"
                     /translation="MRPQHLLPLLLLLLAPAIHAAVLAIDYGAEFTKLSLIKPGVPFD
                     VVLDKDSKRKIASVVGWKRDERVFGAEAKLAATRFPDTHYPFIKPLLGTTTPNTFPVY
                     PVNPHVTNDTLYFPHPSPPSYISPELVSPEDAWTPTALLAQQLSYFRHLAELVQPAGS
                     NKESINSVVVTVPAWWDQAQRRAYRDALELQGMNCLAMISEGTGVALNYAMTRSFPNY
                     DPVTGQGEKEYHIVYDSGAMTTTATVLAFYQTSEYATPKSKTAINTTHIEVLGTGWEH
                     VGGVMLDTVIQDILLTGFVSKTGREEVRQDKKALAKVAKEATRVKQILSANQEANVAI
                     ESLFDDVDFRSTISRADLEKIVGAVDQLYGSPVISALEAAGLQLGDINSVILFGGNTR
                     VPLVQASLKSVLGGAEDKIAQNVNTDEAAVLGAAYYGAALSKQFRIKNIDIKERSVSE
                     IALKNGNAIFPEGSVLGERKAITLPAKGDVTLEFTERISHPDSAHASSSEPQSILSVE
                     VHDVEKALADFTAPEPVINITMRLDPKGHVSAANAVLVSNVTDSKDGGVAGAIKGLFG
                     SKEEEAKETEEDEGQKDAKGKSLKVALKFREKHLGLKPLSGEEKRTTNARLISISAFE
                     AAKASREEARNSLESYLYALQNSLNIDDGPTALTDFSTPAEQQALKKLLGETFEWLGE
                     NDEVAEESNLRRKLAELEGLERPVVFRYNEYRARDKAVADFQQAMHLARAFFIDAQTN
                     YTKAMEAAATATPEDPVAPPKHTEEELKGVEALLKEYTQFIDEKMKVQVTLDGDKTKD
                     PVITVRELQEKGRRLQATVLTLQKKKAPRKPRPTTSSSSATSSTTLASPTDDGPSPDV
                     TESPSDVSSTTLASPTDHGPSSETSAAPTEGSDALRHEEL"
     gene            complement(1145045..1146828)
                     /locus_tag="CNB03880"
                     /db_xref="GeneID:3255991"
     mRNA            complement(join(1145045..1145292,1145342..1145588,
                     1145657..1145938,1145991..1146211,1146268..1146482,
                     1146541..1146745,1146787..1146828))
                     /locus_tag="CNB03880"
                     /product="f-actin capping protein beta subunit, putative"
                     /transcript_id="XM_024656584.1"
                     /db_xref="GeneID:3255991"
     CDS             complement(join(1145714..1145938,1145991..1146211,
                     1146268..1146482,1146541..1146745,1146787..1146802))
                     /locus_tag="CNB03880"
                     /codon_start=1
                     /product="f-actin capping protein beta subunit, putative"
                     /protein_id="XP_024512289.1"
                     /db_xref="GeneID:3255991"
                     /translation="MADPDQTFDALLDLLRRLPPTRVEENVNALCDLAPEYADDLLGN
                     VDQPLKVLVDEEKAREFLGCDYNRDGDSFRSPWTNNYLPEPVPGPTPSPRLRELEIQL
                     NAAFDTYREMYFEGGVSSVYLWDLDDEPQGKEMNFAGVVLVKKTLQSQSGVPTAPAGS
                     WDSLHVFECHERGRSAKYKLTSTVMLVLETATLAKAENKGPEDSDGKGGVTLSGSMTR
                     QAEIDYPLTTPQGHISNIGRIVEDMEIKMRNLLSAVYFGKTKDVINDLRSQSGLEAKS
                     KEDLLRAELAGKLGGRK"
     gene            1146999..1149112
                     /locus_tag="CNB03890"
                     /db_xref="GeneID:3255613"
     mRNA            join(1146999..1147468,1147518..1147789,1147835..1148046,
                     1148100..1148242,1148297..1148440,1148505..1149112)
                     /locus_tag="CNB03890"
                     /product="magnesium ion transporter, putative"
                     /transcript_id="XM_024656585.1"
                     /db_xref="GeneID:3255613"
     CDS             join(1147046..1147468,1147518..1147789,1147835..1148046,
                     1148100..1148242,1148297..1148440,1148505..1148903)
                     /locus_tag="CNB03890"
                     /codon_start=1
                     /product="magnesium ion transporter, putative"
                     /protein_id="XP_024512290.1"
                     /db_xref="GeneID:3255613"
                     /translation="MSSVCRISNCLSPRALSTAIRPKVTFRATPPSCRRRTFLSRRRT
                     SFWAPSYPESKPLASTLQVPFTPPPPTDNGDGHLSEETRPEVIVAEPRDKKNRYLNSL
                     MEKAGELSLKCSILDAEGNWGAEGQKYTKLELCREYDLDPRDLRKLDSLSPSLVPVIL
                     TRKTCILISMLHFRALIKPDSVIVFDSSHAHKDVTRRFKYHLERNIKAGLGIKVGGAD
                     EEKCDEIVLSYEHRALESILVVTANALEEEMAFSRHIVQQLLADLEDHIDRENLKKLL
                     HYSKKIAAFQSRARYVKSAIDELLDSDEDLSAMYLTSRAQGRPRALHDHEQLELLLES
                     FVKQVEEIVSEVDTTVVNMQSTQEIAELMLDSGRNALLALDIKISIATLGIGSGALLA
                     GLFGMNLTTQLEETPYAFAVISSTAFLVTVLITAYGLRTLRRVRRVALSGRNPAVLSS
                     VLGSASWDSSVAQFSQGFDPALVDMRTEMAKRAIWERLWWGSKRKEVEEGEKWRKAYT
                     YASAKKEQEKRKWARLPGGQTR"
     gene            complement(1148974..1151674)
                     /locus_tag="CNB03900"
                     /db_xref="GeneID:3255689"
     mRNA            complement(join(1148974..1149275,1149358..1149662,
                     1149737..1149925,1149987..1150175,1150240..1150496,
                     1150558..1150755,1150810..1151060,1151114..1151198,
                     1151247..1151285,1151334..1151674))
                     /locus_tag="CNB03900"
                     /product="transcriptional regulatory protein, putative"
                     /transcript_id="XM_569219.2"
                     /db_xref="GeneID:3255689"
     CDS             complement(join(1149264..1149275,1149358..1149662,
                     1149737..1149925,1149987..1150175,1150240..1150496,
                     1150558..1150755,1150810..1151060,1151114..1151198,
                     1151247..1151285,1151334..1151638))
                     /locus_tag="CNB03900"
                     /codon_start=1
                     /product="transcriptional regulatory protein, putative"
                     /protein_id="XP_569219.1"
                     /db_xref="GeneID:3255689"
                     /translation="MQNNAPSSFQGYPFPPQQSDLYTFAPVSQQQQQLYYAAQPATDQ
                     HASADSSESAGPSQKKTPAGARKHGVKEEPEEHGKADEPRKKRTKRSAGKACVYCRRS
                     HMVCEGGRPCERCIKREIPHLCRDCTPPPQNQQSPHKQEPQQQQQTQQQQSLNQSQVL
                     PSSAQPMPVYTDSNFVPSWPLLPDAGAAQIPFSDAPSEQIQNPGDAGIMGPPPLGSSR
                     EDGELAALSKFMKDLGVPNLPNDFLSFMNQLDKPDASNSLSIASSSDANLFSSSGAPY
                     GVGLNKGKGKLNQMSRIDKYLMAAADQPNGTRASRLAQVIKAKYDAGLLKPYDYAKGY
                     ERMNKWMESGRAAPRMDSRAGSEIPDESPQRSTAAMRNGRLSVAPLAPNTPAFGKSIS
                     PESRRRILAALAGFRPKFRQIAKTLTNVDLVFVEEAMERWMLEYDRAFASIHTPSCIW
                     RRTGEIQKANQEFSNLTGIPAYMFRDGQLCVYELMDEDSAVRYWEGYAKIAFDPSQRA
                     MSIFCTLHIPLSLTRHPPRHLTNANSNHISKSATSGPPQAPYTPDLALPHQNMLFNDG
                     ASSDAGTAIGEEYREMKCAFSVTIRRDAWGVPVAIMGQWIPIQ"
     gene            complement(1151778..1156884)
                     /locus_tag="CNB03920"
                     /db_xref="GeneID:3255559"
     mRNA            complement(join(1151778..1153529,1153597..1153652,
                     1153709..1154855,1154918..1155885,1155940..1155994,
                     1156045..1156294,1156358..1156884))
                     /locus_tag="CNB03920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656586.1"
                     /db_xref="GeneID:3255559"
     CDS             complement(join(1151865..1153529,1153597..1153652,
                     1153709..1154855,1154918..1155885,1155940..1155994,
                     1156045..1156294,1156358..1156578))
                     /locus_tag="CNB03920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512320.1"
                     /db_xref="GeneID:3255559"
                     /translation="MPNLHVHFLNGNVKAFRQELDGTAGGCTPKGGNGGGGGLGPSSA
                     SGGNGKSWMMSGMGASGKADPNERDMFGRTVLHLAASSTTPMAYTFFQILLRHPQLQV
                     NLQDQESGYTALHRALFVGNIRAARDLLLRNDIDTSIKDAEGMAAYDLYNGTVDGTNP
                     PQNGNGTDLFVWGVNRNFALGTGDQSDKAFPDHINLLTQAQAAGRSDPSQKFSHVGVK
                     DVVMSKLHTGVITSESRGNLSLCGFGANGRLGKSIHSQLALVPMTDLQHSIVSIALGQ
                     DHTLALTSGGYILSWGYNRFSQLGYVIEAPEKPAGMGKEGDDLIQVSPKRIVGPLKKE
                     FVRGVAAGRMASACWTADAVWTWGTNAGHLGYDKASNPVQTVPRRVTSITQPVVDIAF
                     SDYAMICLLDTSEVICFHGDTNFKISFSIPRLLPEAFPFRPPQTTLKPMITKVASSAS
                     SFAALSSIGDVFTFTLPNPMEDVYKDGRHVVVKPQIVWALRKNFTAVKDVAIGSDGTV
                     IVCTHSGHVFVRQRLKSGSGQLKFRRIPYLQRVIKVATNESGAFGAIRVDARPTPIKL
                     VGKTLEEDLFLLQPHFHRLEHQMTAEDFEKLNANSKKTDDDEEEDDESTNSVAKDTSI
                     ALKMCTILSRWRTGEGDSLFAWSDPLLSSDCHLIIQGLAIPVHSAILSMRAVKIAQLL
                     AGEYTSNVLSLGSYGTSPAIKVEACHPLVGLLLIQYLYSDDVAAIWDARVARIIQDKY
                     AAEKIPVGDIKSELKALADELDLSPLSSVLSYAAKQPLPHHTLSSDMQSFFNTTFTVP
                     AGPESPCDVTIFLSDKQVSCNSVILRARCPFFEAMFEDRDWTLNRKSEGAVVVRMTHL
                     KWTPMKLVFRWMYEGVEDDLFDYLHQDTLDEFLDFVFEVMAAATELLLDRLVLVCSRA
                     IIRHCNAFNAAALASEASFYQANTLKLSVFDYIISCLETMLESGLLDEMEQSVLQDLS
                     SVIAEKQKKRSPVAREGVLVKELMAKHREWLLVQDIPAPIVRQPFKYRARSAMSPVDL
                     SSAKPVAPRRKPPPSPMVNPSAEVSDKSSAADGIFQMDDDLPTPTTSASEVRTPNRGS
                     RSMTPLSLGATPFQPAASTSGSSTPAKTPIWKSKTVETGKADLRSIMAETAAAKTPLK
                     PVSMPVVASAVGNGSAARGGFPLPASGAAPSKGMLARSPPSAGPSTGGPWRATEVRKT
                     SFTALQGQQATNGLGTGSPGNTSTSTSTSANANANANTNTLNRSAGSQASPAPQRSGS
                     AKVITPVRLQAPATQPRKSSTPTAAWSTPSTFIPPPPISVSPVAQGLSLLAIQQQERE
                     AAEALARRPAKSLREIQEEEQEAERARVQEEEFMRWWHEEEARVAKETRQGAVGGNQQ
                     GQSGRGRGRGGRGKARGGGGGGRGRGGGQGGQNGRGEDKQGGAAPTGTHGQPSQGRGK
                     HDGGRGDGSGPRALGKA"
     gene            1151937..1156828
                     /locus_tag="CNB03910"
                     /pseudo
                     /db_xref="GeneID:3255605"
     gene            complement(1156988..1159567)
                     /locus_tag="CNB03930"
                     /db_xref="GeneID:3255763"
     mRNA            complement(join(1156988..1157613,1157663..1157694,
                     1157760..1157796,1157918..1157973,1158031..1158099,
                     1158160..1158328,1158386..1158577,1158628..1158728,
                     1158782..1159232,1159289..1159417,1159471..1159567))
                     /locus_tag="CNB03930"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_569326.2"
                     /db_xref="GeneID:3255763"
     CDS             complement(join(1157687..1157694,1157760..1157796,
                     1157918..1157973,1158031..1158099,1158160..1158328,
                     1158386..1158577,1158628..1158728,1158782..1159232,
                     1159289..1159417,1159471..1159503))
                     /locus_tag="CNB03930"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_569326.1"
                     /db_xref="GeneID:3255763"
                     /translation="MEEIGIDLKMEDPSLPAQISEKQNLLNSLPSGSEELYSTWKRLE
                     AHREFLQLQEEYIRDETQNLRRELLRAQEEVKRIQSVPLVIGQFLEPVDERRAIVGST
                     TGSNYVVRILSTLDRELLKPSSSVALHRHSNALVDILPPEADSSIAMLGADEKPDVKY
                     SDIGGLDSQKQEIREAVELPLVQQDLYRKIGIDPPRGVLLYGPPGTGKTMLVKAVANA
                     TKAAFIRVVGSEFVQKYLGEGPRMVRDVFRLARENSPCIIFIDEVDAIATKRFDAQTG
                     SDREVQRILIELLTQMDGFDQQTNVKVIMATNRADTLDPALLRPGRLDRKIEMPNPSR
                     RERRLIFQTVTSKMNLGPDVDLEDYVSRPDLLSSAQIASICQAAGLQAVRKNRYVILP
                     IDFEEAWKSVVKRNDETHEFYR"
     gene            1159710..1160620
                     /locus_tag="CNB03940"
                     /db_xref="GeneID:3255588"
     mRNA            join(1159710..1159830,1159881..1159935,1159995..1160065,
                     1160124..1160154,1160207..1160257,1160310..1160620)
                     /locus_tag="CNB03940"
                     /product="cell growth-related protein, putative"
                     /transcript_id="XM_569220.2"
                     /db_xref="GeneID:3255588"
     CDS             join(1159773..1159830,1159881..1159935,1159995..1160065,
                     1160124..1160154,1160207..1160257,1160310..1160514)
                     /locus_tag="CNB03940"
                     /codon_start=1
                     /product="cell growth-related protein, putative"
                     /protein_id="XP_569220.1"
                     /db_xref="GeneID:3255588"
                     /translation="MGKRKAAKKPVAKKKAEPLSSVFKCLFCNHDKAVNVKLDKATMF
                     GHLHCKVCGQKYSTPINNLSAAVDVYCDWVDACEEVRQQQPPKQRAPRGPDPLTHGQA
                     GGAGYDPEGAEEDDEEQEYNFNDKDEEEDDRRKEPEDRAGKRRKVQEESEDEDD"
     gene            complement(1159940..1161947)
                     /locus_tag="CNB03945"
                     /db_xref="GeneID:36392748"
     mRNA            complement(join(1159940..1160056,1160109..1160247,
                     1160298..1160753,1160813..1160880,1160931..1161061,
                     1161134..1161243,1161306..1161426,1161496..1161947))
                     /locus_tag="CNB03945"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658722.1"
                     /db_xref="GeneID:36392748"
     mRNA            complement(join(1159940..1160056,1160109..1160246,
                     1160298..1160759,1160813..1160880,1160931..1161061,
                     1161134..1161243,1161306..1161426,1161496..1161947))
                     /locus_tag="CNB03945"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658733.1"
                     /db_xref="GeneID:36392748"
     CDS             complement(join(1160697..1160753,1160813..1160880,
                     1160931..1161061,1161134..1161243,1161306..1161426,
                     1161496..1161896))
                     /locus_tag="CNB03945"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514230.1"
                     /db_xref="GeneID:36392748"
                     /translation="MTPSSSPGIEPISPPPTALSSSSRQNYNIPRRNPLPNPSTGKQL
                     PKLYREQSKSGRLKDKKQQSRKEENLKKRKAEFFSNRREKKPRSEGIDGNVEEAESSE
                     QEVEPRARVTERMLKTLGRQGNPITNSDMPSRTDHVVSCTTGHQRGEQRGQNVTWTYA
                     QVRTDQLQKQAREKKTGIFKGCLFYFNGSTGPKLSNIQLRNLISENGGRFTTIQTSAC
                     THVIANNGLSGGKTQKHLDMQGGRGSARQVKVVKIEWILDSVKKGVKLSEAGYGVVEN
                     PPTLFSTLGLKPKSFLSNS"
     CDS             complement(join(1160697..1160759,1160813..1160880,
                     1160931..1161061,1161134..1161243,1161306..1161426,
                     1161496..1161896))
                     /locus_tag="CNB03945"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514231.1"
                     /db_xref="GeneID:36392748"
                     /translation="MTPSSSPGIEPISPPPTALSSSSRQNYNIPRRNPLPNPSTGKQL
                     PKLYREQSKSGRLKDKKQQSRKEENLKKRKAEFFSNRREKKPRSEGIDGNVEEAESSE
                     QEVEPRARVTERMLKTLGRQGNPITNSDMPSRTDHVVSCTTGHQRGEQRGQNVTWTYA
                     QVRTDQLQKQAREKKTGIFKGCLFYFNGSTGPKLSNIQLRNLISENGGRFTTIQTSAC
                     THVIANNGLSGGKTQKHLDMQGGRGSARQVKVVKIEWILDSVKKGVKLSEAGYGVVEN
                     PLQPTLFSTLGLKPKSFLSNS"
     gene            complement(1162131..1165510)
                     /locus_tag="CNB03950"
                     /db_xref="GeneID:3255574"
     mRNA            complement(join(1162131..1162616,1162668..1165172,
                     1165263..1165510))
                     /locus_tag="CNB03950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656587.1"
                     /db_xref="GeneID:3255574"
     CDS             complement(join(1162328..1162616,1162668..1164514))
                     /locus_tag="CNB03950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512291.1"
                     /db_xref="GeneID:3255574"
                     /translation="MSLLTPSRPQDSERTSVVLSSVTCSTCAAHIAFSSLGDHVCESL
                     PVPGAPSRPAQLSTLQSSSSQSQYRPSRQGPPPVSIRPPFAGPSSAHPSPTELAPPRR
                     PSSHSLTPPSRSPNNYTLGFSPQLKTNSPTNPFFPNSAGSYSSSASMESMQMPDTTSG
                     GESGMAGVGRRAFAAAAWGVRAGVALAASARQQAALQQAAASSQPPSQPASLQKPPQN
                     RPELHHSHTAPLQPSPPTRSLTPNSSPQRSQSAMSQRSASDTQSIRKQSTSSTSSSRM
                     GDSLAEMLTGSVKPSTKRNFFEKIKELDRSNSLMSRSTNSTANSGDRKLVSSPIGTTF
                     ELDDDYEDQPSALPWASPETDQMSRLHIDAKVSPAVSRAHQRNPTASSEISTNSSMSS
                     KSGRYGGNSGPESEEVVTPSQSFEGMTDRVDGTFKIDILQQIEEDENEGREVFGSSLE
                     RKHVEEKDRENRLPLSDSASMPTSRILAIAEQSIPANNSSQNFTHRRLSSEKSSNYSQ
                     HSASAIASVRRKKTCQKCGTVVGGPKRFVERDGVVLCEQDWKKLYLPSCRKCKLPIEK
                     SAVSSSDGQLKGKWHRACFTCTKCDRPFEGDDFYVLGGKPWCQYHYHEENGTFCSLHS
                     CRQPIEGACIVLAGRSPQRYHPGHFKCDHRGGASGAQTCRESMDEYYEVDGNRYCERH
                     VGEAVRQGGRNGAIKAEKRWTRLIDLPAA"
     gene            complement(1166022..1168676)
                     /locus_tag="CNB03960"
                     /db_xref="GeneID:3255724"
     mRNA            complement(join(1166022..1166641,1166691..1166856,
                     1166910..1167052,1167110..1167341,1167397..1167525,
                     1167580..1167694,1167748..1167966,1168022..1168141,
                     1168194..1168338,1168391..1168676))
                     /locus_tag="CNB03960"
                     /product="WD-repeat protein, putative"
                     /transcript_id="XM_569222.2"
                     /db_xref="GeneID:3255724"
     CDS             complement(join(1166189..1166641,1166691..1166856,
                     1166910..1167052,1167110..1167341,1167397..1167525,
                     1167580..1167694,1167748..1167966,1168022..1168141,
                     1168194..1168338,1168391..1168537))
                     /locus_tag="CNB03960"
                     /codon_start=1
                     /product="WD-repeat protein, putative"
                     /protein_id="XP_569222.1"
                     /db_xref="GeneID:3255724"
                     /translation="MSSGGHTNAAGPSRQHSLTAESRSLTTARQKEKAPQLEDVVLEE
                     GLFEQEIDLLIGQYLEARGASKAARIWDEQILGRSANGSTRKEHIEDVERAILDGDWG
                     SIENLVARPGLLRIQTQKAFLYLVYRQQFLEHVENRESQKAFNLLQKRLKALEHYQPV
                     PYDFYSLSYLTSASTVHDAPTFRDWAGVGPERDRLVGVWKELMDAERGGGVDERRYIP
                     PDRLKTLLKQAAAWQVGRVGKKRDDIVKIPTLLQDYRPLELPSKLLRLVEGHLANVKC
                     VELIGSTAQHVVSGSSDCTLRVVSTEDGSLSHILSGHSSRVWSCDSSPSGEMIASSSG
                     DGTIRLWSASKGDCLGVLVGDGGDVYNVRWRPNREDQVVSASYDRILRSWDIETGKQL
                     RTFSGHSQSTLAIAYDSTGNTIASGSKDKHVRLWDAVGGVCTNTMTDCLGEISSVEFD
                     NEGKYLLVGCKDNSNRLWDLRMQRSVYRYTGHQNTSKNLVRCSFACSTSLVISGSEDG
                     SVYIWDREGNSNDRRSNSLVPSTRDNELLAPERKGSGGDLTDFNIHPSSPAYYPPREG
                     VRNRNSFARRGEITVRPSKVLVGHGEGAVFEVRWKEGKMVSAGEDGSVGVWGAETN"
     gene            1169321..1171457
                     /locus_tag="CNB03970"
                     /db_xref="GeneID:3255995"
     mRNA            join(1169321..1169876,1169930..1170002,1170056..1170192,
                     1170246..1170446,1170495..1170675,1170726..1171123,
                     1171175..1171457)
                     /locus_tag="CNB03970"
                     /product="transporter, putative"
                     /transcript_id="XM_569223.2"
                     /db_xref="GeneID:3255995"
     CDS             join(1169447..1169876,1169930..1170002,1170056..1170192,
                     1170246..1170446,1170495..1170675,1170726..1171123,
                     1171175..1171374)
                     /locus_tag="CNB03970"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_569223.1"
                     /db_xref="GeneID:3255995"
                     /translation="MTSKTSPAIAAPLRHTHTQPSQSAPLRNQASQQPQLRSASSKTY
                     PDYDPFPIQLNLVRSLSRSQSRPHTSLQRPPTRQDGLDNIPPPLPASSIELDRRLSRD
                     PDVERQMGVNDGDVGPPPEGGAEAWCCVGAAFMVLFCIFGFVTSFGQLKTYYAENQLS
                     EYSQSEIAWIGTLQSFLTFAGSIFSGRYFDSHGARSITILGTSLSVGATIGLAFCKEY
                     YQFILAHALFGFSGTIMYSPSTAVSGHWFMRRRSTAVGIVVCGAGAGGIVYPVALKKL
                     FEQLSFRDSVLIIAGMNAVLMFPAWFFLKARLPPRRPPPVREMKHPWKEARYTCLVLG
                     SALVMMNVFSPYFNAPILLTSNGLSENLASYSIAILQAGSMVGRALSGVLADLFGVWT
                     IFVISILGSSISVYAFWVPQSINTATAVVGLVAYGAFSGAWIALVAASCGAISPTREF
                     GMRLGMLWSTTSVLCLAGPVICGVLISSNDEEFKYAGIFVGSTHLLGAFVTVGPRLVE
                     VTRDFVRRLHGKSGSPYDAEQEGKDITESVN"
     gene            complement(1171701..1174707)
                     /locus_tag="CNB03980"
                     /db_xref="GeneID:3255572"
     mRNA            complement(join(1171701..1172050,1172102..1172150,
                     1172209..1172365,1172432..1172733,1172781..1173033,
                     1173098..1173246,1173308..1173409,1173461..1173509,
                     1173568..1173611,1173660..1173741,1173797..1173807,
                     1173880..1174707))
                     /locus_tag="CNB03980"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_024656588.1"
                     /db_xref="GeneID:3255572"
     CDS             complement(join(1171832..1172050,1172102..1172150,
                     1172209..1172365,1172432..1172733,1172781..1173033,
                     1173098..1173246,1173308..1173409,1173461..1173509,
                     1173568..1173611,1173660..1173741,1173797..1173807,
                     1173880..1174499))
                     /locus_tag="CNB03980"
                     /codon_start=1
                     /product="hexose transport-related protein, putative"
                     /protein_id="XP_024512292.1"
                     /db_xref="GeneID:3255572"
                     /translation="MSDGERITQASSGHGYKQKSRYPLTAAMTEGKPVTQHVEGGASE
                     KPGIPRTSSDDASSEGHPKKATGNALGRKESHKVDLISNTNAKLANPLGDLTDEEVMD
                     NAAAFAAANNLPVEVFRKGGLVAKRPNGFEKMSILTEKDKERLRREITHPYSQTKTLY
                     NLVIACSVAAAVQGMDESVISGAQLFYPEQFGIGAINPDPRYAHNHEWLEGLVNGAPY
                     LCCAVLGCWLTAPLNKWFGRRGTIFITAFFSFITCIWSACMNNWWLLFISRFFLGLGI
                     GPKSATVPVFAAECTPAKIRGSLVMQWQVWTAFGIMLGYVADLIFYHVPDTPNITGLN
                     WRLMLGSAGFPALIVMAQIFFLPESPRWLMAKGKYEKAYRSMLRLRGDELLAARDLYY
                     IFVLLEEEAAIVRGRNLFWELFSVGRNRRAMIGSTIVMFGQQFCGVNAIVYYTASIFT
                     SAGFSEISALLASFGFGLINALFAIPGMLTIDKFGRRPLLLVTFPIMSILLLFTGFCF
                     WIPDREARVGCIALGIYLYCMAYSPGEGPVPFTYSAEVYPLYIREVGMSLATATTWLF
                     NFIVSLTFPKLLTAFTPQGAFGWYAAWCALLFVLILFFLPESKGYTLEELDQVFSVPT
                     GVHAKYQLWNIKWHFNHYILRSKEPFKPLYQFEDDDEPASVRHEKHDGQAEHVA"
     gene            1173722..1174567
                     /locus_tag="CNB03990"
                     /pseudo
                     /db_xref="GeneID:3256080"
     gene            complement(1176661..1180688)
                     /locus_tag="CNB04010"
                     /db_xref="GeneID:3255556"
     mRNA            complement(join(1176661..1178263,1178322..1179839,
                     1179890..1180688))
                     /locus_tag="CNB04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656589.1"
                     /db_xref="GeneID:3255556"
     gene            1176744..1179609
                     /locus_tag="CNB04000"
                     /pseudo
                     /db_xref="GeneID:3255606"
     CDS             complement(join(1177227..1178263,1178322..1178928))
                     /locus_tag="CNB04010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512321.1"
                     /db_xref="GeneID:3255556"
                     /translation="MTSLQSQVSDTKHPKYRPSSRASIPSNTPKLSKRLSFPITPSSS
                     NAHINEDEKHEHAKYLRAPHLNRTVIIPRNPPESPLRVSYAEVGHPKGHPVLFFLGLG
                     CVRYLIALFDDIARAFNLRLICIDRWGLGKTDQVPQDQRDVKEWAKIVRKVLDGMGVD
                     KVQVVAHSAGAPYALASVMEMNERVRGKVHLLAPWVNADIDRGYRWLRWVPGGVIKSA
                     TAAEWKLQSYLLGKPPPLTYKPMEHDAHAPIYHTRTPSRNSKRAYTPVHESDEGSISK
                     GKVGRVTSIKGASLVRKVSKVFGPRSMDILPGQDVSIRHRRSKDTRPLKNLSTHSENI
                     VTTSPIGTKPARASPLPGSSQPSPLPDEANDFDFGFDDKVGFGLGEGFDAMSMCMPPP
                     PSIKFRSSYSSFRPTASLSPTPSEPDQPKAPTGSSFMLVLMQASHAECEPGTTSDLLS
                     IILNKNNVSTQNIVDYTQITHPLKVWWGKEDDRISERSMRWLERCMNDVELKTVENEG
                     HGLLSSVRVMWEVFESLGGEARKWGRVSGQEAFGIDNVS"
     gene            1180968..1183198
                     /locus_tag="CNB04020"
                     /db_xref="GeneID:3255674"
     mRNA            join(1180968..1181523,1181582..1182044,1182100..1182173,
                     1182223..1182314,1182376..1182736,1182801..1183198)
                     /locus_tag="CNB04020"
                     /product="membrane protein, putative"
                     /transcript_id="XM_569225.2"
                     /db_xref="GeneID:3255674"
     CDS             join(1181218..1181523,1181582..1182044,1182100..1182173,
                     1182223..1182314,1182376..1182736,1182801..1183085)
                     /locus_tag="CNB04020"
                     /codon_start=1
                     /product="membrane protein, putative"
                     /protein_id="XP_569225.1"
                     /db_xref="GeneID:3255674"
                     /translation="MSANTTETLPSTPRKELSTDVTPSILSEYPSTTAGLGEPKHSRL
                     TAFLPRGSLRCEFDHQHIRKFDFGFLPIPPGRRHDPSKKVSEEFVFTWKLNLLFAFAA
                     TVSVMNLYYIQPMLVAVADSFDVSHDVVSRIPILAQGGYGCGILFISPLGDLVRRRQL
                     VLILMFFTTCLSIGLALSKNVNMLSGLSFVVGFFTITPQIVIPWTADLAPLKRRATAM
                     SVTLSGLIVGLVVGRTLAGIISLAGWRYSYWMAVGLQGSMLIILWLCLPDTPDKKIGL
                     TYPQVLWSMAKMYTKYPTLAQACFQAYTTSAVFAGFWTTLTFLLSDSPYHYSTLQIGL
                     FGLLGLIAALLSPLWGYLIDQVHPYLAQLVGIWVCLISMIIGLTAAKVNVSAVCIAIA
                     FYDVGQQLNQLGNGYRVAGIDPNARARLNGCNLLALFAGQTSGTAIMTKIYNSHGWYP
                     TAGTAVAFLGVGMLALLLRGPHETGWIGWSGGWKVLKKEKMSDTSANAITEKFKSKKK
                     KEQSVKPVEWPIEGEKNV"
     gene            complement(1182205..1184576)
                     /locus_tag="CNB04025"
                     /db_xref="GeneID:36392749"
     mRNA            complement(join(1182205..1183272,1183362..1183443,
                     1183504..1183886,1183944..1184255,1184308..1184576))
                     /locus_tag="CNB04025"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658743.1"
                     /db_xref="GeneID:36392749"
     CDS             complement(join(1183180..1183272,1183362..1183443,
                     1183504..1183886,1183944..1184255,1184308..1184406))
                     /locus_tag="CNB04025"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514232.1"
                     /db_xref="GeneID:36392749"
                     /translation="MTTPSPESKSEMMFLGQECNHPACYLHDFLPFNCPACHLAFCQP
                     HFLPSQHSCKAPLPASMVDRIAPTCPMCNEIVPYPKSMDPNEAVERHILSGTCVGLQG
                     GEERKKAEAKRRRDAGEVCWKKSCGKVLVVKMKCESCQHVYCPTHRRPTTHTCSNQTP
                     SPSSSSSRLGTPQTQATSRPAGKAALSRLLPPSMQPPASTGASRPVPPVKANSSNPNS
                     SASKPLAASSEGNLGSNLDAKAAAAAAALKRAGQDVKVPFVKSSAEKRTQAETNSQIQ
                     ALKARHEKGLLTKTEQVKYAELVGQQEATRRTGGKSKNKDKDCVIA"
     gene            complement(1184695..1188494)
                     /locus_tag="CNB04030"
                     /db_xref="GeneID:3255798"
     mRNA            complement(join(1184695..1185057,1185109..1185327,
                     1185381..1185726,1185781..1185925,1185979..1185987,
                     1186059..1186447,1186498..1187263,1187324..1187422,
                     1187480..1187583,1187644..1187750,1187819..1187843,
                     1187913..1188372,1188470..1188494))
                     /locus_tag="CNB04030"
                     /product="prib protein, putative"
                     /transcript_id="XM_024658754.1"
                     /db_xref="GeneID:3255798"
     mRNA            complement(join(1184695..1185057,1185109..1185327,
                     1185381..1185726,1185781..1185925,1185979..1185987,
                     1186059..1186447,1186498..1187263,1187324..1187583,
                     1187644..1187750,1187819..1187843,1187913..1188372,
                     1188470..1188494))
                     /locus_tag="CNB04030"
                     /product="prib protein, putative"
                     /transcript_id="XM_024656590.1"
                     /db_xref="GeneID:3255798"
     CDS             complement(join(1184902..1185057,1185109..1185327,
                     1185381..1185726,1185781..1185925,1185979..1185987,
                     1186059..1186447,1186498..1187263,1187324..1187422,
                     1187480..1187583,1187644..1187750,1187819..1187843,
                     1187913..1187995))
                     /locus_tag="CNB04030"
                     /codon_start=1
                     /product="prib protein, putative"
                     /protein_id="XP_024514233.1"
                     /db_xref="GeneID:3255798"
                     /translation="MPPHPSNNGTPSKHSHVRTELIKRPREACLNCRSLKTRCLPYGD
                     RPLTSKDTCARCTKYGLDCEYIRKPRGKSKTDDPNNLQPEESGASKSRNGPVEGSRNQ
                     GRNNNDRLRNQDYMPFQPSYDNTPGNHMAPMPGMQRPEPWGSTTPNSAIPHGTSFTDS
                     FARAIPPALQPQPYQRPPSHSLPSYPTPSTAYTSHMPPPDHRHTPQHYSQHSSTQLPP
                     PLLMHSSSMQSDRNILPMPGNLSTPDANDISYRPHRQVPSPNQMVRLPPMDVGPPQSQ
                     LQHHSLPAINSRNSQCSTPSYDSSDRRRQAQPSTVLTDYIEPQLDHEQTHSPSPPSHD
                     PTRTGAKGPLIQQPMPRSSIRSAHGVDGTIQDTKAGGRLSSLSPLELGLVDEQEARWL
                     YSRFKQHLGPIISLLDFEYHTYERVKLSDSLFTAMLYASSRFFHPEICRPLYNHANTI
                     VNRMITHGTVDLPSVQALIILSFWNVQNDESAYMKSGIAVRAACQLRLWKRHDRPLPQ
                     DEEEVRAILDRERTWIAVIIMDTGFSVIFEQPITLPQPGRGFDDIYEWANEHAHLNIP
                     GDYYLAWSAEDSKNKLPYSNTVQNPNYDNTVAATERRHIDNLNKALPRLSLLYSQMAT
                     IVTDIVLLRNQSEGLKFGHIDMIKNRLISLSEKIAESLNRFAAEGHLIFWSDMFSAGV
                     SMPGVIFYKTRSLFSPTELDRVLAILNNLLNMCSTMLGTHNDHPLYFTYRFYRRLLPV
                     LERVRQGVDSQQPPVVDVEYPYPVALLNDIHTFQNGNLSNANQQLAAPANNSAEADEL
                     WNFILGADSGMGQIFTA"
     CDS             complement(join(1184902..1185057,1185109..1185327,
                     1185381..1185726,1185781..1185925,1185979..1185987,
                     1186059..1186447,1186498..1187263,1187324..1187583,
                     1187644..1187750,1187819..1187843,1187913..1187995))
                     /locus_tag="CNB04030"
                     /codon_start=1
                     /product="prib protein, putative"
                     /protein_id="XP_024512293.1"
                     /db_xref="GeneID:3255798"
                     /translation="MPPHPSNNGTPSKHSHVRTELIKRPREACLNCRSLKTRCLPYGD
                     RPLTSKDTCARCTKYGLDCEYIRKPRGKSKTDDPNNLQPEESGASKSRNGPVEGSRNQ
                     GRNNSNFSEALSNPLPSVLTPLKDDRLRNQDYMPFQPSYDNTPGNHMAPMPGMQRPEP
                     WGSTTPNSAIPHGTSFTDSFARAIPPALQPQPYQRPPSHSLPSYPTPSTAYTSHMPPP
                     DHRHTPQHYSQHSSTQLPPPLLMHSSSMQSDRNILPMPGNLSTPDANDISYRPHRQVP
                     SPNQMVRLPPMDVGPPQSQLQHHSLPAINSRNSQCSTPSYDSSDRRRQAQPSTVLTDY
                     IEPQLDHEQTHSPSPPSHDPTRTGAKGPLIQQPMPRSSIRSAHGVDGTIQDTKAGGRL
                     SSLSPLELGLVDEQEARWLYSRFKQHLGPIISLLDFEYHTYERVKLSDSLFTAMLYAS
                     SRFFHPEICRPLYNHANTIVNRMITHGTVDLPSVQALIILSFWNVQNDESAYMKSGIA
                     VRAACQLRLWKRHDRPLPQDEEEVRAILDRERTWIAVIIMDTGFSVIFEQPITLPQPG
                     RGFDDIYEWANEHAHLNIPGDYYLAWSAEDSKNKLPYSNTVQNPNYDNTVAATERRHI
                     DNLNKALPRLSLLYSQMATIVTDIVLLRNQSEGLKFGHIDMIKNRLISLSEKIAESLN
                     RFAAEGHLIFWSDMFSAGVSMPGVIFYKTRSLFSPTELDRVLAILNNLLNMCSTMLGT
                     HNDHPLYFTYRFYRRLLPVLERVRQGVDSQQPPVVDVEYPYPVALLNDIHTFQNGNLS
                     NANQQLAAPANNSAEADELWNFILGADSGMGQIFTA"
     gene            1189468..1191613
                     /locus_tag="CNB04040"
                     /db_xref="GeneID:3255633"
     mRNA            join(1189468..1189626,1189696..1189735,1189785..1189810,
                     1189886..1191613)
                     /locus_tag="CNB04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_569227.2"
                     /db_xref="GeneID:3255633"
     CDS             join(1189540..1189626,1189696..1189735,1189785..1189810,
                     1189886..1191520)
                     /locus_tag="CNB04040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569227.1"
                     /db_xref="GeneID:3255633"
                     /translation="MESLLRPFPTPLTGKQWFYLLFLQGVGAGIIDGGANFGIAYAMY
                     HNQKEIKMWVLAKNTIAGDLGVTPIIQCLASMLITSTLVHTDLHHHAVAPLPYVWPHV
                     EHLPDPRILLDKIFGRRGGAREETEDEKGDINYPSSRSGIEGHKGWLYYPHMLVRFTF
                     EGTEANILFSPFKAKLFLFKAVITAAQGALLGIFCGLPLWCLFIVVLGPIYKHDNMAE
                     TGWKWAPMVIKCVYGAVLGWITNPIIAGLALGSQATRHLLVIEHDEESVAENASQIVD
                     VDGVPTIVEEDELTAPQFPPSPHASPSHSPRLSPHPSPMSGSLHLPTPNINRPRTRSR
                     ASSNLSRPPLTANCSDMPIIPSRSLHAPQYSDGEALAVPKSAPLVQAGRVRSSSQVTA
                     GGAGAGAGTPSRTALPVLGTPLTGPRETLAPPSPLPYHTVMTPFGPRRRGLTVSTAYT
                     ASSSVNGNNIGGGTAATSTGGAPGTGGSAWSYALGGMGGRNQRRPRAISSLSGKGGGS
                     GKEKIPGELWSKSAVPMGTSSRTPAVTTTATGEEEEVLAAEHADRSGELREGKKTPVW
                     DVFGVVQKAEREAHAGNKSSEKKEGEAQS"
     STS             1191222..1191397
                     /locus_tag="CNB04040"
                     /standard_name="ACG20"
                     /db_xref="UniSTS:470817"
     gene            complement(1191642..1193759)
                     /locus_tag="CNB04050"
                     /db_xref="GeneID:3255681"
     mRNA            complement(join(1191642..1192109,1192170..1192259,
                     1192312..1192528,1192585..1192873,1192965..1193662,
                     1193709..1193759))
                     /locus_tag="CNB04050"
                     /product="glucose-6-phosphate isomerase, putative"
                     /transcript_id="XM_569228.1"
                     /db_xref="GeneID:3255681"
     CDS             complement(join(1191755..1192109,1192170..1192259,
                     1192312..1192528,1192585..1192873,1192965..1193662,
                     1193709..1193730))
                     /locus_tag="CNB04050"
                     /codon_start=1
                     /product="glucose-6-phosphate isomerase, putative"
                     /protein_id="XP_569228.1"
                     /db_xref="GeneID:3255681"
                     /translation="MDGKPATQYQAWKKLQSLHGSKADKLVLKDLFKADPKRFSNLSK
                     TFSSSSPNVSLLLDYSKNLVDDEVLSTLFDLAREAKVETFRDEMFAGKHINTSEDRSV
                     LHIALRNPPADKGGFKISEAGVDEVHAVLAHMKEFSDSVRSGAWKGYTGKAIDTIVNI
                     GIGGSDLGPVMVCEALKHYSKRDLKTHFVSNIDGTDMAEVLKACNRETTLFIVASKTF
                     TTQETITNAESAKEWFLEQAKEKAHVAKHFVALSTNTKGVTEFGIAESNMFQFWDWVG
                     GRYSLWSAIGLSICLSIGFDNFQELLNGAHEMDKHFKTAKLEDNLPVILALVGIWYND
                     FYGAQTQALLPYDQYLKKFADYFQQGDMESNGKSVTKDGSRVDYETGPIIWGQSGTNG
                     QHAFYQLIHQGTKLIPCDFLAPVETLNPISGGKHHEILLSNFFAQPEALAFGKTEEEV
                     IKELGPEQSKNSALVKSKIFEGNKPTNSIMFQKLTPGTLGALIALYEHKIHVQGAIWG
                     INSYDQMGVELGKVLAKAILKQLGSENDVQGHDSSTTGLIHFYQKNRK"
     gene            1194014..1197759
                     /locus_tag="CNB04060"
                     /db_xref="GeneID:3255817"
     mRNA            join(1194014..1194303,1194346..1194702,1194753..1195372,
                     1195442..1196118,1196175..1196477,1196539..1197340,
                     1197516..1197759)
                     /locus_tag="CNB04060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656591.1"
                     /db_xref="GeneID:3255817"
     CDS             join(1194070..1194303,1194346..1194702,1194753..1195372,
                     1195442..1196118,1196175..1196477,1196539..1196825)
                     /locus_tag="CNB04060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512294.1"
                     /db_xref="GeneID:3255817"
                     /translation="MFSSSQPTQSLSRHSQPSANNDISMDAERQGQTPVQTLYLKPEA
                     YPRGGKEKWKATGRTISAAAGPVGGELAVWVTKRPSDDPNKPAKLTNADPTVSDEAII
                     FASINSLPQPLIQLYTESHLLFTSLQQIVADSGRRRLSSVGFGVNGGAESWDTKGNFG
                     VEGLLGPPDAETVINMRRLADFYVDQLGDLKALPDIDAGLRDRFIDAYNIFNIAEILY
                     LPIDGKGEGLVGEELLDWVNEIDVAPDNQLGNEIMSTLHSWDHPSFWPYISRSILRGF
                     HLPAASFLRSLSSHPYAPISKLAVLLAQHLTILPRSSETKWRIDMDFLQAHKQWLAKF
                     KSELATQLGGKGEGKWFEGEWVNWEGDFRCVVELMEGKMERVLEEAGDWREALGAWGI
                     LVDVDMRRDHLPEVMSIITERIPVDKSLPDHVVQSALCSADIIKALMSCYSLDTWLSA
                     HLADLLDKLSLIPDDEEHFEISLRDFFLLEYAQVLQDNPNYKAFWRVICDYLGYAGEE
                     GRGRLKEHLKRLDIPLDRDVKGKSKESPDSTNDEQQGLDASMDIENPTESQGEAIKLL
                     DEVRSACVDFRLDDVWQEISQVLATRLISAGQYGMAATLALMARDGFALSKIADKVLE
                     SFITHGQDEYLALVDTLPPTLLAEAPTALLHLQQSTSNPTEFPSHSAVSVFASRITFL
                     SEFRDYLLFLSQDARDRAAEKVISLLTSGIAPVGFWAVLLVESIALLEDSEILFSSNE
                     TFELLRVLEEVYANAAFAEEEYLGQLVQYLQRTLNTPAAEEEGHIIKKNEKKVTVKDA
                     KRRMEEVRLAISRNLARAMVAGFDSPF"
     gene            complement(1196865..1201195)
                     /locus_tag="CNB04070"
                     /db_xref="GeneID:3255609"
     mRNA            complement(join(1196865..1199840,1199894..1200093,
                     1200153..1200350,1200397..1200514,1200565..1201195))
                     /locus_tag="CNB04070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569231.1"
                     /db_xref="GeneID:3255609"
     CDS             complement(join(1197026..1199840,1199894..1200093,
                     1200153..1200350,1200397..1200514,1200565..1201079))
                     /locus_tag="CNB04070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569231.1"
                     /db_xref="GeneID:3255609"
                     /translation="MSRAPSPSIPASQSVLPLCESTSTTPTPTPARPGLRIDVDSLPS
                     FPVSASDKHDVAMAVRNLRSASPPPPPPKSASRLRANTSPPDSGGVALAPAPGIDGSG
                     QAGVGSSASASTLVFNEEERTLRMIKQALEKSDDDGDTLDLSRKDIDRIGEEAVEMFR
                     SGVGKGQKGVWRLALSYNFLRDDSMVDSFSKLSRLRYLNLKGNKFTRFPHAITQMPAL
                     EILDFSKNELSSLPEQPGHLVKLKVLSLTSNKIHTLPNYLVEFGVLKVFKVDQNPVDW
                     PPAHVLGPLIESVPTKSKTSSTPGGKKKAKEEDLRPWIESMKVWMAQQTPGSENAPRR
                     GEEEAYLASEEEPSSATSIENPGATEWPEVSESSSTVAPSSQATIRRTQPLYGDTPDL
                     VFAQRNISTTFSEDSLLRSSSPSHFSPANHSRDASVSSFTSPPSASTDASFHSHSRNP
                     STNFPHLASQPVQGHTRGASYTPAQRNSGQLTAKKSLPDLRQSHAKIIRERRGDADEE
                     VVTMVAAPDIDPREIGVRSPPRLASALRPKRASRVMGRKTSVDLLPRKMGEMTSHDMA
                     DRNVSHDSILDESRNSYFRRLSTLPASSISKAIPPFLLKFIDSIRGILFALSQLHSSL
                     RQYLVFAVNERVSSVFGRVMEPAGMYINKLINALDRFDSMSRRGTPPTQAIQNLFDAT
                     KESVAVFGKVAAVLKMQVPAMRGNDVRYTRTLMVHVYGAMAEVASSWKAMTGLLPEVK
                     MLLLIDAPGVVGGMGGQKIVPSGSFTGRTPISPIIERRESHSPQSSTLESSPLNLERQ
                     QQQQQAEIDGSPTAHAERRAGVRGHGVGTERRHAGSYSSLDVERGMMMGSPLAKGMSI
                     GVREDEGHRRGESGTIHLPTPDEEDEEDEEEYSSMRHMLGPVSPQSVSGRTSQQRHRP
                     TSSSGSSHALCLPPSLPHHPSRQLSVDVRAPASAAATLFDEDLLDVIETATEAAFACW
                     LKLSEEIGALSPQISRSTHRNNSSVSSVSSQSQGHLDSARMALPFFTPLGAHSRRPST
                     ISPKYHAELVHNLSVAEQITAALRESLLRLRADPLAYSHTTLPDDAQSFIKIVVKVSE
                     LVKAMSGTHPFPISVRQAVGKLTQATRECAILIQVSSLRPGQGTPAPTAPVSSGRSVM
                     PISRVGSATGIGTGYSSSHHGPESSTDDLSHLQPPSSAGPSHVSTPLYTPSSSTTSFE
                     HFHHISSSTGVTTNASGLRDLHLPSRLGHAPFGRNRSANGSAQMALPSIQMPVPYVNG
                     GAVGKANQPRSAQASQVAF"
     gene            complement(1201274..1202287)
                     /locus_tag="CNB04080"
                     /db_xref="GeneID:3255789"
     mRNA            complement(join(1201274..1201786,1201841..1202287))
                     /locus_tag="CNB04080"
                     /product="carbon utilization by utilization of organic
                     compounds-related protein, putative"
                     /transcript_id="XM_569232.2"
                     /db_xref="GeneID:3255789"
     CDS             complement(join(1201702..1201786,1201841..1202250))
                     /locus_tag="CNB04080"
                     /codon_start=1
                     /product="carbon utilization by utilization of organic
                     compounds-related protein, putative"
                     /protein_id="XP_569232.1"
                     /db_xref="GeneID:3255789"
                     /translation="MRPTLLRLANASGPLPLSVSQASVQLIPPIPLYRRLLRAHRLLP
                     VDMRYMGDSYVKSEFRLTRTTDNPLHIIGFLSQWKMYLDEIESSLIRPDGRKQGQAVE
                     WRGKKLDTGAFEKLSTEQVGQLYELMHATKDVWKSPEQIEREANSAGVSPVNPNDPTT
                     AGNS"
     gene            1202466..1204543
                     /locus_tag="CNB04090"
                     /db_xref="GeneID:3255582"
     mRNA            join(1202466..1202541,1202767..1202958,1203015..1203080,
                     1203147..1203287,1203354..1203694,1203749..1203941,
                     1204010..1204543)
                     /locus_tag="CNB04090"
                     /product="isocitrate dehydrogenase (NADP+), putative"
                     /transcript_id="XM_569233.2"
                     /db_xref="GeneID:3255582"
     CDS             join(1202539..1202541,1202767..1202958,1203015..1203080,
                     1203147..1203287,1203354..1203694,1203749..1203941,
                     1204010..1204423)
                     /locus_tag="CNB04090"
                     /codon_start=1
                     /product="isocitrate dehydrogenase (NADP+), putative"
                     /protein_id="XP_569233.1"
                     /db_xref="GeneID:3255582"
                     /translation="MLARSTTAFTRSSLLRSTRPLAFAMASRNYASTPAGIDRIKVKN
                     PVVEIDGDEMTRIIWKKIREELILPYVDVDLKYYDLGMESRDATNDQITIDSAEAIKK
                     YSVGVKCATITPDEARVKEFKLKEMWRSPNGTIRNILGGTVFREPIILDKIPKPVPGW
                     TKPICIGRHAFGDQYRSTDFIAPGPGKLTLTYTPAEGGAPTELNVYDFKGKGVALAMY
                     NTDESIYGFAHASFKMALSKKMPLFMSTKNTILKKYDGRFKDIFQEVYESTYKAEFEK
                     LGVYYEHRLIDDMVAQAIKSSGGFVWACKNYDGDVMSDILAQGFGSLGMMTSELITPD
                     GKTMESEAAHGTVTRHYRQYQAGHETSTNPVASIFAWTRGLAFRAKLDETPALEAFAK
                     DLEAACVEVIDKDGIMTKDLALAMKGKDMTRDDWVTTDVYMKKVNERLVEKLKARSA"
     mRNA            join(1202733..1202958,1203015..1203080,1203147..1203287,
                     1203354..1203694,1203749..1203941,1204010..1204543)
                     /locus_tag="CNB04090"
                     /product="isocitrate dehydrogenase (NADP+), putative"
                     /transcript_id="XM_569234.1"
                     /db_xref="GeneID:3255582"
     CDS             join(1202755..1202958,1203015..1203080,1203147..1203287,
                     1203354..1203694,1203749..1203941,1204010..1204423)
                     /locus_tag="CNB04090"
                     /codon_start=1
                     /product="isocitrate dehydrogenase (NADP+), putative"
                     /protein_id="XP_569234.1"
                     /db_xref="GeneID:3255582"
                     /translation="MFPQLARSTTAFTRSSLLRSTRPLAFAMASRNYASTPAGIDRIK
                     VKNPVVEIDGDEMTRIIWKKIREELILPYVDVDLKYYDLGMESRDATNDQITIDSAEA
                     IKKYSVGVKCATITPDEARVKEFKLKEMWRSPNGTIRNILGGTVFREPIILDKIPKPV
                     PGWTKPICIGRHAFGDQYRSTDFIAPGPGKLTLTYTPAEGGAPTELNVYDFKGKGVAL
                     AMYNTDESIYGFAHASFKMALSKKMPLFMSTKNTILKKYDGRFKDIFQEVYESTYKAE
                     FEKLGVYYEHRLIDDMVAQAIKSSGGFVWACKNYDGDVMSDILAQGFGSLGMMTSELI
                     TPDGKTMESEAAHGTVTRHYRQYQAGHETSTNPVASIFAWTRGLAFRAKLDETPALEA
                     FAKDLEAACVEVIDKDGIMTKDLALAMKGKDMTRDDWVTTDVYMKKVNERLVEKLKAR
                     SA"
     gene            1204723..1207192
                     /locus_tag="CNB04100"
                     /db_xref="GeneID:3255650"
     mRNA            join(1204723..1204904,1204966..1205238,1205295..1205634,
                     1205691..1206472,1206524..1207192)
                     /locus_tag="CNB04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_569235.2"
                     /db_xref="GeneID:3255650"
     CDS             join(1204752..1204904,1204966..1205238,1205295..1205634,
                     1205691..1206472,1206524..1207153)
                     /locus_tag="CNB04100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569235.1"
                     /db_xref="GeneID:3255650"
                     /translation="MALISSPTSLTTFSQPHASSSKNPHVRLNPVVGDKKSAVVAVQG
                     DGVWTYDLTTLRATTSFTVPPSTVFTSSPVSFWTTKTVSAPQANDQGGEDEGMDVDQY
                     EGLDGPKETQIEIKERVTAVGAGKEVWLWKGEEGEKEVIRIKSQISAIHHLPSPATPL
                     LLISSSSQFYLLDSKLQSHSISTASLKSSELLASRVILQETKQSVRVIVVDRTGRIEV
                     TKIWIEDRRLERILEGKVGNGKLVAGDVSDDGVITVLDEQHNLYTTSARTLSTPSSPV
                     RLLHPSSAPLLLSLPSPTLPLVLLPTPHPSPSLLLAIPASNLPTILTTTPLSSFTSSG
                     TISALSILSVRSGVYTIGVVLSHKHSEGEGSSGRSVLYTCEVALPERGVGMGSLLGSK
                     ARTGEYLEVEGTEKKQGKTELEKKQDKVLEGLEKALKSKDVTGAQKTWRDWVAKESDT
                     AEGVFSDRFVRKVVRAVFGAALNEDSKPKGVYAGEILKDLVSRRVVSDGMWKEGVVVD
                     GLLPLGDWENITLALQNIPTIPSSTIIILLQKSAQSSNASSVPSLTALLQIILALPPP
                     GPSYRLDLYKTLSVEDAAAMLKVLVQWMEDYVETLSEGLKGWDESVSQEKEDNLPSLQ
                     SLVTHTSLILDAHLPSFISHSASHDILSRAQASLEPLLAVQNEYRQLRGPVEALLTLA
                     RREAKKAEERAAKKGGKKKGKKDENGRLPEEVVGKWKVEDLAF"
     STS             1205131..1205937
                     /locus_tag="CNB04100"
                     /standard_name="Hind5"
                     /db_xref="UniSTS:470816"
     gene            1207459..1208896
                     /locus_tag="CNB04110"
                     /db_xref="GeneID:3255828"
     mRNA            join(1207459..1207995,1208050..1208295,1208344..1208418,
                     1208475..1208896)
                     /locus_tag="CNB04110"
                     /product="CIP1 protein, putative"
                     /transcript_id="XM_569236.2"
                     /db_xref="GeneID:3255828"
     CDS             join(1207763..1207995,1208050..1208295,1208344..1208418,
                     1208475..1208811)
                     /locus_tag="CNB04110"
                     /codon_start=1
                     /product="CIP1 protein, putative"
                     /protein_id="XP_569236.1"
                     /db_xref="GeneID:3255828"
                     /translation="MSPTVALLGHNGTVGDNLLPYLVEAHKKGSIKLVILHRPSTELS
                     KIPSDVGIEKRIVELEDGKIDSIKAAVKDLEVVISAIAAPSAPSQIYLAEALASSTAL
                     KTFIPSDFGCVWTEEEISIPGLSFLKIKEDVAHRIKQLKVPVTEIKVGLFDQFFFGYK
                     AAGTDVKGNQVQYYHDSLKNRLPITSLSYLGYSVAQIVSDPSLLAKLPNSTLNVFNFA
                     PTGQEIVDILTQLHGQPTKTVQVSEKTVAEQLEGPIAIGAAITKKWGDNNFGNVPKTE
                     ISGWAGKSFAETVKEWVNKA"
     gene            1209244..1212661
                     /locus_tag="CNB04120"
                     /db_xref="GeneID:3255755"
     mRNA            join(1209244..1209441,1209496..1209708,1209763..1210153,
                     1210203..1211691,1211737..1212357,1212412..1212661)
                     /locus_tag="CNB04120"
                     /product="endonuclease, putative"
                     /transcript_id="XM_024656592.1"
                     /db_xref="GeneID:3255755"
     CDS             join(1209390..1209441,1209496..1209708,1209763..1210153,
                     1210203..1211691,1211737..1212357,1212412..1212435)
                     /locus_tag="CNB04120"
                     /codon_start=1
                     /product="endonuclease, putative"
                     /protein_id="XP_024512295.1"
                     /db_xref="GeneID:3255755"
                     /translation="MPSRKKCGNPLFLQWMEEIRDAAREKGSKSAETYSKACRSLEFC
                     PVTYDRPRDLAILAHIGEKTIAQLENRWIEYRKSHGLDVPAEPEKLSTAEPKTKDKGK
                     GCAAPDVDGPMSGTSQETTKKTRKTTAKAYIPTQGSGAYAILLALILAIDRPEVTTQV
                     FLTKSEIIRTAQEYCDTSFEHSEKGTYFTAWSGMKTLVNKGYVYVTGNPHKHCLTEEG
                     YDVALAIRNLRPEFSHMKKHPFSHAPAPGTSNRVTELPRNRAITALDLYNGPSIVPST
                     LSTEYVPPANAHSSPASRLASFDAVASKLTAGERFNFWYITPSGSRTPLMTSAHLRLD
                     PEQFVNLRRIEFKYSQRNHPFAAQLRLMDAPTTAKLRDKSGVPTLYAYLIEADAPPKC
                     SMFDTESSQSRAKASGKDNASNAGSSPLGSSPAPISRSRSGLGGRNDSCASLSDGGSR
                     LSASAGKPTDPFYFDVRTLALQKNPSMPSNSASTSQSVSRSTSSSRPLSNSGPSPYQN
                     PYDAILGQNPSSPPVSTLSRTITAPASTSSQPRTSSLSTLNIGSSSTVPSISNRSYSS
                     AAVLPSRPVVPRMGPRLSNHVPSPIPAPERFDDTIIPPPDLHSKSLPPFTISNAIVFP
                     PGSYDIILIIDTREVESSKTKNRDKIAETLEAKGIRVETRALRLGDMCWVARRKDGLG
                     GEEDECVLDYVVERKRLDDLVNSIKDGRYTEQCFRLSNACLSNVYYIVEDWQVSERME
                     QSGLAIMTVKSQVQVHNRFFLKETHTLNETIDFLATMTRVIISSHRTKALHVIPTHFL
                     SRPSFKPLQDHLQLKHPNIKFHTSFIAYQELNDKSASQTLKEKFAKMMMCVKGMSAEK
                     VSALLDEWETPRVMWEDMKERDRQPDDSEPPGQPRGKKRKGGKGSFFAERVQGEARRK
                     IGDALSESLWTALMG"
     gene            1212846..1214176
                     /locus_tag="CNB04130"
                     /db_xref="GeneID:3256004"
     mRNA            join(1212846..1213432,1213483..1213758,1213809..1214176)
                     /locus_tag="CNB04130"
                     /product="nitrilase-like protein, putative"
                     /transcript_id="XM_569238.2"
                     /db_xref="GeneID:3256004"
     CDS             join(1212962..1213432,1213483..1213758,1213809..1214132)
                     /locus_tag="CNB04130"
                     /codon_start=1
                     /product="nitrilase-like protein, putative"
                     /protein_id="XP_569238.1"
                     /db_xref="GeneID:3256004"
                     /translation="MLLSLRSSLSRNIIGQSRHLPTISFSVTSSRIRNMSSQAATSSA
                     TVAVCQLRSTSDPVHNLKISEKVIRNAVAAGAKACFLPEASDFINPSKTESRKFSHPL
                     PKHEYTIGLQRLAKELGIVISVGVHEGPEDESEERVYNTHVLIGKDGGILASYRKIHL
                     FDVELSKPPAPDGTPRPPQRTGESERILAGQAVTPPVEVEGIGNIGLEICYDIRFPEL
                     SIILTRLGAEVLLFPSAFTVKTGRDHWGTLCRATAIQYQSYLIASAQYGAHNSKRTSW
                     GETLAFDPWGRQLGRLRSVDDTPPPKEGEEGDKGVEKLYEDSGEFFLCEIDGTKVKET
                     RGQIPLAIQKRSDIYGVVGEGA"
     gene            complement(1214148..1215108)
                     /locus_tag="CNB04140"
                     /db_xref="GeneID:3255841"
     mRNA            complement(join(1214148..1214365,1214416..1214526,
                     1214580..1214640,1214704..1214816,1214871..1214955,
                     1215004..1215108))
                     /locus_tag="CNB04140"
                     /product="peptidase, putative"
                     /transcript_id="XM_024656593.1"
                     /db_xref="GeneID:3255841"
     CDS             complement(join(1214237..1214365,1214416..1214526,
                     1214580..1214640,1214704..1214816,1214871..1214955,
                     1215004..1215053))
                     /locus_tag="CNB04140"
                     /codon_start=1
                     /product="peptidase, putative"
                     /protein_id="XP_024512217.1"
                     /db_xref="GeneID:3255841"
                     /translation="MASARYFFKHQALRDAARILAWVPVGVFFTRHVYSLATVTGGSM
                     QPTFNPDLATNPLHNDVVLLERWSPAMNKYKRGDVVTLWSPQNPQLLTTKRIVALEGD
                     LVHPLPPSPPTPVRIPPGHCWVEGDSKYQTRDSNTYGPIPLGLITARVSHIIWPWARA
                     GEVHSGQGKSKGRVKKLADSFI"
     gene            1215255..1217057
                     /locus_tag="CNB04150"
                     /db_xref="GeneID:3255700"
     mRNA            join(1215255..1215373,1215464..1215516,1215566..1215567,
                     1215620..1215677,1215729..1215854,1215908..1215999,
                     1216051..1216288,1216338..1216752,1216809..1217057)
                     /locus_tag="CNB04150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656594.1"
                     /db_xref="GeneID:3255700"
     CDS             join(1215309..1215373,1215464..1215516,1215566..1215567,
                     1215620..1215677,1215729..1215854,1215908..1215999,
                     1216051..1216288,1216338..1216752,1216809..1217013)
                     /locus_tag="CNB04150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512296.1"
                     /db_xref="GeneID:3255700"
                     /translation="MTKCAGCNDKEASRLECPTCKKLGIKGSFFCDQDCFKKNWGTHK
                     TIHSLVQMAAQVESGKNSSLPPSMRNYRFTGPLRPVYPLSPKRLVPAHIERPDYADHP
                     QGMSACEAVRERTVKSLNKEEIEGMRKVCRLAREVLDLVASHIKPGVTTDELDAICHQ
                     ACIDRNSYPSPLNYVKFPKSICTSVNEVICHGIPDQRPLQEGDIINLDVTLYHGGFHG
                     DLNATYPVGKVDQESQDLMDTTKKAMDEAIALCKPGVPYREIGNKIEEIIKPKGFGIV
                     RRYTGHGIHHLFHCLPTIVHYGGSKTPGRMEAGQVFTIEPMVNLGTSNLEHWNDDWTA
                     VTSDGRRSAQFEETILITETGVEILTRPPTSSQNKKKKKKKNNGGADAGTATPTENGN
                     GTSGAATPTTEVARGVENLEVEASS"
     gene            complement(1217049..1217701)
                     /locus_tag="CNB04160"
                     /db_xref="GeneID:3255676"
     mRNA            complement(join(1217049..1217158,1217233..1217360,
                     1217440..1217701))
                     /locus_tag="CNB04160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569240.2"
                     /db_xref="GeneID:3255676"
     CDS             complement(join(1217138..1217158,1217233..1217360,
                     1217440..1217647))
                     /locus_tag="CNB04160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569240.1"
                     /db_xref="GeneID:3255676"
                     /translation="MFRTLLAARPLRSIAPAPSTFVRTQSFAALRLYSTPPAASPPLD
                     NGEEAIYKKLKERFPGSRLEVQDVSGGCGSFYAILISSPAFKGLTTVKQHKLVNECLK
                     EDIKGIHGLQLKTIPE"
     gene            1217839..1220726
                     /locus_tag="CNB04170"
                     /db_xref="GeneID:3255691"
     mRNA            join(1217839..1218014,1218074..1218199,1218287..1218349,
                     1218402..1218478,1218528..1218679,1218733..1218804,
                     1218861..1219007,1219060..1219274,1219327..1220027,
                     1220083..1220253,1220307..1220726)
                     /locus_tag="CNB04170"
                     /product="vesicle-mediated transport-related protein,
                     putative"
                     /transcript_id="XM_569241.2"
                     /db_xref="GeneID:3255691"
     CDS             join(1217993..1218014,1218074..1218199,1218287..1218349,
                     1218402..1218478,1218528..1218679,1218733..1218804,
                     1218861..1219007,1219060..1219274,1219327..1220027,
                     1220083..1220253,1220307..1220651)
                     /locus_tag="CNB04170"
                     /codon_start=1
                     /product="vesicle-mediated transport-related protein,
                     putative"
                     /protein_id="XP_569241.1"
                     /db_xref="GeneID:3255691"
                     /translation="MADAKFFTRTKIQELKDELRGSNDKRDKGFLRKKTALKKIVANM
                     TMGNDVSPLFPDMIQCMAIQVLEIKKMVYLYLVNYGRLRPEELKGAIPSFLTDCADRN
                     PLIRGLAIRTMSSIPLPIIVQALVDPLRHALQDQDPYVRKTAAIAVAKLYASEAGRRV
                     IEREGFVGMLRDLLADHNPTVVANCVAALVEISERGDDIVLKLNVNVAGKLIAALGEC
                     SEWGQIYILDSLLSFVPQSHMEAEQLAERISVRLQHANSAVVLTTIKVILYLMNYMED
                     EGLIMALERKMGPPLVTLLSSGSEVQYVGLRNILLIIQRRPAILQNDVKVFFCKYNDP
                     IYVKLAKLEIMYRLTREENVSEVLAELKEYASEVDVDFVRKAVRSIGRLAIKIAPAAD
                     ECINTLLGLMHTKISYVVQEAIVVIKDIFRRYPNQYESIIGTLCENLDVLDEPEAKAA
                     MIWIVGQYADRINNSEELLEDFAFTFKEEPAEVQLALLTAVVKLFIRRPTVAQELLPK
                     VLKLATEEAENPDLRDRGFMYWRLLTADPAAARDIVLAEKPPISTETDRMDKGMLDQL
                     LLHTGTLGSIYHKNPHTFIRTAKPKYLPESPALNASSKRHLITSYGLPSLSRSIAPSL
                     STRPTSYVSQTSPTSALANAVPGAGAMQPTQHRAENDDPYGQLGDLEFGHGGAGGYQT
                     DIPRPRGAEEDLLF"
     gene            1220905..1222977
                     /locus_tag="CNB04180"
                     /db_xref="GeneID:3255785"
     mRNA            join(1220905..1221321,1221379..1221567,1221622..1221710,
                     1221759..1222194,1222243..1222382,1222430..1222977)
                     /locus_tag="CNB04180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569242.2"
                     /db_xref="GeneID:3255785"
     CDS             join(1221014..1221321,1221379..1221567,1221622..1221710,
                     1221759..1222194,1222243..1222382,1222430..1222887)
                     /locus_tag="CNB04180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569242.1"
                     /db_xref="GeneID:3255785"
                     /translation="MDRDTELIAGPSRPAVYEPVSVQDTSFDAPPGYSQSERTYDAEP
                     SGYQTGNPSFSRDPTFERNRTSIDGVNHQHEGHRHATLAMKKALWWRNAIVTGIFILT
                     WYAFATLLSLYNKWMFSPQYYNFQYPLFVTACHMVVQFTLAMLIRLIWADKFRPKERP
                     TRRDYLTKILPTAASTGGDIGLSNLSLKTITLSLYTMCKSSTLIFVLIFAFAFRLETY
                     SLRLISVISLISFGVFCMVFNTTAVSIPGVLMVFSASALGGLRWALTELVMHKKAMGL
                     SNPFATIFWLAPLMALALAVVSMIAEGWFGILRSEFFDGWRAVETGGVIVLPGTLAFA
                     MVASEYFVIQRAGVVPLSIAGIFKEVSTISISAWVFGDQLTTFNIIGVVITITGIALY
                     SFHKYQKSISSTVELDAEGKPITTDDSVEPLMDAFDIRHSSVGNRQSYEHDPMTLTTN
                     NVPLSYLSSSANPSSHDVPLTTTEERGREEEEVNKAKNDFEGWDRPGEWSGDEEELEE
                     VDEEEVELRRQEREGQKNKQGKWAEWLDKQM"
     gene            complement(1222928..1223909)
                     /locus_tag="CNB04185"
                     /db_xref="GeneID:36392750"
     mRNA            complement(1222928..1223909)
                     /locus_tag="CNB04185"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658765.1"
                     /db_xref="GeneID:36392750"
     CDS             complement(1223003..1223893)
                     /locus_tag="CNB04185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514234.1"
                     /db_xref="GeneID:36392750"
                     /translation="MPQTAPQQLPAPTTEALAFSASLFTSSIASWIPPNFGVTKSETD
                     KQADFELALKEEKGGRLGLGHPLIDAPRKSGDSRGGNGLAGLSKKLGNDKKNKDKEDG
                     GSLPQQQPEDVDEEESRVKSVGKGKKSVNGVLDMFGGKKKRKAEQQVHPLAQQQEQQT
                     AQTPLSKASTPSQDDKEQKQPPLSNPQSPVIPPEPSTPPPASSPGGSGIFPFQGPLAL
                     ESPIAKKMMEERITRKRRAEEVDQEEEEGSGRKERSQSLLESQTDTPSKKQDQGPKSK
                     TQIRREARKRAKLSQLQSAE"
     gene            1224062..1225761
                     /locus_tag="CNB04190"
                     /db_xref="GeneID:3255797"
     mRNA            join(1224062..1224269,1224329..1224486,1224542..1225231,
                     1225295..1225761)
                     /locus_tag="CNB04190"
                     /product="mitochondrial import receptor subunit tom40,
                     putative"
                     /transcript_id="XM_569243.2"
                     /db_xref="GeneID:3255797"
     CDS             join(1224083..1224269,1224329..1224486,1224542..1225231,
                     1225295..1225387)
                     /locus_tag="CNB04190"
                     /codon_start=1
                     /product="mitochondrial import receptor subunit tom40,
                     putative"
                     /protein_id="XP_569243.1"
                     /db_xref="GeneID:3255797"
                     /translation="MSIPTEKPAGPSAFTPYLDAVANVFHPVSGPVLNTYAKFHGWKE
                     NMGLVQPGTVENLTRDAQQVQLANWMFDGARADVAKVISGNPAFQLTHSFSLGSTTRP
                     AAYNFGVIFANAKTFLQGGLDGSGSLTMRANQTWSARDLSKIQAQVTDKPGHTMVQFE
                     HDHIGDHYTFSWKSINPNLLDFTGIHMASLLHSVSPRLSLGFETVIQYPEPAILQTAT
                     SYVAKLTSLPNPVAALTPTTPGLPSPFVPSWIATGHLQPDGNVQATYYQKLSDKVDVA
                     LDFQTILRPQSMLGPAKREALTTLAAKYDFRMATFRGQIDSAGKVGMYLEQRFTPAFA
                     FLVAGEIDHAKNASKFGVGIMIESSTMTQEEMIAAGMLTPV"
     gene            complement(1225748..1228759)
                     /locus_tag="CNB04200"
                     /db_xref="GeneID:3255831"
     mRNA            complement(join(1225748..1226081,1226144..1226444,
                     1226500..1226649,1226700..1226833,1226882..1226955,
                     1227015..1227332,1227389..1227758,1227806..1227938,
                     1227989..1228117,1228167..1228514,1228568..1228759))
                     /locus_tag="CNB04200"
                     /product="RAD17 isoform 4, putative"
                     /transcript_id="XM_024656595.1"
                     /db_xref="GeneID:3255831"
     CDS             complement(join(1225801..1226081,1226144..1226444,
                     1226500..1226649,1226700..1226833,1226882..1226955,
                     1227015..1227332,1227389..1227758,1227806..1227938,
                     1227989..1228117,1228167..1228514,1228568..1228699))
                     /locus_tag="CNB04200"
                     /codon_start=1
                     /product="RAD17 isoform 4, putative"
                     /protein_id="XP_024512297.1"
                     /db_xref="GeneID:3255831"
                     /translation="MSQSSDRSLKRTDSSGSKGSTMSSLASASAGSSKPMKKMGSLSS
                     FQASLNFKSHGSGSNKKEQDRKLMPPPSRSVSPVKMGSFRKAPETSSSSKAVKIPSTK
                     VKGKGKGPEVIEVLSSDEEEERQAKVTRKESEPAQSARKEEKRDTAQMWADLYAPTVE
                     ADLAPGKARIQKVKGWLHESLYGYPADVQPPPLPTRDKLRKYRRILLMTGPAGGGKTT
                     TVRLLAEQMGVDIIEWGESVEEWSLGTGIERESSISKFSSFLSRNSYPSLNLSQSPLS
                     SSSRSVSQSRPRLILLTALPNLTHLPTRDAFHEALLTFCQTFTHSSCPMIIIHSDAGS
                     GGRAEESWMDRDKGGREGAVDLVGKDVKNGPWCQEIDFIPVAPTFILKALNRVISLTP
                     LPPAQRPVKATLQLIAQSSNGDLRSAINSLQLLCGGRKHGDKDKVGKKRKEREEEVAS
                     AKGRGKGRGSMGGRGAKLDVSFELRAVLDAVTRKEQSLNLFHALGKVFYNKRLGDPDE
                     GKDEDQEVLSAIRQLPPDDPLPQHLSGYTRRKALVQMEDFIPSIPIDASSFALWTHQT
                     FPSFCTDIEQVAEGMDYLCVADVMRTDDDIWHSSPQSIAYSLYLTIRGIHLALPSPVT
                     RNHQKVLKPQFFKAFAQGRDNQLALEGVGRYLEKKGTVANNREAAAWGGLVGKRAMAC
                     EMVPMMVKIQSLSNYPLLPPSAQPLVLPPYTPLTQFCISLTQDELTAKAELGEDEGEN
                     LEATMAGDNGVGDVRGHEHLGESVWDDEGVEDDEGEEDYLVDDDIVDWD"
     gene            1228889..1232732
                     /locus_tag="CNB04210"
                     /db_xref="GeneID:3256081"
     mRNA            join(1228889..1229050,1229105..1229214,1229266..1229405,
                     1229493..1231470,1231532..1232732)
                     /locus_tag="CNB04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656596.1"
                     /db_xref="GeneID:3256081"
     CDS             join(1229048..1229050,1229105..1229214,1229266..1229371)
                     /locus_tag="CNB04210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512215.1"
                     /db_xref="GeneID:3256081"
                     /translation="MSALFNFQSLLLVLLLLICTCTYVRGTAPSLVDRNREGFLGLFF
                     KCARIGERLSPYVSLACIAMAVTIILGS"
     gene            complement(1229523..1232686)
                     /locus_tag="CNB04220"
                     /db_xref="GeneID:3255802"
     mRNA            complement(join(1229523..1229875,1229928..1231345,
                     1231394..1232686))
                     /locus_tag="CNB04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_569245.2"
                     /db_xref="GeneID:3255802"
     CDS             complement(join(1229615..1229875,1229928..1231345,
                     1231394..1232615))
                     /locus_tag="CNB04220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569245.1"
                     /db_xref="GeneID:3255802"
                     /translation="MPLKRRGSAKNKKTQRKSRQPASESPVLENDPIPTPSILPSPFI
                     TPPAEPAQTVQPFELTPARYQDPRAEYDKYAMRSHSQPSLELTPTEPGTPPSVASFAH
                     PALSLTHSRPHQDSSLSETAQLPLQLRNFVSSSMSPKEIDHVVNLFEASPVPFDPSIL
                     FNKNMSSEEVENMLMEEYKARVKLHEEKVKANGQTTMKNQHDPAVLRPGGVILDAYGQ
                     NHHHHVRHGPLQSFSEGMSELGVDLGQQSPSDRLHAFYGSGQMLTPRGAEGDTTSNKT
                     PASSFHLESEGDLRSENGVISERKKRKNAKKKEREKEKKKEKQAASAKYQEEPIEQDE
                     EEGVIQMAVKEDVGWPAVKGMAETLSEAVEGALFSPSAESVTTYEKLTTPLSAHEERL
                     PTPPPTNGDETKRCEKELVSEKQVENKLVVTITNFENPAEDDLVAFAASLSYEYSTGT
                     PTTPLSVPASPDEISKRKFGSTAGKIRTFAPFDDWANVVSVNDTDQKQEDEVPASQEG
                     LAVIEECEEESLEESRQEGLQTMPEARESLSVTHINEAEDPTVDSRGSPKVEPTSPDR
                     ESSETSPVIREQPTTIYRIPSELSNSRRNSDAVITSPTSQDFNQPEGNHPSPAKPIFL
                     VERRDQPVRVESKDDNTPRPVVLERTMSTPVPIEVPPSYNDCQQDRLTLTSLRRNNSW
                     GTGHPRQSYSAQSSPEKQKSRPLPGYQHMVEITFSSGRPHSNFASQSSSMNTGLNFSR
                     PLSLPTSPEKARIGPLPQSFPLDRSWTMYYSDTSEKGQHKHRLHLQSAHEYNSGLVTV
                     FNATDLEEFFGGWKALRRAIAETKGREIEPRGMSMQGGAGLGADLMNDDTNLHLFADD
                     IKPMWEDKMCGKGGKFMMAGDAALMDNVFLDICLLLIGGSLSDAVPSPSGARAKSIIC
                     GVAISRRKMTRLEIWLGGEDGPDPMWVDSVYTHFSRCFPQIRLFPYKPFGRP"
     gene            complement(1232743..1236220)
                     /locus_tag="CNB04230"
                     /db_xref="GeneID:3255699"
     mRNA            complement(join(1232743..1232932,1232980..1233254,
                     1233302..1233317,1233371..1233501,1233558..1233737,
                     1233788..1233800,1233850..1234985,1235040..1235367,
                     1235418..1235717,1235770..1236065,1236121..1236220))
                     /locus_tag="CNB04230"
                     /product="Endothelin-converting enzyme 1, putative"
                     /transcript_id="XM_569246.2"
                     /db_xref="GeneID:3255699"
     CDS             complement(join(1232894..1232932,1232980..1233254,
                     1233302..1233317,1233371..1233501,1233558..1233737,
                     1233788..1233800,1233850..1234985,1235040..1235367,
                     1235418..1235717,1235770..1236065,1236121..1236151))
                     /locus_tag="CNB04230"
                     /codon_start=1
                     /product="Endothelin-converting enzyme 1, putative"
                     /protein_id="XP_569246.1"
                     /db_xref="GeneID:3255699"
                     /translation="MAEPRASTDEESAPLLNSQTHATSSAFSRPKTTREKALAAIAVL
                     FLLLASLFIGLFAGAETSYKKEKGKHHSGGGGGWATLTETKTDTQTETATATTTHIGQ
                     PTGTPAPSVCLTPECVKLAASILSALNTSADPCDDFYQFATGGWQESNSIPEDRGLYG
                     AFNEVSDNNKKLILKVLGSIPDEKPGKDATVDERNLAKLKTVYTSCMDIDTLNDIGEK
                     PLIDLVEHVLDIFGEFDVSSQIDNALADAEPYKGAYDESYRLPDELVAAATKVEEIKE
                     LKKAVLTPGAEREKVELEHTLNKADVERRHKLTKTLAWLHSRGVQGLINFEIEGDAGG
                     EDSQIQSLWLYQAEGGLPSKEYYDEAPILDLYHSVIRDILTELAQRTSAEMEGRGWVE
                     DLAALDKELIGDDSWPWPWPGKGDDDEDGDRRRPPSREPIDKRMDKVASQVLKFEKDL
                     VKAGADPEYLFNPHYAYNPYSTSAVSDALPFLDIPTYLSAFAPRTFPENITVTYPPYL
                     KAVTRLVEQTPDEVLSGYFVTRLALTYADALGPKTEVKKSVRRLQEVLKGIKPGTEEN
                     RQDVCLAWVDDIVGFIAGREFVREAFSPEAKSEGERIIRSIVSAFHAKLPHISWMDEE
                     SAAAAQKKADAIIPKVGYPLFPDTTKPESLEAWYARVNIDKEDFFGNVLRSTLVEESR
                     VWLGLGKRRNRDSWEMYPQTVNAYYSPPDGEIVFPAGILQPPFYSLSWPAHLRYGAFG
                     AVAAHELTHAFDNSGSQYDEKGRLRDWWTKKTVEDFEKRAQCVARQYSKYWVYDAEGK
                     KVFVNGNLTNGEDIADSGLAQAYTAWKNSVSDSPSSERLPGLDYSDDQLFFLAFARVW
                     AQLTRPATAVSRIRTDPHSPPYWRAVGTLRNLEAFHEAWGCKTGSRMNPPKEEQCELW
                     "
     gene            complement(1236524..1237828)
                     /locus_tag="CNB04240"
                     /db_xref="GeneID:3255822"
     mRNA            complement(join(1236524..1236626,1236688..1236885,
                     1237026..1237070,1237128..1237307,1237370..1237403,
                     1237455..1237580,1237638..1237828))
                     /locus_tag="CNB04240"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569247.2"
                     /db_xref="GeneID:3255822"
     CDS             complement(join(1236576..1236626,1236688..1236885,
                     1237026..1237070,1237128..1237307,1237370..1237403,
                     1237455..1237580,1237638..1237639))
                     /locus_tag="CNB04240"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569247.1"
                     /db_xref="GeneID:3255822"
                     /translation="MSDVKKPVIIVAFYSTYGHISALAEEVIKGVESTGAIVKPYFIQ
                     ETLSAEVLEKMYAGSSLKPKYPIITPNDLVEADGIIFGAPTRYGRLPAQVSAFFDQTG
                     GLWAKGALVGKFVSLFTSAAGQHSGHESTAISSFPFFAHQGLVYVPIGYSEPSVGNID
                     EVSGGSPYGSSTVAASDGHLQPTVKDLRIAAHQGKYFADFVGTFVRGKNIA"
     gene            1238047..1238719
                     /locus_tag="CNB04245"
                     /db_xref="GeneID:36392751"
     mRNA            join(1238047..1238258,1238320..1238470,1238528..1238719)
                     /locus_tag="CNB04245"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658776.1"
                     /db_xref="GeneID:36392751"
     CDS             join(1238127..1238258,1238320..1238470,1238528..1238604)
                     /locus_tag="CNB04245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514235.1"
                     /db_xref="GeneID:36392751"
                     /translation="MGFFDLFSSSSVVPVNTDIPKPRSDASVNAPPPDQHKTVAQFIQ
                     EAPAAKYFFDSRRNEDQADTELCRLTPNGGRSCVKVAMHSAALFKSMQSLGFYCALPA
                     EPTRTHMECNRLPGSSR"
     gene            complement(1238684..1241657)
                     /locus_tag="CNB04250"
                     /db_xref="GeneID:3255931"
     mRNA            complement(join(1238684..1238748,1238898..1239305,
                     1239355..1239684,1239741..1240049,1240105..1240173,
                     1240230..1241657))
                     /locus_tag="CNB04250"
                     /product="pheromone receptor 1, putative"
                     /transcript_id="XM_024656597.1"
                     /db_xref="GeneID:3255931"
     CDS             complement(join(1238923..1239305,1239355..1239684,
                     1239741..1240049,1240105..1240173,1240230..1240383))
                     /locus_tag="CNB04250"
                     /codon_start=1
                     /product="pheromone receptor 1, putative"
                     /protein_id="XP_024512298.1"
                     /db_xref="GeneID:3255931"
                     /translation="MAFAHPEYLVPSVIALVLALYPLPWHLRTGNIATLSMIFWMTLL
                     NIVHIVNCIVWVDNSAPRAKWWGDISALIIVAYNYALPTAHLVLAKQLESFTSLRPHS
                     PLYDSSSRKRHRIFDISVTIGAPVIGYLVHLSNMDRRFYIVERLGPQAATYWNAWGVI
                     WMAIVPILIAVTVVVYTIMALVNIYLRRQQMLSLIASDASVNRDQFYRLMFLTVSEVG
                     TCGLRAIFNLMSFQNGPQPMGHRGAPFHNLSKIESIEWSSTTTSGRLTLHLSFFTVVA
                     CSYVFFMCFATSTETKRFYSNIVRKIFPCIPESRTSRIHKLGSVDTGLSRSNATGTYS
                     SATTGPISPTTPKDMDISLEEMLHAPALGKNSHWAINRGLDRVEITPSVTTQESKYDE
                     ETADALYLPSMMNEEKTSSSIV"
     gene            complement(1242477..1244749)
                     /locus_tag="CNB04260"
                     /db_xref="GeneID:3256001"
     mRNA            complement(join(1242477..1243843,1243893..1244039,
                     1244097..1244266,1244349..1244749))
                     /locus_tag="CNB04260"
                     /product="5-aminolevulinate synthase, putative"
                     /transcript_id="XM_569249.2"
                     /db_xref="GeneID:3256001"
     CDS             complement(join(1242559..1243843,1243893..1244039,
                     1244097..1244266,1244349..1244573))
                     /locus_tag="CNB04260"
                     /codon_start=1
                     /product="5-aminolevulinate synthase, putative"
                     /protein_id="XP_569249.1"
                     /db_xref="GeneID:3256001"
                     /translation="MQVTSLLRFSGVCPFLGHSTPSSLRAMANTANSSVSALTATAMT
                     CPMMGPKLASISAARTYASVAGAKEVQELHQNKNVTIDSTTTGAAAKCPHAKAARDVA
                     VDAHRKAAAAGTFNYQGFYETELEKKHKDKSYRYFNNINRLAAKFPVAHTANTKDEVD
                     VWCANDYLGMSRNPVVVGTMKRTLDRYGSGAGGTRNIAGNGALHLALEDEIASLHRKE
                     AALVFSSCYVANDACLATIGAKLPGCVIFSDASNHASMIQGIRHSGAKKVIWKHNDLA
                     DLEAKLKTVPKEVPKIIAFESVYSMCGSVAPIEAICDLADKYGALTFLDEVHAIGMYG
                     PNGAGVAEHLDFEAHHATRHSPEPVKGSVMDRIDIITATLGKAYGVVGGYIAGSADFV
                     DVVRSYAPGFIFTTSLPPAIVAGAQASIAYQREFMGDRRLQQLNTREVKRQFNQLDIP
                     VVPNPSHIIPVLVGDAALAKEASDMLLAKHKIYVQSINYPTVPVGEERLRITPTPGHT
                     TEQIAHLVSSIDNVFNTLGLKRIREWKAAGGRAGVGMPNASAIEPVWSDKQLGLTDGS
                     APVALQQGAKSVVRDEAVEVAQKKLTHLLGADAGPALKVASL"
     gene            1245091..1247908
                     /locus_tag="CNB04270"
                     /db_xref="GeneID:3255957"
     mRNA            join(1245091..1245637,1245688..1246462,1246512..1246813,
                     1246862..1247364,1247418..1247635,1247698..1247908)
                     /locus_tag="CNB04270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569250.2"
                     /db_xref="GeneID:3255957"
     CDS             join(1245151..1245637,1245688..1246462,1246512..1246813,
                     1246862..1247364,1247418..1247635,1247698..1247812)
                     /locus_tag="CNB04270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569250.2"
                     /db_xref="GeneID:3255957"
                     /translation="MRITPEYISVGANRSSSCAACSASGLLFFGAGNFIALWDSSSNR
                     GVHATLPGHKGQVTTVKLLPDGRLVSGDNIGEIRVWNSVKGDDEWECVMSWEAHRGGS
                     ISAIGVLASRGSLDDMIITGGSDSLIKRWKIADKPEEIQKIDLGGKLPLDLEVGYLPG
                     SEAPILALGCTDRRIQIWTIRDGSFTRALSLEGHEDWVRCLSFTPYPSASSSSQDLLL
                     ASGSQDNFIRLWRVSPIEQEVASPSAGDEGLEMLDEFEKRLAGEAGGNVQISTKAHIL
                     GVQDGEKNLRFNITLEALLVGHESGLTNVHWSPTPTSSSPTPLLLSTASDNSLIIWSP
                     SSTSTSADGIWVPTNRFGAIGGRGLSFYGAIWGKDGKSVMAGGWNGGWEKWVESEQGW
                     DVQRGLTGHHGSVETVCWDPRGEYLLSVASDQTARIHAECNLPSSSTSIWAEIARPQI
                     HGYDMTDASFISPLRFVSGADEKVARVFDAPQGFVESLRSLGISKREAEEESRPKGAT
                     VPPLGLSNRALQKAPVAGDAVEKQGQNEAIISISHTFTSLPTEEELATSTLWPEVEKV
                     YGHGYELVCAAASHAGDLIATASKATNAEHAVIRVISASKWELVGEPLAGHSLTITSV
                     SFSRDDKRILSCSRDRGWRVFERKEDGEGYFPLAGDEKAHARMVLDACWADERNDMFA
                     TASRDKTVKIWTSAVADGSQWAAAGTIKLTVASTAVAMINDGSDGYLLAVGKESGSIE
                     VFTVAVNRDGVKSDLLSTFDRRVSHVSAVNKLAWRNVEGVLSLASCSDDRSVRVYKVE
                     L"
     gene            1248131..1249409
                     /locus_tag="CNB04280"
                     /db_xref="GeneID:3255960"
     mRNA            join(1248131..1248257,1248331..1248428,1248488..1248743,
                     1248807..1248965,1249021..1249409)
                     /locus_tag="CNB04280"
                     /product="20S proteasome subunit, putative"
                     /transcript_id="XM_569251.2"
                     /db_xref="GeneID:3255960"
     CDS             join(1248226..1248257,1248331..1248428,1248488..1248743,
                     1248807..1248965,1249021..1249234)
                     /locus_tag="CNB04280"
                     /codon_start=1
                     /product="20S proteasome subunit, putative"
                     /protein_id="XP_569251.1"
                     /db_xref="GeneID:3255960"
                     /translation="MSAPGGGGAYSFSLTTFSPSGKLVQIEHALAAVAGGTTSLGIKA
                     TNGVVIATEKKSPSILLDTSALEKVAPICPNIGFVYSGMGPDFRVLVAKARKIAQAYW
                     KVYGEYPPTKVLVQEVAAVMQKATQSGGVRPYGISVLIAGWDSHRGQSLWQIDPSGSY
                     WAWKASAIGKNMVNGKTFLEKRYNDDLSLEDAIHTALLTLKEGFEGQMTEQTIEIGIV
                     TCPTPEQMQEKPGERLPPTFRKLTEQEVKDYLSL"
     gene            1249543..1256467
                     /locus_tag="CNB04290"
                     /db_xref="GeneID:3255731"
     mRNA            join(1249543..1250140,1250189..1250761,1250816..1250911,
                     1250956..1252195,1252243..1252709,1252766..1253555,
                     1253606..1254063,1254118..1254305,1254356..1254419,
                     1254473..1256189,1256246..1256467)
                     /locus_tag="CNB04290"
                     /product="nucleic acid binding protein, putative"
                     /transcript_id="XM_568928.2"
                     /db_xref="GeneID:3255731"
     CDS             join(1249676..1250140,1250189..1250761,1250816..1250911,
                     1250956..1252195,1252243..1252709,1252766..1253555,
                     1253606..1254063,1254118..1254305,1254356..1254419,
                     1254473..1256189,1256246..1256391)
                     /locus_tag="CNB04290"
                     /codon_start=1
                     /product="nucleic acid binding protein, putative"
                     /protein_id="XP_568928.1"
                     /db_xref="GeneID:3255731"
                     /translation="MPPRRSTAKSKVQSATASSFSPAELITPSLNEQLLEYISQWETT
                     GTESLHKLIISLLNTINSAPTTLGVVPLLHVLVTLLKSNVDERELTGVFEGVLDELED
                     DRRDIFGEALVDAVEVLEEEQEDVGGNKNKGEKETEEAEDKSPKGLSILKLLLESNTL
                     PSYIPNLLLNPERLIPLNLHPMPRNPRAFQSALVKKNTTLFFKQRKFNLLRECSEGFS
                     GLIVLLTSEDTLPSHPEEEDDEERRNRADRVWGKIMRLIGYFNLSPPRVLDIILEVFS
                     CHIIHHWPFFLELLRCSPWGPSSNQEDDDGGISTKKGWKEEEVEGIENALKRDGDRVL
                     SQVLGFKFGFFRKPEAGDTPIGLIYTAALLIKHGFVGLTDLLPCLSPDDNEMETIRKK
                     WASSLSSRSGPANALTDTILDDDEPPSGTIGSISEQAQNIPTKPPPEQRIQLTQALLA
                     LGDKAASEYMLARWPWIAQKSTGVADLILDIVEDALKPVYEEVVAKREEKEEFDLQAV
                     APIVQDSESIGKQTVLTLFAPAPPETTTKKFKFFYPHREGVSESWSTVDEIHEKGLRW
                     LGLIGGLGGRRARLMVMLSRIGAAQFERLRENKLEQGLTAEHSQPTVEELKPWLDIIR
                     VSLLPSLSCSMASGTFDVELWSLLKLFPYTSRYSLYGEWRDSTCSANGRKPCLIAAHA
                     AAMTTKEVQKALRRVTSTNTSATSGATPTERHSARALAKQSHHNPVFVWTTAVTQVKA
                     YPNIGEAIVDAGRYMAQLSFDVATFVMLDTLSDDRALRLNEMGTGVALWLERLSKFVG
                     DFNRRYSNMDLYPVLQYIINRLMRGHSGDLIILEKLMSSMSGIEPVPNDGVSEAQLQA
                     YAGGREMIREAFSATRISVTAPPEPGASEQPTRAPVEKVKNVKKSLPRLVNALREKGL
                     AMPIWIALAQTRQAVVDKMVNAPIKAMNLVQDTCHNAFVQFGDFLVEYLTSDEHIALI
                     PDLQQLIVDFGLEYGMAFQILRPRLNAEIERARVEEKAAVQARLEAAKKAMSEKERNG
                     SPQKVESPALPGSPTTPSLQFTPGATPGPGEIEDVVMEESEKGALSIPAPKTPSSKSK
                     MWWPSALTPTMQQTRKLLPREANEVMSAPFFVIFWHLTTPDIAFSPQSYDNAIKSINR
                     HISTISSWWVNPRDKSKMAEQRDELARLKARVKVLQEEKEAHGSLVNGPMKRRMRLES
                     GKWFGKAIVEKNLQRPLAIQLHQYCFYPRAILSPCDAVFVAKFIRMAHNLGTVGFSTL
                     FVYNNFFNDNLAACIFSCTDSEARNLGRCLALILADLDKWHQSENVYLKEALGISPNP
                     IEGGEQKRLPGMLFRSKAGDDMREMSWQEFRNFYAKCHNVLTRALISCWSEAEFMHNK
                     NAIIVALQVIKYFPLMETNGKAIEAAVKKLQAGEVGEIPNDLKMMCTSFLSGLKKRQD
                     ARPFVAPATFHGAAARAAIARAPSAPKVESPAPSGSISTPSRSQPANGTNGTASPSPA
                     GTPGPMTTDPRTLRQKVEESRARAAASAAAKEQEAGTAPQSPLVHPIPTRPGLPSRLA
                     SSANSVPVTPTGPSAITRTSTPNATSVNSRAHTPVSSMGPPPDMSVDEARAAARARRL
                     GGIHRPPPPPPSAAGQTTESAVSTAFTNLDAERQEEKAEEKEKEPGTPPTPLVESTRG
                     RSPPASVKTSPTTTVRTHRDGSVESRASERSKRREQGRDKYRRDKDHRDRDKEREREK
                     EKDRMDRSAAEDDKRRQEDNVPASTQSDSGRESRRSRRDGERERDREEKKNRERERED
                     RKERDRERSYRGEDSDRKRKRDEESSSRKLEPDASSGSRKERERERRRYDERDRERER
                     DFRDRERDRERDRNERDRDGHRDRRERERDGRRRDRDSRDVRENRERRRTPLAEDGPE
                     LASAASKDNTDTASNVSGPGAARTPHALPARPGNSEQVPRLPPNAAPVSQNPQEPLSL
                     AARLGGMARPASPHVRANEPIHRSTRDDLGRDNDWNNAPRRDEATEEESRKEPADRKR
                     ALEAEAGPEAREESPGASKRVKIDRNKARGRRQEGGGAKMFQQAMGSTKDK"
     gene            1256640..1259006
                     /locus_tag="CNB04300"
                     /db_xref="GeneID:3255695"
     mRNA            join(1256640..1256858,1256928..1257001,1257126..1257190,
                     1257246..1257345,1257397..1257441,1257501..1257615,
                     1257689..1257888,1257941..1258012,1258065..1258205,
                     1258260..1258391,1258449..1259006)
                     /locus_tag="CNB04300"
                     /product="membrane protein, putative"
                     /transcript_id="XM_568929.2"
                     /db_xref="GeneID:3255695"
     CDS             join(1256807..1256858,1256928..1257001,1257126..1257190,
                     1257246..1257345,1257397..1257441,1257501..1257615,
                     1257689..1257888,1257941..1258012,1258065..1258205,
                     1258260..1258391,1258449..1258871)
                     /locus_tag="CNB04300"
                     /codon_start=1
                     /product="membrane protein, putative"
                     /protein_id="XP_568929.1"
                     /db_xref="GeneID:3255695"
                     /translation="MSRIPIYLLALLAYVHYAQAHEHHNVTEIDTSVPFDARIYIHMT
                     LQTYLWAIAFPLGMVLGLSKSKYHVPLQSVNTVLSFIGIYFGHHHGGRQFPATVHGFM
                     AKILIWVMVIQACLGIFLKLHVSEKKIRPWVVPFHSVLGKTFPVLGWTQMLFGVATAL
                     GFCRGGNLGQCAAHYIMGSAFIGYGAILVIMLNLGGKWLERRGCSQEMLDSSVITAWG
                     IVNTFTEHHGGPWTHKDMQHTMMGVLWWAGGMLGIFLSRGGRRSFIPSVIIIMTGWGM
                     SAHEQALMISSKIHALFGYALISAGVLRIVEICFVLNDKPTPSNGAIRVFQHLPPYLL
                     VLGGTLFMSATDEEMRNADSLGVDHVTYALFDFSLSFLIYLVITFLVHLYSNSGRNAL
                     QKENSGEEIFDSERAEEHGYAKVPTEQREQIRGDNDLDGDGDGPEAYEMADRDSSGES
                     EAVKIGGEDEVDWMGRRGPVNL"
     gene            complement(1258966..1261061)
                     /locus_tag="CNB04310"
                     /db_xref="GeneID:3255667"
     mRNA            complement(join(1258966..1259328,1259389..1259688,
                     1259760..1260368,1260422..1260573,1260629..1260691,
                     1260804..1260875,1260938..1261061))
                     /locus_tag="CNB04310"
                     /product="chaperone regulator, putative"
                     /transcript_id="XM_568930.2"
                     /db_xref="GeneID:3255667"
     CDS             complement(join(1259324..1259328,1259389..1259688,
                     1259760..1260368,1260422..1260573,1260629..1260691,
                     1260804..1260875,1260938..1260951))
                     /locus_tag="CNB04310"
                     /codon_start=1
                     /product="chaperone regulator, putative"
                     /protein_id="XP_568930.1"
                     /db_xref="GeneID:3255667"
                     /translation="MVKETKYYDLLGVKPDADANDIKKAYRKSALRHHPDKGGDPELF
                     KEMTHAYEVLSDDQQRSLYDQLGEAGLKEGGMGGGVDPQDLFSQLFGGGGGFFGGGGG
                     GRSSGPRRGRDLVHRISVSLEDLYKGKVQKLALSKSVICKTCDGRGGKQGAVQTCTGC
                     QGRGVKVMLRQLGPMMQQIQQPCTECEGTGEMMNPKDRCKTCSGKKTNQERKVLEVHI
                     DKGMKGGQQIKFAGESDQQPGTIPGDVIIVIEEKPHPRFERKGDDLFYNAKIDLLTAL
                     AGGDFAIEHLDEHALHVTIVPGEVIKPDALKIISGQGMPSYRHHELGDLYVRLTVEFP
                     NTIPVENIPLLEKALPARKALPKFNKKIHIDEVVLSEPNERHAKNAATGEDEEMDDED
                     DDGRPGVQCAQQ"
     gene            1261265..1263254
                     /locus_tag="CNB04320"
                     /db_xref="GeneID:3255610"
     mRNA            join(1261265..1261316,1261362..1261410,1261461..1262018,
                     1262067..1263254)
                     /locus_tag="CNB04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_568931.2"
                     /db_xref="GeneID:3255610"
     CDS             join(1261271..1261316,1261362..1261410,1261461..1262018,
                     1262067..1263195)
                     /locus_tag="CNB04320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568931.1"
                     /db_xref="GeneID:3255610"
                     /translation="MVRPLHSIPTMSSTRADKETTLQQLAASNTFDTDWPTLKGYFQE
                     SLNDALKIFLTKGPPRPYRPRGASPPPPAAPSKPQTSLPSVTTDEVGKPPAESLLLSP
                     SHPASMIGPASELAHNPEDLRPSTIGGLVIPPFPPLDPSRRRTPSPAPMQRSPSPLSP
                     RANGMHNQRIVAMGIGVPDEEWDEETVIGGKKLQGWLDEAQGKAEIQRLNNLLDDMEA
                     PPFTIQRLAELLLHPTSQHATFGKFSRAIEKSLLVTSPWGAPSYVYIPPSNFAAYPGV
                     GPISSASSPSPDGGSESDSTVPAGSTTPLFSPIPFLVHPSHEPALAVDTGHPAASIGT
                     EDGLLSPLNLSEEKTPSSSGRSPTPEPEDSIATTSGPSTNDIDTEMVSPGDIPRPENP
                     QGTSDPANTSYMGRVDELDTGPLPTSEQVSIKRRSSISSSSSQMEVDDRETVVMAGQG
                     EGGHLAPHGMADKPMPLSSTTVVKDVPEEGRMIKGLRRNESEKSLGERFVSGGVQKPE
                     EAGQGEGGHLAPHGMADKPMPLSSTTVVKDVPEEGRMIKGLRRNESEKSLGERFVSGG
                     VQKPEEAGLVDSAEGISKSADKEEGVE"
     gene            complement(1263238..1265322)
                     /locus_tag="CNB04330"
                     /db_xref="GeneID:3255550"
     mRNA            complement(join(1263238..1263363,1263415..1263861,
                     1263915..1264503,1264557..1264880,1265020..1265140,
                     1265221..1265322))
                     /locus_tag="CNB04330"
                     /product="galactokinase, putative"
                     /transcript_id="XM_568932.2"
                     /db_xref="GeneID:3255550"
     CDS             complement(join(1263317..1263363,1263415..1263861,
                     1263915..1264503,1264557..1264880,1265020..1265140,
                     1265221..1265300))
                     /locus_tag="CNB04330"
                     /codon_start=1
                     /product="galactokinase, putative"
                     /protein_id="XP_568932.2"
                     /db_xref="GeneID:3255550"
                     /translation="MSAKVPITVFNSLQEIYPSASAVLREGQRWNTLLTRFQERFGET
                     PTYIVRAPGRVNVLGEHIDYSLFPVLPAAIEQDILFALRPTRPVAGSNPTVRLENYDK
                     KYSYPGCSFSLVPGENGWDVGLNAGGGWDKYVRAALLECLDELFPVGKGGGKQEAVGM
                     DVLVSGSIPPGSGLSSSAAMVVGSVIMFLVANNLAAGKTKEDVVQLAINSEHRMGLRT
                     GGMDQSVSALALPNNLLHLSFHPGLLPAPLPLPGNVSLVITNSLAPHSLTDSAPEEYN
                     LRVIEILIATRLILHHWKLESQFYRNPRPWLREVLGAWVGEKGHMGWEKEGEVTKKAL
                     GDIEWIKRDGGWTREEMIKYSGMDEEEFKKSYLDFLEIRAEKFHLYERLHHTLTESLR
                     VHKFVHLCQSISTSNPLPPSSDTPLPTANDILSQLGKLFDASHASMRDTYDCTHPLVD
                     SLQELCLKSGAIGSRMTGGGWGGSVVSLVESSQVPEFLEKVRKGYEKYGDLEDEEWVE
                     VGFATMPGHGAGVYVVENGIRVENGAA"
     gene            1265511..1267858
                     /locus_tag="CNB04340"
                     /db_xref="GeneID:3256087"
     mRNA            join(1265511..1265967,1266022..1266026,1266100..1266164,
                     1266218..1266293,1266347..1267196,1267290..1267858)
                     /locus_tag="CNB04340"
                     /product="expressed protein"
                     /transcript_id="XM_569030.2"
                     /db_xref="GeneID:3256087"
     CDS             join(1265658..1265967,1266022..1266026,1266100..1266164,
                     1266218..1266293,1266347..1267138)
                     /locus_tag="CNB04340"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569030.1"
                     /db_xref="GeneID:3256087"
                     /translation="MAAVPASKVLDVIAHPLFPLFFAIPLFLIFFLAYFFVAPYFATE
                     RQRAYILSTTSSCFMTLVSLPFVWKYARHGLGVIYEEGQSGWMGALGRVGVVFFATYL
                     FSDLAIGYSRYPSQVGLLTGWIHHAVYIGLMGHLLNTRHSPVFLVAAIMELPTFDLAM
                     SNLYPSVRHDLRFLISFFIFRIAFHAYLLGDCLRSSSRAVTDGSWVPSIMLALAGALH
                     VMWFKGGVTGYLKRLGRSNAKAESVEEPCSTMGEILDQNSITTGELVLESLDDSPGTP
                     DDSPLMTPRTPSQTPFVLPAIPSIAIPSFPTLSNLPIVSIPAIPSISGLSLAEIRAAL
                     NKEGAFKLKGNEFKEAVKGRWEEHREKFVERTGLSLGAMRMRKRGERQVKEHVEEQTD
                     EGQLMTMSVDGHVGENQLDSICI"
     gene            1268023..1270034
                     /locus_tag="CNB04350"
                     /db_xref="GeneID:3256094"
     mRNA            join(1268023..1268094,1268190..1268309,1268384..1268512,
                     1268577..1268706,1268767..1268803,1268850..1268855,
                     1268914..1268931,1268981..1269025,1269167..1269305,
                     1269374..1270034)
                     /locus_tag="CNB04350"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569031.2"
                     /db_xref="GeneID:3256094"
     CDS             join(1268093..1268094,1268190..1268309,1268384..1268512,
                     1268577..1268706,1268767..1268803,1268850..1268855,
                     1268914..1268931,1268981..1269025,1269167..1269305,
                     1269374..1269770)
                     /locus_tag="CNB04350"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569031.1"
                     /db_xref="GeneID:3256094"
                     /translation="MSTKPVIAVIYYSTYGHIATLAEEVIKGLESTGAIVKPYVIQET
                     LSEEILKKMHAGSSLKPKYPIITPDDLKELDGFILGCPTRYGGVPAQVATFFDQTGQL
                     WATGALVGKFVSMFTSTAGQHSGQEATTLTTFPFFAHHGLTYVPIGYSNPLISGVEVV
                     NGGSPYGASCIANADGSRKPSAVELEIAEHQGKYFGNFVGTFVKGRSAAAAPATTTAA
                     ASQVPQKVSEKEGYAVGDETAAAGGAAPALANTGVANVATEKTAEPAAAALVADETAA
                     AEPAPAAETTTAAEPAPAAEATPAATTAAATPATAEKPSQTKPAAAAAPKKKGFFSCC
                     GDSNID"
     gene            complement(1269908..1271278)
                     /locus_tag="CNB04360"
                     /db_xref="GeneID:3255548"
     mRNA            complement(join(1269908..1270179,1270239..1270338,
                     1270386..1270493,1270549..1270648,1270701..1270847,
                     1270898..1270989,1271042..1271278))
                     /locus_tag="CNB04360"
                     /product="4-nitrophenylphosphatase, putative"
                     /transcript_id="XM_568933.2"
                     /db_xref="GeneID:3255548"
     CDS             complement(join(1269972..1270179,1270239..1270338,
                     1270386..1270493,1270549..1270648,1270701..1270847,
                     1270898..1270989,1271042..1271234))
                     /locus_tag="CNB04360"
                     /codon_start=1
                     /product="4-nitrophenylphosphatase, putative"
                     /protein_id="XP_568933.2"
                     /db_xref="GeneID:3255548"
                     /translation="MQPGSAIMTIDIEKTAPPFLKTLEEYRQLVDSADTFLFDCDGVL
                     FLGTQLTENAKVLLDMLRSSGKKVIFVTNNSTKSRRQLKAHFDSLGLDASLEECFGSA
                     YASAVYLSEVLKFPKDKKVYVFGHEGIEEELDEVGIAHIGGSDPEDREFTPPIDYSHY
                     SPDPSVGAVLCGADNWINWKKITKAVIYLHNPECRLILTNPDATFPIGGSLFPAAGSM
                     SAPIVYAAKQTPVVIGKPSKTMMDAVIAHHHINPARTIMIGDNLHTDIEFGINSGIRT
                     LLVMGGVTKYEYIYGENPSPVVPTYVINRAGDLAALSKQ"
     gene            1271451..1276484
                     /locus_tag="CNB04370"
                     /db_xref="GeneID:3255639"
     mRNA            join(1271451..1272174,1272227..1272353,1272403..1274574,
                     1274624..1275803,1275856..1275995,1276052..1276484)
                     /locus_tag="CNB04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_568934.2"
                     /db_xref="GeneID:3255639"
     CDS             join(1271582..1272174,1272227..1272353,1272403..1274574,
                     1274624..1275803,1275856..1275995,1276052..1276360)
                     /locus_tag="CNB04370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568934.1"
                     /db_xref="GeneID:3255639"
                     /translation="MSDRPGSASEGEGDEIRPYGEDRDSSEESEDDDPEEAKRIAEGF
                     IVDEDEEDGEGEDDEEDEETRRRRRKEEKRRRKKERRMRREREEAELSEDELELIEEN
                     RGLREGRPLKRLRRRSGSEGSENDRAVPTLQDMFRDDEDRMEDDDDDLMDFIEEDEED
                     EANQGETEEQRRERKRAEKLKRREQARSRPELTGVDRSSWDEIFAVFGDGQDYDWALE
                     GEDGMDLDEEEEAAKKDLRLEDVFDPAEIKARRLQDEDKAVANADRPERHQIVNSTLS
                     DNPVFATDTLYPPPDFAAKWVAPKVSFRTQYLFYNQHPEGSYPIPTIDNPQPYPVYRR
                     PDLEIEFEKAVSTALNMMFVQHLEVPYLWHYKRDVFSLLENQGQSSVLFLERDELWQV
                     YVLGQRYRAIHERNEQTRQQWGKIKARKGDIEDEYFTKGLLGKACVASIEAAGEGDEW
                     LAYHYASDIKAIKEEEAFDEVSKKLPERAEREDIRRGRIMKLVEAFGIDANKVASSFQ
                     DVHGQPAPVMNPDKMPLELADEFTGAAYSSPEQALSAASFVLVQELSKDPAIRQQARD
                     FMDTCGLVTVNATDRGMSVIDQYHLYYNFKFLTNKPVLDFRDSPQFVHMLKAEEEGLI
                     NIAFDIREDMLASFTDALIRCCRSNDYGEIASAWNEVRMEVCNTLVKKHLMPMASKWI
                     KEHLRTQAEEYIAERCREELELRVNVRPYASSGMEQGETPSVLAITNGKGDIRDAVMA
                     VMLDDEGNVRTQTKFDNLRDEEDKTMFIELLEKRKPKVVVIGGFSAQTARLKDAALVA
                     IRQHAIELLGQNPPVSDAYPDHEGFQYAMAEYDEKLKAHLIPLIFVNDATARLYMSSE
                     EAEKEHPNLPLNGRYALGLARYAQNPLNAYCKLGKHIASVTFMEHHQKLIPQEKLLYH
                     LERGLVNSVCFMGIEINSCVADPYQRAMLPYIAGLGPRKADAVIYGIQKHGALINRMA
                     FTDLGLFGPTIFENTAGFLTIESDLKDMMLEAENPQEQPDPLDMTRIHPENYEFAQKM
                     CQDALDLDVEDVADRHKSEVVQTLMLDDKRGKKLGELNLDDFAFNLQRQGEGNKRHTL
                     GEIVSELIRYRSDRRPAFYVPTDWEIVTMVTGETERTVGRGLKVTATVRKAISARVFC
                     QLESGLDAVLERDYVADEDQAPVTSCDEVFKPRQAIKGVVIMPEPARFQVRISTRPSD
                     LRQGVDFVQPFKDEEYNSKDRRDAAEAATAAKKQRRAGKVQRIVNHPNWHVLNSGQAE
                     QFLASQHRGDCVIRPSSKGPDRIAVTWKVDEDVYQHIDVQEIDKPNEYSLGRILMVSG
                     QYRYSDLDDLIINHVKATARKFDEIQMHEKYKPEHELDAFLKNYVQAHPGRSIYGFSV
                     DSDRPGYLKLCFLSKPTKDGGVIQTWPVRVLPGAYKLGNAIVPGVTELSNAFKMQYSE
                     KLAEQGHQGKTPGIYLGKTPMHLGGRTPALGSRTPAMGSRTPALGSRTPALGSRTPAL
                     GSRTPAQGGPRY"
     gene            complement(1276638..1277444)
                     /locus_tag="CNB04380"
                     /db_xref="GeneID:3255725"
     mRNA            complement(join(1276638..1276849,1276911..1276975,
                     1277119..1277202,1277302..1277444))
                     /locus_tag="CNB04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_568935.2"
                     /db_xref="GeneID:3255725"
     CDS             complement(join(1276774..1276849,1276911..1276975,
                     1277119..1277202,1277302..1277310))
                     /locus_tag="CNB04380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568935.1"
                     /db_xref="GeneID:3255725"
                     /translation="MGNGAKAQAKRDRNTKGAAGKGDQSQLKSNAAAMTIQCITCKAV
                     FQGTSKQLVLQQHVDSKHPKSDIKTCFPTFAAV"
     gene            complement(1278073..1279469)
                     /locus_tag="CNB04400"
                     /db_xref="GeneID:3255737"
     mRNA            complement(join(1278073..1278540,1278592..1278687,
                     1278746..1278776,1278831..1278940,1279000..1279089,
                     1279176..1279187,1279337..1279469))
                     /locus_tag="CNB04400"
                     /product="expressed protein"
                     /transcript_id="XM_568936.2"
                     /db_xref="GeneID:3255737"
     CDS             complement(join(1278477..1278540,1278592..1278687,
                     1278746..1278776,1278831..1278940,1279000..1279089,
                     1279176..1279187,1279337..1279374))
                     /locus_tag="CNB04400"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568936.1"
                     /db_xref="GeneID:3255737"
                     /translation="MERLQQNPAELFRIVNMIVGGFAIVGGVGSLIKHNFSSIIIGIY
                     EILIGAVIVFLEVRPPTEEHKAIIQKYASFMHSFLGRGAFYLLLGVLMLNYYMLLYIC
                     GTVVGVVGLVFIALHFVRVVDAPSTMRAPVTDAEAQPVWEGPTE"
     gene            1279651..1281305
                     /locus_tag="CNB04410"
                     /db_xref="GeneID:3256013"
     mRNA            join(1279651..1279782,1279843..1281305)
                     /locus_tag="CNB04410"
                     /product="cell growth and/or maintenance-related protein,
                     putative"
                     /transcript_id="XM_568937.2"
                     /db_xref="GeneID:3256013"
     CDS             join(1279733..1279782,1279843..1281259)
                     /locus_tag="CNB04410"
                     /codon_start=1
                     /product="cell growth and/or maintenance-related protein,
                     putative"
                     /protein_id="XP_568937.1"
                     /db_xref="GeneID:3256013"
                     /translation="MRAAVRKLLTRTLLRTRLFIMSSHTTPIYQCQDWPSIVIKPSSS
                     SGHPLDSPHFSIPPSILPHLEEASKHLHSHKTVAVPTETVYGLAASSLDPEACKMIYK
                     IKNRPSDNPLIIHVSSLDMLRRLLPPDYSFSSLYLALINAFWPGPLSLLFPSPSPPPS
                     PAPQTNAIRMPSHPLALALIAHSNLPLSAPSANSSGRPSPTKAQHVWNDLNGSDGLGC
                     IIDGGDCGVGVESTVVNGLEWKEGGGGKVDILRPGGLGVEQIKKIVDEVDGGEGKTEI
                     LLLGKPWKGASFKHSSSTDPVQQNDVNLLTTPKVNFAPSTPGMKYRHYSPRVPVFLLK
                     PSNIFPRPPALMSPSSSSASAVLRQILSNISSDSKFKRRIGVLHFEGSPLSKQLLIDT
                     DEAELIPVSLGDSVASAAQRLFAGMLTLESVPSTDGQPSGVDAIVIEGCSDDGLGLAV
                     MERVGKAVGGGGVLGDVATDDGKVVGSGNKFWVDVSST"
     gene            1281978..1283856
                     /locus_tag="CNB04420"
                     /db_xref="GeneID:3255990"
     mRNA            join(1281978..1282017,1282109..1282240,1282312..1282417,
                     1282475..1282562,1282621..1283856)
                     /locus_tag="CNB04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656598.1"
                     /db_xref="GeneID:3255990"
     CDS             join(1282116..1282240,1282312..1282417,1282475..1282562,
                     1282621..1283039)
                     /locus_tag="CNB04420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512178.1"
                     /db_xref="GeneID:3255990"
                     /translation="MPATKSKSNVALLTEGATYIQRAKKARKEQVEEIKFDDEARREW
                     LTGFSKRKKAKAEEKKARAKERERQEHLEERRNARKELRQRAAENVKSVRRAMGLEDD
                     EDDNEESNEEEAGSPAPKDLEKAEFSDDEQIATVTITEDFDPSASIYPIRTSTSPSPS
                     VDDKSELKSKKPTVKLLPPSSRRAQKADEKKKEKKKISRSMETKAERRKGKEMELRKR
                     SKKAALAMERKGKTPRGPKKGMGKGRH"
     gene            complement(1282712..1285450)
                     /locus_tag="CNB04430"
                     /db_xref="GeneID:3255973"
     mRNA            complement(join(1282712..1283248,1283298..1283411,
                     1283463..1283666,1283724..1283873,1283925..1284180,
                     1284234..1284570,1284623..1284711,1284767..1284833,
                     1284894..1285032,1285092..1285450))
                     /locus_tag="CNB04430"
                     /product="L-methionine porter, putative"
                     /transcript_id="XM_568939.2"
                     /db_xref="GeneID:3255973"
     CDS             complement(join(1283106..1283248,1283298..1283411,
                     1283463..1283666,1283724..1283873,1283925..1284180,
                     1284234..1284570,1284623..1284711,1284767..1284833,
                     1284894..1285032,1285092..1285335))
                     /locus_tag="CNB04430"
                     /codon_start=1
                     /product="L-methionine porter, putative"
                     /protein_id="XP_568939.1"
                     /db_xref="GeneID:3255973"
                     /translation="MTSPYIPLPAAPLPLSEDPSSMELSSSADDDEGHGRPRLGRSAT
                     INSLGDFEFEHALLPLTLSGDADVDSHKEERHVELWHGVALVVGAQVGSGIFSSPGVV
                     VQEVGSVGASLMVWVISGVLAWTGASSYAELGCAIPLSGGSQAYLAYAFGPITSYLFT
                     WTAVSALKPGSAAMIALIFGEYVNRLISHSLGDSEVPAWSIEVTAVFAIFLCSILNAI
                     SPTMGTNSTVVLTVIKIGALVFVAVLGAIVLLRDGPGEGLMPSGLFKGTLADAGNYAI
                     AIYSGLWAFDGWDACCYVAGEMRDTNRDLPRALHSSMAIVVVLFLGANLSYFIVLSPS
                     VVASSNTVALDFGKVTIGKFGAVVFSTLVAISCFGALNGGLYTTARLIYAASKEHFLP
                     SIFSRLHPQRRTPDNAILLQGGLAIFFVIFGGGFRALLNFFSVASWTFYLLTVLGLLV
                     LRVKEPHLDRPYRAWLVTPIVFCAVSMFLLLMPIFAAPWEAFAAFVFIASGMPVYYLT
                     VRSRTRNAELDGASSSGWGVRVTLSDAWIKFREDIDRLLPREWQQPYRPQPHYNSDRR
                     RGMLGEQVEMSERR"
     gene            1285453..1287111
                     /locus_tag="CNB04440"
                     /db_xref="GeneID:3256108"
     mRNA            join(1285453..1285547,1285596..1285661,1285713..1285772,
                     1285823..1285873,1285930..1286122,1286176..1286357,
                     1286407..1286712,1286762..1286836,1286891..1286979,
                     1287032..1287111)
                     /locus_tag="CNB04440"
                     /product="DNA clamp loader, putative"
                     /transcript_id="XM_568940.2"
                     /db_xref="GeneID:3256108"
     CDS             join(1285527..1285547,1285596..1285661,1285713..1285772,
                     1285823..1285873,1285930..1286122,1286176..1286357,
                     1286407..1286712,1286762..1286836,1286891..1286979,
                     1287032..1287059)
                     /locus_tag="CNB04440"
                     /codon_start=1
                     /product="DNA clamp loader, putative"
                     /protein_id="XP_568940.1"
                     /db_xref="GeneID:3256108"
                     /translation="MSLWVDKYRPRTLDDLHYHDGLSSRLKSLAASGDFPHILFYGPS
                     GAGKKTRIMCTLRELYGPGVEKLRIDQRVFVTPSNRKLDVNVVQSNYHIELTPSDVGM
                     YDRVVIQDILKEIAQTQQVDLNAKQRFKVVIINEADALTRDAQAALRRTMEKYMTNMR
                     LILCANSTSKIIAPIRSRCLLMRVAAPTDDEMSTVLNYVAKKERFMLPSSANNAILET
                     SQGNLRKALLVFEAMRMQHPDLSGDVEVAKPDWETYCGKVADAILQEQTAQKLLDIRA
                     KIYELLSHCIPPTVVMKTISERLVEKVDDTLKPQIVHWTAYYELRMRMGSKKIFHIEA
                     FIAKVMTVYKQYTLMGFTEDFE"
     gene            complement(1287001..1288484)
                     /locus_tag="CNB04450"
                     /db_xref="GeneID:3256092"
     mRNA            complement(join(1287001..1287348,1287404..1287503,
                     1287557..1287664,1287729..1287828,1287882..1288028,
                     1288097..1288188,1288244..1288484))
                     /locus_tag="CNB04450"
                     /product="4-nitrophenylphosphatase, putative"
                     /transcript_id="XM_024656599.1"
                     /db_xref="GeneID:3256092"
     CDS             complement(join(1287132..1287348,1287404..1287503,
                     1287557..1287664,1287729..1287828,1287882..1288028,
                     1288097..1288188,1288244..1288394))
                     /locus_tag="CNB04450"
                     /codon_start=1
                     /product="4-nitrophenylphosphatase, putative"
                     /protein_id="XP_024512179.1"
                     /db_xref="GeneID:3256092"
                     /translation="MAPPFLKSVEEYEKLVDSVDTFLLDCDGVLYHGKQVVEGVRTVL
                     NMLRKKGKKIIFVTNNATKSRRKLKETFDQLGLNASIDECFGSAYASAVYISEVLNFP
                     KDKKVYVFGEEGLEEELDQCGIAHCGGSDPVDREFKAPIDFTVFKADDSIGAVLCGFD
                     SWINYQKLAKAMTYLRNPECKLILTNTDPTFPTHGDVFPGSGSLSIPIVNASKRKPLV
                     IGKPNKMMMDAILAHHMFDPSRALMVGDNLATDIAFGRNSKIRTLLVMGGVTKYEQVF
                     GENPNEVVPDLVMNSFGDLAVLADASEQ"
     gene            complement(1288675..1289953)
                     /locus_tag="CNB04460"
                     /db_xref="GeneID:3255877"
     mRNA            complement(join(1288675..1289364,1289414..1289524,
                     1289649..1289679,1289735..1289790,1289869..1289953))
                     /locus_tag="CNB04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656600.1"
                     /db_xref="GeneID:3255877"
     CDS             complement(join(1288807..1289364,1289414..1289524,
                     1289649..1289679,1289735..1289790,1289869..1289925))
                     /locus_tag="CNB04460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512180.1"
                     /db_xref="GeneID:3255877"
                     /translation="MHKDIYSTTIMAPPLVTIYVTSLTSAPAVRRHHDLLRSSLNAMN
                     IKYEEYDLVMDEEAKRRWQRAKPAGKVIGLPGYLVGGEWIGTMEDFEEAVETQSLESF
                     LKQDLNIPDEASTISDPSAPSASKQKSMQEMELEKIMGEMTNEDLDKLMNELGVSDDI
                     GKVGLINQPSSGINIRSWGGEEGVSKGPAPTNGEDVISKFLHQEEKKDEDKDTNDGTG
                     VYDNTKKVKDEITDVREDEKDLVLELKKESELDAREEKDIALAEKKEVGKLD"
     gene            1290119..1291866
                     /locus_tag="CNB04470"
                     /db_xref="GeneID:3255874"
     mRNA            join(1290119..1290232,1290302..1290358,1290412..1290425,
                     1290483..1290501,1290557..1290601,1290652..1290704,
                     1290881..1291264,1291319..1291351,1291403..1291491,
                     1291557..1291866)
                     /locus_tag="CNB04470"
                     /product="expressed protein"
                     /transcript_id="XM_024656601.1"
                     /db_xref="GeneID:3255874"
     CDS             join(1290216..1290232,1290302..1290358,1290412..1290425,
                     1290483..1290501,1290557..1290601,1290652..1290704,
                     1290881..1291264,1291319..1291351,1291403..1291422)
                     /locus_tag="CNB04470"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512181.1"
                     /db_xref="GeneID:3255874"
                     /translation="MSNQADQASTFTPIHPFNMEQPKTWSATIGMLNWDSDKIVFSKR
                     SLLEFLKSAGVTVNQNFSEIQKLPKYATFGKFSQAATDAAVADLVEAEIADPTTESAI
                     PPSKSTVPRKAKEDNLRLFGEEYEEQDALSLAPPRDGGDGVDVEIERLERMKVHVEQE
                     QEGGAKIEDVKDDDKEKKDRISNPPPGFKPTRKVTQAPGGKSSVGSILFGGDE"
     gene            complement(1291468..1294058)
                     /locus_tag="CNB04480"
                     /db_xref="GeneID:3256097"
     mRNA            complement(join(1291468..1291684,1291758..1291845,
                     1291898..1292430,1292477..1292563,1292610..1292633,
                     1292695..1292754,1292807..1292997,1293053..1293192,
                     1293261..1293318,1293374..1293405,1293466..1293572,
                     1293636..1294058))
                     /locus_tag="CNB04480"
                     /product="carboxypeptidase s precursor, putative"
                     /transcript_id="XM_568944.1"
                     /db_xref="GeneID:3256097"
     CDS             complement(join(1291583..1291684,1291758..1291845,
                     1291898..1292430,1292477..1292563,1292610..1292633,
                     1292695..1292754,1292807..1292997,1293053..1293192,
                     1293261..1293318,1293374..1293405,1293466..1293572,
                     1293636..1293977))
                     /locus_tag="CNB04480"
                     /codon_start=1
                     /product="carboxypeptidase s precursor, putative"
                     /protein_id="XP_568944.1"
                     /db_xref="GeneID:3256097"
                     /translation="MSEQKQSSALPLPIQSSTPYRPSWKPRILLGILFLLATAINFGP
                     SLSSVSEGENGRLDPSSYKFHDDLTTRFDIEQLKNWATCPQQPKPIYPNMTWEMTEEE
                     RNRSIEHYAQAVRIPTQSYDDNEEPDEDPRWKPFFIFQDWLKETYPLAHEKATIEYIN
                     RLGILATFKGSDPTLKPLLLMSHYDVVPAPESTYDRWTYPPFSGHNDGTYIWGRGAAD
                     DKPLLVAQWEAITHLLENGFTPRRTIILSHGNDEEEVFARRGQGQIAPLLEKRYGKDG
                     LLMVIDEGSGTEDDYYGSAFALPAMGEKGYMDITITVGTAGGHSSVPPEHTGIGIMSR
                     LLTSLEDNPFPTKLTPASPYLTALMCAAKHGSSFPSSLSSLLSSEGPTSYPKLAKALA
                     KTSLLERALLGTTTAVDVVHGGVKVNALPELVTAMVNFRIDFSESLNSTKEHVKYLAS
                     QVAEKSGLELSAFDGRDVGELNGKFVKVEVMGLPLEPAPRTPTEGGVWELFAGTVKAA
                     IPGPDGEERFVTPFASTGNTDCKMYYNLTKNVYRFMGTSFTGSENAHTVDEKGSIAGH
                     LQIVKWIHAIVQNADAYTGEE"
     gene            1294651..1295501
                     /locus_tag="CNB04500"
                     /db_xref="GeneID:3256102"
     mRNA            1294651..1295501
                     /locus_tag="CNB04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_568945.2"
                     /db_xref="GeneID:3256102"
     CDS             1294678..1295445
                     /locus_tag="CNB04500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568945.2"
                     /db_xref="GeneID:3256102"
                     /translation="MALRTPATALRAPFTPIRCMSSAARPSAVSKNTSSPQPSAPRVY
                     TARKTFLWNLYNQVLTKSSLVLVFDHANISAAEWSKLRRAVGSIKRPIVPYNPRLPKE
                     EQLERAEIEPAQLMVVRSGVLVATSKACSSPITPHITGQRAVLTCSTLSPTYLNKILT
                     ALSRTVKSIKRENSAIQPTLELVAGLVEGGKVMGQKELEELGKVPELDTLRAQLVGLL
                     EGQGRSLVGVLNQAAGGSLVRTLQGLENDLKEKEGSA"
     gene            complement(1295473..1298894)
                     /locus_tag="CNB04510"
                     /db_xref="GeneID:3256104"
     mRNA            complement(join(1295473..1295607,1295661..1295766,
                     1295817..1296010,1296062..1296521,1296572..1297411,
                     1297458..1297865,1297913..1298240,1298286..1298480,
                     1298537..1298894))
                     /locus_tag="CNB04510"
                     /product="DNA unwinding-related protein, putative"
                     /transcript_id="XM_568946.2"
                     /db_xref="GeneID:3256104"
     CDS             complement(join(1295561..1295607,1295661..1295766,
                     1295817..1296010,1296062..1296521,1296572..1297411,
                     1297458..1297865,1297913..1298240,1298286..1298480,
                     1298537..1298850))
                     /locus_tag="CNB04510"
                     /codon_start=1
                     /product="DNA unwinding-related protein, putative"
                     /protein_id="XP_568946.1"
                     /db_xref="GeneID:3256104"
                     /translation="MSSPPSNFNFPSSSAPMGSLRHSSPPGNRPIVDPLAFENVHGLA
                     GSLPGARNGDVDGSEAEEEGAVQGGRGRRQGRRGLDFDAIPRVKDTTGEKVMESFILF
                     LENYTESIAFPETPGSVVPPPTGDESKYYVEQVHLMKIDERTTLYVDFGHLLEREEIL
                     ARAIQSQYYRFLPYLRRAVQFLVRRYEPTWLYMSTSVNASETIPSSSLTIREFNVAFY
                     NLPLTSGIRDLRMDKIGQLMSISGTVTRTSEVRPELVSGTFVCDNCKTAIHDVEQQFK
                     YTEPIMCQNSTCSNRNQWQLNIEQSKFSDWQKVRIQENANEIPTGSMPRSLDVILRSE
                     IVERAKAGDKCTFTGTFIVVPDVSQLGLPGVNAEMMREAKGGRGDGGPASQGVTGLKA
                     LGVRDLQYKTAFLACMVQNADSRAGVTDVRGEVEDGQEDRESFLRSLTSQELDELRGM
                     LNSDNIYQSLVQSIAPTVYGHEIVKKGILLQLMGGVHKQTQEGIHLRGDINVCIVGDP
                     STSKSQFLKYVCGFLPRAVYTSGKASSAAGLTAAVVRDEESGEFTIEAGALMLADNGI
                     CAIDEFDKMDIADQVAIHEAMEQQTISIAKAGIQATLNARTSILAAANPVGGRYNRKM
                     SLRQNVAMSAPIMSRFDLFFVVLDECNENVDLHIAQHIVNVHRFRDDAIAPEFSTEAL
                     QRYIRYARTFSPKLTPAASAVLVEKYRSLRQDEGGPGKSSFRITVRQLESMIRLSEAI
                     ARANCQHEITPAIVREAYSLLRQSIIHVEQDDISFDDEDEGNGLNGPDGPGGDDGMDE
                     DPQLSSADLAALDEAESSYQRTSSAQQQEQQARETSVATTQPSKRKMRITYNQYMEIM
                     NLCVLYLSEVERDSGTGVDREELIQWYLEQKENDFESEEDMEYEREVIGKALTKLAKD
                     SYLLEIRGDVREGLVPSSELESSAGDGNKVYYLVHPQVDLSDLSSSIPA"
     gene            1299403..1300579
                     /locus_tag="CNB04520"
                     /db_xref="GeneID:3256105"
     mRNA            join(1299403..1299488,1299548..1299653,1299716..1299834,
                     1299887..1300113,1300164..1300579)
                     /locus_tag="CNB04520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656602.1"
                     /db_xref="GeneID:3256105"
     CDS             join(1299443..1299488,1299548..1299653,1299716..1299834,
                     1299887..1300113,1300164..1300223)
                     /locus_tag="CNB04520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512216.1"
                     /db_xref="GeneID:3256105"
                     /translation="MAKIVPPMNFGLVEDGFYRSAQPSELCFSFLEKLNLKSIIWVGA
                     EEPSDIFLSFIESQGIKLYNLAPQTSLNPHFPPPYTDSGVVPISGQYHLPPLPPPPEP
                     LIIQALTLLLRPSTFPTLLCCNMGRHRTGTVVGCYRKLQRWALSSILEEYRRYAGMKV
                     RVLNEQFIELFDTDLVSITAEQVTK"
     gene            complement(1300414..1301702)
                     /locus_tag="CNB04530"
                     /db_xref="GeneID:3256096"
     mRNA            complement(join(1300414..1300988,1301039..1301303,
                     1301357..1301702))
                     /locus_tag="CNB04530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568947.2"
                     /db_xref="GeneID:3256096"
     CDS             complement(join(1300466..1300988,1301039..1301303,
                     1301357..1301654))
                     /locus_tag="CNB04530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568947.1"
                     /db_xref="GeneID:3256096"
                     /translation="MARFTSIGMGRKKFVASAAEEARATVQNDQSGEPDAGPSSAPAA
                     EGKSNVDGSQTAGKKKRRGRIRARDESGKRIAIGEKKGPDDGKVAPRWGRDPELARRS
                     KLSAKHTEDRKQRRIEDRNANVTCFACRGVGHAARACPNILLAATTVGAPEEKGEGEG
                     QRGVERKEVGRRKGGKKGGDVTSNKCYRCNGTDHSLHQCPEPVDPQNPTPYATCYICL
                     GSGHLSSLCPQNKKGVYVNGGACKVCGSTAHRAKDCPHDKREKAPAFEQRKRGDIVLG
                     TGNGAGADEDDFMVEARHRPAQNGSKNKRHAPARNGERPMKRMRDPAEVEGYAQQGEV
                     VQAPSVPLTAKNRTEVVTKPKAKVVAF"
     gene            1301896..1303815
                     /locus_tag="CNB04540"
                     /db_xref="GeneID:3256099"
     mRNA            join(1301896..1302264,1302319..1302437,1302494..1302591,
                     1302646..1303176,1303262..1303376,1303445..1303594,
                     1303650..1303815)
                     /locus_tag="CNB04540"
                     /product="expressed protein"
                     /transcript_id="XM_024656603.1"
                     /db_xref="GeneID:3256099"
     CDS             join(1301940..1302264,1302319..1302437,1302494..1302591,
                     1302646..1302862)
                     /locus_tag="CNB04540"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512182.1"
                     /db_xref="GeneID:3256099"
                     /translation="MRPAVLRTVIRSLPRATAPLAARPVLVRFLSSTLPALKKNKGQN
                     TKTAKQKLRITEDDQAGATDDQGAGEVVIEEVVSKAKAKMEKSVHWAKAVLFEGVERG
                     RGRVSPALLDSVRVSLPDTPGTLHLNALASVTTKGNALFVEVWDTASLKQVESAIHAA
                     NLPGISPQRMAGTTLKIPIARPTVEQRAEILRQLAETVEAAKTQIRVARTDGFKALGG
                     RKANGTDEVQKVVDEMCKDLDGQLALAKKEFEKP"
     gene            complement(1303765..1307952)
                     /locus_tag="CNB04550"
                     /db_xref="GeneID:3256107"
     mRNA            complement(join(1303765..1306160,1306211..1306899,
                     1306953..1307199,1307247..1307369,1307431..1307510,
                     1307574..1307952))
                     /locus_tag="CNB04550"
                     /product="expressed protein"
                     /transcript_id="XM_568949.2"
                     /db_xref="GeneID:3256107"
     CDS             complement(join(1304016..1306160,1306211..1306899,
                     1306953..1307199,1307247..1307369,1307431..1307510,
                     1307574..1307814))
                     /locus_tag="CNB04550"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568949.1"
                     /db_xref="GeneID:3256107"
                     /translation="MEDPASSPSSSAYQLDSPSASTFLRTAQTLEGLAKQLENLKDEV
                     GNDTEVICCCGAVIDETQCEMGKERRSIEDKLKLSGEIGSALLQRCELLERKYRNEVE
                     RFHQQLEVKRTALAESVKRVHNLEKANMTHMQKYAEQSRKMEVVEKRYTEAMHTQTLT
                     QQTLTHVRTELTNLRNTHARQTVALASRGGVEEKLLEAEKRYEEARDMADEELRKGKE
                     EKRKRLRAEARIAELEEQVNTAHKEAEKIRADRAQDAQDLLANAKERLKMLHDELSET
                     YNGKSPSETPEYQRVLEDLVANNTLLKHDASELSDSLAESRDEVRVLRDEIESLRASI
                     PSRLASPIDHYPRLAHELNPRFSHSRTESSPIMGWNQPRLSPWEQHRKLSTGVAGLGM
                     GPIGETEGSITSDDVKSGPVSPIVDSPKQGVRASPGAAVGYMLNGVPKRPGTTSRRVS
                     GDSRIMRNYASRTIGSIDETLPRQEDPPISPGSDYFRAAEISRKRRSLRLARQTTISP
                     NEFSDYSPNASNTLVDQSVSADLPSPMSETAKLDKRAESPHVAKKKPLLLLTKSMGVQ
                     TDHTPDGEEREEKQRQRQTNAVSGWASTPRETSPTPGSESFPGTPGTPNPEDGPASAL
                     LVVVEHMSRILSKLRAADVPTLNKRLKKQHLAGDVVHLSQTTLRALQQEINEVRHHFR
                     GVHNFGTIDPRDFNLLLRLMRDVFNDLVELQAVVNDVTIAPAVAKKLQRAAYKAEEDE
                     AAKAGNVASGLGWIAAPITKFFVTPAENTEHDPNVPSGPGGPGVGLDKGRSPGMPRKP
                     APKQQAMASATATHVSVEFGGSGMVRRVAPALTTPSVAISSVSPAEILSNPSEMEQRT
                     VSGPAAIGRNEEGLVAPTVRTLRSVKSKANRNELLGIFAGAPPRATASGGEANWMVAK
                     GVGSESKRLNNQAYDDHAIKGGPSERKKLSSAVDAVIDQSAVEDDYDVAVAGSYEPPL
                     LERQLRPRGLSDSSIRSTTVSLAKGAIHEATMTTPIPRAAAYGATLSTGSVFQTLSRR
                     FYSFRAPELASANPAEEGNSDVISTPPKPATNTSNTPSPPRAILRSPRGNSRNSSVST
                     TSSLTRDRPNSSTPTSRKTITSTPLVTASSSQTRFFGYFASSLAAAGADGMNEGMEGE
                     GELVGGNLRQGEMLGHARVDSGKQKRVV"
     gene            complement(1308052..1310124)
                     /locus_tag="CNB04560"
                     /db_xref="GeneID:3255793"
     mRNA            complement(join(1308052..1308252,1308309..1308572,
                     1308623..1309237,1309298..1309350,1309405..1309503,
                     1309558..1309685,1309913..1309926,1309985..1310124))
                     /locus_tag="CNB04560"
                     /product="F-actin capping, putative"
                     /transcript_id="XM_569038.2"
                     /db_xref="GeneID:3255793"
     CDS             complement(join(1308156..1308252,1308309..1308572,
                     1308623..1309237,1309298..1309350,1309405..1309503,
                     1309558..1309685,1309913..1309926,1309985..1310061))
                     /locus_tag="CNB04560"
                     /codon_start=1
                     /product="F-actin capping, putative"
                     /protein_id="XP_569038.1"
                     /db_xref="GeneID:3255793"
                     /translation="MADLSVEDKCELAARLIEQTPPGEINDVINDIRAIINDDQALMP
                     HVLPALRSYNLSQLHVIEHPELDEVPAHTSLLSKAVMLPGSENERYVDNVGKKSFAFD
                     HLTFTVSDYRPYELPEEEETFRAELARSLEAYSKNHFPSGFYSVACSQFPLNPQPTAT
                     DIAEPESMAPDEAAPAEDLIPTAAEGEPSAETAVEKMDVEDDVDVTDVVDELVNSGDL
                     EPSSTPAVGHVDSKGDISDPERLEALDEAVEEEKEREEEEERENGEGNVVEKISEPKA
                     EEEDGPKLPEEEEEEIEKKIEGLNVEEKKQERIENPLYTLEVVGNRYNPSNFWTGRWR
                     TRWVVDQAAGKVNGIINVNVHYYEQGNVQLATNHTASFPCPTEPNGSQSIASQIVTTI
                     SKIETNYQLELNDVYNELGEKAFRALRRTLPVTRQKVDWDKVTGYTLGADLSKART"
     gene            complement(1310613..1311712)
                     /locus_tag="CNB04570"
                     /db_xref="GeneID:3255774"
     mRNA            complement(join(1310613..1310730,1310791..1310909,
                     1310972..1311059,1311201..1311307,1311380..1311589,
                     1311644..1311712))
                     /locus_tag="CNB04570"
                     /product="poly(A) binding protein, putative"
                     /transcript_id="XM_569037.2"
                     /db_xref="GeneID:3255774"
     CDS             complement(join(1310709..1310730,1310791..1310909,
                     1310972..1311059,1311201..1311307,1311380..1311589,
                     1311644..1311703))
                     /locus_tag="CNB04570"
                     /codon_start=1
                     /product="poly(A) binding protein, putative"
                     /protein_id="XP_569037.2"
                     /db_xref="GeneID:3255774"
                     /translation="MSEPRESSPRLNEDESNVDEELALMQARLAEMEAEKNALAASTS
                     ASGNGTPVSHNVSGGETNETHEGDGNMEEDGESSEAVDMRSVFIGNVDYGATPEEIQA
                     HFQACGTINRVTILCDKFTGHPKGYAYVEFAEPSIVQNALVLNESMFRGRMLQVKEKR
                     TNVPGMNMTNRGRGRGRGRGGFRARGFGGYRGRGRGRGRGW"
     gene            1311902..1312883
                     /locus_tag="CNB04580"
                     /db_xref="GeneID:3256014"
     mRNA            join(1311902..1311957,1312014..1312280,1312453..1312647,
                     1312715..1312883)
                     /locus_tag="CNB04580"
                     /product="structural molecule, putative"
                     /transcript_id="XM_568950.2"
                     /db_xref="GeneID:3256014"
     CDS             join(1311928..1311957,1312014..1312280,1312453..1312647,
                     1312715..1312744)
                     /locus_tag="CNB04580"
                     /codon_start=1
                     /product="structural molecule, putative"
                     /protein_id="XP_568950.2"
                     /db_xref="GeneID:3256014"
                     /translation="MATKSAASVVDWSKIYTGLGLDKQTLTSLQSFRARHSTALNKNS
                     ALKATAPSIDLSHYKSVLKDQQAVQLAEKVLGEFKPVNYDVSKWNGVVEAFEGKAVAA
                     AKETVSKISTEEASLQATLSNIKDARPFEDLTVDEVAKARPEIAKAVETMLKKGKWSV
                     PGYREKFGDLSLM"
     gene            complement(1313240..1314790)
                     /locus_tag="CNB04590"
                     /db_xref="GeneID:3255824"
     mRNA            complement(join(1313240..1313579,1313638..1313823,
                     1313872..1314030,1314090..1314423,1314481..1314790))
                     /locus_tag="CNB04590"
                     /product="expressed protein"
                     /transcript_id="XM_569035.2"
                     /db_xref="GeneID:3255824"
     CDS             complement(join(1313349..1313579,1313638..1313823,
                     1313872..1314030,1314090..1314423,1314481..1314692))
                     /locus_tag="CNB04590"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569035.1"
                     /db_xref="GeneID:3255824"
                     /translation="MSGILKILSTISPPPAAPLQRDYDGYQVCWKMFCFRPALFKFEA
                     MAFALLGLYLAMYFVGKVINGRRARSAVAPFQSFLSSQFTSIRPLLTSSPALHLLYAT
                     GRRNLLCLHTTITLYPLHDIPGLIYNFVKGIIEPTFDSSEGLVFDATLGMGVDGLQDG
                     VGVWAVVEKSFMRDLRQKRWDLTFAKLSEKPSFPITHALFQEHVDVTDIVLKTPNVGV
                     TELLADPVTAGVLKYLLITDAPALRPAKGPLAPKSKSRHIILSVHKPSNKEQEEAVKA
                     WLQVTLNLVDLLARPGLLKPDVVRKLVKTRQQVDEELVAQYEKEQNEENPPAETAEDR
                     RLAKKKAERAAMSEKELKKAEELDRKRELRKMQKKGATK"
     gene            complement(1315252..1317119)
                     /locus_tag="CNB04600"
                     /db_xref="GeneID:3255815"
     mRNA            complement(join(1315252..1315600,1315676..1316007,
                     1316059..1316164,1316218..1316246,1316323..1316363,
                     1316417..1316558,1316611..1316927,1316989..1317119))
                     /locus_tag="CNB04600"
                     /product="uridine transporter, putative"
                     /transcript_id="XM_024656604.1"
                     /db_xref="GeneID:3255815"
     CDS             complement(join(1315340..1315600,1315676..1316007,
                     1316059..1316077))
                     /locus_tag="CNB04600"
                     /codon_start=1
                     /product="uridine transporter, putative"
                     /protein_id="XP_024512219.1"
                     /db_xref="GeneID:3255815"
                     /translation="MIPGIYTMKNTMSASTGMTSADFLCFVLFTLIIIPCLLIPPEHL
                     CKPLVTIASFSTITCFIFFIWSLARSHGGGPLMQSEGLKLVGIEPVTGSALAWAIFHG
                     ISSALGGIYAGLLNMSDYTRFAKRPNDPLISQTIVSPVVGVLTSMIGIVCASSASQFY
                     PTETLLWIPYNLLTAMQTDLWRQLLDVSLLQVAVHFDFCVGVQ"
     gene            1317538..1321726
                     /locus_tag="CNB04610"
                     /db_xref="GeneID:3256025"
     mRNA            join(1317538..1317900,1317946..1318309,1318366..1318552,
                     1318605..1318897,1318949..1318968,1319023..1319666,
                     1319706..1320168,1320222..1320378,1320427..1320537,
                     1320588..1320984,1321023..1321078,1321128..1321402,
                     1321460..1321726)
                     /locus_tag="CNB04610"
                     /product="hydantoinase, putative"
                     /transcript_id="XM_024656605.1"
                     /db_xref="GeneID:3256025"
     CDS             join(1317845..1317900,1317946..1318309,1318366..1318552,
                     1318605..1318897,1318949..1318968,1319023..1319666,
                     1319706..1320168,1320222..1320378,1320427..1320537,
                     1320588..1320984,1321023..1321078,1321128..1321379)
                     /locus_tag="CNB04610"
                     /codon_start=1
                     /product="hydantoinase, putative"
                     /protein_id="XP_024512183.1"
                     /db_xref="GeneID:3256025"
                     /translation="MTIAPVNIRVGVDVGGTNTDAVILDLTSGCSKPVLAAHKVPTTA
                     DIASGIQAAIKATLEKASMDRSQVQAVAIGTTSFVNSLIERDGSKLERVAVIRLSGPF
                     SKLAPPFVSFPYELRHVLEGPTFFAQGGLQVDGTEITAVDPVEVRGICAEIQRQGIKS
                     VAVSGCYSPIDNDIRQEELVRDIILDELPGIKVCISKEVANVGLLQRENATILNAGLL
                     AFANHTVEGFRESIRALSLSCPLFLTSNDGTLMTCEMAARFPIKTFSSGPTNSMRGAN
                     FLANLESQEKNKETALVVDVGGTTTEIGVLLPSGFPRQAATYHELCGVSLNFSMPHVH
                     SIGLGGGSRVRKDASGKIAIGPDSVGYRIHELGLIFGGDILTTTDIIIAAGSSTPFGN
                     PELVKNIPKEDIKAVQGKIKSMLESAVDGMKTSATDVPLYLVGGGAILVPDELKGVSK
                     VYRFPYYDAANAVGAACAQISGVIDTFEDTSSLSMGEVQRMVEQRAINKAVAAGADPN
                     ETVVVESEAIPIAYTTGRCRFYVKAAGEWRGSVSASDDSRLQNAKPSFIWDKITRVTP
                     IPAANANRQIPDKDIAYSTPELLEYKPKVIDGEWFLSEIDIEWISTGCYILGTGGGGN
                     PHNVYLALREMMRAGSKCRVIDFESFDPNKMVVYGGGIGSPEVAAEKLMSDNAGHTIK
                     ALLDFMKIENLGALTAIEIGGGNGMVNMVSGASDYLDVPVLDGDFMGRAYPTGWQTTL
                     NVYAKDDSGSIMLPNAMTSGDGTTIFMTTAKHYKDIDRVLRGACIEMGTSASVAARPL
                     TKAEIEIPLIRNTISQSWRLGRAVALANRQADIGNIGRILVDALGGPKAAKVLFAGKI
                     HAVGRRLHKGHSYGEIEIHAMSGDEEGVEEGMNEKFEGVMKIPFKNENLLAEHTVNNK
                     TEVVAGVPDLIAVLDAQNGTALGTPEYKYGLRVIVIGITAAPQWTDTPRGLELGALPA
                     FGYDLPYKPLGEYVKPRSVIEEYNVDV"
     gene            1322003..1323605
                     /locus_tag="CNB04620"
                     /db_xref="GeneID:3256030"
     mRNA            join(1322003..1322224,1322292..1322396,1322449..1322619,
                     1322676..1322900,1322952..1323132,1323188..1323605)
                     /locus_tag="CNB04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_568952.2"
                     /db_xref="GeneID:3256030"
     CDS             join(1322086..1322224,1322292..1322396,1322449..1322619,
                     1322676..1322900,1322952..1323132,1323188..1323296)
                     /locus_tag="CNB04620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568952.1"
                     /db_xref="GeneID:3256030"
                     /translation="MSSNAAKKIVVFTATGSQGSSVARYLSEAGYKIVALTRDTESKS
                     AKALKAKGYEVARADNTDPESYKPALQGAYGAFVNTDFWSIFPTKNFDPELTQAEEFK
                     QGTAALQACKEAGLKQIVYSTLDDGTGCVHWQSKAEVSKWAKNNDIPITNLVLTFYYE
                     NIVKMNACAGDDQGPNTFTLNLPLPEDSLVPGFPVAQTGLWVKTAFDDPKNWIGKDIY
                     ACTDIITVKEMADQLSAVSGKTVKTNGLPVEVFKSKDFQKKVGQELWDNMDLFYRRFL
                     QRDVQESVRLAPGAWSFEAWAKQNDQLKKALGF"
     gene            1324224..1326369
                     /locus_tag="CNB04630"
                     /db_xref="GeneID:3256033"
     mRNA            join(1324224..1324539,1324597..1324701,1324762..1325157,
                     1325208..1325388,1325443..1326369)
                     /locus_tag="CNB04630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568953.2"
                     /db_xref="GeneID:3256033"
     CDS             join(1324395..1324539,1324597..1324701,1324762..1325157,
                     1325208..1325388,1325443..1325551)
                     /locus_tag="CNB04630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568953.1"
                     /db_xref="GeneID:3256033"
                     /translation="MSALSNASKSIVVFTATGKQGSSVARTLSDAGYKIIALTRNPDS
                     ASAQRLKAKGYQVVKADLNDPQSYKEALEGAYGAFVNTDFWSILPTKNSDLAATQAEE
                     TLQGIAALQACKEAGLKHIVYATLDDGTGVSHWQSKADVSKWGLANNVPLTNLVLSFF
                     FDNLSSKNLRIASPNDPHTFIFDLAVAEDVKLWGFSAAQTGLWVKTALENPDSWIGKD
                     LQACTDFISLKEMAAKLSKLSGKNVKSNGVSNEIYESQGFIDKVGKELWDNFSVFYKG
                     TVKRDIKESINNAPGAWDFESWAEQNDKVKEILEF"
     gene            complement(1325646..1328421)
                     /locus_tag="CNB04640"
                     /db_xref="GeneID:3256036"
     mRNA            complement(join(1325646..1325944,1325994..1326306,
                     1326351..1327284,1327335..1327709,1327753..1328421))
                     /locus_tag="CNB04640"
                     /product="rRNA processing-related protein, putative"
                     /transcript_id="XM_568954.2"
                     /db_xref="GeneID:3256036"
     CDS             complement(join(1325680..1325944,1325994..1326306,
                     1326351..1327284,1327335..1327709,1327753..1328358))
                     /locus_tag="CNB04640"
                     /codon_start=1
                     /product="rRNA processing-related protein, putative"
                     /protein_id="XP_568954.1"
                     /db_xref="GeneID:3256036"
                     /translation="MAPQPLKVGTSKLSKMVKSAPKTAGKAKKRAVEQVSEESDEEFG
                     DQGSGIDMSDDEEEVDGDDEEDEDEAFPEFDSELEDNDQEEASDEEQDEQDTSDESEI
                     VEEDSDSESGYNTSDIERMYASDDDLSSEENKDLPVDEKLSRLIAKNTVKPDDSIGTD
                     DKISRAKEGVGRLVPSKHVKGSFVREYDEYEAGYGSESSTEDNPNTVGNIPMEWYDDL
                     PHIGYDVNGRKIFRPLQGDELDKFLANVEDPSAWTSAEDKLLQQNVQLSDKELDIIRR
                     LERAENPDADFDPYQPTIEWFTGEGKERVMPLSAAPEPKRRFVPSKWEHKKIMKIVKA
                     IREGRIIPNKPSAEKPRFYPIWSDADQHNPHVMYMPAPQLPPPKTAESYNPPEEYLPT
                     EEEKAEWEAMDKEDRKTDFLPEKYDALRKVPGYKNLVQEKFERCLDLYLAPRTRRVKL
                     NIDPDSLIPKLPAPKELKPFPIASTVQYRHPGDTRVRSVSTSPDGQWIASGSEDGVVR
                     VWDLGNGREVWRWDLHAGPIQYVEWSPSREESLLVALVAGKIAVLSPLALVAPHIAAQ
                     TLTHSNTAFATSSATTKQGAGNEVKGIESVKWTRPSERERERGVLVYVEVPGTPKQVT
                     WHRKGDYFATVASDAANKSVLIHQLSRHGSQSPFRKTPGTIQRVAFHPSKPHFFAATQ
                     RYIRLYDLAAQKLIRTLQSGVKWISSMDVHSGGDNLIIGSYDKKLAWFDMDLSAKPYK
                     TLRYHNRALRSVAYHPTLPLFASASDDGTVHIFHCTVYTDLMQNPLIVPLKILRGHKV
                     IDGIGVLDLRWVPGKPWLVSSGADGEVRLWCS"
     gene            1328529..1330380
                     /locus_tag="CNB04650"
                     /db_xref="GeneID:3256040"
     mRNA            join(1328529..1328694,1328768..1329479,1329533..1329647,
                     1329697..1330380)
                     /locus_tag="CNB04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_568955.2"
                     /db_xref="GeneID:3256040"
     CDS             join(1328560..1328694,1328768..1329479,1329533..1329647,
                     1329697..1330261)
                     /locus_tag="CNB04650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568955.1"
                     /db_xref="GeneID:3256040"
                     /translation="MDNTNDPTMGGLDALVAAASSVSAGKNRRQQPDNIAMDMIDPAL
                     HNESGDTSNPVETISSLLANPAVVSLIAEYNAKKGHRQVSLYTQLLSGSSGGQPPATP
                     VQQTRYGRISRPPLHAPGTPGRMSEHGGSDSQIQAIKDALENVSQQEGDGDVSYDSLV
                     GAVVPSGAEGRFWRPGVEGSGATSWVGDAETLAQAADASHRAVLNRVAAMGANVTGDA
                     GEEQAKGNNRGVTEMSASTDEDGRVPDKDGNLPEWPLPPSGKGGRKNMPRDELLARRR
                     ARNRVAAQESRKKKKQFFGSLAERLQEKEAAYNELETHCRNLEREIELLRKTVTDANL
                     PLPNFIPEVHVPAPVSSGETPAPTTETPAELAFSELFNIDDNDDNDADFVPPSSPKRD
                     SDSEDSDDEVDEEQPRRKKTKRAQEQEQEAEPMAEDEDEDLFLPIVDVPVPPRDSEDH
                     QKIVKQAMTELHVDTPEQLMNVVKKMVETAEYGGVTEEQVGMLSKLLALGQAQGVSVW
                     "
     gene            complement(1330763..1333274)
                     /locus_tag="CNB04660"
                     /db_xref="GeneID:3256041"
     mRNA            complement(join(1330763..1331600,1331656..1331779,
                     1331836..1332224,1332270..1332419,1332472..1332615,
                     1332665..1332916,1332964..1333129,1333178..1333274))
                     /locus_tag="CNB04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_568956.2"
                     /db_xref="GeneID:3256041"
     CDS             complement(join(1330875..1331600,1331656..1331779,
                     1331836..1332224,1332270..1332419,1332472..1332615,
                     1332665..1332916,1332964..1333129,1333178..1333251))
                     /locus_tag="CNB04660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_568956.1"
                     /db_xref="GeneID:3256041"
                     /translation="MSRLGEPSRAVRYPEKVATGAREADPDSSTATVLSAELTTINSQ
                     LMSHGWAKRPLNLDALSQKDYNEVVAVLFELMGASVSNLNMLETLNGRHRTLEYEYER
                     LQKTTNSLKTSNARLESEVAGWKSKCADIEKRLVLEEIKTKELREENSRGRKALETVR
                     VAATHETKKVQMSLDKAHAQLAKIGNDPTIANKPQGLVLLNPIPAGRIQPVAASQSPL
                     LEQTLRDLSDIRASLQEETEAFRHVVVSTGNALREALAASCGQEPPIRLLQSQFFSPL
                     NSSTARTLGSSIAQSASSMSHPSIASARLQSLIEQIRNRITEGVPQYTANGEHLTKQP
                     TPEEIEEQKRVEREKEKIQRDLEDRIKDLEVELNCAKRKEEEASKVVADYAKKQVQRE
                     LNVHDSKEDMDMEIQKQALDKERKRYAEEAVKLRQERQELELERQAFLEEKRRAEEEA
                     AKAPKIAPSTAIIAEPTLNHEMEAEEPIPASPSITWHQHRPHSPSPLSPQHPKIRTPR
                     AHVAGGKRKTAKTPLSRLVLEKAVRQKGRELGVGGLLMKEKDLMSGSVLGVERGRKTN
                     VGPSNRSPRKGKERAVDGMRGSAMRNSTFGNNHSSSGSEASSVSGSKGVTPALKPLIS
                     NKVAGNVERPEMAVLTMRTSIGTTAASQRKAMESNSTGAKTTMVKKAAWR"
     gene            1333454..1335700
                     /locus_tag="CNB04670"
                     /db_xref="GeneID:3256043"
     mRNA            join(1333454..1333945,1334007..1334536,1334588..1335700)
                     /locus_tag="CNB04670"
                     /product="expressed protein"
                     /transcript_id="XM_568957.2"
                     /db_xref="GeneID:3256043"
     CDS             join(1333550..1333945,1334007..1334536,1334588..1335638)
                     /locus_tag="CNB04670"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568957.1"
                     /db_xref="GeneID:3256043"
                     /translation="MQSEQAHGPVNDSAPFPPPSPTLFRHRPQPDGPEPSALRHRLPR
                     TTSHESQQSGSHSVRIRIQSPFGDSGASLERRKEGWVLPANETIGELKDDLAHGQLEG
                     AGLWEREDMRIVYHGRIVRDQEKLGDVVGKIGDHTHVSTLHLVARRVQTTPVVQMSDP
                     IDSSALGPQPSTPTAPAVSNSNSVNSLALSDSIHYLLFTSRHHLFSLLSLEPLKWENT
                     VPPPVVSKNEAREAVLSVVKAYAAHRDTTEEGWENWELAFAEDSDDDLKRIWDETGQR
                     HGIEKEINDLWSGLLNRNWSNRDVGEKTEVEIDGTVYLLDLPALSACTPAQLTHLLIY
                     LRITSLIPLLNSAFYEATQQETQSRLPLPTVTSATAGPSLPPNVRIVYRRTFRFFLPY
                     IPRPVFSHFFFSTFKVFTMLWMLTRGMKWTDPRYWAIAGIAWGWWAVDGWNAIAVFLR
                     NRQANELAQEAERAARNERQAVPAGPGAEMTQTQQIPAQGNAPNRRRSRASLSLTTSF
                     APLVHLSIDNIQLRILPSSGGQPDSFAPAPRTQPPRFQTQVLLPVFLWAVTLMPGWET
                     ARAKLIRMRERRMRALVNVTNPERNQPGEGAEQASERQREPELPAGLSGPARAYYLRV
                     LSRGDAIDWDEEREAQRAMGVGEEQDERDRVGLL"
     gene            1336410..1338264
                     /locus_tag="CNB04680"
                     /db_xref="GeneID:3256045"
     mRNA            join(1336410..1336715,1336770..1337102,1337157..1337392,
                     1337448..1338264)
                     /locus_tag="CNB04680"
                     /product="ATP(GTP)-binding protein Fet5, putative"
                     /transcript_id="XM_024656606.1"
                     /db_xref="GeneID:3256045"
     CDS             join(1336480..1336715,1336770..1337102,1337157..1337392,
                     1337448..1337461)
                     /locus_tag="CNB04680"
                     /codon_start=1
                     /product="ATP(GTP)-binding protein Fet5, putative"
                     /protein_id="XP_024512184.1"
                     /db_xref="GeneID:3256045"
                     /translation="MRYAVLVTGPAGAGKSTFCASLITHAQTIGRSVHLVNLDPAADK
                     FEYEPTIDIRDLINLEDVMEELEFGPNGGLIYCFEYLLNNLDWLEDELGAYEDDYLII
                     DCPGQIELYTHVPLLPRLATFLSTSLNFRTSAVYLIDSQFMQDKSKFFAGVMSAMSCM
                     LSLGISMLCLMSKMDLVKDKKGRTKREVGRYLDPDPNLLLEDINQGTNSKFNQLNRAV
                     VSLIEDQNIVSFLPLDVTSEDSVNTVLSHIDNMMQYGEDEEPKVPKDMDDGDFD"
     gene            complement(1337462..1338766)
                     /locus_tag="CNB04685"
                     /db_xref="GeneID:36392752"
     mRNA            complement(join(1337462..1337601,1337656..1337917,
                     1337974..1338361,1338419..1338766))
                     /locus_tag="CNB04685"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658787.1"
                     /db_xref="GeneID:36392752"
     CDS             complement(join(1337600..1337601,1337656..1337917,
                     1337974..1338361,1338419..1338651))
                     /locus_tag="CNB04685"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514236.1"
                     /db_xref="GeneID:36392752"
                     /translation="MKMLLIPPGLAPIPENDNDDFTFLSASSSPSDTPPLTPLATPHG
                     SPNSMSLASGNDIEMVASDGIKFYTSSVLLQGASPVFATMTRPSKLGLPSIIYFADSH
                     LEASATITLFLHLLSSQSFSSLPTPTAQSFSHYETLISFLKKFQCDGALLEELGRMLR
                     VWLEEGCISASRIFKAGCMMGDEELCKFAVQAGNEWTWIGASRSGSSPYLPGCKKRKL
                     SSSGSEFDLHEDGIFGAPALDISAMPYSFFRSLPDTHKFALLRATRNIVGPLVVLDRC
                     NWDKVAEEFEKILSDVKR"
     gene            complement(1338863..1341320)
                     /locus_tag="CNB04690"
                     /db_xref="GeneID:3256042"
     mRNA            complement(join(1338863..1339532,1339831..1339948,
                     1340002..1340202,1340259..1340401,1340454..1340460,
                     1340530..1340535,1340586..1340617,1340670..1340766,
                     1340845..1340920,1341051..1341170,1341235..1341320))
                     /locus_tag="CNB04690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656607.1"
                     /db_xref="GeneID:3256042"
     mRNA            complement(join(1338863..1339532,1339627..1339948,
                     1340002..1340202,1340259..1340401,1340454..1340460,
                     1340530..1340535,1340586..1340617,1340670..1340766,
                     1340845..1340920,1341051..1341170,1341235..1341320))
                     /locus_tag="CNB04690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656608.1"
                     /db_xref="GeneID:3256042"
     CDS             complement(join(1338982..1339532,1339831..1339948,
                     1340002..1340202,1340259..1340401,1340454..1340460,
                     1340530..1340535,1340586..1340617,1340670..1340766,
                     1340845..1340920,1341051..1341170,1341235..1341263))
                     /locus_tag="CNB04690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512185.1"
                     /db_xref="GeneID:3256042"
                     /translation="MAARNWSRVWVGGTVILISFIAFSSQIFVIWPWYGREISLDLLK
                     LLVPLNLAAFMIFWNYRLCVITSPGSVPEGWRPNIGAMDGMEVKKGTHTPRYCKNCEH
                     YKPPRAHHCRQCKTCWLKLDHHCPWIGNCVGFYNQGHFIRFLLWVDIGTTFHLIIMVR
                     RVLYIAEYYHQEPTLADVLFLVFNFATCVPVWLCVGMFSIYHVYLACGNSTTIEGWEK
                     DKVATLIRRGKIKEVKYPYNIGIYKNIKSVLGPNPFLWLWPQKMQGDGLSFPVNPSAG
                     DHTTQYFWPPQDPSRLPNPPPIPAHASPFVYGNNGFNPNLQPTNSLRARRSSTPHIDE
                     DEHSHERDQYRHYSSGEERDNDSISTSSSPKPYLSDYDHYDEGPMYPGERMTALIPRV
                     RRGSEGWEVAPGGGWNAYSGMMDEEVGWDDEVGYDEAPGEGPYVERPWEMRGRYNVYD
                     TEEESGYAH"
     CDS             complement(join(1339637..1339948,1340002..1340202,
                     1340259..1340401,1340454..1340460,1340530..1340535,
                     1340586..1340617,1340670..1340766,1340845..1340920,
                     1341051..1341170,1341235..1341263))
                     /locus_tag="CNB04690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512186.1"
                     /db_xref="GeneID:3256042"
                     /translation="MAARNWSRVWVGGTVILISFIAFSSQIFVIWPWYGREISLDLLK
                     LLVPLNLAAFMIFWNYRLCVITSPGSVPEGWRPNIGAMDGMEVKKGTHTPRYCKNCEH
                     YKPPRAHHCRQCKTCWLKLDHHCPWIGNCVGFYNQGHFIRFLLWVDIGTTFHLIIMVR
                     RVLYIAEYYHQEPTLADVLFLVFNFATCVPVWLCVGMFSIYHVYLACGNSTTIEGWEK
                     DKVATLIRRGKIKEVKYPYNIGIYKNIKSVLGPNPFLWLWPQKMQGDGLSFPVNPSAG
                     GESATVEWAGIVAPREGSSAPGEYGAADQCESAGSGSGTNGRPGMGHGEERVRHGRAR
                     VEHSMV"
     gene            complement(1341451..1342651)
                     /locus_tag="CNB04700"
                     /db_xref="GeneID:3256047"
     mRNA            complement(join(1341451..1341729,1341806..1342025,
                     1342099..1342155,1342235..1342277,1342357..1342651))
                     /locus_tag="CNB04700"
                     /product="expressed protein"
                     /transcript_id="XM_568961.2"
                     /db_xref="GeneID:3256047"
     CDS             complement(join(1341650..1341729,1341806..1342025,
                     1342099..1342155,1342235..1342277,1342357..1342565))
                     /locus_tag="CNB04700"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_568961.1"
                     /db_xref="GeneID:3256047"
                     /translation="MTSSGLTNRRPSFPSQSSGNVVASIDSPPDRTSVFIKHGKYILV
                     GAGGSWWVDLPTVLSRVLHKENGWIKRMMLAGLGLHVATIFIFLYLVLFIPWLRGYIP
                     NYTKWQESARLRIIVPLLTMTILGSWTCLVISLSQAGKTTMFESVMDAVKGVGNASLG
                     QMEGRDGMGVFSSMVGATSLFMFTLGILGMIPAPSHVLRKQD"
     gene            complement(1343793..1345394)
                     /locus_tag="CNB04710"
                     /db_xref="GeneID:3255834"
     mRNA            complement(join(1343793..1343911,1343965..1344071,
                     1344128..1344327,1344387..1344813,1344869..1344882,
                     1344951..1344957,1345012..1345060,1345123..1345194,
                     1345287..1345394))
                     /locus_tag="CNB04710"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_024656609.1"
                     /db_xref="GeneID:3255834"
     CDS             complement(join(1343854..1343911,1343965..1344071,
                     1344128..1344327,1344387..1344813,1344869..1344882,
                     1344951..1344957,1345012..1345060,1345123..1345194,
                     1345287..1345312))
                     /locus_tag="CNB04710"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_024512218.1"
                     /db_xref="GeneID:3255834"
                     /translation="MSLGRTLKLNNGVVAPQIGFGTWQAAPGEVEKAVEEAIKVGYRH
                     IDCALIYQNQDEVAQGIKASGVPRKDLFLVSKLWNNSHRPEKVEADLDTSLKQLGTDY
                     LDVYLIHWPVPFAPGDNLFPKTEDGKVAIDWDGPSVVDTWKELIRISKETKKVKAIGV
                     SNFNVELLEKLIKETGVVPTMNQIECHPSLIQPELFKYCKEKNIVITAYSPLGNNTTG
                     KPRIIDQPQIIDIAKKLNKEPAQVLINWAAHQGFAVIPKSVTPSRIKSNFEDFKLNDD
                     VFEEINKVGKANAARANIPAEYNPSWPINVFGEKSEEQYKKVW"
     gene            complement(1345649..1346797)
                     /locus_tag="CNB04715"
                     /db_xref="GeneID:36392753"
     mRNA            complement(join(1345649..1345789,1345866..1345967,
                     1346029..1346047,1346103..1346124,1346214..1346231,
                     1346289..1346373,1346432..1346515,1346612..1346797))
                     /locus_tag="CNB04715"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658797.1"
                     /db_xref="GeneID:36392753"
     CDS             complement(join(1345742..1345789,1345866..1345967,
                     1346029..1346047,1346103..1346124,1346214..1346231,
                     1346289..1346373,1346432..1346515,1346612..1346752))
                     /locus_tag="CNB04715"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514237.1"
                     /db_xref="GeneID:36392753"
                     /translation="MLTIPRLLGTRILEKRCAYSTDAKNLRLETKAGRMSFSLPFKYI
                     SAEQLAEIIKAKPAETLKDFVVVDVRDSDFVGGNIVSALNYPSDTFHATVDELVEKLE
                     KVPRVVFHCYLSQARGPKAARIYAETRNHRYPNPSTPQEIFVLRDGFSGFQTRYRDDP
                     ELIEKFNKYYHD"
     gene            1346930..1347916
                     /locus_tag="CNB04720"
                     /db_xref="GeneID:3256050"
     mRNA            join(1346930..1347002,1347077..1347169,1347238..1347336,
                     1347408..1347484,1347551..1347621,1347693..1347916)
                     /locus_tag="CNB04720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568962.2"
                     /db_xref="GeneID:3256050"
     CDS             join(1346970..1347002,1347077..1347169,1347238..1347336,
                     1347408..1347484,1347551..1347621,1347693..1347778)
                     /locus_tag="CNB04720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568962.1"
                     /db_xref="GeneID:3256050"
                     /translation="MVFAKLGLRTLRSLPQSQVARSTTILAQRRFLSAEARKLIDGAV
                     KSNPLVVFMKGTPDAPQCGFSRAVCQILDVQGVPRENLKTYNCLEDQELREGIKEYSE
                     WPTIPQVYIKGEFVGGCDILLSMHQSGELEDLLIKEGLAPPLPEGPEGSA"
     gene            complement(1347901..1349104)
                     /locus_tag="CNB04730"
                     /db_xref="GeneID:3256053"
     mRNA            complement(join(1347901..1348400,1348476..1348937,
                     1348995..1349104))
                     /locus_tag="CNB04730"
                     /product="nam9 protein, mitochondrial precursor, putative"
                     /transcript_id="XM_568963.2"
                     /db_xref="GeneID:3256053"
     CDS             complement(join(1347972..1348400,1348476..1348937,
                     1348995..1349057))
                     /locus_tag="CNB04730"
                     /codon_start=1
                     /product="nam9 protein, mitochondrial precursor, putative"
                     /protein_id="XP_568963.1"
                     /db_xref="GeneID:3256053"
                     /translation="MPYRPYTTRNVFNHKRAIPRMSWSPENLFNIWQRSSPESPIRRE
                     HDFTRTNATPFQLRWIAKRLLRGYHGDHIGYTKFARWYMPEKLPAIHEGGKNDVGEMG
                     KWIEGRERAGGRTRDEKKAKSKAKDSRAPVGTMLFADIERRLDVLIFRSCFAQNVWEA
                     RRYVVQGHVKLNGQVMRNPNIMLNPGDVFTVNPSQIVMLQAPKSKFQPPAEEEVEGEA
                     SEEKPSEPTGPAASSYFKLPDYASPHLFVPAYLLPSYLTCSAVYVRHPTARPNYSEIP
                     SPYDAGGELMSLGWEWFKRSAPRMRNKTKKWPNPFGGFGKQ"
     gene            complement(1349314..1352728)
                     /locus_tag="CNB04740"
                     /db_xref="GeneID:3256059"
     mRNA            complement(join(1349314..1349811,1349864..1350236,
                     1350305..1350735,1350794..1351165,1352555..1352605,
                     1352665..1352728))
                     /locus_tag="CNB04740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658808.1"
                     /db_xref="GeneID:3256059"
     mRNA            complement(join(1349314..1349811,1349864..1350236,
                     1350305..1350735,1350794..1351165,1351227..1352202,
                     1352356..1352508,1352555..1352605,1352665..1352728))
                     /locus_tag="CNB04740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656610.1"
                     /db_xref="GeneID:3256059"
     CDS             complement(join(1349339..1349811,1349864..1350236,
                     1350305..1350735,1350794..1351165,1352555..1352605,
                     1352665..1352704))
                     /locus_tag="CNB04740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514238.1"
                     /db_xref="GeneID:3256059"
                     /translation="MSRHRFVRNIDLNDELDDGDEEVGMSAEETAAKAKAAQTAKSAS
                     LPGKPRVQQVANQKSKLAVSQPNSPSTSASKSTSKSGSASSTPRTLGKSNLSTDLEGL
                     HLNEEMDEAEREREKEKFKERQVLSMKQEELIAKAKEEEEKSGKKNVSLIVVGHVDAG
                     KSTLMGRVLYDIGELSEKEKIANERGSKKLGKGSFAFAWGLDALGDERDRGVTIDIAT
                     THFVTPHRNFTLLDAPGHRDFIPAMISGAAQADVALLVIDGSPGEFEAGFERGGQTRE
                     HAWLVRSLGVKEIIVGVNKMDLVSWSQDRYEEIVESLKPFLLSAGFNSTKTTFLPLAA
                     MEGINILDNDQPELKKWYSGPALIDALDDVEVPTRPYDSPLRIPLSNVFKGQTAIASG
                     VAVSGRLCSGVVQVGDRLRAVPGDEVANVRTIEVDDDSAPYAVAGQNVTLYLSNIDPI
                     NLSIGTVLCPTSIPVPLVTKFTAQILVFDLQSPIIAGTPVELFHHSMNLPATISKLVS
                     ILEKGQVVKERPRVLQKGTTAMVELSLRPSSSGKISSIPLETATDNKEMGRVLIRRNG
                     ETIAAGMVMELLG"
     CDS             complement(join(1351331..1352202,1352356..1352508,
                     1352555..1352605,1352665..1352704))
                     /locus_tag="CNB04740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512187.1"
                     /db_xref="GeneID:3256059"
                     /translation="MSRHRFVRNIDLNDELDDGDEEVGMSAEETAQMNRAVSVARNLL
                     KDVTPPISDNEIADSVWHYWFDGEKAAAWLRQDREKKGEAPPSYLEPTPLQQPRHRPK
                     ILVPPSQPTQAQEDIQPPLTALQRLTLSRRQGSPASPAPSSSVGEKPMSKLALLAQKR
                     REAAAAATTTSETIQSGIVSPQTSRQPSASGTQPSSGTQSPSQLEKKPLSKLAQKMAA
                     ARAAREEAAAAAKSSKLEKNSVGDQMEGDEPLPSLSSPADPMLSLFSPPATSPKPKLK
                     PTHPSPFFSIITSTSSQGGAPGPAKDHLPPEPTSANLHAPLITDVDVLVKQFEQAFAE
                     SPDEIVLRKRQGRAGTADMVTAVKKQATGTGIKPKVK"
     gene            complement(1352896..1355140)
                     /locus_tag="CNB04750"
                     /db_xref="GeneID:3256062"
     mRNA            complement(join(1352896..1353226,1353279..1353398,
                     1353448..1353532,1353583..1353679,1353727..1353931,
                     1353990..1354162,1354212..1354235,1354281..1354354,
                     1354403..1354538,1354592..1354626,1354691..1354860,
                     1354918..1355140))
                     /locus_tag="CNB04750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568965.2"
                     /db_xref="GeneID:3256062"
     CDS             complement(join(1352985..1353226,1353279..1353398,
                     1353448..1353532,1353583..1353679,1353727..1353931,
                     1353990..1354162,1354212..1354235,1354281..1354354,
                     1354403..1354538,1354592..1354626,1354691..1354860,
                     1354918..1355092))
                     /locus_tag="CNB04750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568965.1"
                     /db_xref="GeneID:3256062"
                     /translation="MALVDVEEQSTAGPSHSRSSSVLAATAAESVSSSRRESRRGSKD
                     REVGDGGRGGDDHVSFKTAEEDIELQDSATAPLLAGAAASPRLLDSEERHLLEAEGHN
                     SVSRGSILDAVTNMANSIIGAGIVGLPYAVSEAGFVMGVFLLIALAAISDWTIRLVIL
                     TSKLSGRESYTETMYHCFGPLGAMAVSFFQFSFAFGGTAAFHVIVGDTIPRVVSYIFP
                     SFAENVFLRLFVNRQAVIIMCTLFISFPLSLHRDIVKLSKSSSFALVSMVIIIVSVLF
                     RSVAVDPSLRGSSTDVFSIVKPGVFQAIGVISFAYACHHNSNYIYKSINVPTLDRFDM
                     VTHISTGISLIACLLVAVCGYVVFTDKTEGNILNNFSSEDWLINIARFCFGANMSTTI
                     PLEVFVCREVIEETFYKSKPFSKLRHVIITSSVIFIAMGLALTTCDLGVVLELAGGLS
                     ASALAFILPASAYFVMLSGPWSSRRKLPALLVASFGVIVLVLSCGLSLKKAWSGEGGK
                     SVC"
     gene            1355259..1358292
                     /locus_tag="CNB04760"
                     /db_xref="GeneID:3256065"
     mRNA            join(1355259..1355634,1355688..1356018,1356074..1356619,
                     1356668..1357243,1357291..1357563,1357627..1357905,
                     1357957..1358292)
                     /locus_tag="CNB04760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568966.2"
                     /db_xref="GeneID:3256065"
     CDS             join(1355426..1355634,1355688..1356018,1356074..1356619,
                     1356668..1357243,1357291..1357563,1357627..1357905,
                     1357957..1358172)
                     /locus_tag="CNB04760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568966.2"
                     /db_xref="GeneID:3256065"
                     /translation="MALASQIQSSTTSQPVKRDLDLTQEDMGFEGAADEPNEDAVHFC
                     LLAEFDIDAGATLAHQYPYPTGTDEHRLAELMLPDGAHLRPEDWTIFYLGQTASSAVD
                     PLLSHESEASLQTRTSTDSDGKASTMMTSSRAMRGVAGGGLLYVLNCVRMKEDKKMRR
                     GAMVKAMAICTPNPYVGIYKPLLLLALEEYFNNPSPEIMTRLYDSANGISTSGMPRLS
                     RNERILLRSSEQKDLFEEKFGLYELGNETQEIFEEGSSEAGNSSAEGMSKSEEGQTFT
                     RGHRKTMSSNSGRRMIRKGSATSPHFYLGTPSSREGRITPEFGYGEFGRRKGVPRDTH
                     FFETEARFKKITVPIRIPMAIFEEDVGDYSLIELVQTFSQNPAPFQPPFHAHLHTNGA
                     NTHPIILILNALLANKRVMFLGHGLPANQVARMVLAACALGSGCGQVLRGMTECAFPY
                     ANLASLDILEEFPGYVAGVTNPRFEELPMTWDVLCNLETGKVTVSKNVKSASVSMGSI
                     GSGRSSEISLSASIVKVDDDNTMGTPQAKMVSVSKADCVDNQFMDEIIAAMSSHYGES
                     NIRLRFTDYLNRFVRLAAHQEYSHTGSTKIGYPTTTFQNGQLGSGVVFADDQMRQREM
                     WAHGHRIEAWRKTNSYKLFAKDWDSRVKRRAIEFDVQHQLSRLRMCKNMSDGEADAIF
                     SALSNGVRTYEQVVELLTHLPPHGGGIMPIANGLFHQWLGVRENTVELLLNLQQYPVG
                     RHAVLAMNYFHRKTFAQLLERRELAHRHQPERQLEQERPFGSGSPTSAPHGDDFLSPR
                     TTITPQSAVQS"
     gene            1358310..1361041
                     /locus_tag="CNB04765"
                     /db_xref="GeneID:36392754"
     mRNA            join(1358310..1358353,1358409..1358560,1358630..1358749,
                     1358821..1359170,1359231..1359245,1359294..1359690,
                     1359745..1361041)
                     /locus_tag="CNB04765"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658818.1"
                     /db_xref="GeneID:36392754"
     CDS             join(1359139..1359170,1359231..1359245,1359294..1359690,
                     1359745..1360254)
                     /locus_tag="CNB04765"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514239.1"
                     /db_xref="GeneID:36392754"
                     /translation="MSLSEHAKGKQATKSEPLSVTGLDGPPRLSSNNDIPSGRVSERK
                     WRDAFTGEPADPLIKEELYESKIDYSYRPVENGSNAWFVVAPGLTNDENRRPVYKALF
                     SGKRSPEHRQSRSYYIHQENPNPHWWDEATKKAAEWIISHRQVTGLDPSYDLQRSVSL
                     WSSVLANELRHGLATYEKSGGYSPECPRLAIVKEDDLGHMYAHGLERSKDNVSYEQVL
                     QDPETAIVRVKEEPSYMCSNRSHPVGIAHVLIHTDYSKSGIPTIHCVLALPKEKNALT
                     KTSSEVYAFFDTEDGEAHRYLIQTIGSALSAFENFDKDQFR"
     gene            complement(1361075..1363273)
                     /locus_tag="CNB04770"
                     /db_xref="GeneID:3256066"
     mRNA            complement(join(1361075..1361873,1361925..1362015,
                     1362065..1362274,1362321..1362416,1362484..1362639,
                     1362693..1362765,1362817..1363064,1363118..1363273))
                     /locus_tag="CNB04770"
                     /product="integral to membrane protein, putative"
                     /transcript_id="XM_568967.2"
                     /db_xref="GeneID:3256066"
     CDS             complement(join(1361330..1361873,1361925..1362015,
                     1362065..1362274,1362321..1362416,1362484..1362639,
                     1362693..1362765,1362817..1363064,1363118..1363241))
                     /locus_tag="CNB04770"
                     /codon_start=1
                     /product="integral to membrane protein, putative"
                     /protein_id="XP_568967.1"
                     /db_xref="GeneID:3256066"
                     /translation="MSSQTKDTPPGLARQNSSFSNLMTLNLDRYGEDWAGALTLLDVI
                     ETFFDSRLDLFNRRLRAQSNRLKSRAAEMLPKQLRTPKGGGILLLDDEDEDESKETGK
                     NKSRSEKYKNDVEREVERIKIKLAAKVTHLSGTWKSEQVVRTKDKVSFLFGVLALAFT
                     CLLYGMAPEWFPVAYTVQAAFYMPIRIYTYHRKAWHYFLFDLCYFVNALDLLWIWVFP
                     SSTFLFICCYLLTLGPLASAIITWRNSLVFHSLDKVTSIFIHIYPPIVLTVIRHVIPN
                     AEEKYSGLKHVGEYKWYTMILLSSVPYILWQAAYYKFISVDRKSKIESGERQNSFHYM
                     LNDKRGPIGKALQGIRPEHRELWFIFGQLIYSIIFMIPPSTFLIHSPTSSSIFLIIIF
                     TVSAWNGATFYVEVFGRKFERELEKLRKEMEVVSATMTPSTSGTGTSPAVEDAAASSP
                     LSSAEQLNDEEDDLNDSPLVLPDAGKIEASKEAQVPDLNLGKAVEEVDSELEGQATIR
                     QRKNV"
     gene            1363626..1366269
                     /locus_tag="CNB04780"
                     /db_xref="GeneID:3256069"
     mRNA            join(1363626..1364009,1364050..1364547,1364606..1364778,
                     1364832..1364928,1364981..1365037,1365095..1365436,
                     1365481..1365511,1365578..1365775,1365829..1365923,
                     1365999..1366269)
                     /locus_tag="CNB04780"
                     /product="GTP-binding protein 1 (g-protein 1), putative"
                     /transcript_id="XM_568968.2"
                     /db_xref="GeneID:3256069"
     CDS             join(1363806..1364009,1364050..1364547,1364606..1364778,
                     1364832..1364928,1364981..1365037,1365095..1365436,
                     1365481..1365511,1365578..1365775,1365829..1365923,
                     1365999..1366175)
                     /locus_tag="CNB04780"
                     /codon_start=1
                     /product="GTP-binding protein 1 (g-protein 1), putative"
                     /protein_id="XP_568968.1"
                     /db_xref="GeneID:3256069"
                     /translation="MTTLKSFQAEIEAFSHDKQKEAVDRAREQHHAAELARHHGKIPV
                     KKEAKEPIIEVKVDEDEQPDVPLEDLVVSDGSSDELQSRLALYLLKGHGEYLIALGAH
                     PDPVSQYNPSQTESASTIGKALTSKSLSASIERLRTACGALQADLIELYKAADADRKE
                     GPYGCWLIRLTPRGVEEIMEVRVAVVGNVDAGKSTTLGVLTRGGLDDGRGKARVALFR
                     HPHEVETGRTSSVGGEILGFSPQGESVVPSTHITDSSDPHHPLSVAKREKLGWEDICK
                     RAAKVVSFIDLAGHERYFKTTLYGLSGCAPDYVMLMVGGNAGLIGMSKEHLGVALALN
                     VPIAVCVTKIDMTPPNILEQTVTMLTKVLKSPGCRRVPVFVNSPQEAVDCARYLGKPL
                     DSGSTAGRLCPIFMVSNVTGQNLPLLRTFLNCLPSSQSDDRYVVDAPFEFQISDTFSV
                     PFVGTVVSGVITAGAIHANDPVLLGPDSVGQFIPTAVKTIQRKRASVTSGEAGQSVSF
                     ALKRIRRSQVRKGMVLIAKTDTPPKAVKRFEGMVMVLHHSSTIQPNYQAMMHCGAIRQ
                     TVRIKSLDHPSGLIRTGDRAKVVFEFINQSEFVKEGQLILLREAKTKVLGVVTKILG"
     STS             1364353..1365136
                     /locus_tag="CNB04780"
                     /standard_name="Eco11"
                     /db_xref="UniSTS:470815"
     gene            1366362..1367759
                     /locus_tag="CNB04790"
                     /db_xref="GeneID:3256070"
     mRNA            join(1366362..1366419,1366527..1366747,1366811..1366836,
                     1366912..1367007,1367073..1367281,1367338..1367459,
                     1367512..1367759)
                     /locus_tag="CNB04790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568969.2"
                     /db_xref="GeneID:3256070"
     CDS             join(1366398..1366419,1366527..1366747,1366811..1366836,
                     1366912..1367007,1367073..1367281,1367338..1367459,
                     1367512..1367574)
                     /locus_tag="CNB04790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568969.1"
                     /db_xref="GeneID:3256070"
                     /translation="MSVYVGESRGELLAWLNDLLAPTVVTKLEQCGTGSVYCQIIDSI
                     YGDLPMSRVKFNARMEYEYLDNFKILQKAFTRHKIEKPIPVDRLIKCKMQDNLEFLQW
                     IKKYWDMHSRGEGYDAQARAGGHIAGVRASTSRPTAARTRPAPAVTGSRTVSSASQQA
                     NSAQVAAMQARVAEIEAHSEGLLKERDFYFDKLRNIELIVQERLAVEGITPEESDVMT
                     KIQDILYATIEGFEVPQEEDFIEEQPVEGEEETF"
     gene            complement(1367575..1368957)
                     /locus_tag="CNB04800"
                     /db_xref="GeneID:3256074"
     mRNA            complement(join(1367575..1367770,1367819..1367979,
                     1368036..1368497,1368546..1368792,1368837..1368957))
                     /locus_tag="CNB04800"
                     /product="C-terminal protein carboxyl methyltransferase,
                     putative"
                     /transcript_id="XM_024656611.1"
                     /db_xref="GeneID:3256074"
     CDS             complement(join(1367659..1367770,1367819..1367979,
                     1368036..1368497,1368546..1368792,1368837..1368925))
                     /locus_tag="CNB04800"
                     /codon_start=1
                     /product="C-terminal protein carboxyl methyltransferase,
                     putative"
                     /protein_id="XP_024512188.1"
                     /db_xref="GeneID:3256074"
                     /translation="MLPPRTDPPPAQHSDDAVRLTDDDAASARLSAAQLGYLQDPFAS
                     LLYRPPMPQPGAFAPQAVGRARKPPLINVGTHHRTWGIDRLVDRFLQRGGKQVVSLGA
                     GSDTRFWRLMSRATPPDLARYVEIDFPHLTSPKAQRIARHRKLYQYLGPSSTAMPPPG
                     HPYTVSKGGTQLSSPLYTLLPLDLRPSPSEPASSISAILSHHVLPQLDPRLPTLFLAE
                     CLFPYMSPEDSREIIKWFGETFCSCMGVVYEMVGLDDSFGNVMKRNLAVRNLSIPGSI
                     FSTPESQAGRFTSPMLQGGKFDSAGAKTLWQIREEDVGPEELQRISKLEILDEIEELR
                     LVLEHYVIAWGTKGECMSSISL"
     gene            complement(1369766..1372197)
                     /locus_tag="CNB04810"
                     /db_xref="GeneID:3256076"
     mRNA            complement(join(1369766..1370335,1370385..1370865,
                     1370921..1371673,1371723..1372197))
                     /locus_tag="CNB04810"
                     /product="guanosine-diphosphatase, putative"
                     /transcript_id="XM_024656612.1"
                     /db_xref="GeneID:3256076"
     CDS             complement(join(1369909..1370335,1370385..1370865,
                     1370921..1371673,1371723..1372086))
                     /locus_tag="CNB04810"
                     /codon_start=1
                     /product="guanosine-diphosphatase, putative"
                     /protein_id="XP_024512189.1"
                     /db_xref="GeneID:3256076"
                     /translation="MPAHSFAPSTDTTAFPSSIETSSTSGSLPFPLLSSLRHRPSGRI
                     PKTAASPKSPTTSAMFSTRKYTPLPTSANGPARKRAGAGVTTWKRWALLVTIGVAVIF
                     LVFNRASGGSDDQQIYNEDNTYTPSLDEDVVGGGDPIDYSSPPFRPEDSDVAQPLDHE
                     GDGGDEGMDGSLDTLPVGDGGDDNDDNTSNPHDPTSSEAQDASEAEADFSESASEVES
                     PFPGSFEQDPDPASTTACTEPVSSDKPLVQYALTIDAGSTGSRIHVYKFNNCGPSPQL
                     EYETFMAVKPGLSAYARDPTAAAASLDPLLEEAYRVVPESLRKCTPVEVKATAGLRLL
                     GQQESVAILDEVRNRLETNWDFTVGGEKAVEIMDGKDEGVYAWITANYLLNKIGEGAE
                     SDDTLAVMDLGGASTQIVFEPKFAADSEQALAEGEHKYELTFGGKDFTLYQHSYLGYG
                     LMRARRSVHNLVAFTWSFGQGEVEWENLSEEVEVPNPCLSKGTTRRVALDPPGRQTVN
                     VTMHGGNGNFEACNRVVELVMAKDAICEVKPCSFNGVYQPSLLDTFPRGQLLALSYFT
                     DRIKPLLPSSTTSTLSISELTSMAKDVCAGPEVWAERWGSDAAAMEELAGRPEYCLDL
                     TFMNALLGLGYELSPERELMVEKQLRGVELGWALGAGLALVEKAELTCTA"
     gene            1372424..1373580
                     /locus_tag="CNB04815"
                     /db_xref="GeneID:36392755"
     mRNA            join(1372424..1373016,1373072..1373353,1373406..1373580)
                     /locus_tag="CNB04815"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658829.1"
                     /db_xref="GeneID:36392755"
     CDS             join(1372828..1373016,1373072..1373353,1373406..1373513)
                     /locus_tag="CNB04815"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514240.1"
                     /db_xref="GeneID:36392755"
                     /translation="MSASTSSFLASSSHAIHLPSTTSQLIHILTIIQTSRPALIKVVT
                     FLLSECRKSMCTETPSSSAPNRLPTLSSLMPHTLKGKRKRSITHFDGIPLSVLPLQTP
                     SPPTPERRIVTLRRAMGLYKTMSGVSISGKSLDSKSVEDMQRDAYHFACHYMNNKSSS
                     IKDDSEDDRESSTEGEDSDDEDDVVLVFSRPY"
     STS             1373043..1373824
                     /standard_name="Xba16"
                     /db_xref="UniSTS:470814"
     gene            complement(1373580..1376003)
                     /locus_tag="CNB04820"
                     /db_xref="GeneID:3256082"
     mRNA            complement(join(1373580..1374870,1374920..1375342,
                     1375401..1375544,1375616..1375648,1375716..1376003))
                     /locus_tag="CNB04820"
                     /product="transcriptional activator, putative"
                     /transcript_id="XM_568972.2"
                     /db_xref="GeneID:3256082"
     CDS             complement(join(1373860..1374870,1374920..1375342,
                     1375401..1375544,1375616..1375648,1375716..1375751))
                     /locus_tag="CNB04820"
                     /codon_start=1
                     /product="transcriptional activator, putative"
                     /protein_id="XP_568972.1"
                     /db_xref="GeneID:3256082"
                     /translation="MGRKKIEIRPLTDERNRNVTFLKRKAGLMKKAWELSVLCAADVS
                     IIIFSAAGKAFEFSSKELDSEIDRYHDYEGMIERRRAAEFAAMALAGEDDDDDEDDDT
                     SRRGSASKSKAAAAANGNPPPTRSLKGKETFKHRTVRPGEDRKRKRQDKKQRRKSEPS
                     EKRSFIDEIMSGGESDSEEEEKPRRRSNAEHGNGKRMSSLREEDELADDVPHASRQSL
                     DGLQYALSMHASQPSFERFASRHRSPHAEFLAPAASSSQTPLTTPTIHRHPSDTIPYP
                     MTNSLAAAPMQASLGVPQLGVHPSYPHNPNGHPGYLGYPKSLLGMQASYLPRQPFADA
                     PQPSPYYGAQGPGSHPGGPPQPGLPTQMPGGQPIQWDQNLLARYAEFQLQQNHQRQQR
                     ILLERQRQQLAELGVPLDEKNLLDEIFGGVGASRSVSGGADPSGAGPGSALLTGLGNT
                     ASEGREEGNSLEFIWPLGNNAAAAAPISDEDRNDVSSRSVISAGHHQAAYGYGKPHVQ
                     QQKTGWGFDGAGFESMEEVASGSGVGLPSPVSAGAGGGRK"
     gene            complement(1376695..1377778)
                     /locus_tag="CNB04830"
                     /db_xref="GeneID:3256084"
     mRNA            complement(join(1376695..1376834,1376910..1377044,
                     1377099..1377146,1377203..1377778))
                     /locus_tag="CNB04830"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656613.1"
                     /db_xref="GeneID:3256084"
     CDS             complement(join(1376740..1376834,1376910..1377044,
                     1377099..1377146,1377203..1377428))
                     /locus_tag="CNB04830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512190.1"
                     /db_xref="GeneID:3256084"
                     /translation="MTTLPPPRQIIVAHGANGEPHIIDEKIHYPADSPFQAAVGFLQP
                     ELVGKPDKAIEWASIKPTKVSNDDAISLRWLDFPPGFKSDVHFTQTIDYLIVVHGELE
                     MILHDGSSKTVRAGDAIVQIGNIHGWNNNTTDWARFAIVVVPSEPVKVNGRGLEEPPF
                     NAYHAQF"
     gene            complement(1378250..1379549)
                     /locus_tag="CNB04840"
                     /db_xref="GeneID:3256086"
     mRNA            complement(join(1378250..1378460,1378518..1378684,
                     1378734..1379060,1379129..1379362,1379413..1379549))
                     /locus_tag="CNB04840"
                     /product="aerobic respiration-related protein, putative"
                     /transcript_id="XM_024656614.1"
                     /db_xref="GeneID:3256086"
     CDS             complement(join(1378358..1378460,1378518..1378684,
                     1378734..1379060,1379129..1379362,1379413..1379460))
                     /locus_tag="CNB04840"
                     /codon_start=1
                     /product="aerobic respiration-related protein, putative"
                     /protein_id="XP_024512191.1"
                     /db_xref="GeneID:3256086"
                     /translation="MASLTGFSIRAAVGAFSCPTCTSRFIQPRSSFLRSIRQYSTPPP
                     PKFAASAVAGGAKPRVTAEEARRAVEAARQRMYKERANKNRSILLYSAGSLFLALGIT
                     YAAVPLYRAFCSATGFAGTPMTDTSRFTPDRLYVTPETEGRKRITVHFQSSSAESLPW
                     KFEPVTKSVRVLPGETALAFYTAKNYGDKDLIGIATYNITPDKIAPYFAKVECFCFEE
                     QKIRAGEEVDLPVFFFIDRDIVEEPQLDNLDDVVLNYTFFRARRNDMGHAVPDAPEDV
                     IQKSQGFENYELAKKA"
     gene            complement(1379802..1381326)
                     /locus_tag="CNB04850"
                     /db_xref="GeneID:3256089"
     mRNA            complement(join(1379802..1380131,1380192..1380257,
                     1380305..1380429,1380482..1380550,1380603..1380689,
                     1380751..1380832,1380887..1380981,1381034..1381046,
                     1381128..1381158,1381212..1381326))
                     /locus_tag="CNB04850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568975.2"
                     /db_xref="GeneID:3256089"
     CDS             complement(join(1379952..1380131,1380192..1380257,
                     1380305..1380429,1380482..1380550,1380603..1380689,
                     1380751..1380832,1380887..1380981,1381034..1381046,
                     1381128..1381158,1381212..1381234))
                     /locus_tag="CNB04850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568975.1"
                     /db_xref="GeneID:3256089"
                     /translation="MSRSSYDRYLTIFSPEGRLYQVEYAFKAISSAGITAVAIRGKDT
                     SVVITQRKVPDKLLDPETITHLFQITPTIGCVVTGLIADARAQVQRTRSEAAQFRYKY
                     GYEITPESLAKRMANINQVYTQRAGMRPLGISMILIGPDDERGPQLFKLDPAGYFTGY
                     KATSSGQKQTEAANYLEKRWKTLEAEKKDLDRAGVIEMAIECLSSICATDFKASEIEI
                     GISSLSPDEKHIEGQDGRFRQMDERERDEWLIRVGEKD"
     gene            1381562..1383024
                     /locus_tag="CNB04860"
                     /db_xref="GeneID:3256091"
     mRNA            join(1381562..1381635,1381688..1381693,1381768..1381875,
                     1381940..1382001,1382053..1382123,1382176..1382244,
                     1382298..1382393,1382449..1382623,1382679..1383024)
                     /locus_tag="CNB04860"
                     /product="protein hob3, putative"
                     /transcript_id="XM_024656615.1"
                     /db_xref="GeneID:3256091"
     CDS             join(1381628..1381635,1381688..1381693,1381768..1381875,
                     1381940..1382001,1382053..1382123,1382176..1382244,
                     1382298..1382393,1382449..1382623,1382679..1382872)
                     /locus_tag="CNB04860"
                     /codon_start=1
                     /product="protein hob3, putative"
                     /protein_id="XP_024512192.1"
                     /db_xref="GeneID:3256091"
                     /translation="MSWGGFKKAATRAGTSIMQKTGQVERTIDREFAEEEGRYKTMEK
                     ETLNLQKEAKTYLDSMRSMASSQSRIAETVALFYSADRTSDGAMAGHAYKSAVDELDA
                     GVGRELDAPFRATVLDPIGKLNSYYTNIDAAITKRSHKMSDYDAARAKVRKLVEKPSD
                     DSTKLPRAQSEHDEARDIFNILNDQLITELPILVDLRIPYLDPSFEAMIRCQLNFAQE
                     GYERLAGVQRYFADSIRDDYANGALDAQVETVLEEMKELAIYGQ"
     gene            1383392..1388409
                     /locus_tag="CNB04870"
                     /db_xref="GeneID:3256095"
     mRNA            join(1383392..1383770,1383828..1383918,1384279..1384558,
                     1385516..1386326,1386380..1386697,1386743..1387009,
                     1387057..1387173,1387222..1387414,1387460..1387546,
                     1387605..1388241,1388294..1388409)
                     /locus_tag="CNB04870"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656616.1"
                     /db_xref="GeneID:3256095"
     mRNA            join(1383392..1383770,1383828..1383918,1384366..1384558,
                     1385516..1386326,1386380..1386697,1386743..1387009,
                     1387057..1387173,1387222..1387414,1387460..1387546,
                     1387605..1388241,1388294..1388409)
                     /locus_tag="CNB04870"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658840.1"
                     /db_xref="GeneID:3256095"
     mRNA            join(1385375..1386326,1386380..1386697,1386743..1387009,
                     1387057..1387173,1387222..1387414,1387460..1387546,
                     1387605..1388241,1388294..1388409)
                     /locus_tag="CNB04870"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658850.1"
                     /db_xref="GeneID:3256095"
     CDS             join(1385769..1386326,1386380..1386697,1386743..1387009,
                     1387057..1387173,1387222..1387414,1387460..1387546,
                     1387605..1388086)
                     /locus_tag="CNB04870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512193.1"
                     /db_xref="GeneID:3256095"
                     /translation="MATQGTDYDGNDVASRMSNMNIAENHYASIQQPQPPSHSQSPVT
                     STSPNVSTPFARGLTYSYAGEQQGYPYYSASAGVDQFGGQMGPPATYPYGAPVQLLSP
                     HLAPMNFDGYSGGGEVYGNQQDRSQSHQQQQGVQANGTPGRQNHRPPHGQTLQQSAQY
                     FGYPDQRQYWMSHQEIFLQQIERKKEYQPRSSQGPMSRISQNSGSNFRQDFNPTLQGN
                     FHGQGNLSFHAAQTGQYGLHPAPHFVALTGFPPQFSSQYLGRPAPTRKFDDPGVVRSA
                     LLEDFRLNKLKKWELNDIFGHIVEFAGDQHGSRFIQQKLETATPEDRQKLFDEIYTNA
                     YQLMTDVFGNYVTQKMFEHGDQLQKAALAKKMDGRVLQLSMQMYGCRVVQKALDHLLN
                     EQRAKIVAELEPHILECVKSSNANHVVQRIINTGPPQSIPDSFIGHVEELAKHPYGCR
                     VLQKTFENLDDKMKRSLLDEMHKCVIPLTEDQFGNYVIQSVITVGKPEDRNKVISQLK
                     GRVTTFARHKFASNVVEKALIHADPADRRVLIDELIGMQPDGTNQVGMLLRDAYANFP
                     LQTGMFAADPAQREELLEIVLPLLPPLRHTPVGKRIEGRLAQMENEGNISSVMMRKTL
                     SSSTATTDTNAALSMSRTASGSTVPTSPELSIIHTPTVKSPKKDETEGW"
     CDS             join(1385769..1386326,1386380..1386697,1386743..1387009,
                     1387057..1387173,1387222..1387414,1387460..1387546,
                     1387605..1388086)
                     /locus_tag="CNB04870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514241.1"
                     /db_xref="GeneID:3256095"
                     /translation="MATQGTDYDGNDVASRMSNMNIAENHYASIQQPQPPSHSQSPVT
                     STSPNVSTPFARGLTYSYAGEQQGYPYYSASAGVDQFGGQMGPPATYPYGAPVQLLSP
                     HLAPMNFDGYSGGGEVYGNQQDRSQSHQQQQGVQANGTPGRQNHRPPHGQTLQQSAQY
                     FGYPDQRQYWMSHQEIFLQQIERKKEYQPRSSQGPMSRISQNSGSNFRQDFNPTLQGN
                     FHGQGNLSFHAAQTGQYGLHPAPHFVALTGFPPQFSSQYLGRPAPTRKFDDPGVVRSA
                     LLEDFRLNKLKKWELNDIFGHIVEFAGDQHGSRFIQQKLETATPEDRQKLFDEIYTNA
                     YQLMTDVFGNYVTQKMFEHGDQLQKAALAKKMDGRVLQLSMQMYGCRVVQKALDHLLN
                     EQRAKIVAELEPHILECVKSSNANHVVQRIINTGPPQSIPDSFIGHVEELAKHPYGCR
                     VLQKTFENLDDKMKRSLLDEMHKCVIPLTEDQFGNYVIQSVITVGKPEDRNKVISQLK
                     GRVTTFARHKFASNVVEKALIHADPADRRVLIDELIGMQPDGTNQVGMLLRDAYANFP
                     LQTGMFAADPAQREELLEIVLPLLPPLRHTPVGKRIEGRLAQMENEGNISSVMMRKTL
                     SSSTATTDTNAALSMSRTASGSTVPTSPELSIIHTPTVKSPKKDETEGW"
     CDS             join(1385769..1386326,1386380..1386697,1386743..1387009,
                     1387057..1387173,1387222..1387414,1387460..1387546,
                     1387605..1388086)
                     /locus_tag="CNB04870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514242.1"
                     /db_xref="GeneID:3256095"
                     /translation="MATQGTDYDGNDVASRMSNMNIAENHYASIQQPQPPSHSQSPVT
                     STSPNVSTPFARGLTYSYAGEQQGYPYYSASAGVDQFGGQMGPPATYPYGAPVQLLSP
                     HLAPMNFDGYSGGGEVYGNQQDRSQSHQQQQGVQANGTPGRQNHRPPHGQTLQQSAQY
                     FGYPDQRQYWMSHQEIFLQQIERKKEYQPRSSQGPMSRISQNSGSNFRQDFNPTLQGN
                     FHGQGNLSFHAAQTGQYGLHPAPHFVALTGFPPQFSSQYLGRPAPTRKFDDPGVVRSA
                     LLEDFRLNKLKKWELNDIFGHIVEFAGDQHGSRFIQQKLETATPEDRQKLFDEIYTNA
                     YQLMTDVFGNYVTQKMFEHGDQLQKAALAKKMDGRVLQLSMQMYGCRVVQKALDHLLN
                     EQRAKIVAELEPHILECVKSSNANHVVQRIINTGPPQSIPDSFIGHVEELAKHPYGCR
                     VLQKTFENLDDKMKRSLLDEMHKCVIPLTEDQFGNYVIQSVITVGKPEDRNKVISQLK
                     GRVTTFARHKFASNVVEKALIHADPADRRVLIDELIGMQPDGTNQVGMLLRDAYANFP
                     LQTGMFAADPAQREELLEIVLPLLPPLRHTPVGKRIEGRLAQMENEGNISSVMMRKTL
                     SSSTATTDTNAALSMSRTASGSTVPTSPELSIIHTPTVKSPKKDETEGW"
     gene            1388804..1389940
                     /locus_tag="CNB04880"
                     /db_xref="GeneID:3255847"
     mRNA            join(1388804..1388897,1389032..1389112,1389180..1389292,
                     1389352..1389786,1389838..1389940)
                     /locus_tag="CNB04880"
                     /product="40s ribosomal protein s3ae-a (s1-a), putative"
                     /transcript_id="XM_568980.1"
                     /db_xref="GeneID:3255847"
     CDS             join(1388816..1388897,1389032..1389112,1389180..1389292,
                     1389352..1389786,1389838..1389906)
                     /locus_tag="CNB04880"
                     /codon_start=1
                     /product="40s ribosomal protein s3ae-a (s1-a), putative"
                     /protein_id="XP_568980.1"
                     /db_xref="GeneID:3255847"
                     /translation="MAVGKNKRLSKGKKGIKKKVVDPFTRKEWYDIKAPSFFENRNAG
                     KTLVNRTQGLKNANDSLKGRVLELSLADLNNDQEQSFRKIKLRVEDVAGKSCLTSFYG
                     MDFTTDKLRSIVRKWQSLVEAHVDVKTTDGYVLRLFAIGFTKRQSNQVKKTTYAQSSQ
                     LKEIRAKMVEIMRREAEGSDLKELVQKFVPESIGREIEKAAKGIYPLHNVYVRKAKIV
                     KTPKIDMSKLLESHGEAMDANTGSKVVKSGEFVEPEILESV"
     gene            1390506..1394184
                     /locus_tag="CNB04890"
                     /db_xref="GeneID:3255833"
     mRNA            join(1390506..1390673,1391025..1391205,1391634..1391706,
                     1391765..1392160,1392216..1392761,1392813..1393247,
                     1393300..1393540,1393590..1393641,1393691..1393804,
                     1393860..1394184)
                     /locus_tag="CNB04890"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024656617.1"
                     /db_xref="GeneID:3255833"
     CDS             join(1391701..1391706,1391765..1392160,1392216..1392761,
                     1392813..1393247,1393300..1393540,1393590..1393641,
                     1393691..1393804,1393860..1393983)
                     /locus_tag="CNB04890"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024512194.1"
                     /db_xref="GeneID:3255833"
                     /translation="MKRPLDSTLPISPMNGMQPHLENAPSFIDPLVPKKARYDGLDPS
                     VVGPGHGPIGVPPLSAQRPFGAPGAAHAASSFGGLASGSVNMSGVNQQQEHGSMNQAQ
                     QGANIPGMQQGASFGMMGMGGFGMGFPFNMGMQQSFPGAPIVSPSMNPNTMTGNYGPA
                     AAAAAAAAAGNTTGRTVYVGNLPAEASVDELLNLVRFGPIEAVRLLPEKSCVFISFLD
                     GSTAAAFHADACVKKLALHGQELKIGWGKPSMVHPTVATAVASSQATRNVFVGNLDPE
                     TNEQDLRNQLSRFGPIDQVKIVRDKNIGFIHFLSISTAMKVVGSLPTEQGWEGKRVNY
                     GKDRCAYVPKAQQDAVRQAQTQAMNAIAAQHQQATGSPFPAFSPMSAGFSNFPTPGPN
                     TGFASPAFAGNNFSPVASGFTENGGMNQAGNRTIYLGNIHQDVTIEELCNHIRGGILH
                     QVRYFPDKHIAFITFVDPVAAMQFHQNAHATGLSIMQRRLKVGWGKHSGPVPPALLQA
                     IQAGASRNVYIGQIADFSLFTEEKLRQDFGEFGEIDMINFLNEKGVAFVNFTSIQSAQ
                     KAIEGIKLKPEYSTLRISYGKDRCANPPRTTAGRPPMPPPLGHESDPAIQIDNSAVEP
                     GLYDENDAMLSYE"
     gene            1394376..1398172
                     /locus_tag="CNB04895"
                     /db_xref="GeneID:36392756"
     mRNA            join(1394376..1394788,1394853..1395412,1395463..1395591,
                     1395636..1397953,1398015..1398172)
                     /locus_tag="CNB04895"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658859.1"
                     /db_xref="GeneID:36392756"
     CDS             join(1394854..1395412,1395463..1395591,1395636..1397938)
                     /locus_tag="CNB04895"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514243.1"
                     /db_xref="GeneID:36392756"
                     /translation="MSPPSTDVRDHSKRRFPPPSIDPFFSGSTGTPPPPSTEEDQPEP
                     ESQNHSSTAHPCDTPSTTRTFFSTNSGDETNDATDTTIIANNAITRLVGLQSEAEEEL
                     ILQSIFVPSQESDGRNASELEEMPEGYAASQTTSTRATENAGGSQSSFYDDSLTALEE
                     ILMVPIKVPKGDRVVTERHVKLDYRDGKECLSCLDSLREAVESHRINQHEVDVDEGAS
                     VWLCANDECGSFMCTPCAVHWANRELARFRPPTCPRCDRCWEIKTLVDHARTYNPNGP
                     DRPIRPPPINRFVDKHGRSDDLMSGMIKFRNIYRKPDGSEYDSAEAYMFWLVIMINES
                     AGFTYHGSDREKHLLERVWESSYQVHFVDDIDNRLAAESFSEESSRSSSSGNPEGERQ
                     SVVPPPTPPRRISGNYETEASRYASEAMNSANSSLRFAQPTVDQQLPVRHMRSEPVMR
                     HRAPLRGLSRQPNFQISRNASGHCAVSINSSPIQMNAAIPGTAQTQPTPPTFSRRTCN
                     SGYFAYGRSNFETPVVSPFLDMLEGTLRRVAQERNFDNNPRLSEALYYQRLSGAVEQA
                     IHEHPTVADEFGQAKSPRDPVRPKTSFLRTMASVPALAMNKLKAGRNATAECSFRNMS
                     RKSAAEPPVLPTTEVASAITNVGANDPIPVSRTWGLHLTMSSVGRSVGNLRGNTDSQP
                     SGASQLTPNISSQSLSADGITTTGLINGDGAIHVQRPSMPLRIPSDAKKNHHSVPSAR
                     GDRRTPSSEALSALIIPQGNSDSDSVNTNYLTASSGPSGSIGMCGSTDSSRAAGLSGL
                     SPGFGNSVPISFLRNGTSATGPQATLASSIHTHSDCISKSEQSETSKPRSNASNQALF
                     GGADSGFFTSSGSQLFSGPGSDINRMDYGRMESMANSVNSDQVHSHAHAHLPGVDTLS
                     TLTSLNTVSSASLISYEPCLSRPDQNSPYLHLRLPAPLPPPQGPPYSHFPLPDNLGSL
                     RDREGTDGKKRELKGLWRKFMKKR"
     gene            1398370..1400749
                     /locus_tag="CNB04900"
                     /db_xref="GeneID:3255823"
     mRNA            join(1398370..1399211,1399270..1399628,1399700..1399890,
                     1399958..1400137,1400213..1400749)
                     /locus_tag="CNB04900"
                     /product="septin ring protein, putative"
                     /transcript_id="XM_024656618.1"
                     /db_xref="GeneID:3255823"
     CDS             join(1398568..1399211,1399270..1399628,1399700..1399890,
                     1399958..1400137,1400213..1400623)
                     /locus_tag="CNB04900"
                     /codon_start=1
                     /product="septin ring protein, putative"
                     /protein_id="XP_024512195.1"
                     /db_xref="GeneID:3255823"
                     /translation="MPSSFLRKKLRQTSSAQQQPPIRNPHNTTVRHSLSLPDLTTPLL
                     DPSSWEEVPPFTFTFPAVHTPDSKSDPSSIKRASKGGGGVGMVFCRSPKEQRQQDQQG
                     LDTTRPSARAIGVGTGNTTQTRNRTPSLIENEVQFHRPFTPKMVVNPFPGGWNVGDFR
                     ESDAVWDRRGVSAGVGMGTRGSMLNAISRRKTRKKGAAEKMNIVVAGGKGVGKTSFIN
                     FLINSLPQQGQERGQEQTETQTQNPISSQSQRPAPTTKPTAYTVLSTISDRLLLRLID
                     TPGLELPPGEDWVAAKKGESERSVKGLLSIVEERFEYTLREERKVRRRVGAEEGLVHL
                     VIYLIDARDVLYSKEPGAKEVDWSCLGLFDDKPKCHQGEELDFERGYTSRGGSEPRLS
                     NVEIDIIRQLEKRANVLPVVSHTDSLTIDELEDVKAAVNRDLAAVFARTPGKGFGVFR
                     TGHDESRQRDSIREEDEHPDDDNIDLDVDDDTQGDHRPPTPDSIHFSISSTSLPLPFG
                     IFIPEPRAGFSSDDDHNTLDSNGFESSFLRKFAWGEASALNPAHSDFIALIEAVLGDY
                     SKVLRTRTREVLYESYRTERLLEAMAAS"
     gene            1400915..1402867
                     /locus_tag="CNB04905"
                     /db_xref="GeneID:36392757"
     mRNA            join(1400915..1401968,1402043..1402867)
                     /locus_tag="CNB04905"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658869.1"
                     /db_xref="GeneID:36392757"
     CDS             join(1401170..1401968,1402043..1402611)
                     /locus_tag="CNB04905"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514244.1"
                     /db_xref="GeneID:36392757"
                     /translation="MLRRYSSPTADSSDDVRYIVPQPKQANMYTHHWSQLTNLDMLAR
                     EIGYHDLRSLPDEPRYHPHRLDQHQRQPPARPASRADNRPYRPCPYPGYQHPRALSSS
                     YPRTSPYELHHQQNRSPCSPRHTATCPPRAPSPLSPNARPFSLLQTQNQRSSQSRPIS
                     PTLTPHPTSPRFHRPISPTLPDLCPNSPEMYRHSIISLPSPSHSRPDSPANASDSLKD
                     ILERQPQSQSQSRSQGQGGKGKEKGDREEYADVWRGVMERRIWNMGYSNRPLHLQAPP
                     KVRTRRSTTLPSSCPRPLQPQPQPINVTQVTQVTQHTPPAPFTQITVASQPNHDQTPR
                     PTLQSPPKKLAFLRNLFPLSSPTITTAVPSTPFPTPLTPPLTSPLSPHETADEREKEK
                     GGKFDVDKVYERLRVAEGRVSFDDLGLGLYSEDREGEGEEGEEMEGISSLKDGFLKPN
                     ANAND"
     STS             1401785..1402192
                     /locus_tag="CNB04905"
                     /standard_name="VMC_NG4c8"
                     /db_xref="UniSTS:514071"
     gene            complement(1402853..1406574)
                     /locus_tag="CNB04910"
                     /db_xref="GeneID:3255773"
     mRNA            complement(join(1402853..1403003,1403077..1403171,
                     1403242..1403356,1403439..1403507,1403587..1405681,
                     1405739..1406118,1406169..1406336,1406413..1406574))
                     /locus_tag="CNB04910"
                     /product="leucyl aminopeptidase, putative"
                     /transcript_id="XM_568983.1"
                     /db_xref="GeneID:3255773"
     CDS             complement(join(1402977..1403003,1403077..1403171,
                     1403242..1403356,1403439..1403507,1403587..1405681,
                     1405739..1406118,1406169..1406336,1406413..1406520))
                     /locus_tag="CNB04910"
                     /codon_start=1
                     /product="leucyl aminopeptidase, putative"
                     /protein_id="XP_568983.1"
                     /db_xref="GeneID:3255773"
                     /translation="MLSRGLARNPHIQRSLLSRNVSQLASPLALRATVLSNTNKLSNK
                     NSSLQSYRRNLCFCRHDNNMSDIPSVLGGAVAASAQDDYRLPTNVYPNHYDIVIKTDL
                     LSSPPTFSGEALITLDVNSSTSELVFHLNKDLSITNIAISTSDLKTTSSLVIPKEELK
                     LDEEKERATISLDKLPGGGLKEGTKDVKVFFKFESELHASMFGYYRSEGDADENGKKP
                     IYGLTQFEATAARKAFPCWDEPMIKSKFSISMISRNGNTNLSNMPEISSKPWKAPSNA
                     SIEQVFSSSYELGSLLGGSSSFAKTEGKIEGKTEGKIEGKTEGKTESSIGSDDWHISK
                     FETSPLMSTYLVAYASGEFVSLESEHKSKLTGKTVPLKIFATKDQIKQAQFALDIKKW
                     ALPIYEEIFDIPYALPKLDTLVAHDFDAGAMENWGLITGRTTAYLYDPEKSPLSAKKR
                     VAVVQCHELAHMWFGDIVTMKWWDNLWLNEAFATLMGELIILERVWPEWNPRSQFLKT
                     HLQGALDLDAQRSSHPIEVDCPDSNQIAQIFDSISYSKGASVLRMLAGVVGEEKFLKG
                     VSLYLKKHVYNNAETKDLWEGISEASGLDVAKIMANWTLKTGFPVIKVDESADGKITV
                     TQNRFLSTGDVKPEEDETLWYVPLEIATLDNGKVSVDHSAILQDRSSTFTVANPDAFK
                     LNASTIGVFRVAYSPERLTKLGKQASSFTVEDRVGLVSDAATLARAGYAKTSGSLSLI
                     HELGAAETEFLPWSQIGSALSKLSAVWWEQPEEVRKAINKLRVKLFKPLVQKLGFENA
                     KDDVPDVKELRELVVATAAAAEDAEVIQEMKDRFQPFLEKNDDSRIPPDLQRSIFINA
                     VEHGGKAEYEKILEVFNKPSNPSTKVDAMYALCSPRDEELLDRTFAMLEKKVKDQDLY
                     IFFFGFGGNKYARRKVANYFKANYDSLIKRYPDGNGLNYLVKGSFAQLSSRKDLEDVK
                     AFFETKDTRKFKLAVAQTCDSIQAAADWIERDSKDVENWLKENQFL"
     gene            complement(1406727..1408548)
                     /locus_tag="CNB04920"
                     /db_xref="GeneID:3255782"
     mRNA            complement(join(1406727..1406964,1407018..1407120,
                     1407177..1407349,1407399..1407703,1407760..1408548))
                     /locus_tag="CNB04920"
                     /product="GTP cyclohydrolase I, putative"
                     /transcript_id="XM_568984.2"
                     /db_xref="GeneID:3255782"
     CDS             complement(join(1406923..1406964,1407018..1407120,
                     1407177..1407349,1407399..1407703,1407760..1408444))
                     /locus_tag="CNB04920"
                     /codon_start=1
                     /product="GTP cyclohydrolase I, putative"
                     /protein_id="XP_568984.1"
                     /db_xref="GeneID:3255782"
                     /translation="MPSTTDPLADSRASPQSPRSIPTANLNNLSLLSESSTGSWERGR
                     MAGNARSPPTNSILADSLAAGVAPVAAGVNVVEGGNDLSPSSGAKSLRSGGAYPQPQR
                     PWPADKGLSRPNPATGRVSFPSVPQYARQAREGYGFRPRSGQTTPTTGAEASLTYPFP
                     STSSSRVPRPKEDDDDLDHRPDGKSMDELRGEVREELDKQGLVQAAKGVVEPHMGISG
                     IADEEGLGWPAKSTHLRLHSTPEEKSANMELLTSALRTVLECIGEDPDREGLQRTPER
                     YAKALLWMTKGYEERLVDVINDAVFAEDHDEMVIVRDIEVFSLCEHHLVPFTGKISIG
                     YIPSKLVLGLSKLARIAETFSRRLQVQERLTKQVALAVEEAIRPRGVAVVMEASHMCM
                     SMRGVQKPGATTVTSTMLGCFRQQQKTREEFLTLIRTPSAARH"
     gene            1409407..1411403
                     /locus_tag="CNB04930"
                     /db_xref="GeneID:3255735"
     mRNA            join(1409407..1409446,1409802..1409872,1409929..1409986,
                     1410040..1411403)
                     /locus_tag="CNB04930"
                     /product="60s ribosomal protein l37a, putative"
                     /transcript_id="XM_568985.2"
                     /db_xref="GeneID:3255735"
     CDS             join(1409444..1409446,1409802..1409872,1409929..1409986,
                     1410040..1410186)
                     /locus_tag="CNB04930"
                     /codon_start=1
                     /product="60s ribosomal protein l37a, putative"
                     /protein_id="XP_568985.1"
                     /db_xref="GeneID:3255735"
                     /translation="MTKRTKKVGVTGKYGTRYGASLRKTVKKMEITQHARYSCPNCGK
                     IAVKRTNVGIWACKACNKSYAGGAYTFGTPSAATVRSTIRRLREVAEV"
     gene            complement(1410272..1413271)
                     /locus_tag="CNB04940"
                     /db_xref="GeneID:3255765"
     mRNA            complement(join(1410272..1410706,1410775..1411223,
                     1411292..1411385,1411454..1411634,1411689..1411709,
                     1411768..1412156,1412211..1412531,1412586..1412974,
                     1413035..1413271))
                     /locus_tag="CNB04940"
                     /product="expressed protein"
                     /transcript_id="XM_024656619.1"
                     /db_xref="GeneID:3255765"
     CDS             complement(join(1410361..1410706,1410775..1411223,
                     1411292..1411385,1411454..1411634,1411689..1411709,
                     1411768..1412156,1412211..1412531,1412586..1412974,
                     1413035..1413217))
                     /locus_tag="CNB04940"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512196.1"
                     /db_xref="GeneID:3255765"
                     /translation="MAQNNAAPFAGSSSSTPSMAHPTPASSSSGLIPGVTRKQNIACD
                     QCRSRKIRCLRADKKDVCEQCKSKGTECTSNYIEALAEKKKKADEEHLSSSRRKRRRK
                     SNQDQSQSQPPPVPLSSASCSVRPELERHISNESRDSEASSTPKMDHSGMQSPAMGIA
                     SSMAGDGVDPDKLHRVQAAQHVRENASAIADSLHLLANLRSTQNLSLNLPLPLPLSLP
                     NHPPPQPPPFLTPGEKQHDLIRYLLSPYPILTPVLGYSDVASIESCKRGESDLWEEMG
                     GKVWEEEPSEVHKSLEADELTKLADDLIDSFFSVAHIRNPCYDPPTFRARLYTPNTHP
                     QGPISHPILATALAWGARFSDHPVIQRDRDECSQRRSDGEEHGVREKGRGMKRSRLVQ
                     MAVIRAREVCEMCRIWRIPSIDNIKALVNLEGLLGQVLVKKNNYQAVYATAAVKHLLS
                     MGYNSTRAILTIPDEKERTDIVLIWWILIVTDSYRSVFYRIKPCLLDDDYDLEPPGNT
                     ANLLNFTPVSLSEPNQAILWFSAAQSAASMCRALSLRLCSPHLQTSGIPLSLLRTFIH
                     SASVWRTNYLSKLGVPPVWPESWDFLQAIAACSADVSHHALWLVLYRALEESGVEEER
                     KGAMEMGGVGMGIGVEVESVKRRIKEESEHAALRIAALVAVLAENEYLSLDPLSIHHP
                     IYEAGLHLAQRGRGECLACVVGLKQYAITFPATWDNAEELENIYADSQQGDPRLDSRF
                     QSRAHNVSMNVVSNGETASSLTGTGSASAEPAAMPSIEEQMWQGENMWHL"
     gene            1413443..1416478
                     /locus_tag="CNB04950"
                     /db_xref="GeneID:3255706"
     mRNA            join(1413443..1413808,1413860..1414014,1414063..1414674,
                     1414733..1414834,1414889..1415042,1415113..1415530,
                     1415579..1416478)
                     /locus_tag="CNB04950"
                     /product="potassium channel, putative"
                     /transcript_id="XM_568988.2"
                     /db_xref="GeneID:3255706"
     mRNA            join(1413443..1413808,1413860..1414014,1414063..1414674,
                     1414733..1414834,1414889..1415042,1415113..1415530,
                     1415579..1415779,1415848..1416478)
                     /locus_tag="CNB04950"
                     /product="potassium channel, putative"
                     /transcript_id="XM_568987.2"
                     /db_xref="GeneID:3255706"
     CDS             join(1413545..1413808,1413860..1414014,1414063..1414674,
                     1414733..1414834,1414889..1415042,1415113..1415530,
                     1415579..1415779,1415848..1416365)
                     /locus_tag="CNB04950"
                     /codon_start=1
                     /product="potassium channel, putative"
                     /protein_id="XP_568987.1"
                     /db_xref="GeneID:3255706"
                     /translation="MGTPSPQHVSSTTTKRSRRQHLPLTRWNVMGQQQNRTAMAENCY
                     VKDTSPRSRRVIKKKYLRSFAKYCPLVSATLAPFSTLMDIPALSQRWYSDNGIIQPDP
                     KASLVLSAVGLALNVVANILLVIRFSSKAPFWVDHSTKWSLYCWLGKTVIAAINLILF
                     GILTRNEAGYQYLEGFWCAIVSFIGSSLISFTLLFHYFLAFGHSKSDNSDMRSEGRRF
                     MLSVTAFVAILAVQSFVFSKIEHWDYVSGIYMSVQTALTIGYGDYVPTTTAGKVLIFP
                     FAVLTISQLGNEIALIIGFIKQRAEERRNKWRQSFEGAMHREANSLRPKAGLTEEMAL
                     VYRINSREEMMSQMYDLIWSAMALVVFWVLGATAFSQIEGWTYGNAIYMCMILSLTIG
                     FGDYTPVQPAGRVVFIVYALMAVPIVTSFAVQTITGLLSTVSQRKVNRESFITEQKRS
                     PEAFAPHMDHIDRYHKSYADLRDKVLQGNIGSDGRDDGRENGSDNSKGEHSEVGARAE
                     AEAEAERGGNASNESKRDLQEEGSTKVNIQGAEENGLDETIDQFREMEKEDLEEDTQR
                     EKEQSTHPAVAESESGSHFIISKEERQLEVDLLKKLLAKTVSFEVEARQMLLDSMEKS
                     VERTILLADRNVQIRDVRAVRGDDANIVSVWAGEEQAQRNATEKHKNNKSSSILGAEP
                     DKQHHFKGSPSDMLARVSNYRSLFAEILVLGGILQKLEGAELKQFERWRGRPLKKMDG
                     RDGVEGREEDEVMNDEIRKVAHGRVEGNAEDMKAVGKDRWSGLMKDLIKRQMRKMTHK
                     DGWDKKDMV"
     CDS             join(1413545..1413808,1413860..1414014,1414063..1414674,
                     1414733..1414834,1414889..1415042,1415113..1415530,
                     1415579..1415844)
                     /locus_tag="CNB04950"
                     /codon_start=1
                     /product="potassium channel, putative"
                     /protein_id="XP_568988.1"
                     /db_xref="GeneID:3255706"
                     /translation="MGTPSPQHVSSTTTKRSRRQHLPLTRWNVMGQQQNRTAMAENCY
                     VKDTSPRSRRVIKKKYLRSFAKYCPLVSATLAPFSTLMDIPALSQRWYSDNGIIQPDP
                     KASLVLSAVGLALNVVANILLVIRFSSKAPFWVDHSTKWSLYCWLGKTVIAAINLILF
                     GILTRNEAGYQYLEGFWCAIVSFIGSSLISFTLLFHYFLAFGHSKSDNSDMRSEGRRF
                     MLSVTAFVAILAVQSFVFSKIEHWDYVSGIYMSVQTALTIGYGDYVPTTTAGKVLIFP
                     FAVLTISQLGNEIALIIGFIKQRAEERRNKWRQSFEGAMHREANSLRPKAGLTEEMAL
                     VYRINSREEMMSQMYDLIWSAMALVVFWVLGATAFSQIEGWTYGNAIYMCMILSLTIG
                     FGDYTPVQPAGRVVFIVYALMAVPIVTSFAVQTITGLLSTVSQRKVNRESFITEQKRS
                     PEAFAPHMDHIDRYHKSYADLRDKVLQGNIGSDGRDDGRENGSDNSKGEHSEVGARAE
                     AEAEAERGGNASNESKRDLQEEGSTKVNIQGAEENGLDETIDQFREMEKEDLEEDTQR
                     EKEQSTHPAVAESESGSHFIISKEERQLEVDLLKKLLAKTVSFEVEARQMLLDSMEKS
                     VERTILLADRNGECYLSYSVLRFLSDGLHIKL"
     gene            complement(1416569..1418219)
                     /locus_tag="CNB04960"
                     /db_xref="GeneID:3255661"
     mRNA            complement(join(1416569..1416842,1416898..1417202,
                     1417253..1417698,1417761..1417840,1417895..1417978,
                     1418035..1418219))
                     /locus_tag="CNB04960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568989.2"
                     /db_xref="GeneID:3255661"
     CDS             complement(join(1416644..1416842,1416898..1417202,
                     1417253..1417698,1417761..1417840,1417895..1417978,
                     1418035..1418159))
                     /locus_tag="CNB04960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568989.1"
                     /db_xref="GeneID:3255661"
                     /translation="MEIDPPASVSTSPAAYLDSQLASAPEELKPWWTKIKDQYERKLW
                     HNLTVTLTQFVFLPGTGQYQIELFEKFITTVESKINALKLVEIARRVGREFSEPDLTL
                     KFLQSVHSRLASPYPKPATDSTPEVPAPPPPAASAFALSLSSIAYAQLLLGDLPACKS
                     SLDECEKILSEQDTVEPVVNAGYYGVAGDYFKVKADYAPYYKNALLYLACVDVNAELE
                     AEDRKSRAHDLCIAALLGETIYNFGELLQHPILQTLVGTEYEWIKSMISAFNAGEIGK
                     FESLCNNLPNEPILEASLSFLRQKICLMALIQTVFARPRDGSSRLMTFQSIGEATRLP
                     VHEVEHLIMKALSLGLIRGSLDQVDGTADITWVQPRVLEGRQLDTLAEQFKAWTESVG
                     KTEKRVEEQAKAAKTQVLVQ"
     gene            complement(1418380..1421475)
                     /locus_tag="CNB04970"
                     /pseudo
                     /db_xref="GeneID:3255672"
     gene            1422201..1423634
                     /locus_tag="CNB04980"
                     /db_xref="GeneID:3255675"
     mRNA            join(1422201..1422625,1422701..1422985,1423054..1423634)
                     /locus_tag="CNB04980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656620.1"
                     /db_xref="GeneID:3255675"
     CDS             join(1422492..1422625,1422701..1422985,1423054..1423531)
                     /locus_tag="CNB04980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512197.1"
                     /db_xref="GeneID:3255675"
                     /translation="MKYSATAVAVMGALAIQATPIKRDAYTPTDIDILQYALTLEHLE
                     NNFYSCALNNMDAQAFADAGFPAWVRNRFEQIAAHEASHVAVLSDALGADATKPCEYS
                     FPYTDAKSFTALAQVIENVGVSAYLGAAGFIMDKTYLTVAGSILTTEARHQAWIASAV
                     NKQNPWSGPYDTPLGLSDVYSIAAAFITSCPSSNPTLPVKAFPALTLSCDSAGSTATL
                     NYTGADSSDTLILYSGLTTLALPITDMMVTIPSSLQGIAYAVVSSTSNTTMVDDSNTI
                     AGPAIIDLPFASSASNPNFTGM"
     gene            1425431..1426599
                     /locus_tag="CNB04990"
                     /db_xref="GeneID:3255562"
     mRNA            join(1425431..1425669,1425785..1425863,1425920..1425965,
                     1426017..1426127,1426191..1426250,1426305..1426599)
                     /locus_tag="CNB04990"
                     /product="protein-methionine-R-oxide reductase, putative"
                     /transcript_id="XM_568991.2"
                     /db_xref="GeneID:3255562"
     CDS             join(1425460..1425669,1425785..1425863,1425920..1425965,
                     1426017..1426127,1426191..1426250,1426305..1426347)
                     /locus_tag="CNB04990"
                     /codon_start=1
                     /product="protein-methionine-R-oxide reductase, putative"
                     /protein_id="XP_568991.2"
                     /db_xref="GeneID:3255562"
                     /translation="MPFISPTLFRSTIHTARTHFPTSSVTSAARSISFSLPFAFFSSS
                     ASANMSQPAKVQKSDDEWRAILSPEQFRVLRQKGTERPGSHPYDHSNDKGVYHCAGCD
                     APLYTSNTKFQSGCGWPAFYDTIPGAVNRHEDRNFGMTRTEITCANCGGHLGHVFKGE
                     GFPNPVDERHCVNGISLNFKNE"
     gene            complement(1426474..1429033)
                     /locus_tag="CNB05000"
                     /db_xref="GeneID:3255598"
     mRNA            complement(join(1426474..1427727,1427780..1427956,
                     1428012..1428818,1428875..1429033))
                     /locus_tag="CNB05000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_568992.2"
                     /db_xref="GeneID:3255598"
     CDS             complement(join(1426727..1427727,1427780..1427956,
                     1428012..1428765))
                     /locus_tag="CNB05000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_568992.1"
                     /db_xref="GeneID:3255598"
                     /translation="MPRIAARTECYDTLRECMRHYKAKRDHLLHNLGKTSYIDGSQFV
                     VAFISPKGEVHTYQSALLKETFEKGGKGDGGGILNMDALRYHASVLKGKLKKRREEEG
                     KGTMKKAFGEGSSAATASAAIGGSDEEEAEEEAEDDDSEEVDPDKTLVDEPATPLFEA
                     ANVKPPSSSNAKSLTSNEHCITLQQEEVVPYFAKRFAAVQQDTCKLVAKAWIKVIEPK
                     KQSKFPYNKGENAKPKWWPDGVPHRAPDHLSKEQRIVLLIHLLRSGLARVADLELSTA
                     SIMAWITYERFEILRELCLVGRADEHRRQNGKAEDMNKPLVIPIPESLRRTVQAGSAC
                     DGSELPPPFNTVNPLTTTNATNTINTINAANPRKRSDSPLAVPEPNLAMPVPQPKRTK
                     NKPQFLYTPLQPSDVSWRATGQVPNHHLPFTPLGMQLPDPRQQQSNLHHDSFSYPPSN
                     HHTHPHHIQMPTQRFQQPGNMTRHHSMYELSMDYNNNKPVYFTPAMPSPVVDEFQGGV
                     QGDNDQAFVFINNSNSHQAASSQGANPQTSLPTSQPSLSSAPISAPTPVSAPLPIIQP
                     ISIASTPTSAEFVRSASAQGYMQQQQLEFLETHPPQGYGYISPGSSTQTEPSSAFSRF
                     AFEGDRYDYGMPSLEDNGF"
     gene            1429403..1432686
                     /locus_tag="CNB05010"
                     /db_xref="GeneID:3255553"
     mRNA            join(1429403..1430967,1431034..1431365,1431442..1432686)
                     /locus_tag="CNB05010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656621.1"
                     /db_xref="GeneID:3255553"
     CDS             join(1429882..1430967,1431034..1431365,1431442..1432591)
                     /locus_tag="CNB05010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512198.1"
                     /db_xref="GeneID:3255553"
                     /translation="MVSFFRSSRSGSSTQAPSSELISPTSSASHRLSSAPSFGGPFIP
                     ENGVFSPGLFSFHEGRGRARISPPPSPLCSSPPPVERRASEPVGIDNAASEQDRLPGY
                     TLNASTPAQSQATAAPIPTYESALTQGISSPFFAGDRISDEWEDTYMREYFGSDDFRG
                     ERGEGGQPESHVNDTAGHDTGSDEEEPLLPPQNARADRRFTFAGIDHRTPVSDGIVEP
                     PVLETLSPPAGALLPPVYSPEVRTDELMLVSTAHLSPDHPASAFFNAISLNPSLFDGE
                     EAASPVPLPIPSQTPDATGESNQVTGERSGVMTGGKKLNLTITSTNARRLNANNTGPL
                     FIKIGRAGIVRGSIVVKGIDHAVGLEVAILGYVKTVFYARGQYNMMDTHPLGRSAVTL
                     FPPPSESTEQQHLKHTKDGQLLIEPGTTFPFEIQMPTTHWQSNDIDLPPTCEVLQLGL
                     QAAVEYVLRVKVKRKGGWRMNEELTVPIVYQPRSYISPRRLRALMLDDQLNPGWRTIP
                     LNGGLSSSDPTPVQATLLLPSPMILYIPRNSLPPAIPFHLRFYHPAGGSFLRNFTDPR
                     ESTIIVRLQRVATVRVDSGREVRKSEIPSQVLVWEDGGEKVDLGEVQKERREKEKEKE
                     KKGVRGKRRKASSGDGPGQVATPSSQAGGTEQGRGRKFSFVDGKVGSVFRRKSSTPSG
                     PVSTTTTTTASRTVPTFASSPRTDHTLLSSSPIAEHSLSSCVTNTSSPGGHDSHINTS
                     STASASTSSTQTQLSSLSATDIQLHGLLTLRSNHSSQSTNCANEHHLNPFGQDPRQPE
                     GISSDLKSKLIQSFSTPEIAITYIIQIGVQPKGSEGSGGKLRDGHVWGGGLVDVVWG"
     gene            1433284..1434510
                     /locus_tag="CNB05030"
                     /db_xref="GeneID:3255932"
     mRNA            join(1433284..1433349,1433879..1433991,1434051..1434134,
                     1434193..1434306,1434385..1434510)
                     /locus_tag="CNB05030"
                     /product="structural constituent of ribosome, putative"
                     /transcript_id="XM_569252.2"
                     /db_xref="GeneID:3255932"
     CDS             join(1433334..1433349,1433879..1433991,1434051..1434134,
                     1434193..1434306,1434385..1434459)
                     /locus_tag="CNB05030"
                     /codon_start=1
                     /product="structural constituent of ribosome, putative"
                     /protein_id="XP_569252.1"
                     /db_xref="GeneID:3255932"
                     /translation="MASSLGLASDRRKSRKAHFSAPSGLKRKLMSSPLSKELRKEHNA
                     RSIPIRKDDEVLIVRGKYKGREGKVTQVYRKKWVIHVDRVHIEKSNAATSPVGIHPSN
                     VVITSLKLDKDRRAILERKGSKKSGDVEMAE"
     STS             1433344..1433580
                     /locus_tag="CNB05030"
                     /standard_name="D1S3688"
                     /db_xref="UniSTS:474266"
     gene            1434885..1438711
                     /locus_tag="CNB05040"
                     /db_xref="GeneID:3255937"
     mRNA            join(1434885..1435952,1436010..1436114,1436177..1436292,
                     1436392..1436588,1436671..1437918,1438021..1438711)
                     /locus_tag="CNB05040"
                     /product="translation initiation factor, putative"
                     /transcript_id="XM_569253.2"
                     /db_xref="GeneID:3255937"
     CDS             join(1435498..1435952,1436010..1436114,1436177..1436292,
                     1436392..1436588,1436671..1437918,1438021..1438065)
                     /locus_tag="CNB05040"
                     /codon_start=1
                     /product="translation initiation factor, putative"
                     /protein_id="XP_569253.2"
                     /db_xref="GeneID:3255937"
                     /translation="MPNSQPGGVSGANASSMSFARAPSPNPNRPGMNRSFSSSVVLAD
                     GRGAHGHGHGLSHNGSHGHAHLSPGHLSLGAHGHQHQLAHGHGLHSHGPSALSRDWPS
                     PGGQQQVQSGQKDGLTTPGGAAVPGGGIVVSKWEHLNLKVDLLRSISKYGIGPPNKIQ
                     TRVLPFMIKGSDIIAQAPPTTERIISYVIPALHICQSLPPPSGPYVGPAVVIITTTVD
                     QAMQCHKLVRGVGGP