GenomeNet

Database: RefSeq
Entry: NC_006685
LinkDB: NC_006685
Original site: NC_006685 
LOCUS       NC_006685            2105742 bp    DNA     linear   PLN 14-AUG-2010
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 3,
            complete sequence.
ACCESSION   NC_006685
VERSION     NC_006685.1  GI:58271753
DBLINK      Project: 10698
            BioProject: PRJNA10698
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella;
            Filobasidiella/Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 2105742)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 2105742)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2105742)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AE017343.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2105742
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /variety="neoformans"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="3"
                     /note="MAT-alpha"
     repeat_region   1612..1645
                     /rpt_type=tandem
                     /rpt_unit_seq="taaaaa"
                     /satellite="microsatellite"
     gene            <1984..>3809
                     /locus_tag="CNC00010"
                     /db_xref="GeneID:3256733"
     mRNA            join(<1984..2196,2252..3449,3508..>3809)
                     /locus_tag="CNC00010"
                     /product="hypothetical protein"
                     /transcript_id="XM_569349.1"
                     /db_xref="GI:58264385"
                     /db_xref="GeneID:3256733"
     CDS             join(1984..2196,2252..3449,3508..3809)
                     /locus_tag="CNC00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569349.1"
                     /db_xref="GI:58264386"
                     /db_xref="GeneID:3256733"
                     /translation="MIGDEQTFDDRIFRRYLDRFIQENCNYMAMATEFSHQANLKTVF
                     YDRYDKEWAKLDLVDMYRRRTGKILGAPSQSQGTSKSKKDVATTPDASLIGSVNDPSS
                     PSGRKRMLYAVIELKWMNLAALLTGEAKSQTDEKALSYLCQEGVFQTMWYVILGYAIS
                     RCIFGLSIVNEYFYRIVYLYQDSASDSPVLALEASKEFLENAGRHFGYPRDGYSVEEL
                     AELQDFWSSPPNCLISDRANATLNKETRYHLDATILLFLAHAAALPTQRFLNDLPLPF
                     AHHVPVDATAHSATDMRLKGLEVGRRRHSLRSTKRNKRTLADLYDEEKGEEDKPGDQE
                     DKSGDRKPPGKDNRNNDPRNDGSQGGNSGSGGDNSRGGGSGPGGDNLHDGGSGSGRGH
                     EGSDSRDVGGYEGSESRDDGRDPVRDGAGGPSTHRAEAADIRTPTTRQEFLRGLQKLS
                     TPGNMLDMKSSIIASLISNPHTSTSVAPSSPGVNSTTSSEDVLFPDLSLDSNGRTLVH
                     CDLSTDPLPKVHKSTPLDLDLEDIDPETGELTLAAYRDRLAMLGVRVKLVTREEMDVL
                     LARG"
     gene            complement(4572..6132)
                     /locus_tag="CNC00020"
                     /db_xref="GeneID:3256284"
     mRNA            complement(join(4572..4932,5018..5326,5385..5503,
                     5586..5755,5823..6132))
                     /locus_tag="CNC00020"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531150|gb|CF676991.1,gi|41531156|gb|CF676997.1,
                     gi|41559654|gb|CF705495.1,gi|41573505|gb|CF719346.1,
                     gi|41573506|gb|CF719347.1"
                     /transcript_id="XM_569351.1"
                     /db_xref="GI:58264389"
                     /db_xref="GeneID:3256284"
     CDS             complement(join(4655..4932,5018..5326,5385..5503,
                     5586..5755,5823..6098))
                     /locus_tag="CNC00020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569351.1"
                     /db_xref="GI:58264390"
                     /db_xref="GeneID:3256284"
                     /translation="MASFTLSWGIISTGGIATTFAHDLLVDPASRNTKDVKHRIAAVG
                     SRSLQSAQSFINKLKESSEGKSWAWGVKNGVLDGVKARGTYEEVYNDPDVTAVYVGTP
                     HVFHHRNAKDALLAGKHVLLEKPACLEVEELDELIKIAKEKNLFFMEAVWTRFQPIAY
                     AVEEVIKSGILGKPRRFSADFSMDWNLDASPDSSRMVNPALGGGSLLDMSAYPSVWAM
                     LLVHRNPFNTDKDPKVLFTNQTIYPRSGVDINSRWLVEWKGLCQGMLMTDLDNAGQKD
                     STAVLQCEEGDLVVAYPPYKPETFYIHPRPSRFPGTITSSTTHHHPLHDGNNGMSYEA
                     DEVARCIRDGKIESERMPWEESRVVQGWVDKVRKEGPTETAKLVGTAGQ"
     gene            complement(7518..10589)
                     /locus_tag="CNC00030"
                     /db_xref="GeneID:3256326"
     mRNA            complement(join(7518..7762,7811..8565,8613..8783,
                     8925..9638,9716..10589))
                     /locus_tag="CNC00030"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534637|gb|CF680478.1,gi|41571018|gb|CF716859.1"
                     /transcript_id="XM_569353.1"
                     /db_xref="GI:58264393"
                     /db_xref="GeneID:3256326"
     CDS             complement(join(7675..7762,7811..8565,8613..8783,
                     8925..9638,9716..9901))
                     /locus_tag="CNC00030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569353.1"
                     /db_xref="GI:58264394"
                     /db_xref="GeneID:3256326"
                     /translation="MSIHSISDTYYTGPINSTLRGFSNVVRLFGTGKAAHSDGKDVDE
                     ENSDDADIDEEGLLWDAQTALIANEPEIATRLYVQAALPPYCSPSACLALGNLLIRSS
                     VYMESPSAPISSSNELTSGRSGTSLWSKLFGTISTPQSPSSAHSSSPTRKRIDLVACG
                     WQMPKVGKRAVRDVEGMGVAGAWFVLGLGWVVRVEMEREKRLRGKVVIKPSKETFEDS
                     EEEAIFTKKKGKGNGRLHSSTIYIAPPQRADDPFPIVAGNPKTALSESTKTEESSLIG
                     TPAMGDVESLEDEDESEMESLSIMLPPALRPKNEADKGRNVWWLGRVVAQQLIKLDIL
                     KAAKGKGQKEQLRKAVGVSVNYIIATTSPDLQAEMYFRSIASTPSIGLEYADDLVTNA
                     KKRLQIITSTPRDEKMLRFFPFPSMLDKASPPNPQKTSISSPRSILTPPKVMVQSAKS
                     TVSLAALAGEEEVASLVAPGPKKLGALDTLKRVHEKAVMQDEEVGREEVHDEPGVSYS
                     EVRPTIRRVSTSPHLQTHLHPPPSSSRTRRRLPFELPSSEPIAPVDPVLAAAEMSSAL
                     TKHVVCNVCGMKGVNFPECRKCGLRFCSRECRVGEDRAGNGKRHICGLSESRRNHGGL
                     SHGIEYGVVGDVH"
     repeat_region   10550..10577
                     /rpt_type=tandem
                     /rpt_unit_seq="ga"
                     /satellite="microsatellite"
     gene            11105..14777
                     /locus_tag="CNC00040"
                     /db_xref="GeneID:3256521"
     mRNA            join(11105..11286,11336..11405,11461..11936,11996..12132,
                     12182..12324,12382..12516,12568..12676,12745..12983,
                     13052..13167,13339..13386,13447..13572,13626..13745,
                     13794..13856,13901..14777)
                     /locus_tag="CNC00040"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537130|gb|CF682971.1,gi|41542382|gb|CF688223.1,
                     gi|41559335|gb|CF705176.1,gi|41561619|gb|CF707460.1,
                     gi|41562407|gb|CF708248.1,gi|41564262|gb|CF710103.1"
                     /transcript_id="XM_569355.1"
                     /db_xref="GI:58264397"
                     /db_xref="GeneID:3256521"
     CDS             join(11155..11286,11336..11405,11461..11936,11996..12132,
                     12182..12324,12382..12516,12568..12676,12745..12983,
                     13052..13167,13339..13386,13447..13572,13626..13745,
                     13794..13856,13901..14344)
                     /locus_tag="CNC00040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569355.1"
                     /db_xref="GI:58264398"
                     /db_xref="GeneID:3256521"
                     /translation="MSIHDSTFSALKDMGIDPMLAREAASRFHSVEPAVNWCFGDGAN
                     WQPTTVAESMYGGFNPRHREGTSVEHREVIEVFDSPSGSPKPRHSHIPLGSNNPFLPT
                     QPRSPHPASHPLPQPPLPPRSPSVRLGTQGLPVEVDDGNDSEGEELRKAIALSQNVEH
                     SVSEAAPLQDAMDVDGKRDSRERSERASGAPPPSPKSDMPGTIGVTFGPSTKDDVDGK
                     LALVPTSQNNNTTSNEDADLDKAIQESLMTASFHSASAEANKERPQPTKRGDGVPLVF
                     YSPSGRYTYVAQILQAFAAVPRIQTAFQENVDSASSGDDILTERTQALSDSFGRMIDE
                     PFSFYEIDDTAKIITEGSERNQLPPLLPTMDFQLIFIDLFERAAIPRLQGMAKDEDEL
                     NRLREECRRVFETKVTGHTPDSITSASYVTFVRQPTGNDVYTQLADVFWGPEAQTTSI
                     KKLGDVLTVYLDWKPSSAREVWKLDEEITLDRFLQSNAAWAANRRGLQAVSAGNARRI
                     KEKIESLTLHDNVDITRAVSREGMKGKIETILTALKTKVADLEEELKEQEKAASAEAF
                     ETDDPQYNQHVFNLRAILFHDGAMVGQKHLYMYVRGKDDRWWKIQEHEATEVEWEAII
                     GDRTGIWMEGGPYMLLYARQGDRPSSPESSPTRPSDVDVPPHSNSIILESNNTLTPTL
                     PPDYSESTSTSASNGSKSQSSDTNEKNGEGLLLMDMETPEAETEWVEDAGSEANKDLM
                     DIVMGEGGSPKKEEEIKATVHEKADEENKEVEARSTNKDEDTVML"
     misc_feature    16985..17025
                     /note="C-rich"
     gene            complement(19049..>23574)
                     /locus_tag="CNC00050"
                     /db_xref="GeneID:3256313"
     mRNA            complement(join(19049..19104,19159..19271,19329..19348,
                     19410..19466,19513..19562,19623..19850,19909..19939,
                     19996..20050,20111..20275,20333..20403,20468..20595,
                     20646..20701,20761..20807,20856..20924,20983..21109,
                     21174..21199,21256..21372,21432..21515,21571..21750,
                     21804..21847,21906..21982,22032..22185,22249..22356,
                     22407..22620,22667..>23574))
                     /locus_tag="CNC00050"
                     /product="chitin synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531244|gb|CF677085.1,gi|41531248|gb|CF677089.1,
                     gi|41549041|gb|CF694882.1,gi|41549048|gb|CF694889.1,
                     gi|41562016|gb|CF707857.1,gi|41562028|gb|CF707869.1"
                     /transcript_id="XM_569357.1"
                     /db_xref="GI:58264401"
                     /db_xref="GeneID:3256313"
     CDS             complement(join(19213..19271,19329..19348,19410..19466,
                     19513..19562,19623..19850,19909..19939,19996..20050,
                     20111..20275,20333..20403,20468..20595,20646..20701,
                     20761..20807,20856..20924,20983..21109,21174..21199,
                     21256..21372,21432..21515,21571..21750,21804..21847,
                     21906..21982,22032..22185,22249..22356,22407..22620,
                     22667..23574))
                     /locus_tag="CNC00050"
                     /codon_start=1
                     /product="chitin synthase"
                     /protein_id="XP_569357.1"
                     /db_xref="GI:58264402"
                     /db_xref="GeneID:3256313"
                     /translation="MNPGDIYQPPGGYSPARQNQRPPQPQPFPQQPYPPPPAVQYGDP
                     FSAPPQRPPAASLQNMSPAWHEPPHASHPLQPTSPTGPPAPRYSLPTQSLSPFNGSPA
                     SAPAPAPYTMGSPPNSHPPMHASPPQHIRFHANPSHLPPQQQPAPSYSYPNGIDDRLT
                     SPPPLLPHHSSQSSMSAMPAPVPDNINYGPPSYPPQGYGNAADDDMNDSRPLLAHAAP
                     DSRFGIPQSTSAMSMTAPAVRYQLSDAGAGDMGVTMYTGNGDAEGQNGFGTGDGVGAG
                     GEDEVNMHYGPVPARIVRRNRTQKRVQLFQGHLVLDIEVPTMLLEQCPIRQGNEFTKL
                     RYTAVTCDPNDFVEDMYTLRQRLYDPPRQTELFIVITMYNEDDILFCRTMRGVMQNIA
                     HLCTRSKSKTWGVNGWKKVVVCIVADGRKKINPRTRSVLAALGVYQEGVGKNMVNGKP
                     VTAHVYEYTTQLSINSSGKIGPAGSNTVPIQMLFCLKEKNQKKINSHRWFFNAFGACL
                     RPNVCVLLDVGTQPGPDSIYHLWKAFDINSSVGGACGEIVALKGMFWKNLLNPLVAAQ
                     NFEYKMSNILDKPLESVFGYITVLPGAFSAYRYIALLNDEKGNGPLKQYFVGETMHGS
                     GAGIFSSNMYLAEDRILCWELVSKRQCKWKLHYVKSAYAITDVPDTVAELVSQRRRWL
                     NGSFFAAIHSIVHFGYLYRSSHSFTRKFFLHIELVYQTLNMVFAWFALGNYFIAFFVL
                     TESLNSLGTAWKYVNTPLHYIYIALLLWCFLLSLGNRPAGSKIGYTSSMVGFALITIY
                     MLFAAIYLTVKGVEDIQAAGEVTASTVLGNKIFRNIVISLLATYGLYIISSLMALEPW
                     HMITSFFQYLLLAPSYINVLNVYAFCNVHDVSWGTKGSDKVSDDLGAVKSSDDNKDEV
                     TVDVPIEQKDINAVYAAELQILGNKAPKEVRVVNDDQKQEDYYKNVRTNVLLAWTMTN
                     GALVAAILQVSGGDSAVATTYMGVLLYTVAGLAFFRFLGSSAYLLVRLFVGE"
     gene            complement(24167..26835)
                     /locus_tag="CNC00060"
                     /db_xref="GeneID:3256561"
     mRNA            complement(join(24167..24433,24505..24590,24660..24850,
                     24917..25053,25108..25196,25251..25390,25456..25790,
                     25856..25915,25979..26035,26086..26178,26237..26360,
                     26425..26835))
                     /locus_tag="CNC00060"
                     /product="sugar transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530428|gb|CF676269.1,gi|41530433|gb|CF676274.1,
                     gi|41543462|gb|CF689303.1,gi|41543468|gb|CF689309.1,
                     gi|41546658|gb|CF692499.1,gi|41549793|gb|CF695634.1,
                     gi|41554532|gb|CF700373.1,gi|41554542|gb|CF700383.1,
                     gi|41555013|gb|CF700854.1,gi|41555026|gb|CF700867.1,
                     gi|41556338|gb|CF702179.1,gi|41557542|gb|CF703383.1,
                     gi|41557556|gb|CF703397.1,gi|41564696|gb|CF710537.1,
                     gi|41564702|gb|CF710543.1,gi|41575702|gb|CF721543.1,
                     gi|41575709|gb|CF721550.1"
                     /transcript_id="XM_569359.1"
                     /db_xref="GI:58264405"
                     /db_xref="GeneID:3256561"
     CDS             complement(join(24247..24433,24505..24590,24660..24850,
                     24917..25053,25108..25196,25251..25390,25456..25790,
                     25856..25915,25979..26035,26086..26178,26237..26360,
                     26425..26593))
                     /locus_tag="CNC00060"
                     /codon_start=1
                     /product="sugar transporter"
                     /protein_id="XP_569359.1"
                     /db_xref="GI:58264406"
                     /db_xref="GeneID:3256561"
                     /translation="MVAAVANEGGGLESWADWFKKDYRRPIFFCALISIAPVAYGYDG
                     TYFTSLLETPVFVEQFGDNTGNGTYALSSSDQSLWVSIIQVGEVVGSLGAGPIGDYSG
                     RKGGIFSAIVLLAIGVVLQMIIVGSSALLTVGRLIAGMGIGIISNAAPLYLSEIPPME
                     IRGACVSSWQLMLAIGQVIGAGVGLGTHTMSSTASWRIPVALNLVWVVLLFVVLFIVP
                     ESPRWLLYKGKEAKAERALNKIHGGSEYRDVLVSEQLAILNKSREEEAEASSGESKWS
                     DLWKNPVERRKFFATVGILVSQQISGVQFIFSYTTTFFALVGISDTFIITIIVDCIEV
                     LGVIASFFVVERWGRRPLLIYTGIFMFITLLIVGAMGAVSGQGDRFEPYLADHPSLGK
                     AVAAMICLYVFAFNLSWGPLAWVVAAEMSTGRNRQKHLSIGTAMFWVSAWVVTFTLPY
                     LFQPDEAGLGPMIGFIYAFGGFLSVAFVYFFIPETQGRTLEEINFMMEARIPTRQWKG
                     YDLATVVARDEKKITRGEAEHLEKVDELERPQNKRFMSLFAADSESS"
     gene            <27638..29297
                     /locus_tag="CNC00070"
                     /pseudo
                     /db_xref="GeneID:3256424"
     gene            complement(28347..30497)
                     /locus_tag="CNC00080"
                     /db_xref="GeneID:3256619"
     mRNA            complement(join(28347..28816,28943..29104,29163..29175,
                     29247..29349,29439..29565,29631..29660,29735..29749,
                     29806..29883,29947..30018,30081..30497))
                     /locus_tag="CNC00080"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41551169|gb|CF697010.1,gi|41551176|gb|CF697017.1,
                     gi|41568892|gb|CF714733.1,gi|41576602|gb|CF722443.1,
                     gi|41576608|gb|CF722449.1"
                     /transcript_id="XM_569362.1"
                     /db_xref="GI:58264411"
                     /db_xref="GeneID:3256619"
     mRNA            complement(join(28347..28816,28943..29104,29163..29175,
                     29247..29349,29439..29565,29631..29660,29735..29749,
                     29806..29883,29947..30024,30081..30497))
                     /locus_tag="CNC00080"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41551169|gb|CF697010.1,gi|41568354|gb|CF714195.1,
                     gi|41568892|gb|CF714733.1,gi|41576602|gb|CF722443.1"
                     /transcript_id="XM_569361.1"
                     /db_xref="GI:58264409"
                     /db_xref="GeneID:3256619"
     mRNA            complement(join(28380..28816,28943..29082,29291..29349,
                     29439..29565,29631..29660,29735..29749,29806..29883,
                     29947..30018,30081..30491))
                     /locus_tag="CNC00080"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41551176|gb|CF697017.1,gi|41552123|gb|CF697964.1,
                     gi|41576608|gb|CF722449.1"
                     /transcript_id="XM_569363.1"
                     /db_xref="GI:58264413"
                     /db_xref="GeneID:3256619"
     CDS             complement(join(28761..28816,28943..29104,29163..29175,
                     29247..29349,29439..29565,29631..29660,29735..29749,
                     29806..29883,29947..30018,30081..30402))
                     /locus_tag="CNC00080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569362.1"
                     /db_xref="GI:58264412"
                     /db_xref="GeneID:3256619"
                     /translation="MWTLHQLTENKATRSTTGSPSRSPSPSVARKRARLSSSSPKMAP
                     SLVKKEVEEVSSGKPDSSKLEEGGDEPKPDVEREWEGFSKDVLEKWPALKKRNFWCIQ
                     RHSATALHYDLRMHLDGVTVSWAIPKGLLGISKSGEARRMAVETTLHPLWYTIHEGSD
                     GRTFGQGRQGGTLLWDIGEYTIDLPSGYIPDLDTDEEEEAENRRRFKKRRKDSESDGR
                     EEEDKFRNALHRHIGFGKSRSMHFTLKGGKKMTNHSFILVLSSNPYKYNTVSLEGKEK
                     KTWFISLPRGVDSYPWDQGGEDGDFYGRSIKSGMTFQQVCQGLADDSSQ"
     CDS             complement(join(28761..28816,28943..29104,29163..29175,
                     29247..29349,29439..29565,29631..29660,29735..29749,
                     29806..29883,29947..30024,30081..30402))
                     /locus_tag="CNC00080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569361.1"
                     /db_xref="GI:58264410"
                     /db_xref="GeneID:3256619"
                     /translation="MWTLHQLTENKATRSTTGSPSRSPSPSVARKRARLSSSSPKMAP
                     SLVKKEVEEVSSGKPDSSKLEEGGDEPKPDVEREWEGFSKDVLEKWPALKKRNFWCIQ
                     RHSATVVALHYDLRMHLDGVTVSWAIPKGLLGISKSGEARRMAVETTLHPLWYTIHEG
                     SDGRTFGQGRQGGTLLWDIGEYTIDLPSGYIPDLDTDEEEEAENRRRFKKRRKDSESD
                     GREEEDKFRNALHRHIGFGKSRSMHFTLKGGKKMTNHSFILVLSSNPYKYNTVSLEGK
                     EKKTWFISLPRGVDSYPWDQGGEDGDFYGRSIKSGMTFQQVCQGLADDSSQ"
     CDS             complement(join(28946..29082,29291..29349,29439..29565,
                     29631..29660,29735..29749,29806..29883,29947..30018,
                     30081..30402))
                     /locus_tag="CNC00080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569363.1"
                     /db_xref="GI:58264414"
                     /db_xref="GeneID:3256619"
                     /translation="MWTLHQLTENKATRSTTGSPSRSPSPSVARKRARLSSSSPKMAP
                     SLVKKEVEEVSSGKPDSSKLEEGGDEPKPDVEREWEGFSKDVLEKWPALKKRNFWCIQ
                     RHSATALHYDLRMHLDGVTVSWAIPKGLLGISKSGEARRMAVETTLHPLWYTIHEGSD
                     GRTFGQGRQGGTLLWDIGEYTIDLPSGYIPDLDTDEEEEAENRRRFKKRRKDSESDGR
                     EEEDKFRNALHRHIGFAIPTSTIPLAWKEKKKRRGSLVFPEEWIAIRGTRAGKMAISM
                     EGA"
     gene            <30765..>31337
                     /locus_tag="CNC00090"
                     /db_xref="GeneID:3256787"
     mRNA            join(<30765..30944,30981..>31337)
                     /locus_tag="CNC00090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569365.1"
                     /db_xref="GI:58264417"
                     /db_xref="GeneID:3256787"
     CDS             join(30765..30944,30981..31337)
                     /locus_tag="CNC00090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569365.1"
                     /db_xref="GI:58264418"
                     /db_xref="GeneID:3256787"
                     /translation="MSPLTPNPLSTLRVTKKQIPSYQNFPNTALHRHPLIIYHSAYPS
                     SLTADQVEKHLSSVGVHHYHSNTHELLVVVSGAGTLCFGGPRDEENKSRTEIDVEKGD
                     AMLVPSGVAHAMIEDKGGFSMVGSYPIGAKNWDMCTGQDGEKNDAWETVKGVKWFDKD
                     PIYGDEGPAINTREGDAK"
     gene            complement(<31726..>33431)
                     /locus_tag="CNC00100"
                     /db_xref="GeneID:3256178"
     mRNA            complement(join(<31726..32636,32687..>33431))
                     /locus_tag="CNC00100"
                     /product="RNA helicase, putative"
                     /transcript_id="XM_569367.1"
                     /db_xref="GI:58264421"
                     /db_xref="GeneID:3256178"
     CDS             complement(join(31726..32636,32687..33431))
                     /locus_tag="CNC00100"
                     /codon_start=1
                     /product="RNA helicase"
                     /protein_id="XP_569367.1"
                     /db_xref="GI:58264422"
                     /db_xref="GeneID:3256178"
                     /translation="MPPNLTPRSFNRDDGVTEEYINGLPAYPTPPTTLANEEQARPRT
                     FDDFGLEEGLVKSLKGLYGEDGKTTPIETLSFHHFTQPDIASAPIGSQRVLLGAETGS
                     GKTVSYLIPLFHHLKRTDPGPSVTSSFFADSENTLHPRSIILSPTHELTRQSTQFAKI
                     LTHNTKLSVHGMSSTVSGGVGEKRGSVDVLLGTVGSLRRMFGMTRSEEEQEKEDYIRG
                     KRIWQDEQEKGMVEGDKVEWVVIDEADVLLGREFYLDTISVLSQVKQANLILCTATLP
                     PFLINLLTTNPFFTKKEPFIHLLSPGLHKLPPKLLTRFIRPSTTGNKHGDVAHQVRLT
                     LAEDAKAAKAEGREGEEPSKIVIFCNSDKQVEQVSGILGTKKIDCLAWTGAGEERLRG
                     RNGSLNDFLQRPHLPGHEPPAPLPSLEPRETKPIFQDKNGTTPNVSQVTRRRVLVTTS
                     LLSRGLDFHPSVSSVFLVQPPRDVLDFVHRAGRAGRAGRPGRVVVFGIDEGGTLGEGA
                     KNNKGGKGQGPLKKDGKTALGDRLKDVLGKREVVGAMGKRVRT"
     misc_feature    34831..34888
                     /note="T-rich"
     gene            34913..36922
                     /locus_tag="CNC00110"
                     /db_xref="GeneID:3256192"
     mRNA            join(34913..35155,35246..35344,35402..35465,35543..35633,
                     35683..35843,35898..35967,36212..36329,36385..36466,
                     36525..36922)
                     /locus_tag="CNC00110"
                     /product="fatty acid elongase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41567462|gb|CF713303.1,gi|41568871|gb|CF714712.1,
                     gi|41568881|gb|CF714722.1,gi|41573644|gb|CF719485.1,
                     gi|41573651|gb|CF719492.1"
                     /transcript_id="XM_569369.1"
                     /db_xref="GI:58264425"
                     /db_xref="GeneID:3256192"
     CDS             join(34950..35155,35246..35344,35402..35465,35543..35633,
                     35683..35843,35898..35967,36212..36329,36385..36466,
                     36525..36527)
                     /locus_tag="CNC00110"
                     /codon_start=1
                     /product="fatty acid elongase"
                     /protein_id="XP_569369.1"
                     /db_xref="GI:58264426"
                     /db_xref="GeneID:3256192"
                     /translation="MFPFDAWTPGPGPVYTAITSVWDALDLPHPALGYRTWIPGESPL
                     STQKAVVAAVGTYLLIIFGGREMMKNRQPFKLKIPFQIHNVYLTLGSGLLLALMLEEI
                     IPLFLKHGFFWSICNTSAFTPRLVTYYMINYYFKYVELIDTVFLVLKKKPLAFLHVFH
                     HAATAVLCYTQLNGETSVQWVVITLNLTVHVIMYYYYYATAGGAKIWWKKYLTTLQIT
                     QFIIDLFIVFFATYSHFAFKYGVPAVGDCAGSEGAALFGCGLLGSYLVLFIAFYKATY
                     KKGVAKGKGKATEIRGSSKSK"
     gene            complement(37007..38665)
                     /locus_tag="CNC00120"
                     /db_xref="GeneID:3256434"
     mRNA            complement(join(37007..38090,38130..38339,38384..38665))
                     /locus_tag="CNC00120"
                     /product="manganese ion homeostasis-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41561258|gb|CF707099.1,gi|41561266|gb|CF707107.1"
                     /transcript_id="XM_569373.1"
                     /db_xref="GI:58264433"
                     /db_xref="GeneID:3256434"
     CDS             complement(join(37321..38090,38130..38339,38384..38648))
                     /locus_tag="CNC00120"
                     /codon_start=1
                     /product="manganese ion homeostasis-related protein"
                     /protein_id="XP_569373.1"
                     /db_xref="GI:58264434"
                     /db_xref="GeneID:3256434"
                     /translation="MPISFSRLAIALGIASIILLPFAYASSGDRNPTFQHCLRGCAAT
                     YCDPSQPPIAFYLRLFGWTCAENCAYHCSHSFTDKIGPGSRYHQFYGKWAFYRLGPFQ
                     EPFSIIMSLGNLLVNLQGVSAVRRRIRSENKLRKWLVSLGFVQVNTWIWSAVFHARDK
                     PWTERLDYFSATLTIAFTLLYSIIRILHFQTPLYTSRFLLPACVAVALLVLSHFKYIL
                     SFPLGQFPYGYHTMFNLCLGLIHNLLWVLWSFSFRFPYPTLRFGRFLSLSFPYPYPPH
                     NPYKNPSPKESSTPAVLVGLTTLAMSLELWDFAPLFRVIDAHSLWHTATIPLTMGWWH
                     FLMADALELEGSLMGQGGMGVGLLEEPIGRRRGGGPLERDADMPMTPTFQELDSGRVK
                     LTSSSPSPGTRMRISPKSSEFK"
     misc_feature    37752..37818
                     /note="GA-rich"
     gene            38879..41216
                     /locus_tag="CNC00130"
                     /db_xref="GeneID:3256252"
     mRNA            join(38879..39229,39276..39781,39824..39881,39934..40180,
                     40230..40316,40369..40574,40632..40689,40773..40883,
                     40999..41125,41197..41216)
                     /locus_tag="CNC00130"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530456|gb|CF676297.1,gi|41530463|gb|CF676304.1,
                     gi|41533423|gb|CF679264.1,gi|41533436|gb|CF679277.1,
                     gi|41562554|gb|CF708395.1,gi|41562564|gb|CF708405.1,
                     gi|41576270|gb|CF722111.1,gi|41576279|gb|CF722120.1"
                     /transcript_id="XM_569375.1"
                     /db_xref="GI:58264437"
                     /db_xref="GeneID:3256252"
     CDS             join(38990..39229,39276..39781,39824..39881,39934..40180,
                     40230..40316,40369..40574,40632..40689,40773..40883,
                     40999..41108)
                     /locus_tag="CNC00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569375.1"
                     /db_xref="GI:58264438"
                     /db_xref="GeneID:3256252"
                     /translation="MPSIRESRAPIEPDDVWEHSNSDPEGNHDFNNVLHIDYIEGEAL
                     ENMSENAMLLGETSAPMEYDHRLRRGRGWVTISGFSLPKPLLYLLAVPPLLILVNLVA
                     STYNSARPHAHYRHPTLTNGTHPFHPTILLLSLDGFRSSYLSTHAHLLPNLLFLSSSK
                     WGLRAESMQPVFPTLTFPNHWSLMTGLYPSSHGIVANDFWDPLFDEKENKGAQFVYTE
                     ESKSWDSRWWWGEPIWEVVEKVGRKAAVIMWPGPPVTRAGASPSYFVPYRNLPPSSKL
                     SQIFAYLDHPLPTRPEFIASYFPEIDQSAHRHGPDAPQVEEKLRMMDEMVGGLLRGLE
                     ERNLTGVVDLLIVSDHGMTGTSNERIIYLDDILGEDGIEAIEHKDGWPSVGLRFSPTS
                     NHSLYLSRLLSAAEASNGTFAVYTPDTMPQRWHFTGGRRIAPIYVVPDIGWAVTDRHE
                     HEVLFQGDYQPRGNHGYDNKYADMQAIFFAHGPFARTLKDMGKGFISHDPPVLHSFKN
                     LEIFSLVTRLLSLRDVEPGHNGTIGFWEGLLD"
     gene            complement(45400..47426)
                     /locus_tag="CNC00140"
                     /db_xref="GeneID:3256766"
     mRNA            complement(join(45400..45692,45754..46141,46207..46473,
                     46530..46600,46662..47092,47142..47197,47263..47426))
                     /locus_tag="CNC00140"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541093|gb|CF686934.1,gi|41541102|gb|CF686943.1,
                     gi|41552801|gb|CF698642.1,gi|41552805|gb|CF698646.1"
                     /transcript_id="XM_569377.1"
                     /db_xref="GI:58264441"
                     /db_xref="GeneID:3256766"
     CDS             complement(join(45448..45692,45754..46141,46207..46473,
                     46530..46600,46662..47092,47142..47197,47263..47334))
                     /locus_tag="CNC00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569377.1"
                     /db_xref="GI:58264442"
                     /db_xref="GeneID:3256766"
                     /translation="MITPEEQKQVTRKLTHWIESESKIVTYRTVSREIGCHVNVAKNI
                     LLRHFEANPSLAATYLLTGPLLSNSVLTQTTIQSGTTSKDGKSLRDLGDGMVKIVDMD
                     QNSDAGDSDVEGLESQSQGQSKAQRIGLMGTDDEDERMDGVGNDRGAQVGDGGIGGGK
                     RLGELGFKRERVKRWGVVLATAEALEEKKTLFDESELNIHIYALSPAPVKDPAQFLIA
                     SLELHDNANMYNSSIYGSITGHAFKPSAKPNPLAPAKPPIKEAAAPSIFARGPKEKMV
                     KEQTKKEVKKQGSTKDVKDEPLQSRSSTSATTAPAKNKAQPLNKSNSKKRVINSDTEE
                     DEPGPAKAKASTPTSKGGSSKTALEPTSSMVAREDKAALEAMAGMDVDFSDNEEPLAA
                     RPKAKEEARPLRKSATGRKVRRVKKTKREKDDKGYFVSKDYWTDESYSGESEPEQVET
                     QPRAQPASKRGGSKPPMKARESASSVGSGSGAGAGGNMKKSAGKPTGGQSTLMGFFKK
                     K"
     gene            <48108..50602
                     /locus_tag="CNC00150"
                     /pseudo
                     /db_xref="GeneID:3256242"
     gene            complement(50645..52790)
                     /locus_tag="CNC00160"
                     /db_xref="GeneID:3256354"
     mRNA            complement(join(50645..50947,51005..51153,51206..51489,
                     51545..51955,52012..52208,52262..52393,52610..52625,
                     52720..52790))
                     /locus_tag="CNC00160"
                     /product="phosphopyruvate hydratase, putative"
                     /transcript_id="XM_569379.1"
                     /db_xref="GI:58264445"
                     /db_xref="GeneID:3256354"
     CDS             complement(join(50835..50947,51005..51153,51206..51489,
                     51545..51955,52012..52208,52262..52393,52610..52625,
                     52720..52752))
                     /locus_tag="CNC00160"
                     /codon_start=1
                     /product="phosphopyruvate hydratase"
                     /protein_id="XP_569379.1"
                     /db_xref="GI:58264446"
                     /db_xref="GeneID:3256354"
                     /translation="MSVVTKVHARQIFDSRGNPTVEVDLYTEKGLFRAEVPSGASTGA
                     HEAVELRDKGSDYMGKGVLKAVENVNKVIAPALIDSKLPVTSQKEIDDLLIKLDGTEN
                     KGKLGANAILGVSMAVSEAAAADKGVPLYGYLAQLAGVSEPYVLPVPAFNVINGGSHA
                     GNALAFQEFMLLPTGASSFTEAMKMGSETYHTLKKVITKKYGIDAANVGDEGGFAPNV
                     SGAEESLDLLTEAIKQAGYTGKVQIGLDVASSEFFKEGKYDLDFKNPNSDSSKWLSGK
                     ELADLYHGYCEKYDICSIEDPFHEDDFDAWAAYNQTAKIQIVGDDLLVTNPRRIKMAI
                     EKKACNALLLKINQIGTISESIQAVQLAQSNGWGVMTSHRSGETESTYIADLAVALRT
                     GEIKTGAPCRSERMAKYNQLLRIEEQLEGKSIFAGGKGLSKGTTAPELHSSK"
     gene            complement(<53564..55457)
                     /locus_tag="CNC00170"
                     /db_xref="GeneID:3256132"
     mRNA            complement(join(<53564..53886,53948..54044,54134..54264,
                     54357..54481,54538..54542,54592..54708,54772..55037,
                     55091..55099,55146..55250,55308..55457))
                     /locus_tag="CNC00170"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533676|gb|CF679517.1,gi|41533685|gb|CF679526.1"
                     /transcript_id="XM_569381.1"
                     /db_xref="GI:58264449"
                     /db_xref="GeneID:3256132"
     CDS             complement(join(53564..53886,53948..54044,54134..54264,
                     54357..54481,54538..54542,54592..54708,54772..55037,
                     55091..55099,55146..55250,55308..55443))
                     /locus_tag="CNC00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569381.1"
                     /db_xref="GI:58264450"
                     /db_xref="GeneID:3256132"
                     /translation="MRFTAPRPNNFALALLPAALTLLLLLYLWTVSHRPPVPEKAKIE
                     NPHRWGFPEWYGKGPTPYDPESGLSVEKQKSVLLFIDLPYDSLSIPKALSTLQILRND
                     PSIRLSVISPFSSTWDHQSTPQENLESAGCENVDRLWRIGEYSGEVEGCEGVVWISEG
                     MDRRARVDGRANVILAQQPFDILRDEVSYDRLKESLGEDWELGLLSYIPPAADPSIFY
                     PEETPSYKSVTYFPLSSTPERKHPRMPWTGKWSKYTPSRKPPPPTKAGQDPLSPDSAY
                     IKHWRKEDKRRAKAMRKAGICLFEGWQDGQLDERMVEAMMAGCVVATVPPQTDYDMLK
                     PLILPLSPPSSSASPLSLPVKQISTLLASPRASQRLTYKALHAFLAARHHFTVQTRFE
                     RVWNVVKGWEEGKRGYDFDEGLMGFRWDCGTVMDGDAGRPAWCKD"
     gene            complement(55549..57274)
                     /locus_tag="CNC00180"
                     /db_xref="GeneID:3256576"
     mRNA            complement(join(55549..55751,55801..56340,56393..56783,
                     56850..57022,57102..57274))
                     /locus_tag="CNC00180"
                     /product="histone lysine N-methyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538296|gb|CF684137.1,gi|41538313|gb|CF684154.1,
                     gi|41547253|gb|CF693094.1,gi|41570540|gb|CF716381.1"
                     /transcript_id="XM_569384.1"
                     /db_xref="GI:58264455"
                     /db_xref="GeneID:3256576"
     CDS             complement(join(55695..55751,55801..56340,56393..56783,
                     56850..57022,57102..57215))
                     /locus_tag="CNC00180"
                     /codon_start=1
                     /product="histone lysine N-methyltransferase"
                     /protein_id="XP_569384.1"
                     /db_xref="GI:58264456"
                     /db_xref="GeneID:3256576"
                     /translation="MDTPGAGPSRQSSSAPAANNKLDPNVKPGTVLLTSDLLSSFQPA
                     KRFKDAVLEPTSTPSGPKTHSVTTLTFDDTGDRLISAGDDNQFILWDARKGKKIKSFY
                     SKKYGIDHVRSTHKTGTILHASTQGGDHAVRYHSTHDNAYLAYFKGHTARVRSIDMSP
                     ADDSFVTAGDDGTVRLWDLRANACKGLVNDVGGSAIAAMDNTGVVFAVACSDTQTIMM
                     YATKTADVHPFIHQGLIDIALEDISTPPPKPIFTSLHFSNNGQYLLVGTSSDVHYVLD
                     AIYLTPLRRLVGHVGLERDAQGNKGVEPRRGISGEELCWTADSNWVISGSANGEVVAW
                     DLRPEPGQSQLTRSDVAGGNWHTANPPDWTTLRIPDLKPKVVLHGDGAGSGPTRAVKF
                     NPRYNLMAVGGYDLTLWMPIKDEEARLAAEGW"
     gene            complement(57930..59003)
                     /locus_tag="CNC00190"
                     /db_xref="GeneID:3256261"
     mRNA            complement(join(57930..58142,58204..58214,58285..58390,
                     58470..58496,58560..58642,58697..58782,58863..58875,
                     58943..59003))
                     /locus_tag="CNC00190"
                     /product="hydrolase, putative"
                     /transcript_id="XM_569386.1"
                     /db_xref="GI:58264459"
                     /db_xref="GeneID:3256261"
     CDS             complement(join(58089..58142,58204..58214,58285..58390,
                     58470..58496,58560..58642,58697..58782,58863..58875,
                     58943..58985))
                     /locus_tag="CNC00190"
                     /codon_start=1
                     /product="hydrolase"
                     /protein_id="XP_569386.1"
                     /db_xref="GI:58264460"
                     /db_xref="GeneID:3256261"
                     /translation="MASLASCIFCKIIKGEIPSMKLLETESVFAFMDVGPIARGHCLV
                     IPKQHAATFTELPDEAMVDILPTCKKLAAATGAENYNILQNNGRPAHQVVDHVHFHVI
                     PKPAEAGDKEGLVIGWPTQKDLSKDEISKIFEQMKSRL"
     gene            <59405..>60418
                     /locus_tag="CNC00200"
                     /db_xref="GeneID:3256144"
     mRNA            join(<59405..59632,59693..59895,59975..60046,
                     60091..>60418)
                     /locus_tag="CNC00200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569388.1"
                     /db_xref="GI:58264463"
                     /db_xref="GeneID:3256144"
     CDS             join(59405..59632,59693..59895,59975..60046,60091..60418)
                     /locus_tag="CNC00200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569388.1"
                     /db_xref="GI:58264464"
                     /db_xref="GeneID:3256144"
                     /translation="MSHSPNLTSHDPNAYRTHASFVFSAANSAPVLGLLDPKPGEKII
                     DLGCGTGEITIAIKEVVGQQGTVIGVDANQSMLDSAASSGPSTIRWIQADIQAAQSFS
                     KAHPEYEAAFDAVFTSATLHWCKDSPEGVVQLIRWLLKPGGRCGVRAALHHAIRAKGI
                     DPVPLDPCIHKKLQLKGLQVLQSGGLIPSNVHLVPRPTPLPTTLEGWLVTFARNSFLS
                     SFSDDEAKAIMKEVVGICRVDNYWSDENPGTGVKGSGEGGESGWEVLYVRLRGVGKKP
                     "
     gene            complement(60441..62344)
                     /locus_tag="CNC00210"
                     /db_xref="GeneID:3256234"
     mRNA            complement(join(60441..60812,60868..60873,60930..61229,
                     61288..61581,61637..62344))
                     /locus_tag="CNC00210"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538906|gb|CF684747.1,gi|41538915|gb|CF684756.1,
                     gi|41549113|gb|CF694954.1,gi|41549124|gb|CF694965.1,
                     gi|41554268|gb|CF700109.1,gi|41554277|gb|CF700118.1,
                     gi|41563796|gb|CF709637.1,gi|41563810|gb|CF709651.1"
                     /transcript_id="XM_569390.1"
                     /db_xref="GI:58264467"
                     /db_xref="GeneID:3256234"
     CDS             complement(join(60480..60812,60868..60873,60930..61229,
                     61288..61581,61637..62293))
                     /locus_tag="CNC00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569390.1"
                     /db_xref="GI:58264468"
                     /db_xref="GeneID:3256234"
                     /translation="MPYYAPRPAFRNGLRSATSLLPWNTPAKVHFNSLRISFYSSALM
                     PYSSEKNYPSFVSRPFTFSHRLSSDCSTQVGGGGDSVGMSRLPSPLFAPIPLRHFRSK
                     GLRNFLPRKRLFSSTPTTASLLPPSPAASDAEMMSDSEESEAVRQGKRISKELMTTSS
                     AGGGRYVRIVDVSPRDGLQNLKGKPVPTEVKRELVERLLEAGVRNIEVGSFVRSDWVP
                     QMADTPQLLPLLPPFTGKTLSPPSPVSRSESPFSGRPSSPSIGPLIGEHLPPHAEDVH
                     YPVLVPNMRGLDNLIKLQEEWSSKGLPALTDEIAVFVSATEAFSQANNHAPISKVLDS
                     LPSVINKAKSHRFRVRGYVSCVITCPYSGPTDPNQAVDVAERLLQMGCYEVSMGDTTG
                     EGDPDSWKILWDRMKDRGLDMDKIAAHCHDTFSLALSSILSLVPYGLKTIDSSLAGLG
                     GCPYSPGATGNVPTEDVVYALHKMGYETSIDLDRLVESGNWLAKTLGVRNESRVGRAI
                     WARRQRREEIEGKGAETEDGM"
     gene            complement(62618..65352)
                     /locus_tag="CNC00220"
                     /db_xref="GeneID:3256812"
     mRNA            complement(join(62618..63062,63127..63587,63643..63731,
                     63781..63913,63970..64418,64470..64604,64669..64913,
                     65072..65094,65152..65352))
                     /locus_tag="CNC00220"
                     /product="CTP synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41541607|gb|CF687448.1,gi|41541625|gb|CF687466.1,
                     gi|41550882|gb|CF696723.1,gi|41551411|gb|CF697252.1,
                     gi|41551429|gb|CF697270.1,gi|41558412|gb|CF704253.1,
                     gi|41558421|gb|CF704262.1,gi|41564221|gb|CF710062.1,
                     gi|41569871|gb|CF715712.1,gi|41569876|gb|CF715717.1,
                     gi|41576198|gb|CF722039.1,gi|41576216|gb|CF722057.1"
                     /transcript_id="XM_569392.1"
                     /db_xref="GI:58264471"
                     /db_xref="GeneID:3256812"
     CDS             complement(join(62758..63062,63127..63587,63643..63731,
                     63781..63913,63970..64418,64470..64604,64669..64913,
                     65072..65094,65152..65189))
                     /locus_tag="CNC00220"
                     /codon_start=1
                     /product="CTP synthase"
                     /protein_id="XP_569392.1"
                     /db_xref="GI:58264472"
                     /db_xref="GeneID:3256812"
                     /translation="MVKYILVCGGVISGIGKGVIASSTGLILKTAGLKVTSIKIDPYM
                     NIDAGTMAPTEHGEVYVLNDGGETDLDLGNYERYLDVSLNKDNNVTTGKVYQHVIDRE
                     RRGDYLGKTVQIVPHLTNAIQDWVERVSKVPVDETGEEPDVCIIELGGTVGDIESMPF
                     IEAMRQFQFRVGHENFALVYVSLIPVVGGEQKTKPTQAGVRDLRGLGLLPDLIACRCT
                     EKLLTATMEKVSMFCHVSPRQVLGVHNVSSTYHVPLLLQEQGMLKFLWERLSLSSINM
                     RPELKARGEKIMEKWQVLTTGLERCFETVEIVLVGKYITLEDSYMSVVKSLEHAAMRC
                     GRKLILHWVDSSDLELTMQTENPIKFHNAWQAVCSARGIIVPGGFGLRGTEGMIAAAK
                     WAREQNIPYLGICLGFQVAVIEWARHVCGLEKANSAELVPDSPHPVICFMPEISKTHM
                     GGTMRLGLRPTIFEPNTEKSKLRRLYGSRNIAWERHRHRYEVEPKYVEQLEAPGGMRF
                     IGKDERGERMQMLELDDHPYFVGLQAHPEFCSRPLNPSPPFVGLIAAACGLDVLEEQL
                     ANNEKNYVDPHPESDKVIPESEAATQAGKGKSQSVEGVRVKHEDVVDALGKKLDEVAE
                     I"
     gene            complement(<65944..>66704)
                     /locus_tag="CNC00230"
                     /db_xref="GeneID:3256666"
     mRNA            complement(join(<65944..65977,66042..66164,66251..66363,
                     66422..66462,66568..66595,66669..>66704))
                     /locus_tag="CNC00230"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_569394.1"
                     /db_xref="GI:58264475"
                     /db_xref="GeneID:3256666"
     CDS             complement(join(65944..65977,66042..66164,66251..66363,
                     66422..66462,66568..66595,66669..66704))
                     /locus_tag="CNC00230"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein"
                     /protein_id="XP_569394.1"
                     /db_xref="GI:58264476"
                     /db_xref="GeneID:3256666"
                     /translation="MAAVLLFTMVFFIIMFSDLECDYINPIDLCNKLNQFVLPEMIAH
                     AFLTLCFLLSGQWLAFLLNAPLVAYNVNKIMSKNHMYDATEIFRTLSGHKKESFIKLG
                     FYLISFFYYLYRMILALISESD"
     gene            <67161..>67936
                     /locus_tag="CNC00240"
                     /db_xref="GeneID:3256640"
     mRNA            join(<67161..67324,67391..67659,67728..>67936)
                     /locus_tag="CNC00240"
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /transcript_id="XM_569396.1"
                     /db_xref="GI:58264479"
                     /db_xref="GeneID:3256640"
     CDS             join(67161..67324,67391..67659,67728..67936)
                     /locus_tag="CNC00240"
                     /codon_start=1
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /protein_id="XP_569396.1"
                     /db_xref="GI:58264480"
                     /db_xref="GeneID:3256640"
                     /translation="MANPRQRNKAKSSRTQKPSLNAKRRMHQKLRKAPPLKGPEVLQE
                     KWDKKKTVFQNYAALGLLPSIPVSKGASTSRSQRVKLPEVPAEAEAQNVKVGFGRIIR
                     DEEGNVIDIIIDEDEEKQEEEQIEVDEEKELEPVEAKTEVVKRLEELAASAAPVKRHS
                     SMSERTWLQQLVDKYGDDTERMARDRKLNVWQKTEGEIKRMIKKAGGVQMLRK"
     gene            complement(68265..74795)
                     /locus_tag="CNC00250"
                     /db_xref="GeneID:3256448"
     mRNA            complement(join(68265..68465,68534..69039,69167..70172,
                     70228..71265,71313..71836,71893..73884,73938..74795))
                     /locus_tag="CNC00250"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41554488|gb|CF700329.1,gi|41554498|gb|CF700339.1"
                     /transcript_id="XM_569398.1"
                     /db_xref="GI:58264483"
                     /db_xref="GeneID:3256448"
     CDS             complement(join(68334..68465,68534..69039,69167..70172,
                     70228..71265,71313..71836,71893..73884,73938..74322))
                     /locus_tag="CNC00250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569398.1"
                     /db_xref="GI:58264484"
                     /db_xref="GeneID:3256448"
                     /translation="MPNISESIDSVMEGVKGLVNMAEGYLAPASDEGEASVPPPRPQS
                     QPLHIPSTHRNTTSKFALPQQSQLVQTIDVPSGWIHLQAAYLDGDGGQRQVRPFGLRN
                     LTEEEVEVEVESDLKQLLFWASDDEKSIPSSASSTSSLSTNAGLPSLQITIPASSTVT
                     LFIAFQPTVSLPPFPLNPLPPTGTIDDGGYTPRVKPILSRTNSFELSPVGLSVSDSTE
                     SGQSLQSVAGNIRETHVAKRPEPIHRAFSVHGSVSIQAITATSHQSIALPFFATVCRS
                     VFTAGPIEPVSGLVTGSQQSSGDLVVDFGSENVMGKKYHRDILLVNRSEIELVWTTHV
                     VSAPHKDSVWFELRDLDSENVFGVDHSSQPVPLPALSSRHLRLSLRSKAPVNDFEFSF
                     LLSNSNQAGNIVTCKAIGSILPTTADDSLKILSGPTLDFGEITDKVWARQTISVRNVG
                     DRTLDVRFGKSEGVEVVFRLAGVAGEDVDEDLPIERSMGISSAKEKGLGLSRTSTREV
                     AYPADHPHVHSTSLEQGKDEGGNENTEKWKEREMSQSGGSRPLSRITSRTSSSHQGPY
                     HLEGFESESEDVEAPFFGGGGGGGGTGSGGQDGQLSLLGSHPRVMASPTIPAPTEQQV
                     IPNQIEEITMRPGTEYRISVLHRPASLGPSAAPEIAGTLRKSSFKIYLDSIPSSLRSS
                     HATHTSTRRTISATVSSCTSLIRLVSGNVVDFGQVTVGASKSTTIKIENLSELSTKVE
                     IAAMSKVLSVNKSVIVIPPKEVVEEKMEFFPRRINEKYEKQIFIRNLLNRANDQLVEI
                     KSRNVDVYNLTLHSHLYRILTPSGSNFLDFGSVVINSPTVRIINIENLSRAPLVLDLS
                     ASQPEDIELFVKAEDSSAAKALASGKYAEEAQSSSHGGERPGGTGELKERFMEELNEK
                     SSNGGSIKSKKGREKNGGRAKEENGEEIGGKKGSIAASVATALKKGSRGKPVQLYGNS
                     VVFKDRSLLEPHEYLDLASGPPVAAHRSSPHSKRTQLLESIELEDKSKLSGQHPKVPK
                     LDFAAGAKATGAVGKEGKKRRQAQEHSHHHTQHHSHPSQARTAPGTGQHTPKTPDKTK
                     PHLGSFALINRLLPQVTDGGLKSPALTAKRIEPPLDNPPAAPTDPSKMTPDQLLLAIE
                     QHDAKKSSMTHTTLEEEEAFVRRTIALRKELQNLIANNRLIPAQTLRVAPGASRSLIV
                     IMTPNSSIRPHISTRAKRADSRIFIKLLEFDKSLLNSARSGPGITPGPGSRKQLGGDQ
                     DMEVLEGVELPIRDLIIRSSCVRSVLEVQQSSINFGACDKGEVKSKTIVIHNKSDCIG
                     LFRLRTSGSIASGDLKLGLGRYGVISAFGRKQFDNFSFTPSLVGNYQENITIENVLDS
                     WNDQPLAVKATVRKVPTFKVDPLSLDFGVVEKSTRKPETKGFVITNVSKHERTFVISV
                     QDLVPNSFAEIHLIQDEKDAGTALSRVEEEELEALLQKLKIARRKGKAEKIAKYETRL
                     LELGVPKPQLNAGAEGEVGKDGQEEESSASVAGKVIAEIASSVLTTLKDTKADLPKEC
                     ITKLNLTLAPKQKSNILVDLIPRNPSSSADDGQKDESSIDVSASITIHDRKNTDETVS
                     VNVMASRMAKPVRSRTMDTSNSSGQEDMDGHVTPSATSISPTAFCVGSTLFLPSSSSY
                     YPPLKSHFDAFPQSVVGEPKGLILADGWSRQIPGNTHAEANALTNFKTKYADILSDDD
                     GDDEGQREGEGFIEGRGYEQREGSSGVEDKVEGEESGSTVSSKEVIQLPPIDMVLKDA
                     ICFATMEPCSYRTSGGPSCALELVRAGVKAVYLGVEEPPDFVECEGVRILQDGGVRVV
                     RVVGLEEDCLKAARRGRT"
     gene            75371..79133
                     /locus_tag="CNC00260"
                     /db_xref="GeneID:3256134"
     mRNA            join(75371..75752,75809..75903,75990..76107,76158..76250,
                     76308..77390,77436..78092,78147..78269,78327..79133)
                     /locus_tag="CNC00260"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530032|gb|CF675873.1,gi|41531509|gb|CF677350.1,
                     gi|41531522|gb|CF677363.1"
                     /transcript_id="XM_569400.1"
                     /db_xref="GI:58264487"
                     /db_xref="GeneID:3256134"
     CDS             join(75579..75752,75809..75903,75990..76107,76158..76250,
                     76308..77390,77436..78092,78147..78269,78327..79085)
                     /locus_tag="CNC00260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569400.1"
                     /db_xref="GI:58264488"
                     /db_xref="GeneID:3256134"
                     /translation="MPRKALPPVAVAPVDALRPPPPPSPIVQTLRKDWRWAAISQFIA
                     TFSDAFGLLDWDIEVLEKDFDGDETALIPTLVAKLLFALTYNRQINSENAFEQLRKQY
                     LKRAPETTLLGTVEEPVEWAALGLSQKVGILHQLCEWQMDDPARFRGLLKTEDDAVSW
                     RIEPVGWDKSGNIYWLFDDNRLWIQRTPPLPPAPPKKSSLKAKRALKRARNNINNTSK
                     SNSKFKAKPAPKPKPKTKPSTSTPRPKGPPVKREPTPPPEEISGSRRRAPVAFYGNPT
                     PTALALKRGAVFPPASGGTPTNGRATRSSARISGVNGNSTDQSTAIGATPSKTAKKTQ
                     LPLGTRVSRRLRNVDDEWQQVPDEWLDGAKEDHADTEDASDGEKEEEGDDDESELSDL
                     TDEEEHAAEVEAVKARESQENGQPKKNRRKAVKEEVEEKVEEVADADSPLSELPEPDP
                     EPIVEQDDEEDEYNPDEDVEQDDAMDVDETEPKQEEEEDDAEEDGEEEEDIIKAAIKE
                     ANNLPEGFIEWETVCVTLYDWRTFPEQFAKSKHPDEKALYKLLHDQVGPTIIEQLTEK
                     EKERLKQEAFLNRKRSSRIATKELEKEEAVRREQAQREMEERMERTRKEEMRKAKEEA
                     EALAREKAREDRLKEREERAQAREEAALRKAEEEQKAKEKEERRREKRKRRREGEIVS
                     DDSEDESSQAPSRRSRTMTPSHMGETTNQKSKVGAGKAVAGNRWELGCEVCGMHGWNI
                     DGDKDLVSCDECGKWQHVECLDRLDRSQGRVRRNWSKVDFTCKECQQRAANKRLRIES
                     LTHANSRPIPVIPSPLAPRPTPPHPYPHPRPHSAHQQQQSPPYPILPGSAPGPQPLLN
                     PSRPPPPPLQAGQYYLPYPPESRSPAQPAGYAVYYPPGDPRHDTTAPQPHHQHQPHQE
                     RRISGQGNNRRASAEGYAPSPTGVTPGYASPHVQAHAYPTAPQYSSLAPSPSSGAAYP
                     PTAYSHPQIQTQAPRPIQVHQAHLMPSHLPTTARYPHQPQMQAGAVGHVPPDPRLQDT
                     RQQ"
     misc_feature    77275..77326
                     /locus_tag="CNC00260"
                     /note="GA-rich"
     misc_feature    77682..77802
                     /locus_tag="CNC00260"
                     /note="GA-rich"
     repeat_region   77857..77904
                     /rpt_type=tandem
                     /rpt_unit_seq="gagaa"
                     /satellite="microsatellite"
     gene            complement(79494..81810)
                     /locus_tag="CNC00270"
                     /db_xref="GeneID:3256761"
     mRNA            complement(join(79494..80521,80568..81240,81294..81334,
                     81393..81810))
                     /locus_tag="CNC00270"
                     /product="multiple drug resistance protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535542|gb|CF681383.1,gi|41535548|gb|CF681389.1,
                     gi|41545927|gb|CF691768.1,gi|41545933|gb|CF691774.1,
                     gi|41550459|gb|CF696300.1,gi|41550473|gb|CF696314.1,
                     gi|41558460|gb|CF704301.1,gi|41558468|gb|CF704309.1,
                     gi|41564152|gb|CF709993.1,gi|41564162|gb|CF710003.1,
                     gi|41565812|gb|CF711653.1,gi|41565826|gb|CF711667.1,
                     gi|41566743|gb|CF712584.1,gi|41566744|gb|CF712585.1,
                     gi|41567786|gb|CF713627.1,gi|41568582|gb|CF714423.1"
                     /transcript_id="XM_569402.1"
                     /db_xref="GI:58264491"
                     /db_xref="GeneID:3256761"
     CDS             complement(join(79556..80521,80568..81240,81294..81334,
                     81393..81641))
                     /locus_tag="CNC00270"
                     /codon_start=1
                     /product="multiple drug resistance protein"
                     /protein_id="XP_569402.1"
                     /db_xref="GI:58264492"
                     /db_xref="GeneID:3256761"
                     /translation="MSIVSDVTQVDGRTRSKFTADDKPLSSYTLKKYPWRPYVTPFEE
                     IIGKKYPGSGTNEDPYIVDWLSNDKEDPQSWPGTYKWFTIFIVSSMTLAVALSSSAYS
                     GGIESLIKELGASRELLIAGISLFVVGFAFGPLFWAPLSEVFGRRYIYIASYALLTLW
                     SGAAAGAPNVGALLVFRFLAGFFGSSPLANAGGTISDVLDANQRGLGMAFFSAAPFLG
                     PSLGPITGGFLGLTSGWRWVEGFLTIFCGVLFIIGIVFCGETYAPVILRARAKRLSQV
                     TGDVYRFRADAKKPLNVTSMFRMSLIRPWKFLFLEPIVTILSLYTALIYGILYLFFAA
                     YPIIFQSGHGWNTGVGGLAFLGVLVGTVLSVLLSIFISNPQYIKVAKKKGGRADPEDR
                     LPPAMWGGVLIVIGLAGTAATDGPDIHWIAPIIFGVPFGCGIIVVFLSILGYLVDSYT
                     IYAASVLAANSVLRSLFGAAFPLFTVQMFDKMGVHWGVALPGFLSLACIPATWVFYKY
                     GAAIRAKCKYSADAERQMAMIMAARMAQSKQEDEEARAEGKEVIYPVGSRPESEVQDV
                     QPAEQEGGLGKVVSRAGEYTGPHSNGGAPLARVPTHLHHEWTIYEALADRDENDLQDD
                     ERIKLQDMHTKFDNKLRK"
     gene            <82687..84362
                     /locus_tag="CNC00280"
                     /pseudo
                     /db_xref="GeneID:3256768"
     gene            complement(<84908..>86961)
                     /locus_tag="CNC00290"
                     /db_xref="GeneID:3256600"
     mRNA            complement(join(<84908..85882,85930..86488,86535..86689,
                     86740..>86961))
                     /locus_tag="CNC00290"
                     /product="multiple drug resistance protein, putative"
                     /transcript_id="XM_569405.1"
                     /db_xref="GI:58264497"
                     /db_xref="GeneID:3256600"
     CDS             complement(join(84908..85882,85930..86488,86535..86689,
                     86740..86961))
                     /locus_tag="CNC00290"
                     /codon_start=1
                     /product="multiple drug resistance protein"
                     /protein_id="XP_569405.1"
                     /db_xref="GI:58264498"
                     /db_xref="GeneID:3256600"
                     /translation="MYTTSDSTQASDGKPLSSYTLRRYPWRPYVVPFDDIVGKKYPGS
                     GTNEDPYIVDWLPNDKEDPQQWPGTYKWFTIFIASMMTLAVALSSSAYSGGVISIMED
                     FGSSRELLIAGISLFVLGFAFGPLLWAPLSELYGRRWIYIISYALLTLWSGAAAGAPN
                     VGALLVFRFFAGFFGSSPLANAGGTISDVLDANQRGLGMALFAAAPFLGPALGPITGG
                     FLGLTSGWRWIEGFLTILSGVLFLVGIGFASETYAPTILRRRAKRLSRVTGDVYRFRA
                     DAKKPLDAMALFKASLIRPWKFLFLEPIVTILSIYVALLYGILYLFFAAYPIIFQEGR
                     GWNTGVGGLAFLGVLVGTIISVAVSILVVNPQYVKVANKKGGRAAPEDRLPPALWGGI
                     LIVIGLAGTAATDGPNVHWIAPIIFGAPFGCGIIIVFLSIMGYLVDSYTIYAASVLAA
                     NSVLRSLFGAAFPLFTTQMFDKLGLHWGVALPGFLSLACVPFTWIFYKYGAAIRAKCK
                     YSADAERQMEMIMAARMAQSKQEDEEARAEGKEVIYRAASRPEGDESQDVQPSEQTGG
                     LGRSQSKRSQHSASAGQSGNGAPLDRVSTHLHHEWTVYEALANRDENDLDDDERIRLE
                     GLRRTFGDRSEK"
     gene            complement(88126..92215)
                     /locus_tag="CNC00300"
                     /db_xref="GeneID:3256822"
     mRNA            complement(join(88126..88449,88519..88577,88631..89114,
                     89170..89330,89387..89616,89672..89739,89791..89862,
                     90169..90450,90502..91016,91068..91370,91423..91489,
                     91538..91709,91759..92215))
                     /locus_tag="CNC00300"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531618|gb|CF677459.1,gi|41531624|gb|CF677465.1,
                     gi|41550211|gb|CF696052.1,gi|41550969|gb|CF696810.1"
                     /transcript_id="XM_569407.1"
                     /db_xref="GI:58264501"
                     /db_xref="GeneID:3256822"
     CDS             complement(join(88353..88449,88519..88577,88631..89114,
                     89170..89330,89387..89616,89672..89739,89791..89862,
                     90169..90450,90502..91016,91068..91370,91423..91489,
                     91538..91709,91759..92107))
                     /locus_tag="CNC00300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569407.1"
                     /db_xref="GI:58264502"
                     /db_xref="GeneID:3256822"
                     /translation="MDPYSVDYTRHSQYQQYNPVRIAPGLEASSSRTASTSDIYGRGN
                     SAYSSSWTGASPVDERPARKLDRPWEHENDIKGLSQPQASAQQPPQQQQSLQPSVFPS
                     SGPTAKRGSRACMACRRGKNRCEWDPAGKETSCRRCLMNGTQCVFEKPAEKNGTRART
                     NSSAVADHPNEAENRITSLEKMVETLSSGQTQMQTTLQQILTLLPQTQSLLTPTGHPS
                     FLSHNTPSTGVPPSTIFASVSPPQTFHDGAGMSSVRDHAQSDRPRSPQNTASGRGISN
                     STMNRVKSVKEFPPLPGFAPPNHRFGTYGIIPLPSAPPSPSRSRHSSRSSSSSRSRDE
                     YSSALPHETLTAPIQALQALANAADQAAALVDKDDEGEKGKSTSQEVRSDGSDEDSRR
                     GEGEAKGGAERQWKLNGEDDEDRGRSRKRKRVTIDGQNIHLRVRKKTRPDPTPRNPFP
                     DVVTKGLVSEKEARELWDIFFSGCHYFVPLWDKSYDTFETYIERTPFSTNGLLAVAAK
                     IRAGNGPVDETFHRCLEEAQGIARSTLFGPIVRKEAVMAMLILSLWSQNGWLPCGVSL
                     GTGKPILLRDDSSVRKARELLDHPMASDTDVRLIAGVELVNIRITILEHLTPLHGSTD
                     APTISFVKSKLAELQAWHQEWYCIHKRRYDDESVVVKLLETERVYAELWTVCMALRGC
                     SWDKLSHEQKELAFHAKDCAWRCLEIFLRSDNFRKHLKYATHDQLVSVAFAAVFLLKV
                     AILYPTSLSIPLLVSQVSELAHCLSAECFAERYALTLRLMLSNFRRTTGAMSTIPGTP
                     RTAASAAAGAVHGLSGLSMTALNVNGQLNDVEGSFQNFLSLPQMENHNMEVGGEGENA
                     SNGMGATGFTGTEGDGGLWGMMGLEGFDWPTELSPSSLPVWLQDGNATDLGLPVDGSD
                     SLFLPVELANMFMPSNSQTSGLYQFTLPDSGDVGTEAW"
     gene            92683..93332
                     /locus_tag="CNC00310"
                     /db_xref="GeneID:3256239"
     mRNA            join(92683..92771,92831..93003,93065..93189,93251..93332)
                     /locus_tag="CNC00310"
                     /product="Hmp1 protein, putative"
                     /transcript_id="XM_569409.1"
                     /db_xref="GI:58264505"
                     /db_xref="GeneID:3256239"
     CDS             join(92733..92771,92831..93003,93065..93189,93251..93258)
                     /locus_tag="CNC00310"
                     /codon_start=1
                     /product="Hmp1 protein"
                     /protein_id="XP_569409.1"
                     /db_xref="GI:58264506"
                     /db_xref="GeneID:3256239"
                     /translation="MSNPNEPSKTNGQLNSLIGTGKTLVGNAIETAYSTVGGSTESSS
                     WTTAGQKQHDKGEAEISAAKTQGYVEGVGDRLEGKKDSVVGAITGDKTQQASGNVQHD
                     KGETQMDINKSS"
     gene            complement(93470..95826)
                     /locus_tag="CNC00320"
                     /db_xref="GeneID:3256256"
     mRNA            complement(join(93470..95171,95222..95475,95536..95826))
                     /locus_tag="CNC00320"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41570589|gb|CF716430.1,gi|41570593|gb|CF716434.1,
                     gi|41570843|gb|CF716684.1,gi|41570856|gb|CF716697.1"
                     /transcript_id="XM_569840.1"
                     /db_xref="GI:58265367"
                     /db_xref="GeneID:3256256"
     CDS             complement(93645..95117)
                     /locus_tag="CNC00320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569840.1"
                     /db_xref="GI:58265368"
                     /db_xref="GeneID:3256256"
                     /translation="MPGAAGLSQSHHRSVSLPFSSLGKRRLPFEYRSESEDAEVKRVR
                     HSGRGEPSTSASVTGRVSNETSGQPRAPSSRKAPSSFPPDFFAPPPAAGSSSTSASRP
                     VSILPRTPSPSRQGVIPDNSQTPRLPLEWRAPEFGSRTGTPLRTPFINERTPEFATTP
                     EPPIMSMSPSLEGTALGSRLTPGRTLLSLHGSTPDRSDEDIQAEASTSTPTSGQAPSR
                     TGEGISLSAVTELERIDEGEELAPSPPVQHMSPAGQLRFPVVKPHPGLGVGVTGSPSS
                     GSPKLVRRSISQPNQSTTPSLLGQHSLLAPPALISRGSRAGSERPAVPSRAFTQSPPP
                     RPRSASAMYRSSYGRSVSASSSRHASPLPSTIIPTEVAPQVRSASADYMRIAMFGLEG
                     ASLDSIDYADDPLQTDTLPDVTEDPAAEEREAGPSAGTGTSAGVTAERRRWRKVDEVV
                     TPGHRTLLGTERYNDTRFGDIPVGMWAQPKIDFGTPGGPF"
     gene            complement(99183..99931)
                     /locus_tag="CNC00330"
                     /db_xref="GeneID:3256141"
     mRNA            complement(join(99183..99505,99562..99635,99690..99843,
                     99904..99931))
                     /locus_tag="CNC00330"
                     /product="bud site selection-related protein, putative"
                     /transcript_id="XM_569411.1"
                     /db_xref="GI:58264509"
                     /db_xref="GeneID:3256141"
     CDS             complement(join(99334..99505,99562..99635,99690..99843,
                     99904..99926))
                     /locus_tag="CNC00330"
                     /codon_start=1
                     /product="bud site selection-related protein"
                     /protein_id="XP_569411.1"
                     /db_xref="GI:58264510"
                     /db_xref="GeneID:3256141"
                     /translation="MGRLRRSRTHHARRDVHRAARTRARVKDLDQIETDLRPQNRNRL
                     EKQPIDEDKPGLGQHYCVECSKYCETAVALQSHLKSKVHKRRLKELKEGAYTVDESER
                     AAGLGTDNKQRGVEDVIKRFDGINSSAAGPSIVAQPQA"
     gene            100287..101874
                     /locus_tag="CNC00340"
                     /db_xref="GeneID:3256605"
     mRNA            join(100287..100508,100565..100675,100740..100982,
                     101043..101483,101552..101874)
                     /locus_tag="CNC00340"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546627|gb|CF692468.1,gi|41546631|gb|CF692472.1"
                     /transcript_id="XM_569413.1"
                     /db_xref="GI:58264513"
                     /db_xref="GeneID:3256605"
     CDS             join(100632..100675,100740..100982,101043..101483,
                     101552..101819)
                     /locus_tag="CNC00340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569413.1"
                     /db_xref="GI:58264514"
                     /db_xref="GeneID:3256605"
                     /translation="MCVTFFTLSQPGYKLILAFNRDEFLDRPTLPAHWHDFNSPSPLT
                     PTLYKFNNFTDPCSRENKESDDGGRVLSGLDRGKAEGGTWLGISKDLKVALLTNIARI
                     RPAPGVQPLSPPPSRGKLLREFLSPSPLTSSQLETQSYISSHFPTAGDYEGFNLLLFS
                     LSPERNIGYLTNRPSPSSLDLTSSLCGGEDGQRRCVGLSNSPLDEKWPKVQQGEKNME
                     KSLREWEEKREGEDRLVERMFRVLSPSRPITCDDDLTLSTTIPPIKLGEDLFLNTDPQ
                     NTRARWKGTRTATVIIVKDSGETTYVERDIWMIDEDGEPKKGEDERRFKFVGEEK"
     gene            complement(101916..103978)
                     /locus_tag="CNC00350"
                     /db_xref="GeneID:3256686"
     mRNA            complement(join(101916..102048,102105..102174,
                     102231..102582,102856..102895,102954..103386,
                     103449..103604,103672..103746,103856..103978))
                     /locus_tag="CNC00350"
                     /product="ribosomal protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530417|gb|CF676258.1,gi|41530426|gb|CF676267.1,
                     gi|41532231|gb|CF678072.1,gi|41532238|gb|CF678079.1"
                     /transcript_id="XM_569415.1"
                     /db_xref="GI:58264517"
                     /db_xref="GeneID:3256686"
     CDS             complement(join(102034..102048,102105..102174,
                     102231..102582,102856..102883))
                     /locus_tag="CNC00350"
                     /codon_start=1
                     /product="ribosomal protein"
                     /protein_id="XP_569415.1"
                     /db_xref="GI:58264518"
                     /db_xref="GeneID:3256686"
                     /translation="MAPSKTAGKAAAKPQDVKAKAAKKAALKGTQSTSVRKVRTSVTF
                     HRPSTLRLPRAPKYPRKSVHHLPRMDQFRTIQHPLNTESAMKKIEEHNTLVFIVDIKA
                     NKRNIKDAVKKLYDVEAAKVNTLIRPDGRKKAYVRLTADFDALEVANKIGFI"
     gene            104759..107684
                     /locus_tag="CNC00360"
                     /db_xref="GeneID:3256782"
     mRNA            join(104759..104930,105132..105153,105490..105807,
                     105858..106000,106051..106576,106633..107684)
                     /locus_tag="CNC00360"
                     /product="protein phosphatase type 2C, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529996|gb|CF675837.1,gi|41530002|gb|CF675843.1,
                     gi|41532847|gb|CF678688.1,gi|41532855|gb|CF678696.1,
                     gi|41544199|gb|CF690040.1,gi|41544203|gb|CF690044.1,
                     gi|41555725|gb|CF701566.1,gi|41555739|gb|CF701580.1,
                     gi|41567179|gb|CF713020.1,gi|41576237|gb|CF722078.1,
                     gi|41576240|gb|CF722081.1"
                     /transcript_id="XM_569418.1"
                     /db_xref="GI:58264523"
                     /db_xref="GeneID:3256782"
     CDS             join(104928..104930,105132..105153,105490..105807,
                     105858..106000,106051..106576,106633..107279)
                     /locus_tag="CNC00360"
                     /codon_start=1
                     /product="protein phosphatase type 2C"
                     /protein_id="XP_569418.1"
                     /db_xref="GI:58264524"
                     /db_xref="GeneID:3256782"
                     /translation="MGQTLSEPMTEKHTTDVVRGKQFWVGLSDMQGWRISMEDAHSVH
                     LYLPPSSDDSKPHSPASDVPAQPEGSTVTNHNEPEVANAMFGVFDGHGGQTVAKFAGT
                     TLHSRLSALDAYKSGDYITALTQAFIKTDEDLRADPSFLNDPSGCTAVVGLITTDGRI
                     IVANSGDSRSVLGYQGQAKALSNDHKPTNEEETARITAAGGFVEFGRVNGNLALSRAM
                     GDFEFKQNFSLAPEKQIVTVVPEIITHELDGEEEFLVLACDGIWDCLTSQQVIDFTRR
                     AIANGDPLGKICENMMVKCLAKDSSTGGIGCDNMTVVIVALLNGRTPEEWQAWVKERV
                     EQKVGHDTPESIPDVFPQNSGPSNSGFAGSGFRVAGGAGGLANIASILGASGITFRPA
                     YDSDDDDDGIQLMGDGPVSPDKLSSPGLIDNEAVEGGTKPKDVTGQLEKEEEETMFGG
                     EGKKGSVRLLDEDGDSSMDSDDSDSTTTGNDPAPQPIPSSSHQATHSPIPPNFSSIGS
                     PTVPTPQELQGLQASNRSEPQGDAYSDAVKVEGLMDKSESPLNL"
     gene            complement(107982..>110389)
                     /locus_tag="CNC00370"
                     /db_xref="GeneID:3256539"
     mRNA            complement(join(107982..108282,108351..108372,
                     108442..108538,108624..108878,108932..109251,
                     109323..109438,109498..109553,109612..109676,
                     109753..109844,109898..109913,109964..110065,
                     110120..>110389))
                     /locus_tag="CNC00370"
                     /product="polyamine transporter, putative"
                     /transcript_id="XM_569420.1"
                     /db_xref="GI:58264527"
                     /db_xref="GeneID:3256539"
     CDS             complement(join(108119..108282,108351..108372,
                     108442..108538,108624..108878,108932..109251,
                     109323..109438,109498..109553,109612..109676,
                     109753..109844,109898..109913,109964..110065,
                     110120..110389))
                     /locus_tag="CNC00370"
                     /codon_start=1
                     /product="polyamine transporter"
                     /protein_id="XP_569420.1"
                     /db_xref="GI:58264528"
                     /db_xref="GeneID:3256539"
                     /translation="MTEKNERQTAKPQDVEHFDESQHHNMAFEDFGLTKEQNQLLIDN
                     YAYMWKKDDSGNLLIRSAKGDPTNPRSWPNWKRYAIVGLASLLNNLVCLCVSGYSTGI
                     AQMEEEMGFSSEVGTVGLSLYVLGFAIGPMLLAPLSEYWGRRPVYLVSWTIFTIFQIP
                     LALAQNVATILVCRFIQGLAGSTPLANTGGVVHDVFAVKEAGYAVAIYALSSADGPPL
                     GNVISGFLAQNAGFRWLFWAYLIIFGFFLIVIFFCLPETRSTIILSRKSSKLREATDL
                     PFYGEHELAKKAPGHLWKVTIFRPFKFLFTERITYLCAGINGFVYGMIFLSNEAFPLV
                     FGPGNNGHGWTHSGVVNLTFGAYVVGSFLGFCLTPLQEAWYRKASKAKGRGDPEARWW
                     SALWATPFMPLGLMVAAWTSYPDLPWIAPIIGFTMFGFGYIILAAILNYVVDGYAHYS
                     ASALGGVVFVRNIIGAVFPLFSSQMFKGMGNQWALFLLSMVSFLMIPIPVYLYYRGKV
                     VRDRSPYCAMHYNDEE"
     gene            111147..113580
                     /locus_tag="CNC00380"
                     /db_xref="GeneID:3256706"
     mRNA            join(111147..111598,111672..111764,111822..112028,
                     112094..112231,112659..112877,112963..113151,
                     113280..113580)
                     /locus_tag="CNC00380"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545912|gb|CF691753.1,gi|41545921|gb|CF691762.1"
                     /transcript_id="XM_569328.1"
                     /db_xref="GI:58264343"
                     /db_xref="GeneID:3256706"
     CDS             join(111914..112028,112094..112231,112659..112877,
                     112963..113151,113280..113506)
                     /locus_tag="CNC00380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569328.1"
                     /db_xref="GI:58264344"
                     /db_xref="GeneID:3256706"
                     /translation="MDGALDVLDLERRVLIEVAETVEKEMWEVDFWIGKKVEVRISEE
                     KAKKMDEWYNKWLKARAAGKYKHLKPEWKWIGDAKEAQKVRQAANVTPPPSFSGENYL
                     DTTYTMEEGPYLIATTHAGIVLGLSHEVAVKKGILEKKDVFGNVDDSYVQPAAKRWLS
                     EYCKNSFTNWGEEAPGEGAMRFWSGIMCATKDTLPLVGQVPSEQVPEGKNEGLYIAAG
                     YHGHGMARIALTTKYVVKLATTGEWDEGMPESFKISQNRLERGRTAPPYITAVDKIGG
                     ATSKILNAVGIGGVQSVCR"
     gene            complement(113953..115415)
                     /locus_tag="CNC00390"
                     /db_xref="GeneID:3256150"
     mRNA            complement(join(113953..114006,114104..114195,
                     114365..114408,114664..114755,115191..115273,
                     115359..115415))
                     /locus_tag="CNC00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_569329.1"
                     /db_xref="GI:58264345"
                     /db_xref="GeneID:3256150"
     CDS             complement(join(113990..114006,114104..114195,
                     114365..114408,114664..114755,115191..115251))
                     /locus_tag="CNC00390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569329.1"
                     /db_xref="GI:58264346"
                     /db_xref="GeneID:3256150"
                     /translation="MSERGSNPPEEKPKAEEPAADPNTLNIKITNTNNEEVFFKIKRT
                     TKLNKLKSAYADRVGTDVASIRLLFDGHRILDHQTANDLDLEDGDAIEVQLEQVGGY"
     gene            <116053..>116952
                     /locus_tag="CNC00400"
                     /db_xref="GeneID:3256209"
     mRNA            join(<116053..116124,116182..116195,116260..116593,
                     116680..>116952)
                     /locus_tag="CNC00400"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569330.1"
                     /db_xref="GI:58264347"
                     /db_xref="GeneID:3256209"
     CDS             join(116053..116124,116182..116195,116260..116593,
                     116680..116952)
                     /locus_tag="CNC00400"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_569330.1"
                     /db_xref="GI:58264348"
                     /db_xref="GeneID:3256209"
                     /translation="MSSKPQQELAVPTHLPDPVLIIVMGPASCGKSTVGQDVADHFHI
                     PFIDGDSLHPKSNIAKMSSGTPLTDEDRLPWLALIRSTAEKMCKEQSDEIAGKTRSEE
                     DGGLGRAGVVIACSALKKWYRDILRGVVKADPPPAEDLNDALPDDAQVPATASLKTYF
                     VYCYGTPELLKQRIASRKGHFFGQQMLDSQLAVLEDPSEEEGVTVANIDGTKEEVGER
                     AVNGMKKLLGIN"
     gene            117792..120474
                     /locus_tag="CNC00410"
                     /db_xref="GeneID:3256162"
     mRNA            join(117792..118076,118273..118299,118370..118401,
                     118485..118515,118567..118667,118745..118933,
                     119003..119138,119209..119398,119474..119630,
                     119693..119875,119948..120474)
                     /locus_tag="CNC00410"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41573064|gb|CF718905.1,gi|41573077|gb|CF718918.1"
                     /transcript_id="XM_569331.1"
                     /db_xref="GI:58264349"
                     /db_xref="GeneID:3256162"
     CDS             join(118050..118076,118273..118299,118370..118401,
                     118485..118515,118567..118667,118745..118933,
                     119003..119138,119209..119398,119474..119630,
                     119693..119875,119948..120275)
                     /locus_tag="CNC00410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569331.1"
                     /db_xref="GI:58264350"
                     /db_xref="GeneID:3256162"
                     /translation="MSCPSDNSTAVDDEFWSSDGIHWDAHRIGWAVAGGCAILTVLIT
                     LFTLTMHATRYKHPPAQRQVMRVLLMPPVYAVVSFFSYRYYKSYEYYILAETAYEAIT
                     LSAFLMLLMELVSMGTIDLQIKSVLAEKDKMKFPFPFGFWRFRASKPYFWHALSFSVM
                     QYVVLRPLISIIGIICEYYGVLCPEEYSIHFAEVYLDAVDFVSISVALYGLIVFYVLC
                     KDELKGKKPLNKFLAIKLIVFFTFYQSFLFSILQSHGVIKGTAMWTATNVSDGLSALC
                     TCVEMVFFSVYMGWAYNWTDYTDPEKNPYQRDTNFRTYLQAIWDTINLSDFCSEIYLA
                     CKFFVDYARGKPGTRSGATKLQKTFMPHTIPEESQEMGMIASYNAGGGYDNEYEQDKH
                     KLQNNTKGGTIFSSSKPSGLLEDNDSGDDTYAPIRSPEGTAYSRVREGHGRDESAFEP
                     WPQERPTGQEAHRHQF"
     gene            121518..123676
                     /locus_tag="CNC00420"
                     /db_xref="GeneID:3256535"
     mRNA            join(121518..121771,121861..121921,121987..122430,
                     122481..122653,122700..123676)
                     /locus_tag="CNC00420"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540895|gb|CF686736.1,gi|41540904|gb|CF686745.1,
                     gi|41548049|gb|CF693890.1,gi|41548983|gb|CF694824.1,
                     gi|41548995|gb|CF694836.1,gi|41550283|gb|CF696124.1,
                     gi|41550285|gb|CF696126.1,gi|41555348|gb|CF701189.1,
                     gi|41555353|gb|CF701194.1,gi|41559158|gb|CF704999.1,
                     gi|41559170|gb|CF705011.1,gi|41560556|gb|CF706397.1,
                     gi|41560561|gb|CF706402.1,gi|41564831|gb|CF710672.1,
                     gi|41564842|gb|CF710683.1,gi|41565512|gb|CF711353.1,
                     gi|41565519|gb|CF711360.1,gi|41572503|gb|CF718344.1,
                     gi|41572515|gb|CF718356.1,gi|41574951|gb|CF720792.1,
                     gi|41574959|gb|CF720800.1"
                     /transcript_id="XM_569332.1"
                     /db_xref="GI:58264351"
                     /db_xref="GeneID:3256535"
     CDS             join(121623..121771,121861..121921,121987..122430,
                     122481..122653,122700..123306)
                     /locus_tag="CNC00420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569332.1"
                     /db_xref="GI:58264352"
                     /db_xref="GeneID:3256535"
                     /translation="MPPPGVFTFDQSSDESPELLPRDALPETEHIPEVSMVEESTVTG
                     VTFTPELWMQRRQWALQTLRKEGVRSVLDLGCGPGALLETLVMPASTICEPPIREKPS
                     ETRHAEDEEEDFDHEDELFIGRLAGIDANPEVMNPALSVLSPHSETSTFPPPRPRWEP
                     ITTELWLGGLEKYNARLEGYEAITALEVIEHLDPNVLSRFGVVTLGTYRPRIMLISTP
                     NFDFNAKFPQANGDCFAKKGFVDPTGRTDRVFRHSDHKIEMTGAEFRNWAETAAADWG
                     YDVEVSGVGSSSIPSFYPSDDITKPPRPIYASQTAIFRIATGMPLRSPRSVRTMQLPF
                     TPSSKESSHPHKLAGRFTLPATAPGIGQRSSPEEVRVKVREFFTGSSVNEVSLEELWG
                     VLDIAGACGGSKRWLVGSLGGYGDCPALDANDEDELEFEVKKVKGVGLSVQWREWTPR
                     AEEKPRSWGTPVQNESEHTSPAAAQGW"
     gene            124081..125593
                     /locus_tag="CNC00430"
                     /db_xref="GeneID:3256212"
     mRNA            join(124081..125028,125085..125266,125323..125366,
                     125427..125593)
                     /locus_tag="CNC00430"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41557923|gb|CF703764.1,gi|41557929|gb|CF703770.1"
                     /transcript_id="XM_569333.1"
                     /db_xref="GI:58264353"
                     /db_xref="GeneID:3256212"
     CDS             join(124260..125028,125085..125266,125323..125366,
                     125427..125454)
                     /locus_tag="CNC00430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569333.1"
                     /db_xref="GI:58264354"
                     /db_xref="GeneID:3256212"
                     /translation="MPPSLVLFTTSQTPLAVRYPHPRKPILTVPPLLHRSLHNALDRD
                     QPSAAFVVNAGDAGGVAQGTLYIPNLEELAKPSPLPVANGHAAPELVHDNIELTVKVH
                     LIVSPTSTSPASARAEWVSEALQVFRKAKRLPLPDNLLIGFKGIDYRGIKTATGAEAS
                     VTPNTEIVPAELEEEVLKVWERVFAERGKLVKENGKLGSLYAPQGLLKKLTEREGEGR
                     VKVNALDTPDCHHLPKDYTGYARKNGVELWAGGGGEGSDPLPSTHLQNVLQEFLPAIR
                     KIIPEQQAKEFNKLDNPIPLRQDGLKFEDVETGVQVRWVLSYTVLSTTRNVVEDKGYI
                     VAADLV"
     gene            complement(<125733..>126605)
                     /locus_tag="CNC00440"
                     /db_xref="GeneID:3256224"
     mRNA            complement(join(<125733..126142,126450..126478,
                     126538..>126605))
                     /locus_tag="CNC00440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569334.1"
                     /db_xref="GI:58264355"
                     /db_xref="GeneID:3256224"
     CDS             complement(join(125733..126142,126450..126478,
                     126538..126605))
                     /locus_tag="CNC00440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569334.1"
                     /db_xref="GI:58264356"
                     /db_xref="GeneID:3256224"
                     /translation="MTTSAYSDLIGRAEKLVKAHMAKYDPSHDWAHDKYAKPGSPTLP
                     DLLFPILQLQIPDETIDRILSIIPAVSYTAETALLAAGKWTWQKDCLELHAVQDADRL
                     DAIGAVGILRCAAYSGATKRVLVEDEDTGGKSAEAHFEEKLLKVKDRMKTAFGKEEAE
                     RRHQTVGI"
     gene            complement(<128144..>129079)
                     /locus_tag="CNC00450"
                     /db_xref="GeneID:3256312"
     mRNA            complement(join(<128144..128909,129072..>129079))
                     /locus_tag="CNC00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_569335.1"
                     /db_xref="GI:58264357"
                     /db_xref="GeneID:3256312"
     CDS             complement(join(128144..128909,129072..129079))
                     /locus_tag="CNC00450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569335.1"
                     /db_xref="GI:58264358"
                     /db_xref="GeneID:3256312"
                     /translation="MAIRPESQAIIFCKSKDQPETISQILKRAGQRATWYNSEAGDRD
                     QVRKFFGPGHAQGESQIDFLCSTSGLGAGVNMPNIDVVYFLGDPWDLFEVIQGGGRGG
                     RLGHLFKVCVFSGSFNTAVFYTPNGNRLLKEWMQHNVCRRLTIGSYMDGTEATCLTLN
                     AGQCDLCVQSVPFKRGHQPTYSPLPRDPPLTSRLIQNSWFLLLDQAHPLFHQTVSAPC
                     HEQDHLVAKNQVVIWENFIIRFNAQVVIPVTVVPTCPRD"
     gene            130466..132418
                     /locus_tag="CNC00460"
                     /db_xref="GeneID:3256457"
     mRNA            join(130466..130602,130736..130860,130965..131079,
                     131150..131266,131333..131437,131490..131589,
                     131641..132191,132244..132418)
                     /locus_tag="CNC00460"
                     /product="SNARE binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529895|gb|CF675736.1,gi|41532628|gb|CF678469.1,
                     gi|41532638|gb|CF678479.1,gi|41536105|gb|CF681946.1,
                     gi|41536111|gb|CF681952.1,gi|41550760|gb|CF696601.1,
                     gi|41550769|gb|CF696610.1,gi|41557045|gb|CF702886.1,
                     gi|41557050|gb|CF702891.1,gi|41563587|gb|CF709428.1"
                     /transcript_id="XM_569336.1"
                     /db_xref="GI:58264359"
                     /db_xref="GeneID:3256457"
     CDS             join(130507..130602,130736..130860,130965..131079,
                     131150..131266,131333..131437,131490..131589,
                     131641..132191,132244..132339)
                     /locus_tag="CNC00460"
                     /codon_start=1
                     /product="SNARE binding protein"
                     /protein_id="XP_569336.1"
                     /db_xref="GI:58264360"
                     /db_xref="GeneID:3256457"
                     /translation="MRLTIIAPDSVHEHEVSPSLLIQDIINIVEATADLPPAVIVLTS
                     DAGTPLTDPTRTLESYGLNGETATIFLTPTGPPVASSSSIPFPDADADIERMRLQALG
                     NPSLMNDLRERDPETFAAIQGGTQSFKKALQLAQSRQRDAEFEKQRQIEALNADPYDI
                     EAQKKIEEAIRMEAVLENMQHAMEYSPESFGNVTMLYINVEVNGHPVKAFVDSGAQTT
                     IISPECAEQCGIMRLLDTRFAGMAEGVGTARILGRIHSAQIKLGSLYLPCAFSVLEGR
                     SVDLLFGLDMLKRHQCCIDLSTNTLRINNTEVPFLSEHELPDKARRRGEAQVAGEMGD
                     AAGQGVKAGVASPKIGKKTFPGEGHALGAGSSTGPGTATGSASATGARTGGTASVPSP
                     SNRWKEDDIQTLVNLGAPRAQAIQLLEASGGNVDVAASMLFG"
     gene            complement(132527..133908)
                     /locus_tag="CNC00470"
                     /db_xref="GeneID:3256342"
     mRNA            complement(join(132527..133134,133336..133531,
                     133709..133822,133878..133908))
                     /locus_tag="CNC00470"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41567213|gb|CF713054.1,gi|41567221|gb|CF713062.1"
                     /transcript_id="XM_569337.1"
                     /db_xref="GI:58264361"
                     /db_xref="GeneID:3256342"
     CDS             complement(join(132622..133134,133336..133531,
                     133709..133779))
                     /locus_tag="CNC00470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569337.1"
                     /db_xref="GI:58264362"
                     /db_xref="GeneID:3256342"
                     /translation="MFGQKQYDQALFNDLLSRVEISKHDLNALVLDYLLIEGFSDAAV
                     EFARETGLPADVDHAQVAERMEIRQAVEDGRVEEAVRRVNELDPEILDGNASLLFHLH
                     LLRLIELIRTEDLDTALAFATEELAPRGAQNPEFLADLEKTMALLAFPDLAKFADDSP
                     AADKPTLAPETLTLFEEPAFEPIIALMKRSQRVKVAKELNAAILENQGYGMETKLSGL
                     VRLMAWGEEKLVEGSDIVIPEEEQRKGRTWADAVLSGEVDC"
     gene            134106..>136254
                     /locus_tag="CNC00480"
                     /db_xref="GeneID:3256719"
     mRNA            join(134106..134633,134681..134753,134804..134910,
                     134960..135046,135095..135334,135391..135451,
                     135501..135911,135965..>136254)
                     /locus_tag="CNC00480"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41555095|gb|CF700936.1,gi|41555102|gb|CF700943.1"
                     /transcript_id="XM_569338.1"
                     /db_xref="GI:58264363"
                     /db_xref="GeneID:3256719"
     CDS             join(134208..134633,134681..134753,134804..134910,
                     134960..135046,135095..135334,135391..135451,
                     135501..135911,135965..136254)
                     /locus_tag="CNC00480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569338.1"
                     /db_xref="GI:58264364"
                     /db_xref="GeneID:3256719"
                     /translation="MSGGYDFSHLFPANTLAFSPGTTFLAVAHQNRIIVRSTSTLQVV
                     RTWECTLPSESTIFRSKEPCVASSATEATSEAFIIDTLQWSGDSTYLLVHSKEAKMAW
                     VYGVAQEGEAAHVGGMGVEGLSKVEWGKGNREVLAWTEIDSRLYIYSLSSGETRLIQN
                     VKPTADGYTYSPDSRYLAVTEKHLGKDYIGVYDILDGYNLLRHFPLLTVDVQGVSWSP
                     CGKYIAAWDLPLSYSLHIHSAIGPHLTHLNPSSPAFSLAPNETPGLGLRTLAWAPGGR
                     WIAVGGWDGKVRIVESDGWRCVCVITCGTRANKTAAVWREPNDWLRDTRGRGIVQFDR
                     QPHPVTFPALRPDITKPYPRMGISQLTFDREATLLLIRLDSQPNVVHIYSFLPTPTSE
                     QPTIAHIVSSIFSREIKKAKWSPVKSKLSVVTRGGGVYFWDRESGWIEEESGGSFECD
                     REIDVATGGMMEGVGIPTRAEFSALDIHWSPDGRSLAIRDRYHFCLLYDEDTGNLDDD
                     EQEGERSALMWNEQGEGLTDVLEEEGHISLSEGLPSREQFIWEKKRYATVKAAVYS"
     gene            complement(<136566..140292)
                     /locus_tag="CNC00490"
                     /db_xref="GeneID:3256395"
     mRNA            complement(join(<136566..136690,136777..136937,
                     137123..137268,137321..137365,137506..137680,
                     137727..137792,137848..138036,138096..138268,
                     138321..139512,139570..139593,139648..139771,
                     139827..140292))
                     /locus_tag="CNC00490"
                     /product="potassium ion transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536170|gb|CF682011.1,gi|41536182|gb|CF682023.1,
                     gi|41540187|gb|CF686028.1"
                     /transcript_id="XM_569339.1"
                     /db_xref="GI:58264365"
                     /db_xref="GeneID:3256395"
     CDS             complement(join(136566..136690,136777..136937,
                     137123..137268,137321..137365,137506..137680,
                     137727..137792,137848..138036,138096..138268,
                     138321..139512,139570..139593,139648..139771,
                     139827..139971))
                     /locus_tag="CNC00490"
                     /codon_start=1
                     /product="potassium ion transporter"
                     /protein_id="XP_569339.1"
                     /db_xref="GI:58264366"
                     /db_xref="GeneID:3256395"
                     /translation="MKRPRFRVRKAFRKPKMPTVAEARDTWQKLKCHFNFFRIHLLVF
                     TFIPIIAACIFYAANGSASGNANSGLTGRQKVTFIDSLFLCFSAMTTTGLCTVNLSAL
                     HPFQQVILFFLFIVGDYSFVSLIMVLVRKHYFRTHCEQLLINDLFRRIPTISYDTGAQ
                     GGLNYSSKSFKSTIKKLRGKNIAISGPIDGHKMDNFAEDGLVTAGDQEQHMMTDSPVD
                     MTFEERGRRERAEASEIPADNQTPGPRVPSTLGKSTAALLNPANAAPPPATSSAQAED
                     HRSPFVDPLFQARQRLRTQTRAKSISAAQHGRSTSDHRPTPPHVTSDVPNHMGGGAIP
                     PKRKNNVHIKDYSHHDQSQHPHLHTAAQIVTHHTIDPTRGLPIPFGHKNTGYGGFPSL
                     LHIFHHFLPERAKQRLYRPVRRVGIVMHPTYAHEFENGHAGHEESWSEAIRGSVAKWM
                     PEGLQGLVIGRNSRFWTEELDDEELEQIGGVEYRALKLLSSIVSSYIFLYQMIPFAIL
                     SIYFAKVDYWNSALLETAGEQAGTVNKTWFSLFLSASAYTGCGMVLTDEGLVPFQTCY
                     LMIYVLIVALLVGNHALPIMLRFIIWIGTKITRKGVKHESLHFLLDHPRRCFLYLFPS
                     HQTWYLLFILLAFTVVELFSFLVLNIGLPVVDSLGGWERFSDGLLQSLSVRASGFGII
                     TISDMAPSVLFLYILLPCLSDLQMCTKSGRSDCTNMMIPIRQVKMNRNLKVTVEKSSG
                     GFDLPVCLCKGNVSDIGLTHSWFTIFRIIFECTSGYGTIGLTLGTPNNNYAFSGEFGT
                     ASKLVMIVIMLRGRHRQFCFLESIPASSNPPKAYNQRYLTPIHLPVHRMKMIDRDR"
     misc_feature    140433..140463
                     /note="AT_rich"
     gene            complement(143485..145723)
                     /locus_tag="CNC00500"
                     /db_xref="GeneID:3256758"
     mRNA            complement(join(143485..143750,143815..143947,
                     143997..144107,144164..144289,144344..144440,
                     144489..145217,145276..145723))
                     /locus_tag="CNC00500"
                     /product="3'-5' exonuclease, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538629|gb|CF684470.1,gi|41559863|gb|CF705704.1,
                     gi|41559870|gb|CF705711.1,gi|41571876|gb|CF717717.1,
                     gi|41571884|gb|CF717725.1"
                     /transcript_id="XM_569340.1"
                     /db_xref="GI:58264367"
                     /db_xref="GeneID:3256758"
     CDS             complement(join(143821..143947,143997..144107,
                     144164..144289,144344..144440,144489..145217,
                     145276..145684))
                     /locus_tag="CNC00500"
                     /codon_start=1
                     /product="3'-5' exonuclease"
                     /protein_id="XP_569340.1"
                     /db_xref="GI:58264368"
                     /db_xref="GeneID:3256758"
                     /translation="MLSNLGLFAAERCPDTNCTRPRCFFSHDPTISGPSQSQVPIGIR
                     EPANRKPPTAVKRKVGESSGAPIVREMKKQNVTRNPKPVAPSSTTPVRSAPAPTKTVV
                     SGGANSSSTDYSRPPMLPYGIKLSPQPRTDRQKALGTLHTQFVKLYSQILHFSPSLAH
                     DSSLAQEAEISSSSTSLRAYKTAIHHAAVAISRRPPPTSIPHPSIGTVKESRVAMEKA
                     EKEKASKLTRNRVERYCMKKEDFEKWGYPDPSGEGLTGRGVETKPDGEGETHDCDRCK
                     VSFIVSSKNLERRFGECRYHYGRTAPERVEGRRKWIYSCCGKERGEQGCEEGVHVFKD
                     GEDDKELAKRVAYKTVRMCLEEAKASGKNVVGEGYGVVAMDCEMIFTTAGLSLGRVTV
                     VDENGYTLLDELVRQKVPILDINTRFSGISPGQLDNAIMDLDGVRAAVCMFIGPETII
                     VGHGLENDLRALRLLHDQVIDTAIVFPHDKGAPYRRALRDIVKEKLGYFIQDRTSDKG
                     HNSVEDAKATLDVLKWKVREDNED"
     gene            145851..147601
                     /locus_tag="CNC00510"
                     /db_xref="GeneID:3256391"
     mRNA            join(145851..146067,146118..146369,146419..146581,
                     146636..146762,146817..147063,147138..147243,
                     147307..147601)
                     /locus_tag="CNC00510"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41547712|gb|CF693553.1,gi|41547729|gb|CF693570.1"
                     /transcript_id="XM_569341.1"
                     /db_xref="GI:58264369"
                     /db_xref="GeneID:3256391"
     CDS             join(145876..146067,146118..146369,146419..146581,
                     146636..146762,146817..147063,147138..147243,
                     147307..147569)
                     /locus_tag="CNC00510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569341.1"
                     /db_xref="GI:58264370"
                     /db_xref="GeneID:3256391"
                     /translation="MFISRPVAPSLRLFAKNSLQSITQNSPVRSTALFRCQSNSAVSS
                     SSKPAAKPNELAKVIRDSIKSTGPISASRYMQFCLSHPVHGYYSKGDVFGQKGDFITS
                     PEISQIFGELVAIWFLTRWMEVDSPTRVRIIELGPGRGTLMDDVLRTLFNFPGIAASI
                     NSVHLVENSEAMREVQSQTLTPRIKGKDVKLNWYTSIEEIPETKDEFTLFVAHEFFDA
                     MPINVFEKTDMGWREVLIDRDPSYTPNLPTSSTPSGLRFTLSPSPTTLSTILPSTSPR
                     FAKLPSGSRIEVSQDSYKIMHRLGQVVNQGLGGCGLVVDYGADKAFASSFRAFRKHEI
                     VDVFEDPGNCDLTANVDFAYLRESLTGTATPLGPISQAQFLISLGLQPRLRKLLDTAP
                     PERREAIEKGAKRLIDVLGMGSQYQVMGVVSGEPEMKEGIYPFPVKKETVESKVLRP"
     gene            complement(147579..149224)
                     /locus_tag="CNC00520"
                     /db_xref="GeneID:3256231"
     mRNA            complement(join(147579..148164,148235..148761,
                     148815..148938,148996..149052,149108..149224))
                     /locus_tag="CNC00520"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535808|gb|CF681649.1,gi|41535814|gb|CF681655.1,
                     gi|41553575|gb|CF699416.1,gi|41553590|gb|CF699431.1,
                     gi|41553790|gb|CF699631.1,gi|41553793|gb|CF699634.1,
                     gi|41563766|gb|CF709607.1,gi|41563774|gb|CF709615.1"
                     /transcript_id="XM_569342.1"
                     /db_xref="GI:58264371"
                     /db_xref="GeneID:3256231"
     CDS             complement(join(147625..148164,148235..148761,
                     148815..148938,148996..149052,149108..149146))
                     /locus_tag="CNC00520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569342.1"
                     /db_xref="GI:58264372"
                     /db_xref="GeneID:3256231"
                     /translation="MQMATKYRGLPDIDTAPDIFETTDEPEIVLKPSDVRSGDEDSVL
                     KPVSEDIDAGGLPSRRKAERVFARGTRKPELSTLSFRPRLPPLSRYASSSSDTDEEPP
                     LPRETPAARLRRLKAELAEIEAEVGSSSPSKTQSISHEGSGAGKRRSVLPPRQPVDVV
                     SELANVRERLERVEIDGLDVGQVVAVGMGPSSEWRERLDKLVTAENRSGKGKVAQSTA
                     VGQQDSSLSDIDKRLAALEQVVGPTTDGLDQTLSPLVPTLNKHDHLLTLLTQPRHLDA
                     ISRRVKLLLVDLDRAAAASRRTGAGGAAIPQQSSEKAVTNLSLTQGEYTQLQSLFSVL
                     PRLDPLLPILTPLLARLRSLSALHSEASEIAVSLRELQSRDKKNAEEINELDEVVKSV
                     QTGLGDAIAAIKKNWEGLEKRMMGLEQRLKDMERQI"
     gene            <149379..150301
                     /locus_tag="CNC00530"
                     /pseudo
                     /db_xref="GeneID:3256737"
     gene            complement(<151938..>153402)
                     /locus_tag="CNC00540"
                     /db_xref="GeneID:3256806"
     mRNA            complement(join(<151938..152330,152389..152910,
                     153028..>153402))
                     /locus_tag="CNC00540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569343.1"
                     /db_xref="GI:58264373"
                     /db_xref="GeneID:3256806"
     CDS             complement(join(151938..152330,152389..152910,
                     153028..153402))
                     /locus_tag="CNC00540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569343.1"
                     /db_xref="GI:58264374"
                     /db_xref="GeneID:3256806"
                     /translation="MPRRSAKYKATARARELYRMATILNHKQLKTSLSIPYHALRTSR
                     YLNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLRVNHTEFRKLLCLIKDHPVSSLM
                     VQESRRTPFYSLQLRSIDWDIADGTSAIWTTRVIKAILSLERNNVYWPDENERKAIDR
                     HFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVDSLSYKGRYGFNILGICDHLKRIRY
                     FQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVHSEMISQGEYLLADSAF
                     PAGDWCVPLFKRRRGQNDLDAPEAKFNKKCSSARVKIEHAYGILKNRWQSLRNLRVKI
                     RNVRDEGVATCWIRACVVLHNLLIDTGDWYNQLDGDADEPDDYIDIERMQERMERVLE
                     RHREEEEDEARDARDASNLTRKRVMERMQEIERRDLL"
     gene            <154350..>155387
                     /locus_tag="CNC00550"
                     /db_xref="GeneID:3256701"
     mRNA            join(<154350..154649,154749..>155387)
                     /locus_tag="CNC00550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569344.1"
                     /db_xref="GI:58264375"
                     /db_xref="GeneID:3256701"
     CDS             join(154350..154649,154749..155387)
                     /locus_tag="CNC00550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569344.1"
                     /db_xref="GI:58264376"
                     /db_xref="GeneID:3256701"
                     /translation="MSWKPSPAGIFASGPPMSSSSNPVINRIKPNASGLSAFQREALV
                     SSYGPSSSAQPKVRTEWDVLKENHRFIRDDEDAKDVSWEERLARAYESKLFKEFALSK
                     KLALRWRTAPEVVNGIGEETCASLRCKYHEPLRAPSPVSDHAVGFISPHSRAESTDRN
                     YGWEYLGHDEKERRRRKEKKTKTTPELKTFELPFVYMEAGERKEALVKVRVCPRCTAK
                     LLWKPGQDDVEEDLMGQMRSGERENEKEKEDEKRSRKDRDRRTEDRGKSAEDKERRRK
                     RKVQECERGRSRSQSPKRHSRHHFEEKGKSHRHRWD"
     gene            complement(155391..157621)
                     /locus_tag="CNC00560"
                     /db_xref="GeneID:3256740"
     mRNA            complement(join(155391..155839,156113..157084,
                     157148..157270,157334..157415,157467..157548,
                     157597..157621))
                     /locus_tag="CNC00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_569345.1"
                     /db_xref="GI:58264377"
                     /db_xref="GeneID:3256740"
     CDS             complement(join(155537..155839,156113..157084,
                     157148..157270,157334..157415,157467..157548,
                     157597..157612))
                     /locus_tag="CNC00560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569345.1"
                     /db_xref="GI:58264378"
                     /db_xref="GeneID:3256740"
                     /translation="MTSLELPLARLSISNPRLAPAGASPKSLNWDSYSNCIIKTNVTS
                     DPASLRLQIVHDTSTLIVRDLPASDLINASITRRITHIGQQAAFRYDWPLNAGVGAKT
                     QECFQVIFQNATDLTSLLDHLKPFFNIQTSTTKPITVTASQPTQVQAKENSSTKKRSP
                     SKSGQKKQVANPAPIRASPKGRLAGDTRAVNKPRPTSQPSLASNPRAPKVNTLGSSPT
                     AKSLGTDGTVPSTLSSDGPRAVTKDIGRQSPLPVHGPLAFSMNDPTMAGLKRKLLAGF
                     DPGTTASVTMHPSQTARITGSPSHSEPQTHEATPSRSVTHKSDPESTTNESAPFNSHF
                     PPIVPVQKPAPTFQPTSVDLITFSSPIMSSNSLPPPPGPARIVLGGSSDIEIGSECDW
                     PVMLTEEKQREETLKRLVEEDLDVEMNPDDGSAYGKVSHILGQVSIAQHNNPYPTPSE
                     SYASLPLFTPRGESVYSQEYTERGCHSYSSQDRSNYKRPAYSLEYHDNQTIWKRMRVG
                     EEEIYLYDDLEEEDRMC"
     gene            159150..162208
                     /locus_tag="CNC00570"
                     /db_xref="GeneID:3256477"
     mRNA            join(159150..159192,159239..159639,159686..159937,
                     159984..160583,160639..161364,161426..161572,
                     161638..162208)
                     /locus_tag="CNC00570"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536563|gb|CF682404.1,gi|41553043|gb|CF698884.1,
                     gi|41553240|gb|CF699081.1,gi|41576632|gb|CF722473.1,
                     gi|41576641|gb|CF722482.1"
                     /transcript_id="XM_569346.1"
                     /db_xref="GI:58264379"
                     /db_xref="GeneID:3256477"
     CDS             join(159177..159192,159239..159639,159686..159937,
                     159984..160583,160639..161364,161426..161572,
                     161638..161745)
                     /locus_tag="CNC00570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569346.1"
                     /db_xref="GI:58264380"
                     /db_xref="GeneID:3256477"
                     /translation="MYNGQPPFPGNGLPPFPPQMVPNGTMPAGFPPFAPPFPPPFPGM
                     RPPSGPGIPSPATPGMMPSPAPMSGMQTPGMAFRPPPMGYAPRPAHPGLGSTPHGLPQ
                     PPHMPPSTPKPDVKTTKVFVGGIAPGITDETLESLLNACGPLHELKRVIGASGKPQAF
                     GFAMFENPEVVLRCIRCLNGVELPDMTPEGRRDRKPAKKLIVKADEKTQAFLEEFEST
                     LGRSDSDEEADASSRKSIQHIIALLTDPNAQHPDGPSAGNNGGQSPVQVVVPAHLQDL
                     QEGDLPEEQRVAVLGQIAVFRENAAKREREKKLMEEEKERYKAMQSQGGGQRQAPSGY
                     GYGNRGLAKQQQQAERQWGSQSASPVPWKGAGPSRYGPGERDPQAYDKPVSFVKAETT
                     EGKAESGRTDEEEEELRRRKIQMDKDIALRDAERRVEARERTRLDALSREMNYRQTQK
                     DLVARSRARQEELYARYDDDEYIERSERERDRRDRPDRERDVRELFYVDRPQWRARRQ
                     KFRQNEYQADLRDRQHEEDERQALERESEEFLKKQMAELAALEQSQRAQGLLTEDAAP
                     IKLAINPSALPPPPPKEEKKHVVAPRPGVQFEGEDDDEESGRKKKGTFVRLDEEEEGD
                     GLNEAEKRARRNARLLDVKKGVPNDRRSIWKFPVEWAAVGETLIQNKIKPFVHEKIRN
                     FLGELDEDLADFVLEHLRDRKGADDLVDGLEPILAEDAEPFVLQLWRQLIFESLAFRE
                     GIDTGSMMI"
     gene            complement(<162245..163302)
                     /locus_tag="CNC00580"
                     /db_xref="GeneID:3256662"
     mRNA            complement(join(<162245..162661,162731..162821,
                     162870..162969,163019..163302))
                     /locus_tag="CNC00580"
                     /product="N-acetylglucosaminylphosphatidylinositol
                     deacetylase, putative"
                     /transcript_id="XM_569842.1"
                     /db_xref="GI:58265371"
                     /db_xref="GeneID:3256662"
     CDS             complement(join(162245..162661,162731..162821,
                     162870..162969,163019..163298))
                     /locus_tag="CNC00580"
                     /codon_start=1
                     /product="N-acetylglucosaminylphosphatidylinositol
                     deacetylase, putative"
                     /protein_id="XP_569842.1"
                     /db_xref="GI:58265372"
                     /db_xref="GeneID:3256662"
                     /translation="MPPAQGPGQPRPLAFPFVFAVIFPLFRLLFSLTPITQPQDFNLL
                     TPKSIDTLGDKPSALIVTAHPDDEVMFFSPTILGLIGAGWDVKGLCLSTGNSEGLGQK
                     RKEEFIKSYEALGIPAENLEITDHPDLPDGLTTKWNTTLVSTIIQDSLFSHPVDIIVT
                     FDPKGITSHPNHVTLPSSLALIPAERRPRVLALQSPDILPKFTGPLYIIYLHIRTLFF
                     SPQFQRAFQFLFPSFNTFFGTENAKGTQTHVMINDLRGWAIGLKAMMAHNSQLVWYRY
                     LYLAFSRLMWVNELVEVTY"
     gene            <163539..>164556
                     /locus_tag="CNC00590"
                     /db_xref="GeneID:3256674"
     mRNA            join(<163539..163570,163617..163746,163801..163996,
                     164077..164165,164227..>164556)
                     /locus_tag="CNC00590"
                     /product="vacuolar ATP synthase subunit d, putative"
                     /transcript_id="XM_569347.1"
                     /db_xref="GI:58264381"
                     /db_xref="GeneID:3256674"
     CDS             join(163539..163570,163617..163746,163801..163996,
                     164077..164165,164227..164556)
                     /locus_tag="CNC00590"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="vacuolar ATP synthase subunit d"
                     /protein_id="XP_569347.1"
                     /db_xref="GI:58264382"
                     /db_xref="GeneID:3256674"
                     /translation="MSGTGPREAIFPTRMNLTLTKGRLKGAQTGHSLLAKKRDALTTR
                     FRQILRKVDEAKRLMGRVLQLASFSLAEVTYAAGDIGYQVQESVRKANYTVQARQENV
                     SGVVLPAFEGVRSNDASGLSRGGQQIQKSRDTYIKAVGTLVELASLQTAFTILDEVIR
                     ATNRRVNAIEHVVIPRLENTIKYINSELDEMDREEFFRLKKVQGKKKRDAANAEQTRE
                     GENKAFEATGGELHRDEGIGGGVAGGADMLDEGKDEDVIF"
     gene            <169138..175588
                     /locus_tag="CNC00600"
                     /db_xref="GeneID:3256637"
     mRNA            join(<169138..170341,170395..171138,171187..171337,
                     171394..173298,173347..174904,174966..175056,
                     175113..175214,175271..175588)
                     /locus_tag="CNC00600"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535319|gb|CF681160.1,gi|41535329|gb|CF681170.1,
                     gi|41559922|gb|CF705763.1,gi|41572524|gb|CF718365.1,
                     gi|41572531|gb|CF718372.1,gi|41572645|gb|CF718486.1,
                     gi|41572655|gb|CF718496.1"
                     /transcript_id="XM_569348.1"
                     /db_xref="GI:58264383"
                     /db_xref="GeneID:3256637"
     CDS             join(169138..170341,170395..171138,171187..171337,
                     171394..173298,173347..174904,174966..175056,
                     175113..175214,175271..175455)
                     /locus_tag="CNC00600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569348.1"
                     /db_xref="GI:58264384"
                     /db_xref="GeneID:3256637"
                     /translation="MKRQSLSFKNLIAVEPRMSPTQRRSSFFERQRQSSGSSTKTDHS
                     SVFGSGSGSGSGLMKKKNLVSKMEGWWNAVKSNFVPEHPPGRPGGHSNQGRVNHSPKR
                     RGSIPSITQLKSAYLAPEPAALRGSPNLPLRQVISHNELRQRPQGDNHYESASVLDST
                     PADIARLSRNSSSETAMPIPQHMLVPPPPPVRHASTVTEVTEEPTNPPSRQEPPIHTS
                     LEARRRQPNLRLELEPHTLAQPSPHSSNSSGSQPRMVPLGMPLRLSESSLRSSVYGQS
                     RGPGLTPGAPRWDQTPWPVHTFSQHQVEDREDKPVAPGAELTVGSVRNHIRRRLNGAK
                     EACDASLRRTINSITKFVEQERQDVGRQEEIPVDYFETLNLNDSAVVDGEDTGSEAAY
                     ENEGPSSRAVSISWSRGPSRRPSVSLHAISPKARTSALATSPSRIVSRRRPSAVLPRT
                     FGPTGRNVSIPKDRTQSGASSRSTSRSHSPMPGRQLPLQVDSTDEDRHFLQALQDLIV
                     QATEVVDSSVHTLKSGPDSCATIIQRIQKIGAKWDEHPDWPGREWYVEILLAVANLGR
                     VLDWWEAEKGFWNFDAETENDQLLFVLKPREEQRFDQEFRATFSEPRYSPLSTAVSVA
                     GDLPPALGLDATSPIVSSPQTAKSEEPGKGLSPKAQAIDDLKFLAEHAKSVNIVMELS
                     LQGEIVEYVNDAVLEVLGQVPEEVIDHPITDLLAPGDASVFSEATHQLIEDDNNTVQC
                     RFRFEVHDLAQDEDDERQPGPVYIELEGVGMLMRENNEPSHTMWVMKPVAATQVEAIT
                     AAVFPRDGHISTEGILCRICEREIVAWFFEKHNETCDALHRLEAEIAECDDCLHELRQ
                     TVVDLESEVDAAAPNNPAQYQGVLFFTLPESVAASDAKAATQYLQGIEVRKVAREHLQ
                     DVLHILSTARQIETPYVREEEADLPSNIQNYLSEESEDRLLKIMRWQRPQTNEFALNL
                     LFTHVEEQLKRKHKAVARMQSTIRYSEKTRHEWEDKVNEMLAEQEDGSGTESESGSGG
                     SEIDKSPSEVHAALSVENPESSPPGPRKIAPLARLPITQAHPHRQPSVLEELSAPTSI
                     APTPAAPQTITTDPAPPALTSASSLPTVPILAPKVRNAPFQFGSKVHSPDMPPPAPSR
                     RVTPSKTGSTEPESMTSSPLLMPYGADRHHRRRISGSQGMRDAPLSPRIPSAALRSSV
                     AQTTIDDFKILKPISRGAFGSVYLAKKVATGDYFAIKALKKSDMISKNQITNVKAERT
                     ILMNQASSPYVAKLFFSFQSKDYLYLVMEYLNGGDCASLVKTLGGLSEDWARNYTAEV
                     VLGLEYLHKRNIVHRDIKPDNLLIDARGHLKLTDFGLSRIGLLNRQVGGPRPAYLRGI
                     SLRGSGQHRLSMTRTTSNSSLIDSNMLSPEISSGQSLPNVSQSYFSQMRPSGPEDESS
                     GSESAGIIPKHVRQMATKLSSELGTPSVNGKEPPKFVGTPDYLAPESILGIGQDDAAV
                     DWWALGVVLYEFLYGFPPFHAETPEKVFDNVVSRRINWHEDEVGISPEARDLINRLLC
                     SDPQMRLGANGAEEVKSHPYFASINWDTIATSEASFVPDVADPESTDYFDSRGATVGF
                     HDGGGVPQVSKQTATDPNAKANPGAASMSPKASGEMEAIANDMAEQSDFGAFNYKNLP
                     VLKQANDDVIRKLRTDSMAPLSQALECAPSLSKGKQRRLSVQVQSKSTRRISDPNQAP
                     YTPSPSTSTSSAVSTPSRSNMQPPSSSTSHHPRRLSELGALDRVKSTDEADEPREAQS
                     QTRLRGDSGSSIGSNSTELTKQRRHASLQLDFATSEPFGGLAENKHFVGSNVHSRGLD
                     VLVAEDNPISQKILETLLTRVGCRCICVDDGPSALAAIMGSIRFDVIICDIHMPVVNG
                     EQVARMIRSTNNHNQLTPIIAATSYEQYINEEGTLFSGVLAKPVTKADLIRCLAKLGF
                     VISAGASDVASVPTTAPAVQS"
     gene            complement(173298..>174819)
                     /locus_tag="CNC00610"
                     /pseudo
                     /db_xref="GeneID:3256735"
     gene            complement(<176069..180464)
                     /locus_tag="CNC00620"
                     /db_xref="GeneID:3256413"
     mRNA            complement(join(<176069..176332,176395..176591,
                     176642..177426,177484..177680,177737..178967,
                     179084..179157,179204..180296,180346..180464))
                     /locus_tag="CNC00620"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544316|gb|CF690157.1"
                     /transcript_id="XM_569350.1"
                     /db_xref="GI:58264387"
                     /db_xref="GeneID:3256413"
     CDS             complement(join(176069..176332,176395..176591,
                     176642..177426,177484..177680,177737..178967,
                     179084..179157,179204..180295))
                     /locus_tag="CNC00620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569350.1"
                     /db_xref="GI:58264388"
                     /db_xref="GeneID:3256413"
                     /translation="MLSSSLTALPPTSEAPTLPSEPSPPRPAPKRTYGRAKHVSPPPD
                     KVEFSSITNTSEFGEPSSARDNTLVNRWTDLSSNWRSQLAEIDAPRDGAGLAEDPEEL
                     AREMARLRGELRGKNGSTSTLVTEEQDHTRKLTAKATGGLTVSVNGSSQASPFSMPPS
                     SPPKRHSSQASSALSEPQSLLQVSEASETTEEESYVLNRLLKGKSRSVIASDEEEEEE
                     EETPKRRARSESSQSASPPLFSSQEELTEQNPTEKDADSDKEKDDGEDQDIGALLAQQ
                     NEEVETHGQREQERAKEGQFSQAREDPLAELNDLFSDDKDSDEHEKSNNKVDICDGFS
                     LYGSALTAKIRVSTSGIRKQCIGKSMLQSANALSTSLNQMRNWRLWAIGSTSGKPSTA
                     HVHVPSTQIKTSTISSSPTPNSILRPSRDYSKSRISQSSRVLGTSEPNEQEEEDENQD
                     FGAFMEKEEKKDTAAEKQAEKMRNLKEIKAKLAREAALRNKPKSKADDDDDLDIVQGS
                     RDFLLEGRGRAGGSVKPNTKTLDIIRAAASRRSTTPFEKGGPKPQSMSQEATETYVLH
                     AAHTPNHASSKFLNGGVRPAGQKKGRDGAISQAKLNAYILDKHRQQANMTKGKKEEQW
                     GRGRILPERVTQDVDELVTQAEQAGEEEDEDGDEDEDDGEYAPDDESEEQELVYSGEE
                     EEDEKSEELPMKDEPIADTSGDKGNQSQSEEEEEEDSALILKRKSKKPRASARVLESD
                     DEDESVPPKAPTPREPLAETAISNLAPLAADIDIDLAGFGEGGMSQLFDATQIDNAGD
                     GEDAFAELRNRKPVGLLPTQLELPPLQISESQALRDDQLVIAAIEDAAMERARELEEP
                     AKRYLNTQGLFTQTKPTTPDEDYDPSYALGGGSPTPLTQRDTQYANSMGQTFPRRNGD
                     MVSSDQFSPTQKLTRLKRRVSGSPRSPDRLRESSPEASADELEPTQVSEEQQNAFDVL
                     RAGARLAANPLDIPIIEAERKKKGKNKSAFLEAEAEESDEGDGGWMKTTGGEDENSGD
                     EGDDRFLEELVDDAAVSAEEKARQDELAAQMRKQIEDEDDARRLEEARKITEGEHRKR
                     RKGQDFYDDDSDDEGVRLKKLSRKERKRRELGRAEGLLDGEINVFEQEYHRDLDSDQS
                     DVGEEEYHPSVLGGVERLSPEPEPVERLSYGDRRVRLQKVAKMNAQRDMETMDQEMDA
                     ELGLGVKHHISGRSRATAIHLGIDEDVIMKDSNFNIKRNVRYTKKMEQVPAEDDDLVS
                     TYSASCSLSSVDLTGFL"
     gene            180689..182318
                     /locus_tag="CNC00630"
                     /db_xref="GeneID:3256671"
     mRNA            join(180689..180799,180859..180960,181018..181126,
                     181182..181986,182053..182318)
                     /locus_tag="CNC00630"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539304|gb|CF685145.1,gi|41539315|gb|CF685156.1"
                     /transcript_id="XM_569352.1"
                     /db_xref="GI:58264391"
                     /db_xref="GeneID:3256671"
     CDS             join(180708..180799,180859..180960,181018..181126,
                     181182..181667)
                     /locus_tag="CNC00630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569352.1"
                     /db_xref="GI:58264392"
                     /db_xref="GeneID:3256671"
                     /translation="MPRSNSNTEDLPKHQEDDTLRQKILVLGWRKAGKTSCIKTVFQQ
                     VPAVEVPHFGVTQKIEQINYNSIVPLQIWDTPSNFEIDQLEVPLSTFSTIVYVLDMQQ
                     DDSYHDSIRKFVHIMVRAYLSNPDIRFHMFIHKAEMLSEDYRGENYAEIQRTTAEEIE
                     DFRYGDLQAYAPNNLDLDDPSTIGMIINQLIPEVVYSMTSAHDVSLRAAWSKVIQGSM
                     EMLSAVEALLLDFSSVRSISFYPLSSIANLSYSTLAPITRSCST"
     misc_feature    181798..181881
                     /locus_tag="CNC00630"
                     /note="GA-rich"
     gene            complement(182468..184324)
                     /locus_tag="CNC00640"
                     /db_xref="GeneID:3256762"
     mRNA            complement(join(182468..183121,183180..184117,
                     184168..184324))
                     /locus_tag="CNC00640"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41559570|gb|CF705411.1,gi|41559580|gb|CF705421.1"
                     /transcript_id="XM_569354.1"
                     /db_xref="GI:58264395"
                     /db_xref="GeneID:3256762"
     CDS             complement(join(182515..183121,183180..183640))
                     /locus_tag="CNC00640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569354.1"
                     /db_xref="GI:58264396"
                     /db_xref="GeneID:3256762"
                     /translation="MTIVPNLQEATTSDSDSERTLYDRPNRTSRTDRAESGHDSSEIF
                     FPYTAPFSSIVPALTSFTKQPQVTSFQPLKETKWQRPPFLPTLNSHPRLVYPIVVLTL
                     LSAGLITGLVVFVIHQNHILVGEESSPDNEGKDDGQELSPLILFIDAVFIIFIIGTIS
                     ILLLLIYRFSTKFRHPPLPSSTTRIANPLDFLPGWCRTTLPSLPTYGEAVIGASGTID
                     HQLEMTLPVYEDNRNSRMLMRSQSRQNVEDRGGSSVSVVMTDDEGNERQVRSPTQEQR
                     LTSYWMSELVLPTAKRQSQIHIQSEPRSSSLLDVIVEDESVMINMEDIKERGRIGVEE
                     GGVNGDEGEVKEDEIEVWLEV"
     repeat_region   184511..184537
                     /rpt_type=tandem
                     /rpt_unit_seq="gagaa"
                     /satellite="microsatellite"
     gene            184633..>185611
                     /locus_tag="CNC00650"
                     /db_xref="GeneID:3256738"
     mRNA            join(184633..184741,184826..184931,185095..185242,
                     185332..185504,185573..>185611)
                     /locus_tag="CNC00650"
                     /product="expressed protein"
                     /transcript_id="XM_569841.1"
                     /db_xref="GI:58265369"
                     /db_xref="GeneID:3256738"
     CDS             join(184671..184741,184826..184931,185095..185242,
                     185332..185504,185573..185611)
                     /locus_tag="CNC00650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569841.1"
                     /db_xref="GI:58265370"
                     /db_xref="GeneID:3256738"
                     /translation="MASITPSTIPPSSQIGIPTTVPPAAQSWGPLAIDAAAHGAIAFC
                     QIYYEAYDEPSRRAEEIPILYLPSSKIIWNGNPVSSEPAAFAEFLRSMPLSRHDLQTL
                     DCHPVASEEGSAPSLIINVTGSVLHGPAVLQSSNDKPQERDMPRKFHEMFMLKVIGQE
                     EGMQPRYAVHSSNFRFIG"
     gene            186993..190469
                     /locus_tag="CNC00660"
                     /db_xref="GeneID:3256367"
     mRNA            join(186993..187064,187117..187150,187209..187223,
                     187310..187378,187437..187839,187892..188187,
                     188276..188405,188487..188627,188707..188851,
                     188950..189063,189143..189157,189218..189240,
                     189303..189390,189447..189481,189557..189730,
                     189787..190059,190154..190469)
                     /locus_tag="CNC00660"
                     /product="long-chain-fatty-acid-CoA ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537320|gb|CF683161.1,gi|41537329|gb|CF683170.1,
                     gi|41538649|gb|CF684490.1,gi|41538659|gb|CF684500.1,
                     gi|41538938|gb|CF684779.1,gi|41538951|gb|CF684792.1,
                     gi|41542456|gb|CF688297.1,gi|41553000|gb|CF698841.1,
                     gi|41553008|gb|CF698849.1,gi|41556154|gb|CF701995.1,
                     gi|41559032|gb|CF704873.1,gi|41559045|gb|CF704886.1,
                     gi|41562616|gb|CF708457.1,gi|41562628|gb|CF708469.1"
                     /transcript_id="XM_569356.1"
                     /db_xref="GI:58264399"
                     /db_xref="GeneID:3256367"
     CDS             join(187014..187064,187117..187150,187209..187223,
                     187310..187378,187437..187839,187892..188187,
                     188276..188405,188487..188627,188707..188851,
                     188950..189063,189143..189157,189218..189240,
                     189303..189390,189447..189481,189557..189730,
                     189787..190059,190154..190331)
                     /locus_tag="CNC00660"
                     /codon_start=1
                     /product="long-chain-fatty-acid-CoA ligase"
                     /protein_id="XP_569356.1"
                     /db_xref="GI:58264400"
                     /db_xref="GeneID:3256367"
                     /translation="MPLEPLPPNVDLNRQNHEIPGTRKDGQSGVFTNSFYNRSILTAP
                     GEPHTLFQLFEDSVKKNPGHPLFVRRALHPSSTPLEPVWTDTLIPTSYATVQTRRNNF
                     GSALLALEREGRLRDPTSADISPPEIKHPGVPFYGDENRRKGGARRGWAVGVWSGNRE
                     EWQIMDLACHAFGLVGVSLYETLGPDVAKYITNHCPLPIIVTSQNHLPSLLKIAPLCP
                     SLRVIVSMDPLPASERVLLNQWAASVNIEFFTMDELEAKGAQAPCKPGPEEGEEELDL
                     KRICTISYTSGTTGDPKGVVLTTENVLSATISNGKGVNPGLINESWMFLSFLPLSHIY
                     ERFAEIVVMYGCGTIGFTRGDPTKLLEDAQLIKPHFMVGVPRMWNRIHAAVKEQMNSG
                     GLKGALLTKAVNTKLAKWRETGEVTHPIYDALVFRKIRALLGGRLVFIGSGAAPLRKD
                     VHEMLKVVLSCEVVQGFGMTETVGTCSVGIPWDVGGPGTCGRLQPCNDVKLVDVPDMG
                     YTARDLPNPRGEVCLKGLNISPGYLHNPKATKESIDEDGWFHTGDIGEIDSAGRLKIV
                     DRLKNVVKLSQGEYVALEKLEGLYALDPLFASFLVHGDSTRSSLIAIAILDPQQTSNL
                     VSKVLGKNVPSENLRGLEEAAKSKEIRKAVFKILGKTARQNKLNGFEMIKGLYLTLKP
                     FPEDIVTPTFKVKRNLAAKIYAKEIEEAYERGEEEAVEALREARL"
     gene            complement(190671..194144)
                     /locus_tag="CNC00670"
                     /db_xref="GeneID:3256475"
     mRNA            complement(join(190671..192013,192069..192305,
                     192355..192509,192558..192990,193045..193468,
                     193517..193680,193750..193839,193914..193949,
                     194060..194144))
                     /locus_tag="CNC00670"
                     /product="nucleus protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544641|gb|CF690482.1,gi|41560872|gb|CF706713.1"
                     /transcript_id="XM_569358.1"
                     /db_xref="GI:58264403"
                     /db_xref="GeneID:3256475"
     CDS             complement(join(191006..192013,192069..192305,
                     192355..192509,192558..192990,193045..193468,
                     193517..193680,193750..193839,193914..193949,
                     194060..194122))
                     /locus_tag="CNC00670"
                     /codon_start=1
                     /product="nucleus protein"
                     /protein_id="XP_569358.1"
                     /db_xref="GI:58264404"
                     /db_xref="GeneID:3256475"
                     /translation="MSNDESKTNQQQAPLKRRRITRACDRCHRGGIRCAASSNPSVCA
                     PCADFGSECTYNRPMKRRGPPPSKARESYGSASGIALTRWTLPLPSDNWTYREIASHA
                     HIESLVEAFYAIVYPIYPMFHWPTFTANIRRRVYTTYPAFHALTMSVCAITSARLRDG
                     AVPSPNSSTPTSDPQPPTSETFYQAAVASYPRDITTASDFDYKRAKPLLATLAIQYGQ
                     IPAVHAHIGDYMTLCAIDGFHNESRWPNDLNEIEVQERRRLFWLAYQLDVYAATTWGG
                     IIRHRESQSTVLYPAEVYSDEEITPTGIVKSVNPAHPVSFWRGWNFVVDLYRILEHAV
                     TRLRARNHTFDAGNQIAALFSEGRVGSGTELKPGDLLVLVERLYRALPPELRATSEMT
                     GDVEKDRYGFQAANILVTMQTMKMVVAGMAEWSVEQRCSIAGELLDAFATVPRAYIQA
                     ISTPLLHHLAGVGHLLASIIHSPLSPAAYLHVRTVLLSMADLLSSLESHLTSTGGIAP
                     KLREHVERIDRYMTSATESNGKLATFASPIHDVQTRQHLATPHHAKDTTPTTTFSLRN
                     VSAVPGTASSVTGTGSLGMSTGTNSSNVRTTSRPSTSANADVYNPSPLGNVNAKFQFK
                     PNSTSSSSSLPLPHLPRPPASQIQNTILPSSSSSVPPPMHLPFGGIGAGVSDTGAGES
                     LQRREPPVITPSSSHSSHSTPSQFSPKFVNTSLVSHPVPPPSIGQPQGNLAGLPLPLQ
                     PSHSQNQSQSRTQHNQPQQPIENPFHLTISNFPPETQEPAYQLPDDLFVDWPFLFNEF
                     GFQGDAFDFLSSGIGGAGGGPGGESASTGVFDGVQAGAGGSTAPVGNFNGVNMTGIGG
                     GRIPPALEGANLQ"
     gene            complement(194979..197496)
                     /locus_tag="CNC00680"
                     /db_xref="GeneID:3256297"
     mRNA            complement(join(194979..195924,195984..196295,
                     196353..196598,196660..197496))
                     /locus_tag="CNC00680"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550654|gb|CF696495.1,gi|41550663|gb|CF696504.1,
                     gi|41566761|gb|CF712602.1,gi|41566769|gb|CF712610.1"
                     /transcript_id="XM_569360.1"
                     /db_xref="GI:58264407"
                     /db_xref="GeneID:3256297"
     CDS             complement(join(195007..195924,195984..196295,
                     196353..196598,196660..197490))
                     /locus_tag="CNC00680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569360.1"
                     /db_xref="GI:58264408"
                     /db_xref="GeneID:3256297"
                     /translation="MSDATLFLRKNKDKQRRRNVSGASRIASTSNSSLASRPGASKGQ
                     PVAGPSSSGAPSSAAPSPSSVSIKPEPDSSNNPNITEIKIFSTGSNSALRYNLMRLNS
                     VKDVDPTQITAPVLMNRKKPGPKDPPTFALDENGKIVGRYVYDEEGKPILDEEGQPVV
                     ERKEVVDMSLVGQAPGGGRKKRVKRGTKEVFHQDIEIMRLRREEALPWVLESGNPQDK
                     PAQPEQWVGRMLEQGQLSTVLLSNDGTRDGFEMMPLGRSYKFEPARPFKPLDSDAANK
                     LFELQAKNKIHDRWAFRPADNQSGEASSASTPIQVKAEPNELEQRASRMETRIKMHKG
                     VTVDRKAKVERYEDDYQREGHRVERGMEGGVDEELDFDEAEEFQDDDDNNTFYRDAQE
                     EEEARELEERLKKEFRVANANVGDRPQIDAEDDEDDLFGDKSLDDEGKKLRKIMRRRM
                     RENGEDYDIDDDSDSDSDDESTTSTQNKEKEKEKDKEKEKAKEKDSSRNPSQPPSRPS
                     SRPPTARTSSPSGSNPRYPSPKKGKASTAPPPVSGASLIAQRATSRGASPRPSTHGGH
                     VAGRASSPLGRVPSPAEGRGPGVTGQSQPASRATSPAVRESSPASGGAAATGGASPAS
                     GGPSTRDVSPAPPAGRPSPRKENAAVSTSSSSAKRKSSPSVSTPSADAPPRPKKHKKT
                     GSLTPAPAPEDIPPFSGMITKQDVLGWFQRNKKKAVPMNEAIGAFRKRIVDAGPNRDA
                     NQKLFLGWIRMVADQENGNLSLKPEFRQ"
     misc_feature    195830..195882
                     /note="CT-rich"
     gene            <197780..>198933
                     /locus_tag="CNC00690"
                     /db_xref="GeneID:3256549"
     mRNA            join(<197780..197823,198003..198120,198190..198293,
                     198351..198485,198546..198649,198842..>198933)
                     /locus_tag="CNC00690"
                     /product="chaperone regulator, putative"
                     /transcript_id="XM_569364.1"
                     /db_xref="GI:58264415"
                     /db_xref="GeneID:3256549"
     CDS             join(197780..197823,198003..198120,198190..198293,
                     198351..198485,198546..198649,198842..198933)
                     /locus_tag="CNC00690"
                     /codon_start=1
                     /product="chaperone regulator"
                     /protein_id="XP_569364.1"
                     /db_xref="GI:58264416"
                     /db_xref="GeneID:3256549"
                     /translation="MPSRRAPMTLPKSSSPYDILDLPLSATETDVKKQYRKKSLLIHP
                     DKFKHEKGLEAFDFLKKAHDHLADPAKRKDIDMIMTHARTQVLKSILGDGYSTSVTDD
                     DPRLTNLSPPFEQQIRAKGREILVEDELARRRKQKLAYSNEGAEKARAEAEVAARKRK
                     VEEQAKWEERRDDRIKDWRDFSQKKEKKRKKNNLHVLG"
     gene            complement(198946..>200430)
                     /locus_tag="CNC00700"
                     /db_xref="GeneID:3256811"
     mRNA            complement(join(198946..199229,199282..199356,
                     199418..199856,199915..199993,200126..200199,
                     200260..200273,200367..200372,200428..>200430))
                     /locus_tag="CNC00700"
                     /product="PRCDNA38, putative"
                     /transcript_id="XM_569366.1"
                     /db_xref="GI:58264419"
                     /db_xref="GeneID:3256811"
     CDS             complement(join(199757..199856,199915..199993,
                     200126..200199,200260..200273,200367..200372,
                     200428..200430))
                     /locus_tag="CNC00700"
                     /codon_start=1
                     /product="PRCDNA38"
                     /protein_id="XP_569366.1"
                     /db_xref="GI:58264420"
                     /db_xref="GeneID:3256811"
                     /translation="MGKGTPSFGKRHSKSHTLCRRCGNRSFHKQKLTCAQCGYPAAKL
                     RSFNWGLKAKRRKTTGTGRMAHLKNVNRRFKNGFREGGAAAKKAKAE"
     gene            complement(<201585..>202396)
                     /locus_tag="CNC00710"
                     /db_xref="GeneID:3256125"
     mRNA            complement(join(<201585..201873,201924..>202396))
                     /locus_tag="CNC00710"
                     /product="pyrophosphatase, putative"
                     /transcript_id="XM_569368.1"
                     /db_xref="GI:58264423"
                     /db_xref="GeneID:3256125"
     CDS             complement(join(201585..201873,201924..202396))
                     /locus_tag="CNC00710"
                     /codon_start=1
                     /product="pyrophosphatase"
                     /protein_id="XP_569368.1"
                     /db_xref="GI:58264424"
                     /db_xref="GeneID:3256125"
                     /translation="MSLQLPESSLPPLKSFSLTHILYDPAHPLSIPLTLLSLSPIFLF
                     VSYFTLLIFTRRISIALLASGQLANEVLSWVLKRIFKGERPYIGHGEVGAGYGMPSSH
                     SQAAGFLVAWGIGYVLTHADRNEQVRSVRAEMVRKWRTRVYVFGLLLWSVGVSYSRFH
                     LHYHSPAQIVAGYLAGLAFGALYFTITEYYPLRHPFSSLARLRIAVEYIWGGIGGVGG
                     WELGDAGGGWGEGWAFVGEEQPAEEKREDKKKKKK"
     gene            205111..>209504
                     /locus_tag="CNC00720"
                     /db_xref="GeneID:3256244"
     mRNA            join(205111..205846,205917..206457,206740..207000,
                     207047..207161,207211..207668,207720..207961,
                     208016..208558,208607..208863,208919..209192,
                     209247..209370,209425..>209504)
                     /locus_tag="CNC00720"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545411|gb|CF691252.1,gi|41554776|gb|CF700617.1"
                     /transcript_id="XM_569954.1"
                     /db_xref="GI:58265595"
                     /db_xref="GeneID:3256244"
     CDS             join(205926..206457,206740..207000,207047..207161,
                     207211..207668,207720..207961,208016..208558,
                     208607..208863,208919..209192,209247..209370,
                     209425..209504)
                     /locus_tag="CNC00720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569954.1"
                     /db_xref="GI:58265596"
                     /db_xref="GeneID:3256244"
                     /translation="MPHTTNVSLSPRPTTPSGSLPRTDRSRRPLPPDTAASGINDLPR
                     REFFSEGSDGEDYDDEEDEEEEDDVFAFNRPATAAQPNGASSSGYGTAPTSGRPTTAG
                     ISWTQTTAEERGPAHVGTSTGPGTLSYDGPTPLRDQPQSVNSNNKDAVPTPTGVIDVG
                     GHLPDTTYDVNNPPPFSEDGVYSEDGNFGRRRRRSRGSIGMTELTGDMTVPDGMTTWG
                     DGMGGLAKGGSDGEVQSAMDVDFDEEDSPYPEVRASVSNIDDPDMPAMTIRAWVLGIF
                     LTILASGCNTYFHFRTPAPYISPLIVQVVAYPLGKFAAWILPIDTYKLPLWLGGREFS
                     FNPGPFNIKEHTVIVMMANVAIGPAYALYATVSSELYYNHPMGFGFSIMFLFATQMTG
                     FTLAGICRRFVVWPASMIWPGNLVVATNLNTFHAEEDGFTGGMSRFKFLIVCMAGSFA
                     WYFFPGFVFTALSYFSWVCWIAPRNNVVNQLFGVSTGLGMGLLTFDWTQITWIGNPLT
                     TPWWAEVNVGIGFVIFYWILTPILYYTNVWHTAFLPISVIQAADRFGSTYDVFNILTP
                     EITLNKTAYAEYSPIYLSASYCVTYMVAFALSTALLVHTALYHGPRIYRAILNIKTEA
                     DDIHYKLMKMYPEVPDWWFLALFAVVFVFAVVSIEVYHTELPVWGYLISVLLPFIYII
                     PTAFIYAMTSQQITINLLAELIPGYIFQGQPLPGMIFKVFSVQTIVEALSFVQDQKLG
                     HYMKVPPRATFVAQLSATTVACFVQSGTKELLFHVVKDICTATQKSLLICSSTKVFFT
                     SSIIWGLIGPNRLFSKGAFYYPQLFALVFGAVLPIPLWFWVRRNPRSIFRNLNFPVMF
                     NGALSIPPASGVNYASWLSTGFIFQFWLRRKRFAWWSKYNYVLSAALDVGTALSAVAL
                     FLFIDLPGASLSWWGNNVYKQTVDWDGVGATYYKPPPEGFGPDTWKV"
     repeat_region   206073..206130
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     gene            complement(210638..211251)
                     /locus_tag="CNC00730"
                     /db_xref="GeneID:3256177"
     mRNA            complement(join(210638..210857,211061..211251))
                     /locus_tag="CNC00730"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41560301|gb|CF706142.1,gi|41560854|gb|CF706695.1"
                     /transcript_id="XM_569370.1"
                     /db_xref="GI:58264427"
                     /db_xref="GeneID:3256177"
     mRNA            complement(join(210638..210874,211061..211251))
                     /locus_tag="CNC00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_569372.1"
                     /db_xref="GI:58264431"
                     /db_xref="GeneID:3256177"
     mRNA            complement(210638..211251)
                     /locus_tag="CNC00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_569371.1"
                     /db_xref="GI:58264429"
                     /db_xref="GeneID:3256177"
     CDS             complement(join(210844..210857,211061..211184))
                     /locus_tag="CNC00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569370.1"
                     /db_xref="GI:58264428"
                     /db_xref="GeneID:3256177"
                     /translation="MSFTTLFTAALVLIAPALVAAAPAAEPAPSVKSQNFGAPGGAYP
                     W"
     CDS             complement(join(210861..210874,211061..211184))
                     /locus_tag="CNC00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569372.1"
                     /db_xref="GI:58264432"
                     /db_xref="GeneID:3256177"
                     /translation="MSFTTLFTAALVLIAPALVAAAPAAEPAPSVKSQNFGAPGGASP
                     I"
     CDS             complement(211050..211184)
                     /locus_tag="CNC00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569371.1"
                     /db_xref="GI:58264430"
                     /db_xref="GeneID:3256177"
                     /translation="MSFTTLFTAALVLIAPALVAAAPAAEPAPSVKSQNFGAPGGGKY
                     "
     gene            213201..216212
                     /locus_tag="CNC00740"
                     /db_xref="GeneID:3256779"
     mRNA            join(213201..214915,214972..215652,215714..216212)
                     /locus_tag="CNC00740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569374.1"
                     /db_xref="GI:58264435"
                     /db_xref="GeneID:3256779"
     CDS             join(213221..214915,214972..215652,215714..216136)
                     /locus_tag="CNC00740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569374.1"
                     /db_xref="GI:58264436"
                     /db_xref="GeneID:3256779"
                     /translation="MASTDLHSSDPLSPQPGICPPSPIIRVPEAEIYSGHQSMAFDFD
                     EGNLHAMEGSDSSEVSNIADEEDSEDDIIQAPIDSFNDDEMISTPGFDEQAYYQSKDE
                     CKGAVQAYAASQGFAAVIRRSKRKKPTKTHKEGRELIQYSCIFGDEYRCTRGDSFKDV
                     RIRTIQTVKNGCPFAAVAWEMAEAEVKEHGGDKCWTWKVVNASHNHPPVANIGIALLR
                     RASRTPEAKELINTLIDSRTPFPSIISTMSQRFPTVMLTSEDLHRLAFRRRADLRAGS
                     SASAACIRQLVSNDELHRPFVNTRDELIGLVYTKRTARALIHRFPEVLFFDCTYKTNL
                     YRMPMLHIVGSTSTGMTYTAGVILMLRETTNWYTQALNSFFELVGKPDVKVVITDRDP
                     ALINALMSVLPKAYRFSCFWHLQENVKSNIRPCFVDEENIVMAVSNFCKAWVRYCVHA
                     KSDEQLEEGYRKMEELYPGQKYARAISYIRGLDEIKERFVHAYINKQLHFGQTGNSRL
                     EGQHATLKKSIDTKYGDLLLVIGSLSTYFDQQWLKILKRIELERTRCATHIPSTFVRL
                     KGSISRAAMKLLAEQLTLAKRYLGDYDEGVDDFEESHPCSGSFTKSHGLPCAHRLISF
                     VRERRHLEKDHIHPHWRLGSAASLKRYLDHINRLVGTPDTSVIRLDDVFDFGEDQELI
                     LDPPILSTKRGRKAPNPPVLQEDRMSAPSGRYLTQSERIMGAGLTQRKKGRCKHCQSS
                     THYTKDCARVQASRRVDKNQEAENAGEDRRVLVPDSDDEEGNEEDLVEVPNEPNLRPK
                     KHSRSQYPAPSQIYPSHAVQMQHLPPEPSVPQLPPSSQFYPPLSQYYPPAPQHYPTSK
                     YHVPPTQYIPYNQVLFHNHSEAPTPYHYPSVSGYNNLQSPQIYQYNLENNVGKDASIR
                     SQEDSIIMQRGRDRHSWE"
     gene            complement(214862..>216173)
                     /locus_tag="CNC00750"
                     /pseudo
                     /db_xref="GeneID:3256493"
     gene            217274..219019
                     /locus_tag="CNC00760"
                     /db_xref="GeneID:3256630"
     mRNA            join(217274..217520,217608..217792,217852..219019)
                     /locus_tag="CNC00760"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533262|gb|CF679103.1,gi|41533274|gb|CF679115.1,
                     gi|41533697|gb|CF679538.1,gi|41535795|gb|CF681636.1,
                     gi|41535799|gb|CF681640.1,gi|41541061|gb|CF686902.1,
                     gi|41541074|gb|CF686915.1,gi|41542754|gb|CF688595.1,
                     gi|41543727|gb|CF689568.1,gi|41543734|gb|CF689575.1,
                     gi|41553532|gb|CF699373.1,gi|41553538|gb|CF699379.1,
                     gi|41553610|gb|CF699451.1,gi|41553624|gb|CF699465.1,
                     gi|41555602|gb|CF701443.1,gi|41555610|gb|CF701451.1,
                     gi|41556722|gb|CF702563.1,gi|41556730|gb|CF702571.1,
                     gi|41561161|gb|CF707002.1,gi|41562741|gb|CF708582.1,
                     gi|41562753|gb|CF708594.1,gi|41567356|gb|CF713197.1,
                     gi|41567362|gb|CF713203.1,gi|41571868|gb|CF717709.1,
                     gi|41571873|gb|CF717714.1,gi|41574244|gb|CF720085.1,
                     gi|41574249|gb|CF720090.1"
                     /transcript_id="XM_569376.1"
                     /db_xref="GI:58264439"
                     /db_xref="GeneID:3256630"
     CDS             join(217669..217792,217852..218681)
                     /locus_tag="CNC00760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569376.1"
                     /db_xref="GI:58264440"
                     /db_xref="GeneID:3256630"
                     /translation="MFAKAAVIALASASIVVAAPVNCARAKPTTYDEGYLESYDAYHT
                     RYLALSCSTQHNTTFFDDCCHPLLATETLADNRASYCTPNSTAIASVNATIAEATASA
                     TASADIEAESQYNNASSYAAEATASVTAEATASVTAEATASVTASAVNNLADVAQQTA
                     ASSYEEQPTASSSSSYGRASASSSSSDEESATSTSSSSASDSSSTSSSEVYTGGYATF
                     YSQGGVAGECGTVHSDDDYVIAIDSNGWWQDYESNDSSPYCGKSITLTNTNNGKSVTA
                     VVADVCPTCETANSLDLSIGAFNQIATEEDGMVPITWYFTD"
     gene            complement(217858..>219019)
                     /locus_tag="CNC00770"
                     /pseudo
                     /db_xref="GeneID:3256425"
     gene            complement(219350..>222584)
                     /locus_tag="CNC00780"
                     /db_xref="GeneID:3256392"
     mRNA            complement(join(219350..219679,219791..219878,
                     219945..220205,220283..220378,220444..220510,
                     220576..220632,220715..220871,220961..221150,
                     221207..221334,221412..221524,221594..221746,
                     221806..222094,222155..>222584))
                     /locus_tag="CNC00780"
                     /product="histone deacetylase clr3, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536768|gb|CF682609.1,gi|41536772|gb|CF682613.1,
                     gi|41557682|gb|CF703523.1,gi|41557692|gb|CF703533.1,
                     gi|41557840|gb|CF703681.1,gi|41557845|gb|CF703686.1,
                     gi|41564186|gb|CF710027.1,gi|41564194|gb|CF710035.1,
                     gi|41567422|gb|CF713263.1,gi|41567430|gb|CF713271.1,
                     gi|41570515|gb|CF716356.1,gi|41570520|gb|CF716361.1"
                     /transcript_id="XM_569378.1"
                     /db_xref="GI:58264443"
                     /db_xref="GeneID:3256392"
     CDS             complement(join(219495..219679,219791..219878,
                     219945..220205,220283..220378,220444..220510,
                     220576..220632,220715..220871,220961..221150,
                     221207..221334,221412..221524,221594..221746,
                     221806..222094,222155..222584))
                     /locus_tag="CNC00780"
                     /codon_start=1
                     /product="histone deacetylase clr3"
                     /protein_id="XP_569378.1"
                     /db_xref="GI:58264444"
                     /db_xref="GeneID:3256392"
                     /translation="MHSPSPLCAPPSLRPAPAHRRMAHTAAMHTGPPPAAPTNVGNSP
                     SHTTMAMPGAAARIARTGYIYDPLMMLHCMEGYMPTAENVMDNGDGHPEDPMRIKRIF
                     TRLAEQGLIRRMKRLDFEEVKFEQVLLVHGEEMWDKVQATELLSDQQIQDMKEYYDQL
                     SLYVCRETAHCARLSAGGVIQACRSVCKNEVRNAFAIVRPPGHHAEPNEHMGFCFFNN
                     VAVATREMQREGLAKKVLILDWDVHHGNGTQRAFWHDGDVLYMSLHRHEGGTFYPNSD
                     FGSLNMVGDGEGVGKSVNIPWPGPGFGDADYIYAFQRIIMPIAYEFDPDLVIISAGFD
                     AADGDMLGQCRVTPAAYGHMTHMLSSLAGGKLVVALEGGYNLRAISDSALAVARVLLG
                     EIPPELGIMRASEAATEVVYQVALEQSKYWKCIDVKACEPPEVTELENGTSPVYTIPD
                     LLKIHRAHHMFTKHQLYQIPLASQELEAAFGGQIICNENMYEVGEKGVLVVFVHDFGN
                     LRVETDGARSTNIHLANSYLLDTSDAVVSWVKTKGYNIIDVNILKQLPTEYPEGPKMV
                     VKQANDMESKLMKYIWDNYIELSECEKVVFIGHGTGCQAIMDLVNARDVELKVKAVVQ
                     VAGLHSLVRPNPSNKEKLSWFKQCNQIYVPAEHVVLEDEKVKRRLGDAVFTSQKAKVV
                     DVLNDVLPRIKAFVESKVEDGLAPRAHSGLDGLYGLGGAGAGGELVVVNGHVHVG"
     misc_feature    222474..222494
                     /note="GC_rich"
     gene            <222743..224767
                     /locus_tag="CNC00790"
                     /db_xref="GeneID:3256540"
     mRNA            join(<222743..222898,222961..223359,223428..223706,
                     223776..224222,224283..224767)
                     /locus_tag="CNC00790"
                     /product="RNA-binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537966|gb|CF683807.1,gi|41537976|gb|CF683817.1,
                     gi|41574030|gb|CF719871.1,gi|41574034|gb|CF719875.1,
                     gi|41574614|gb|CF720455.1,gi|41574624|gb|CF720465.1"
                     /transcript_id="XM_569380.1"
                     /db_xref="GI:58264447"
                     /db_xref="GeneID:3256540"
     CDS             join(222743..222898,222961..223359,223428..223706,
                     223776..224222,224283..224756)
                     /locus_tag="CNC00790"
                     /codon_start=1
                     /product="RNA-binding protein"
                     /protein_id="XP_569380.1"
                     /db_xref="GI:58264448"
                     /db_xref="GeneID:3256540"
                     /translation="MAKHSAHKGKAPVTDKNNKRKRDAQDSSQGDAPVALFAAVKDTE
                     LDDIFAKSNAFSAPAPVASTSKAHLQTTSAPAAKKGKKSPSPEMEEDVRVDDQDESES
                     SEEDEDGEDNEAELSEIDEELPDDDDEDVSDAESDSEAAKAKETKKTKKSKLGKYVPA
                     EESVQDKNRRTAFIGNLPIDAAKSKSTLKQLRAHIMSFVPSAKIESLRFRSVAFATPT
                     AALPTEDPEKDANQRAKREKERAAAWKAKQNADGEDAELDKAKVFIDAKGKRKVAFIK
                     KDFHSEIDSCNAYVVFAYPHPDRAANVAPILDPFEAAAKFIASANSSTFSGRTIRVDS
                     VRLPSSVGLAGASTSLSKRDAWLPSNTDPKKSLFVGGLDYAAKEEDVRVFFEELVKAE
                     RGANKEGSGKWVTGVRIVRDKETQLGKGFGYVHFADRESVEEILAMDAKQIKFAKRTL
                     RVQPCKTIPTANTLQNTIKKIAAGSGGASKDKTKKAYVRPGVIPKGDPALGDKLKNLS
                     KEERKTIKSSDADRQARRLAKKKAKMSLEKDKAKGAVKLTLTKSEREKTSASKKPKAK
                     KGKKRAPSAVAKMKGSRE"
     gene            <224941..227592
                     /locus_tag="CNC00800"
                     /db_xref="GeneID:3256816"
     mRNA            join(<224941..225315,225374..226820,226892..227592)
                     /locus_tag="CNC00800"
                     /product="biotin-[acetyl-CoA-carboxylase] ligase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545534|gb|CF691375.1,gi|41545539|gb|CF691380.1,
                     gi|41552642|gb|CF698483.1,gi|41552651|gb|CF698492.1,
                     gi|41565682|gb|CF711523.1,gi|41571289|gb|CF717130.1,
                     gi|41571297|gb|CF717138.1"
                     /transcript_id="XM_569383.1"
                     /db_xref="GI:58264453"
                     /db_xref="GeneID:3256816"
     mRNA            join(<224941..225315,225374..226820,226892..227126,
                     227207..227592)
                     /locus_tag="CNC00800"
                     /product="biotin-[acetyl-CoA-carboxylase] ligase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545539|gb|CF691380.1,gi|41565677|gb|CF711518.1,
                     gi|41565682|gb|CF711523.1,gi|41571297|gb|CF717138.1"
                     /transcript_id="XM_569382.1"
                     /db_xref="GI:58264451"
                     /db_xref="GeneID:3256816"
     CDS             join(224941..225315,225374..226820,226892..227126,
                     227207..227519)
                     /locus_tag="CNC00800"
                     /codon_start=1
                     /product="biotin-[acetyl-CoA-carboxylase] ligase"
                     /protein_id="XP_569382.1"
                     /db_xref="GI:58264452"
                     /db_xref="GeneID:3256816"
                     /translation="MPGPTPSAHQVLVYSGPGVSPLSLSHTLLTLRLLLLPHYTVQPA
                     APDLLALQPWEPSCALLVVPGGRDLPYVDELTHKRPVTNRIREYVQQGGRFLGICAGA
                     YFASAEVRFDVGGGMEVAGKRDLAFFPGPSRGPVFQGFQYASESGSRAVVLNLESSKL
                     ETLNHIYYNGGGQFILPSPPPPNVQILARFQETCSDPSGQQQQQLVAAVFTQNGKGCT
                     VLSSVHPEYPLSDPPASNAIAKLDVRPSQVEVEMSDKARLSWVEELLIKLGLTPPERL
                     TAANRAKSSADSEHEDEDPALLLHPTHPSPIFFLSHPNLPQLPEAAVNKPELKGKMEQ
                     RDGWDVLRDANDEIRFGTTEATSPERAASEDGITQWLAQARRTQPVFPPSVEDLSIQS
                     DSTPQPPSPPDLHALTKTILLPSPSVEYSSRWTPLFNFSTYWDELDQARKRSGRRSGV
                     MRQGSDGQGERCSLGDCVLYGETVTSTQTMLDGNPLLLTNLPTPLVFLASFQLSGRGR
                     GSNMWLSPPGCLQFSLLLDLPASLSSKMVFIQYIMALAVCEAIDEDGRLGVRIKWPND
                     IYAEVEGVGGTEIGSGKKGKAKLGGILVNTSFVGGKWRIVVGCGINILNALPTSSVSQ
                     LHALLAAKLSSTSSNKPLPPAPTMEGTFARIMSSFDAKWEQFIEEKGFKGFMDEYHGR
                     WLHSGQDVLLTTTEPHTRVRILSITPDHGLLRCIPISDKPKASTGLTPLYNRDIDAGE
                     DDRGSWSSSPSVPRSGAARAQTQNHSPFVDLQPDGNSFDLMSGLIKRKV"
     CDS             join(224941..225315,225374..226820,226892..227187)
                     /locus_tag="CNC00800"
                     /codon_start=1
                     /product="biotin-[acetyl-CoA-carboxylase] ligase"
                     /protein_id="XP_569383.1"
                     /db_xref="GI:58264454"
                     /db_xref="GeneID:3256816"
                     /translation="MPGPTPSAHQVLVYSGPGVSPLSLSHTLLTLRLLLLPHYTVQPA
                     APDLLALQPWEPSCALLVVPGGRDLPYVDELTHKRPVTNRIREYVQQGGRFLGICAGA
                     YFASAEVRFDVGGGMEVAGKRDLAFFPGPSRGPVFQGFQYASESGSRAVVLNLESSKL
                     ETLNHIYYNGGGQFILPSPPPPNVQILARFQETCSDPSGQQQQQLVAAVFTQNGKGCT
                     VLSSVHPEYPLSDPPASNAIAKLDVRPSQVEVEMSDKARLSWVEELLIKLGLTPPERL
                     TAANRAKSSADSEHEDEDPALLLHPTHPSPIFFLSHPNLPQLPEAAVNKPELKGKMEQ
                     RDGWDVLRDANDEIRFGTTEATSPERAASEDGITQWLAQARRTQPVFPPSVEDLSIQS
                     DSTPQPPSPPDLHALTKTILLPSPSVEYSSRWTPLFNFSTYWDELDQARKRSGRRSGV
                     MRQGSDGQGERCSLGDCVLYGETVTSTQTMLDGNPLLLTNLPTPLVFLASFQLSGRGR
                     GSNMWLSPPGCLQFSLLLDLPASLSSKMVFIQYIMALAVCEAIDEDGRLGVRIKWPND
                     IYAEVEGVGGTEIGSGKKGKAKLGGILVNTSFVGGKWRIVVGCGINILNALPTSSVSQ
                     LHALLAAKLSSTSSNKPLPPAPTMEGTFARIMSSFDAKWEQFIEEKGFKGFMDEYHGR
                     WLHSSVFFFFFIPIDCSVSMISY"
     gene            complement(<228432..>231525)
                     /locus_tag="CNC00810"
                     /db_xref="GeneID:3256318"
     mRNA            complement(join(<228432..228740,228792..228854,
                     228911..229484,229536..229864,229930..230193,
                     230241..230335,230388..230583,230647..230771,
                     230859..231068,231120..>231525))
                     /locus_tag="CNC00810"
                     /product="gamma-tubulin complex component 3 (gcp-3),
                     putative"
                     /transcript_id="XM_569385.1"
                     /db_xref="GI:58264457"
                     /db_xref="GeneID:3256318"
     CDS             complement(join(228432..228740,228792..228854,
                     228911..229484,229536..229864,229930..230193,
                     230241..230335,230388..230583,230647..230771,
                     230859..231068,231120..231525))
                     /locus_tag="CNC00810"
                     /codon_start=1
                     /product="gamma-tubulin complex component 3 (gcp-3)"
                     /protein_id="XP_569385.1"
                     /db_xref="GI:58264458"
                     /db_xref="GeneID:3256318"
                     /translation="MIYAYTSSGAKEGGAEKALKFNAIWNKLERGVSLGATRDYRSNS
                     SLGCQKLLSSPNPHLELLAALSPINPNNASRSTVAGSSKSPKNMPPPTFPSTKPSSSR
                     QPLVDAVPNISLLGFDAKGKAKADIINQWRANRSQPPFPQHLLLRDTLYLLQGIDGRY
                     VHFAVSPPKEQNPYLTERGREGEGTGFPLGKEGPIIEEGYDDEVVVISQPTRTLLMQL
                     SEMGMLYRRVTNFVNSRQAGDSKGGMIEQSLCHFLHHELSEYHRLLAVLESQMNTASS
                     SGEQPDSGLTLLRLRLWTEDMKLKLKQMSTIVDEAKNTHGGALVSKLHSHTSNGDPLI
                     RNFTTQILEEVSKPFFLTLQRWIFSGELHDPFKEFFVQLNPENVSFREGQISPTGDVG
                     FEMGMDADGGEEEAYKLWEKKYVFVKKMVPGFVGEDFAKKIFSTGRSLNFIRYSCHDS
                     DWIETQAKIANAGRGEFMGCKRGSMSDRVVALKYSDLAGLERSIDDAYSIASQRLLEI
                     FFDKFRLLDHLRALKSYLMLGAGDFTELLMEAMAPRLSKPAINLYRHHLTSDLESAIR
                     GSNAQYDSPDILRRLDARILEYSHGETGWDCFALQYKVEAPLNAVLDHRAMGDYDRLF
                     NHLWRLKRVEVVLTQNWMRVTSGSKVYERVPGLNNDWHHCRIVQAEMVHFLRQLQAFC
                     QLEVIECSWADLIEFTTKREGDLDALITAHRKYLSRVVRKVLLLSAKRDKEEILLDLV
                     RDALELILQFKDAMDDLYAWSLGEATRLDRQRDASRGLYTPSTSSDDPTRSEEQLQSI
                     RIRIRECSNSFQHRVVSIVHMAGAHADLDVRFLAIRIAFNGHYSLRKKDKGSSRSTRA
                     "
     gene            232093..>234135
                     /locus_tag="CNC00820"
                     /db_xref="GeneID:3256166"
     mRNA            join(232093..232649,232701..232734,232793..233092,
                     233145..233315,233370..233683,233751..233908,
                     233964..>234135)
                     /locus_tag="CNC00820"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546295|gb|CF692136.1,gi|41569127|gb|CF714968.1,
                     gi|41575085|gb|CF720926.1,gi|41575090|gb|CF720931.1"
                     /transcript_id="XM_569387.1"
                     /db_xref="GI:58264461"
                     /db_xref="GeneID:3256166"
     CDS             join(232488..232649,232701..232734,232793..233092,
                     233145..233315,233370..233683,233751..233908,
                     233964..234135)
                     /locus_tag="CNC00820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569387.1"
                     /db_xref="GI:58264462"
                     /db_xref="GeneID:3256166"
                     /translation="MSTPKVVTYLRSLEAVRDRSRQVYNLGVDGKLDHWTFDEAKLAD
                     IADYCSKIIERDFGVDYASIPPHCRRGHFITPSNNRIATLLAKPSFPPKSEPLSRAGT
                     LIDLYLVSVLLDAGAGPDWTFTETDEEGNETWKGGRSEGLAVASYHMFINGLFSSSGN
                     KFQVDANGLKKLTPELLAKHLQVSEDNPMTGLEGRCNLLIKLGDALAARPDLCATGRP
                     GDLLKYFEPKVKDSLPLSDFWSTLFDLLLPIWPSRVTLPSHPTYPLGDVWPCTSLSRS
                     LDQAGIDREEGDDFVPFHKLTQWLCYSLVDAIESEAGWKVDKGLGQTGLPEYRNGGLF
                     IDLGALTIKPESLGGNAYPNGKDKPPVLEPSHPAVIEWRAVTVISLDRIHNLLCEKLQ
                     VGKDVLALAQVLEAATWKGGREIAKEKRAGGGPPIDIVSDGTIF"
     gene            complement(234188..236344)
                     /locus_tag="CNC00830"
                     /db_xref="GeneID:3256562"
     mRNA            complement(join(234188..234631,234681..235300,
                     235351..235655,235708..235859,235911..236004,
                     236061..236115,236188..236242,236293..236344))
                     /locus_tag="CNC00830"
                     /product="t-complex protein 1, alpha subunit
                     (tcp-1-alpha), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530163|gb|CF676004.1,gi|41530172|gb|CF676013.1,
                     gi|41531149|gb|CF676990.1,gi|41531157|gb|CF676998.1,
                     gi|41537362|gb|CF683203.1,gi|41537371|gb|CF683212.1,
                     gi|41538016|gb|CF683857.1,gi|41538022|gb|CF683863.1,
                     gi|41538740|gb|CF684581.1,gi|41538750|gb|CF684591.1,
                     gi|41540781|gb|CF686622.1,gi|41540794|gb|CF686635.1,
                     gi|41544135|gb|CF689976.1,gi|41544148|gb|CF689989.1,
                     gi|41544260|gb|CF690101.1,gi|41545817|gb|CF691658.1,
                     gi|41545821|gb|CF691662.1,gi|41548751|gb|CF694592.1,
                     gi|41548760|gb|CF694601.1,gi|41555331|gb|CF701172.1,
                     gi|41555341|gb|CF701182.1,gi|41555900|gb|CF701741.1,
                     gi|41555908|gb|CF701749.1,gi|41556400|gb|CF702241.1,
                     gi|41557291|gb|CF703132.1,gi|41557299|gb|CF703140.1,
                     gi|41559339|gb|CF705180.1,gi|41559340|gb|CF705181.1,
                     gi|41562355|gb|CF708196.1,gi|41562359|gb|CF708200.1,
                     gi|41564317|gb|CF710158.1,gi|41564325|gb|CF710166.1,
                     gi|41566024|gb|CF711865.1,gi|41566025|gb|CF711866.1,
                     gi|41566626|gb|CF712467.1,gi|41566923|gb|CF712764.1,
                     gi|41566932|gb|CF712773.1,gi|41573056|gb|CF718897.1,
                     gi|415"
                     /transcript_id="XM_569389.1"
                     /db_xref="GI:58264465"
                     /db_xref="GeneID:3256562"
     CDS             complement(join(234272..234631,234681..235300,
                     235351..235655,235708..235859,235911..236004,
                     236061..236115,236188..236242,236293..236328))
                     /locus_tag="CNC00830"
                     /codon_start=1
                     /product="t-complex protein 1, alpha subunit
                     (tcp-1-alpha), putative"
                     /protein_id="XP_569389.1"
                     /db_xref="GI:58264466"
                     /db_xref="GeneID:3256562"
                     /translation="MASTMYQRDPRAGLFLGGTRTSGAEVRDANVMACQTVSNILKSS
                     LGPVGLDKMLVDNVGDVTITNDGATILSLLEVAHPAARVLVSLATQQDKEVGDGTTSV
                     VLLASELLRRANELVRNKIHPTTVITGYRLACKEACRYMAEQLSTKVDKLGKDSLINV
                     AKTSMSSKILGADDDFFAPLAVDAMLAVKTINAKGEKKYPVKAVNVLKAHGKSARESF
                     MVKGYALNCTVASHAMKTRITGAKIACLDMNLAKQRMHLGVHITIDDPDQLEAIRARE
                     SEITLERVRKILAAGANVVLTTKGIDDLVLKEFVEAGAMAVRRCRKEDLRRIAKATGA
                     TLISSLANLEGDETFEASSLGYAEEVVQERISDDELILVKGTKIVNSSSVILRGANDF
                     MLDEMERSLHDALSIVKRTLESGSVVPGGGAVETALSIYLENFATTLGSREQLAIAEF
                     AAALLTIPKTLSINAAKDSTDLVAKLRAYHNAAQNAPLNDPKRGLMYYGLDLINGEVI
                     DNRQAGVLEPTMSKIKSLKSALEAATSLLRIDDSIQVAPEQKEEVDPHGH"
     gene            236562..239309
                     /locus_tag="CNC00840"
                     /db_xref="GeneID:3256525"
     mRNA            join(236562..236894,236947..237107,237157..237600,
                     237655..237870,237948..237972,238035..238269,
                     238315..238500,238558..238721,238771..238981,
                     239032..239309)
                     /locus_tag="CNC00840"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540059|gb|CF685900.1,gi|41540065|gb|CF685906.1,
                     gi|41555519|gb|CF701360.1,gi|41560733|gb|CF706574.1,
                     gi|41560737|gb|CF706578.1"
                     /transcript_id="XM_569955.1"
                     /db_xref="GI:58265597"
                     /db_xref="GeneID:3256525"
     mRNA            join(236562..236894,236947..237107,237157..237600,
                     237655..237870,237948..237972,238035..238269,
                     238315..238476,238558..238721,238771..238963)
                     /locus_tag="CNC00840"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540065|gb|CF685906.1,gi|41555516|gb|CF701357.1,
                     gi|41555519|gb|CF701360.1,gi|41560733|gb|CF706574.1,
                     gi|41560737|gb|CF706578.1"
                     /transcript_id="XM_569956.1"
                     /db_xref="GI:58265599"
                     /db_xref="GeneID:3256525"
     CDS             join(236594..236894,236947..237107,237157..237600,
                     237655..237792)
                     /locus_tag="CNC00840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569955.1"
                     /db_xref="GI:58265598"
                     /db_xref="GeneID:3256525"
                     /translation="MNRPISTLRLVLSATQPRFAPSPAVLRPFVSSTRLYATHHETAS
                     PHSQSQATSDLLKGLGNKTGTSSGTQDTVGPFPLGVGPNGRRKTWKSWSDLNIGGKLV
                     RTTQQTGNLTVILFGGALFVVLTFALTTELFAKNSPSVLYSHAIDMIRGSNALDAYLL
                     PPLKFTHSPHSSAPVRGSPPIAHTFIRNPTSGKDHLVISFWIHGRAKDEEETLSWIKQ
                     GWRSAVAWGKEGMDMLVGEKPEDVVKEDVEKKERVVVKKEPGTLSRWFGGLNLRSTAG
                     SRVPLAKELPPAGTYTVGEARGEYVKDEAGEFQMLSLIVDIPSSKASYPGRAVIFQSP
                     EAETEGLLGKRIR"
     gene            <243460..246016
                     /locus_tag="CNC00850"
                     /db_xref="GeneID:3256616"
     mRNA            join(<243460..243712,243767..243828,243881..243938,
                     243989..244051,244101..244236,244511..244833,
                     244889..244965,245016..245083,245137..245365,
                     245418..245453,245501..245597,245656..245845,
                     245900..246016)
                     /locus_tag="CNC00850"
                     /product="transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41563955|gb|CF709796.1,gi|41563958|gb|CF709799.1"
                     /transcript_id="XM_569391.1"
                     /db_xref="GI:58264469"
                     /db_xref="GeneID:3256616"
     CDS             join(243460..243712,243767..243828,243881..243938,
                     243989..244051,244101..244236,244511..244833,
                     244889..244965,245016..245083,245137..245365,
                     245418..245453,245501..245597,245656..245845,
                     245900..245924)
                     /locus_tag="CNC00850"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_569391.1"
                     /db_xref="GI:58264470"
                     /db_xref="GeneID:3256616"
                     /translation="MSAAVPVVVDTHAVTNPRPVDQPDSLIKDDIEDKGELSYSDIND
                     SVETLDAKWYEPPDSYESKHRWDPEAKWTTQEETRLRRTLDIRVAAFACLCFAALQLD
                     RGNITNALSDGMLADIGLTTAGYNTGMTIFYCCFLVAELPSQMISKKLGSDVWIPIQM
                     MAWSIVAICQVAIKGKSSFYATRALLGLLEGNYVATAAAELTIRLSWFWVSLTTTTII
                     GSLLAAGILQMRGVHGLAGWRWLFAIEGALTFLIGFWAWWYLPASPTETKKWWRPNGW
                     FTEREETIIVNKVLRDDPTKSSMHNREGLSPIDLWRSIADFDMWPLYVIGLIAFIVPS
                     TVQAYFTLTLRNLDFSTFQTNLLTIPSNVMFIFMNLGVSFLSKRLNERLIVTTVQPIW
                     HLIFLIVIIALPDDVNRWAKWVVTSLLMAYPYCHPILVSMNSMNAGSVRTRTVASSVY
                     NMFVQAASLIASNIYQPSDAPYYHKGNRVLIALSVVSIVMCWSAKAWYIWRNKQRAKI
                     WDSWTISQKEEYLATTKDLGNKRLNFRFLH"
     gene            complement(<246508..>247301)
                     /locus_tag="CNC00860"
                     /db_xref="GeneID:3256301"
     mRNA            complement(join(<246508..247031,247193..>247301))
                     /locus_tag="CNC00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_569393.1"
                     /db_xref="GI:58264473"
                     /db_xref="GeneID:3256301"
     CDS             complement(join(246508..247031,247193..247301))
                     /locus_tag="CNC00860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569393.1"
                     /db_xref="GI:58264474"
                     /db_xref="GeneID:3256301"
                     /translation="MIDLSLTILDNAGANPDYTDDGRKTNLHQHGEKNLECYRTLRIH
                     DEHDDKSHSHSYSVWCTDEREHYDLEKDPKQINNLLSPLNELGAFSPFNSTILNGEPA
                     LSHHLQNLFNRLEALLLVLKRCTIGEACHNPYRELAPSSQATGGEIFKFSQILESRFD
                     AFLRTCPRFSLISVLWVSKKNWRNLIGRMSGSMVRMRVMRLGEGIVFQGF"
     repeat_region   249963..249994
                     /rpt_type=tandem
                     /rpt_unit_seq="tcca"
                     /satellite="microsatellite"
     gene            <250472..>252868
                     /locus_tag="CNC00870"
                     /db_xref="GeneID:3256447"
     mRNA            join(<250472..251020,251078..251965,252014..>252868)
                     /locus_tag="CNC00870"
                     /product="Mih1p, putative"
                     /transcript_id="XM_569395.1"
                     /db_xref="GI:58264477"
                     /db_xref="GeneID:3256447"
     CDS             join(250472..251020,251078..251965,252014..252868)
                     /locus_tag="CNC00870"
                     /codon_start=1
                     /product="Mih1p"
                     /protein_id="XP_569395.1"
                     /db_xref="GI:58264478"
                     /db_xref="GeneID:3256447"
                     /translation="MALFGSSPLVDAFPSPRFSEPPSPTKTETDLPIDVDQSFNSSLS
                     LSDSPYFSPTPSMAVGAKSAGSSSMLSAAPPSFSLKCKQPEAAPTQVKPPLQSKSTTE
                     TTLGSGQLSRGRSFGMDITNNVLHQPDSNIRNNKGKMLPPAVPEARMLKANASVPMQW
                     TSSNEELGECSKNSSLFGVPRTESDPAISGSPLSSLSRDDSAMQVDSPQIRSNSRPGS
                     LMASPALGGPASCSSSPDLGSFFCDSPAPSSQAPPAKRRSLVSGPPASPSSGSPSAKR
                     TSLGLGVSRPPLDKTASSSALLFGGGRANTVASRRGPSYKRPTLGPLAAPSCDASRTA
                     STNSAFPILYGPPKQTLGQSGTFPRAANAPMRRAYSVCDQNTANEMDDDDSEFENSPC
                     VGAHAEYARRYGARMGPRIDGSPGFKSVRASIAASGEGVVSPLHKGKKTSPYGPGGLP
                     GFGDNEIDGKILPCHKVKEDGLVRITPDTLDELLSGKYSHKIKRYHVLDCRFDYEYDG
                     GHIAGAINVKSMDALDKLLLSEADGIHADGECLPRPSRSGQLEDGQPVVLIFHCEFSA
                     KRAPTFAKHLRSRDRLLNNAIYPKIYYPEVYILEGGYCGFYQTRPERCDPKGYTPMDD
                     PKHFERRDSDLHDFRKFSRTRSFTYGEQQQPSSRALLPCPPLAFAAASAAAARRIGAQ
                     GGSTSGNNTIKEEDDQDNSSSPHPGDSSAEMDTDASPCPRAVLSLGQPPIFGSAKTRV
                     LGRVGFSRVASYAGTTTIPAPRP"
     gene            complement(253351..256659)
                     /locus_tag="CNC00880"
                     /db_xref="GeneID:3256708"
     mRNA            complement(join(253351..253660,253713..254149,
                     254203..254856,254907..255112,255279..255346,
                     255545..255894,255945..256015,256064..256172,
                     256233..256319,256372..256443,256493..256659))
                     /locus_tag="CNC00880"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537526|gb|CF683367.1,gi|41555447|gb|CF701288.1,
                     gi|41555455|gb|CF701296.1,gi|41572712|gb|CF718553.1"
                     /transcript_id="XM_569397.1"
                     /db_xref="GI:58264481"
                     /db_xref="GeneID:3256708"
     CDS             complement(join(253463..253660,253713..254149,
                     254203..254856,254907..255112,255279..255346,
                     255545..255894,255945..256015,256064..256172,
                     256233..256319,256372..256443,256493..256616))
                     /locus_tag="CNC00880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569397.1"
                     /db_xref="GI:58264482"
                     /db_xref="GeneID:3256708"
                     /translation="MTSRNPTVNMSSSKPIKPMVINSNVRNTSHSTVLGAKRKVDDVL
                     NSSSEGEGKENGATQKKKALDATLGQPLFELRNRKLLFKQALPSRNLPRRRILNFQGY
                     VLDEVEGGRTINEIPEEHWALIAMAGNEMSSANEGSFVKQLKAALGLEPAEQKSLPNE
                     VLTVISRKLFTLSHYGFFPSQFPNSVKIPSSLQIRCWEVNEPEKWFPSEELEALRARR
                     TERESLTEECFKLLQGMTDAQKIELVGGSKDQKDTPSKSASTAEKSALPKEIQIEADR
                     LKKKQRDEKKAIWAEKKAVSSSNQALSDYQKTFRPLPPKKYVKTAKVNEWIRIENGIN
                     HAAGDISGGKVEQWINEGSPDVEGWSSQDFIKDHLKKHGHQMRHPRRNLPRGFKVAPI
                     DGSVGELWAALQVAEEPREVLDQLRDRRRFPWKTLAFDQQPRPPYSGTFTKKSLVVGP
                     RTPFAQDPIFDYSYDSGDEWQDDDEGEDVDNFGGEKNLEEEEEDEDEEDEGEFDDWLD
                     DSEDVEATQPDSMDVDDAPEPEKLSRNVKKLKEQPIKRIVKLVPNWKGPIWENRIGEK
                     GTEGLESYRIQLLNDTPVSLNPFTFESTDTPQQYKANYSTTVIGHNLNVRCLLSVETI
                     VQKEQPGPITKLSPVTAAAMSSPVPRSELPRRVRSAFPSSHIPELYRLIEGDNRYLKD
                     MITFLREKFDGVATKVSIENELKESAVREGRSKDSVWRVYREAWIAAGLEPAVSAPSR
                     PPTAPSTTAALSLNPKSTVNQPTNLPSPLDQSLQTSPVQDGSAAEPTVVDS"
     misc_feature    254438..254480
                     /note="CT-rich"
     gene            257888..260275
                     /locus_tag="CNC00890"
                     /db_xref="GeneID:3256152"
     mRNA            join(257888..258412,258550..258653,258709..260275)
                     /locus_tag="CNC00890"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531973|gb|CF677814.1,gi|41531977|gb|CF677818.1,
                     gi|41532786|gb|CF678627.1,gi|41532790|gb|CF678631.1,
                     gi|41542924|gb|CF688765.1,gi|41542931|gb|CF688772.1,
                     gi|41560264|gb|CF706105.1,gi|41560277|gb|CF706118.1,
                     gi|41560706|gb|CF706547.1,gi|41560714|gb|CF706555.1,
                     gi|41563702|gb|CF709543.1,gi|41563709|gb|CF709550.1"
                     /transcript_id="XM_569399.1"
                     /db_xref="GI:58264485"
                     /db_xref="GeneID:3256152"
     CDS             join(258601..258653,258709..260086)
                     /locus_tag="CNC00890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569399.1"
                     /db_xref="GI:58264486"
                     /db_xref="GeneID:3256152"
                     /translation="MFEEDFERCFICQGPSKGLYCSSMCRQKDQGSFSPQVNPDQESV
                     HITSQLPPALSPHVRPMNTISLSPRNSGQPRATSNGTSSGSSSVNSSPLHSPQTNPSD
                     LDSPQKGLFNLPPPAYPVTQFGAPPSAVPMKIPPLLPRASPIFGAIGTPGSQGSTVYP
                     HGASIDTLRFGRRPGAVNSVTSPNALIPRCACGLPANHRTRARSKDRADVVDSGFSRL
                     SLGPSVVAREEPISRSLRIVSDSAIPPFTLSPKGTPQTITATLNHSGPFHTEQCSPVA
                     PNNVLSRSRSDPIPPSPKVGKRTLAPVPVVSTILPIRRQSSHEPERRTNVLEVSNIDS
                     PRRGRSRERQEHHGDAEDCPPAILNHPPEREAAPSRSRTRRDSRRRSGERSRSRPRER
                     IRDLDMSRDREHDGQRSPVSHEGPQILPSWSRPASVADHVVPLSMKGQSSGDKEKYAR
                     DEDERKREELRRATNQFGQVFGVAAG"
     gene            <260901..>267108
                     /locus_tag="CNC00900"
                     /db_xref="GeneID:3256654"
     mRNA            join(<260901..260986,261185..261584,261645..262082,
                     262133..262865,262918..263001,263057..263303,
                     263360..263460,263511..263560,263613..263684,
                     263735..263974,264026..264350,264400..264494,
                     264545..264810,264864..265236,265297..265389,
                     265442..265504,265559..265708,265791..265792,
                     265847..266003,266057..266107,266154..266492,
                     266543..266800,266860..>267108)
                     /locus_tag="CNC00900"
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41552407|gb|CF698248.1"
                     /transcript_id="XM_569401.1"
                     /db_xref="GI:58264489"
                     /db_xref="GeneID:3256654"
     CDS             join(260901..260986,261185..261584,261645..262082,
                     262133..262865,262918..263001,263057..263303,
                     263360..263460,263511..263560,263613..263684,
                     263735..263974,264026..264350,264400..264494,
                     264545..264810,264864..265236,265297..265389,
                     265442..265504,265559..265708,265791..265792,
                     265847..266003,266057..266107,266154..266492,
                     266543..266800,266860..267108)
                     /locus_tag="CNC00900"
                     /codon_start=1
                     /product="ATP-binding cassette (ABC) transporter"
                     /protein_id="XP_569401.1"
                     /db_xref="GI:58264490"
                     /db_xref="GeneID:3256654"
                     /translation="MVVQDLAQSVFSSVSESLVEVAKNKNKNPQSYQPLLINDEELDV
                     ETEAVEVTPIPPSMPSGGLLADFKAHVRSMKEFGSVLFGLEILRTLCLCALLGLSIYA
                     TILAESPEEHQTVYEDGTVEDMAKQWGRKKNKKKKGKHSKSTVDDYSSLEWGEFGVSG
                     FYLYTLIFSLLLLTLRPATRLRRHIITHLDSLLLLAFAVYAYRDIWPLFTFNLDPADI
                     NTPVTWARVAILTVSAVLIPLVRPRTYVPVDPENPSPPGEIHPEQTSPLLFYMFFEYM
                     TGLVWKAWKTPALPYEDLHPLADYDRAEYLYKQHMDKLDPVRRKEKGLKPRNLVLSLA
                     SVFKKEIVMVSLMSALSAIFELSGSVGINQLLDYLEKDGKGHSLRPIVWIIFLFLGPT
                     FGSLTMQFYIFTTTRSLVRSEALLTQLLFDHALRLRMKDQVDDDREKEVDSMTNGEGS
                     APLITVEDVEEVIDHAPGAPGEFHDRFDNETEEESTAQGNGKRKSAPQSTDATEVGSA
                     NGSNKDAAVDRKAAADEEARKSKGQGLAGKINVLMAADIESVIEGRDLALIFVYTPVQ
                     FVLCVVLLYRILSWSSLIGMLTMFITLPLPGLLTKLNAQFQQKRMLATDSRIDTITES
                     INALRIIKMFGWEDRIKERVAAKREEELTLIWQRRLMNLFTTLLNTVLPVLTMTVTFA
                     VYTTIQKQQLTAAKVFTSMTVFELVKGQLGMCFYLINSVVTAWVSVRRLDKFLHESEM
                     IDEYSEGKLATIKPPEQLEAEQEGLIRIHNATFTWGSELYTSTEIPFRLSIEDTTFKK
                     GKINLITGPTGSGKSSFLKALIGELHFEQKQGAFYHLPREDGVSYAAQESWCTSDSVR
                     DNILFGEPFEESRYWKVISACGLEPDLKLFDDGDLTEVGEKGITLSGGQKARLTLARA
                     IYSKTAVVLLDDIFSALDTLTSRWIIDNLLSGDLVKDRTILLITHHIHLAAPVADFII
                     TLNEDGSVRSQGSIKEGTLDASELQEAEEAEEQELKEAKQGEKKVEEKPTTKLIQAEE
                     KSEGRISRKALFAFFRTFGGPIFWFLYFGLLVGGQAMSSFETYWLGRWARAYDQAEDP
                     RKVSVTFYLGLYFVFVLIGLVQLAASAIIFYMGAVKASREVHKRLVNTIFGAYMRFLD
                     STPVGRIISRFTKDMKSVDGSFTETFANVADVTVGLALKIIVVISLVPLFSLPAVFIG
                     CLGGILGEMYIHGQLSVKREMSNAKSPLFSHFSAAFNGIVSIRAYGAQQKVRKEAQRR
                     ADKYTRAATAFYNLNRWVTIRLDMLGGLFAASLAAFLVYGPRLDASTSGFALSQAISF
                     SSMILWWVRMVNEMEVQGNSVERIQDYLVIPQEPAFEESKQPPAAWPTSGEIVLDHLS
                     AKYSNDGPLVLDNLNLTIKSGEKVGIVGRTGSGKSTLALALLRMLPTTGKVLIDGVDT
                     GKINLHALRSNVTIIPQDPILLSGSLRFNLDPFGEHDDYELNDALQQSGLGATRQPGG
                     IGAATPQRLTLDTHISAGGGNLSQGQRQLVALARALVRNSKVLILDEATASVDFDTDT
                     LIQKSIRDLPSSCTVLTVAHRLSTIMDYDRVLVLGAGKVLEFDAPETLKKNSDSYFGK
                     LCQAMEGKSSDER"
     gene            267831..269575
                     /locus_tag="CNC00910"
                     /db_xref="GeneID:3256638"
     mRNA            join(267831..268632,268688..268768,268829..268923,
                     268973..269191,269241..269575)
                     /locus_tag="CNC00910"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545089|gb|CF690930.1,gi|41545100|gb|CF690941.1,
                     gi|41574433|gb|CF720274.1"
                     /transcript_id="XM_569403.1"
                     /db_xref="GI:58264493"
                     /db_xref="GeneID:3256638"
     mRNA            join(267886..268240,268615..268632,268688..268768,
                     268829..268923,268973..269191,269241..269575)
                     /locus_tag="CNC00910"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41574437|gb|CF720278.1"
                     /transcript_id="XM_569404.1"
                     /db_xref="GI:58264495"
                     /db_xref="GeneID:3256638"
     CDS             join(268223..268240,268615..268632,268688..268768,
                     268829..268923,268973..269191,269241..269379)
                     /locus_tag="CNC00910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569404.1"
                     /db_xref="GI:58264496"
                     /db_xref="GeneID:3256638"
                     /translation="MNPHKMNKVDISQMNEQDQKAFKLYGKVPGKNLLTKMQKERKYF
                     DSGDYMMSKAGVPTASPPGTAHPTPEAVPHASPPSGPGGYLSSSPTGGSLPSPNIMEH
                     GIGGEKCAHNVGVGISPAATSEAIEMPGHGHHHGHQRRGSESRISPPNTWRESVNPSS
                     FPIHHPGIFGGSPVKASSLAKRVDEEGEQ"
     CDS             join(268591..268632,268688..268768,268829..268923,
                     268973..269191,269241..269379)
                     /locus_tag="CNC00910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569403.1"
                     /db_xref="GI:58264494"
                     /db_xref="GeneID:3256638"
                     /translation="MVVFPVIQNKVDISQMNEQDQKAFKLYGKVPGKNLLTKMQKERK
                     YFDSGDYMMSKAGVPTASPPGTAHPTPEAVPHASPPSGPGGYLSSSPTGGSLPSPNIM
                     EHGIGGEKCAHNVGVGISPAATSEAIEMPGHGHHHGHQRRGSESRISPPNTWRESVNP
                     SSFPIHHPGIFGGSPVKASSLAKRVDEEGEQ"
     gene            complement(269864..272073)
                     /locus_tag="CNC00920"
                     /db_xref="GeneID:3256603"
     mRNA            complement(join(269864..270269,270327..270483,
                     270538..270960,271012..271323,271373..271446,
                     271500..271631,271695..271727,271796..272073))
                     /locus_tag="CNC00920"
                     /product="glutamate dehydrogenase (NADP+), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530411|gb|CF676252.1,gi|41530414|gb|CF676255.1,
                     gi|41530849|gb|CF676690.1,gi|41530859|gb|CF676700.1,
                     gi|41531670|gb|CF677511.1,gi|41531678|gb|CF677519.1,
                     gi|41532298|gb|CF678139.1,gi|41532307|gb|CF678148.1,
                     gi|41533224|gb|CF679065.1,gi|41533235|gb|CF679076.1,
                     gi|41534690|gb|CF680531.1,gi|41534707|gb|CF680548.1,
                     gi|41535051|gb|CF680892.1,gi|41536152|gb|CF681993.1,
                     gi|41536160|gb|CF682001.1,gi|41536168|gb|CF682009.1,
                     gi|41536177|gb|CF682018.1,gi|41536636|gb|CF682477.1,
                     gi|41537120|gb|CF682961.1,gi|41537346|gb|CF683187.1,
                     gi|41537357|gb|CF683198.1,gi|41539218|gb|CF685059.1,
                     gi|41539226|gb|CF685067.1,gi|41540643|gb|CF686484.1,
                     gi|41540658|gb|CF686499.1,gi|41540923|gb|CF686764.1,
                     gi|41540931|gb|CF686772.1,gi|41541201|gb|CF687042.1,
                     gi|41541207|gb|CF687048.1,gi|41541392|gb|CF687233.1,
                     gi|41541403|gb|CF687244.1,gi|41541427|gb|CF687268.1,
                     gi|41541434|gb|CF687275.1,gi|41543854|gb|CF689695.1,
                     gi|41543866|gb|CF689707.1,gi|41543918|gb|CF689759.1,
                     gi|41543923|gb|CF689764.1,gi|41544325|gb|CF690166.1,
                     gi|415"
                     /transcript_id="XM_569406.1"
                     /db_xref="GI:58264499"
                     /db_xref="GeneID:3256603"
     CDS             complement(join(270081..270269,270327..270483,
                     270538..270960,271012..271323,271373..271446,
                     271500..271631,271695..271727,271796..271831))
                     /locus_tag="CNC00920"
                     /codon_start=1
                     /product="glutamate dehydrogenase (NADP+)"
                     /protein_id="XP_569406.1"
                     /db_xref="GI:58264500"
                     /db_xref="GeneID:3256603"
                     /translation="MSNYPSEPEFQQAVAEITQTLEPFLAKNPEYRRALDVVQVPERI
                     VQFRVTWERDDGTIAINRGYRVQFNSALGPYKGGLRLHPTVNLSILKFLGFEQIFKNA
                     LTGLMMGGGKGGSDFDPKGKTDSEIRRFCYAFMQELSRHIGTDTDVPAGDIGTGGREI
                     GFMFGAYKKYRNENAGILTGKGADWGGSHIRPEATGYGLVYYVTEMLRDLDNTDWKGK
                     RVLISGAGNVAQYAALKVIELGGTVLSLSDSTGALVATGDEGFTPEEIMNIADIKLQR
                     KSLTAFATGSKFQWHEGKRPWTLVSNADIALPSASQNELNDEEAKALIKAGVRYVAEG
                     SNMGCTLDAIKIFEESRTAAKNATDAGVCFYAPGKAANCGGVAVSGLEMAQNSQRLKW
                     THEEVDAKLKAIMINCYQTCWETGKQYAEAGVVPSLVAGANIAGFVKVANAMREQGDW
                     W"
     gene            272703..272784
                     /locus_tag="CNC00930"
                     /db_xref="GeneID:3256741"
     tRNA            272703..272784
                     /locus_tag="CNC00930"
                     /product="tRNA-Gln"
                     /codon_recognized="CAA"
                     /db_xref="GeneID:3256741"
     gene            complement(<274922..>280619)
                     /locus_tag="CNC00940"
                     /db_xref="GeneID:3256548"
     mRNA            complement(join(<274922..275621,275669..276131,
                     276180..276308,276356..276815,276865..277196,
                     277247..278899,278948..279676,279728..280085,
                     280137..>280619))
                     /locus_tag="CNC00940"
                     /product="vacuolar membrane protein, putative"
                     /transcript_id="XM_569408.1"
                     /db_xref="GI:58264503"
                     /db_xref="GeneID:3256548"
     CDS             complement(join(274922..275621,275669..276131,
                     276180..276308,276356..276815,276865..277196,
                     277247..278899,278948..279676,279728..280085,
                     280137..280619))
                     /locus_tag="CNC00940"
                     /codon_start=1
                     /product="vacuolar membrane protein"
                     /protein_id="XP_569408.1"
                     /db_xref="GI:58264504"
                     /db_xref="GeneID:3256548"
                     /translation="MEGGVLDLSLLNKDRDNVALLLYTYKPLLNNTGASANPAHPSLL
                     PSAAASPNAPSSQVIINYAALPWNVQPGDYLEIRQINRTQPKVPTASTRIQGMEGEKP
                     QKIKRPPALEDVKTGKGREGYVFRLGEDSPTANIHQIQVPDSVATAFGFQNRLEVEVR
                     RIHDKESSHADYIEFYFSQYLGRADMWRLGMSLEGTTLHVGEKVSLAGGAVRAEVNFI
                     IRDEKSKDGIAKPKRYSSGIVTAKTKTIFRSKSAQVYLFIQLCEETWQFDEDGERYVE
                     KVVHGYLPELFARWADKGTSHVVTIIFFARIFYRDDEVDYLRKHDMVDMLSQDYSGQW
                     YKDFFKVAVDLERRNDWMSSLPEIKRQLERSEREILLDYHLRLLKAKGAAEEEIKIVG
                     KWCFAYQGNVLEAINLALNPFDEHYVDRDLSRTGLSITVVTPGTGHFAVDKNLLRLTT
                     ERMVDHGMSVDFVCLTKMPLHSVPLFSYVSHRPKGPVQHEDGIGAKAKPVVPDLLYFD
                     ANLSQVKDIELADCYSLPSWVSTSFYAVTHDKPFREDRFVARCKMYDIQMLGILDHNL
                     TTVTVPLLNVDDTPMPRRPLTVDDRKAIRDSFDQSIFSGISDLVKTGSSPLDSAPASV
                     TASYQSARLLAEKAKERTSSMSLSKPRGSDIANSSRLSPIKATSESDNIDLGKKTTPR
                     SPSPEPSSLSLRRGSRRSLSPTKMTQLAHTSAVTNELNKDSPSLLKNSRPGSPITMAR
                     SISPVPPLPPTREQGDSPLSPVDSLPLSASVERSPSPSRRSVRSNMTDREHLGSGAST
                     PKGTPAKSLRSQPSKGFIPSWVLNSFKPLLSTSKPSFAVPAMENVARTDVATGDDNRP
                     SSPSPSVGSLRGRPSKGGPNPKPIITPSTPSPSRSQKPPFKPAKIIQTQPHTQAQGTQ
                     PLPIAAPPASRLPSQSEEDAISRSFRNKGHGLSRSHEDSSLRAQSNALVQSSRHFTIN
                     PCKPSAETIDRVRDAGGRRWRFVLPKLTQQHIVQWPSLIAPACLPLTTDFLPDQKQSD
                     ELYTTGTYTVQCYLEDDQFLIRSDAAETNLALAMMREMVSQRLSQNFQVIVQPHELTE
                     PEKPRPMPIHLEKDADIGVELVSGGASEVLKKGQGAIWLSWANHIHRLLFHPTKPEIV
                     VHWMTRKITHQTESVQWKGLVWPSGMKGYQKASATFAYPDVSMKINYNHLDHLINGER
                     IDFAPLRYWRTRFILIPSGREPVTFPGLMPKNENLGSNDLLWLGAQKVMETLNRYLLK
                     RPEGTPQQRSLKIVATTFDPSTCVLDEELMMDLARQIHGDSSGDKKKKLEGMTLANVA
                     ELMCQPDNGLVIRTRWWESRQHVSSFNGFELREWLQNTFEDVTGREKAQEWAAELTNK
                     GLIEHVTKSHGFLDYWHLYYRLREPYNHMYSHLAKKEGKNKSWFSTSSKGSRAAPPSL
                     TSSQASSSTVIAAAVADPSQATADLNTSQSGKDPSAGEQDQSSLAKIYLKVHKGEPKQ
                     GGKKRKIMMTQKRVLDLDPSRKSDRAEVAILHADVVHNARNAFHFELNWLGVTAALLE
                     ELRQKLSAQSERYGLRFVETPVEQIADIPKKCAYRTPIPIRLALAPPVIPDLHTRLVA
                     VAHGTGQAENYFEYSILTKKFGFVLDVEATDRYPDNVEVVYSYRKAGVKYTYSQFCHK
                     TGLALVQCVGGEAGFLWSDNRLVVSAPTRKGVGNRVDEARALRKELEDFCSDAEQLSK
                     FYEEVLPPPPTTGESTPEEGQEEFEAKDDEEEQPAPQEKTEL"
     gene            281578..286424
                     /locus_tag="CNC00950"
                     /db_xref="GeneID:3256411"
     mRNA            join(281578..281983,282032..282913,282966..283310,
                     283366..283590,283644..283820,283874..286424)
                     /locus_tag="CNC00950"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530059|gb|CF675900.1,gi|41530072|gb|CF675913.1,
                     gi|41552588|gb|CF698429.1,gi|41556657|gb|CF702498.1,
                     gi|41556668|gb|CF702509.1,gi|41557938|gb|CF703779.1,
                     gi|41557943|gb|CF703784.1,gi|41562003|gb|CF707844.1,
                     gi|41562020|gb|CF707861.1"
                     /transcript_id="XM_569410.1"
                     /db_xref="GI:58264507"
                     /db_xref="GeneID:3256411"
     CDS             join(281720..281983,282032..282913,282966..283310,
                     283366..283590,283644..283820,283874..286315)
                     /locus_tag="CNC00950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569410.1"
                     /db_xref="GI:58264508"
                     /db_xref="GeneID:3256411"
                     /translation="MSFVSSETPNAIASSSTAHAGSANSRARHRLDNGLRYHSNHLSS
                     DCRPLPRSAPRKQRVASKSKKLRWRKGLVTEAFRKFGEHCARNQIRTLLIDCLVMTNL
                     FYPSLALYLPKRFPPPSPRAVQDAHWPPLDNDVTSPYRTNVDHPLSFSTLGRLFPSAP
                     PLLPRLTWAGWWGSGTREREDDGWTATRAIPGAKEIGEGQNDQVWVMRIGWADVEDVL
                     DRHIEDGERKWEERDHHLLKLVQNVAENWERQIPSNRQRCVRQLKSSTSVRGDGVDSE
                     PPPCYVLTPSPDAFDSAIPISMSGFVHFDHGVSASPDSVPLGRSPNPDNIYHTFAALF
                     HVPQNSTSAFEQRWQSAMSDVAKEVEGEVFVEAKGPRVGDQIGEWFISYASSPLSQQP
                     NLTGPISSDRSKIFSSSPPPIIIVLYVILFTTLIVQLSNASKAHSRFGLAFTGVVQLC
                     CSSVMSFSILALLGWNGWGVPHAESSLPTYVLPFVIVVVGAENMSTLTQAIFSIPFTH
                     SVPVRIGLGLSKVGTTIALTSLTDLGILSVVWLCVNLQPVREFCLFAAVVIVTDWFML
                     HTFFLTVLSIDAQRLELADVLASNKVGMVSPVESTGEKDAQNENQGFLWRNMLRARTT
                     KSGSLLLLLFTVGLLYWLTERHRSPLNTTASLYGYTPTARSTSVSVPTPTASPFVSTP
                     EAISVLSSAEKLWRALNPEGWPFAHVIVPPASILVLPKFGHSMRPGDIRKLSLPASRL
                     LIPRLKALFYIFKVLVLPQAITAGALYALLLYLLKDADLLDAQRNRLGRMGDAHEDES
                     DFRGSTKNASGLLNCLRARMLPCSHEADVDVIASSSDGRIAISVAIDNSVCLWRFLDT
                     PGSGTREPLPTGGLDGGDAIVAAAVSEDGQHVAVCTNMAVVQIWEVPREGAVVPLQVR
                     KPEQTFTAKILGIAFDETAPNVDDPFTANEPATEEARKATSIMIGYGDGSVMALTEMD
                     AKVVIPAQDRGAYSSCRVLFMREIGGSVSILIARQHDIDIWRKSTFGWVSSSLIADLP
                     GEDRVTALSPLNAELPGVFAVGRRSGNITIYDESHGQLELMPQGSSIEGVRKIQLVRP
                     SSMKCLGCGLQSAEGYAIISSTSSQVSIDRIAPRTSIPTFCRCTRRVSSADDVPALMH
                     RSDSPQRSKPNSLIVPPVTFRQRPTPGSSPHKSISLLSPVSNGEFPLSSHGSARRSSN
                     FHREDDSLKIISSPHDRSALSSIGGGSGLVSPSGDMEVTSLGGISAQGASDGGWAILD
                     GDVLVGVRRGREGIDDAQWQVWSVDMTAPWDMAGLVVDSIDLSELQRRTFEADCTIRG
                     QASGGGSTNGVVSMRDRRTERLLSLNGRASFPERVGSFAVPTYESLGYVEVVGLNILG
                     TKGMIGGFGNRLGTISLERFEEKKVIGRSSMDGQLGMGLGGLTPTRRQSLFPLTPPPP
                     CDGSIGRF"
     gene            complement(286488..287785)
                     /locus_tag="CNC00960"
                     /db_xref="GeneID:3256554"
     mRNA            complement(join(286488..286733,286793..286910,
                     286963..287077,287136..287227,287288..287373,
                     287562..287785))
                     /locus_tag="CNC00960"
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /transcript_id="XM_569412.1"
                     /db_xref="GI:58264511"
                     /db_xref="GeneID:3256554"
     CDS             complement(join(286660..286733,286793..286910,
                     286963..287077,287136..287227,287288..287373,
                     287562..287739))
                     /locus_tag="CNC00960"
                     /codon_start=1
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /protein_id="XP_569412.1"
                     /db_xref="GI:58264512"
                     /db_xref="GeneID:3256554"
                     /translation="MSGWMSYFTGRKDTRESARDAIVGLRQQLLMLEKKEEFLQKKIE
                     EEMKKAKANATGNKRLAMAALRQKKAHENELDRIAGTRLTLETQVNAIESANLNAETM
                     VAMKKGADALKGIHSNLTAEGVDATMDKIREQMDLTNDISDAISNPVGMGIVLDEDDL
                     KEELEALEQEQLDDRLAGADRVPSHLPASPVGQTTGRAAVEEDEDDEEAQLRKLQAEL
                     AM"
     gene            complement(<288224..>289428)
                     /locus_tag="CNC00970"
                     /db_xref="GeneID:3256254"
     mRNA            complement(join(<288224..288599,288654..288826,
                     288882..289009,289062..289226,289305..>289428))
                     /locus_tag="CNC00970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569414.1"
                     /db_xref="GI:58264515"
                     /db_xref="GeneID:3256254"
     CDS             complement(join(288224..288599,288654..288826,
                     288882..289009,289062..289226,289305..289428))
                     /locus_tag="CNC00970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569414.1"
                     /db_xref="GI:58264516"
                     /db_xref="GeneID:3256254"
                     /translation="MSIPLPDTSSVPSHALDALQEDALLPICKTCGTQYPSPRDDCPI
                     CEDPRQWVPASGQAWTSLADLGSKSKHSLLPDKEDVRISHIVTEPAFAIGQTPFLIET
                     AGGSYIWECSAFLSLGLIGHLSELKKPLKAMAISHPHFFSSSLTWSRALNIPLYICAA
                     DKEWYSRIGDLKDSDDVRLWSRETELGPGVKLVQCGGHFPGSCVFYWDRLSEPPPSPS
                     NLPTKPTPVSGIIFTSDTLMVQPNQTHFTFAWSIPNMIPMRPKAVLRIKESLKGVEYS
                     QATSSWPERWIREDAKKALEESVVRYLGAEGWRFEGDSLFELVTQ"
     gene            289980..290634
                     /locus_tag="CNC00980"
                     /db_xref="GeneID:3256362"
     mRNA            join(289980..290156,290212..290244,290307..290315,
                     290387..290634)
                     /locus_tag="CNC00980"
                     /product="expressed protein"
                     /transcript_id="XM_569416.1"
                     /db_xref="GI:58264519"
                     /db_xref="GeneID:3256362"
     CDS             join(290039..290156,290212..290244,290307..290315,
                     290387..290568)
                     /locus_tag="CNC00980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569416.1"
                     /db_xref="GI:58264520"
                     /db_xref="GeneID:3256362"
                     /translation="MSASNTDAYSAGTSGVDQKGNTYVAGSKADGSAGANAAQTAGDK
                     VKGGWNVFHGTGEGIRGNINSFVDNIGEQIAGRDPAAAPQRSTAGGERPAEVTSKGAD
                     EFRTGVQQLRH"
     gene            complement(290756..292071)
                     /locus_tag="CNC00990"
                     /db_xref="GeneID:3256631"
     mRNA            complement(join(290756..290886,290940..291396,
                     291526..291653,291717..291736,291795..291837,
                     291995..292071))
                     /locus_tag="CNC00990"
                     /product="ATP synthase, putative"
                     /transcript_id="XM_569417.1"
                     /db_xref="GI:58264521"
                     /db_xref="GeneID:3256631"
     CDS             complement(join(290861..290886,290940..291396,
                     291526..291653,291717..291736,291795..291837,
                     291995..292034))
                     /locus_tag="CNC00990"
                     /codon_start=1
                     /product="ATP synthase"
                     /protein_id="XP_569417.1"
                     /db_xref="GI:58264522"
                     /db_xref="GeneID:3256631"
                     /translation="MASRFAIKSLRSAAIRPAIAPRAVVAQSARFLATQPTPDEKAAS
                     IINSVPSSSLFTKTGGVILGTGLTAAAVSSELYVANEETVLLVGFLVIATVIGKSVSA
                     PYAEWANGQIEKVKSILNSAREEHTRAVTDRIDSVGQLKEVVPLTESLYAVAKETNKL
                     EHENFILAQENAVKAELKSVLDSWVRYEQQQREAEQIALVKTVQANVEAELAKPAFKK
                     QLLEEALAQVEQIAKSKAI"
     gene            292119..293842
                     /locus_tag="CNC01000"
                     /db_xref="GeneID:3256511"
     mRNA            join(292119..292414,292462..292650,292697..292885,
                     292931..293842)
                     /locus_tag="CNC01000"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531123|gb|CF676964.1,gi|41531131|gb|CF676972.1,
                     gi|41532146|gb|CF677987.1,gi|41533511|gb|CF679352.1,
                     gi|41533521|gb|CF679362.1,gi|41535335|gb|CF681176.1,
                     gi|41535344|gb|CF681185.1,gi|41535947|gb|CF681788.1,
                     gi|41535956|gb|CF681797.1,gi|41541503|gb|CF687344.1,
                     gi|41541515|gb|CF687356.1,gi|41550129|gb|CF695970.1,
                     gi|41550137|gb|CF695978.1,gi|41550330|gb|CF696171.1,
                     gi|41550341|gb|CF696182.1,gi|41554605|gb|CF700446.1,
                     gi|41554610|gb|CF700451.1,gi|41561750|gb|CF707591.1,
                     gi|41561759|gb|CF707600.1,gi|41567616|gb|CF713457.1,
                     gi|41567621|gb|CF713462.1,gi|41568302|gb|CF714143.1,
                     gi|41568308|gb|CF714149.1"
                     /transcript_id="XM_569419.1"
                     /db_xref="GI:58264525"
                     /db_xref="GeneID:3256511"
     CDS             join(292247..292414,292462..292650,292697..292885,
                     292931..293824)
                     /locus_tag="CNC01000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569419.1"
                     /db_xref="GI:58264526"
                     /db_xref="GeneID:3256511"
                     /translation="MSDSESAADLFGDEGRSRNNSPGYEKSPSPQLSHKSDDEEQDDE
                     EQDDEEQDVGDLFGDDAEEDEAQIGRRSTDTPASGSRSPHPLEYVEEDEEAVPQKQNV
                     VTLPIPQWPHMTATDGKVWQMKFPAYVNLDPKPFDPDLYRATQEEEPIDGAADPIAAK
                     SMMIGVKNTIRWRWVTGPDGEPVRQSNARMLRWSDGSVTLQLGDDFYDVAPSQGATLA
                     RPSDPQPVRKRDDKPATNSSTTFLCVGAAAERVLVTERPIAGQLSLLPTSMTSKTYLE
                     LVKHVGKQHTKHSKMKMLEETQDEEALQALLLKSAPNREAIKGAKSTVRRTSSKTGLG
                     KGKKTRKIGYSDSESDAGFSPDERRPRKKPERESVEYDDDDGFIVSDSDEDDYASKKK
                     KAKGKNKKRKGFTDDEESLDEMEEAERRIEERERERKRARKDKGGPSKKSREYVDTED
                     EEDEKKVDDDDAEGEEEMDMDMDVESEED"
     gene            294982..295691
                     /locus_tag="CNC01010"
                     /db_xref="GeneID:3256357"
     mRNA            join(294982..295087,295142..295192,295251..295281,
                     295462..295691)
                     /locus_tag="CNC01010"
                     /product="cation transport-related protein, putative"
                     /transcript_id="XM_569421.1"
                     /db_xref="GI:58264529"
                     /db_xref="GeneID:3256357"
     CDS             join(295034..295087,295142..295192,295251..295281,
                     295462..295499)
                     /locus_tag="CNC01010"
                     /codon_start=1
                     /product="cation transport-related protein"
                     /protein_id="XP_569421.1"
                     /db_xref="GI:58264530"
                     /db_xref="GeneID:3256357"
                     /translation="MAFTCSDIFKIILAIILPPLGVFLERGCGADLLINILLTILGYI
                     PGIIHALYIILKY"
     gene            296457..296538
                     /locus_tag="CNC01020"
                     /db_xref="GeneID:3256742"
     tRNA            296457..296538
                     /locus_tag="CNC01020"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:3256742"
     gene            <296763..>297327
                     /locus_tag="CNC01030"
                     /db_xref="GeneID:3256415"
     mRNA            join(<296763..297078,297139..297220,297273..>297327)
                     /locus_tag="CNC01030"
                     /product="ribosomal protein YmL32 precursor, putative"
                     /transcript_id="XM_569422.1"
                     /db_xref="GI:58264531"
                     /db_xref="GeneID:3256415"
     CDS             join(296763..297078,297139..297220,297273..297327)
                     /locus_tag="CNC01030"
                     /codon_start=1
                     /product="ribosomal protein YmL32 precursor"
                     /protein_id="XP_569422.1"
                     /db_xref="GI:58264532"
                     /db_xref="GeneID:3256415"
                     /translation="MAALQLTNRSLNTPFFSLRSFLPTLRSSWSTPCEASSSSSTLSS
                     SLVAHAPSTSSPSLSSLFPSFSLESLLELIPPFLWASVPKKKVSHSRKNMRAANKGLK
                     NKTNLSLCPACGSIKLTHHVCPTCYSQISRRWKEEARNQLPSALHSHP"
     gene            complement(297399..300625)
                     /locus_tag="CNC01040"
                     /db_xref="GeneID:3256194"
     mRNA            complement(join(297399..297557,297616..297696,
                     297743..298728,298776..299939,299989..300625))
                     /locus_tag="CNC01040"
                     /product="chromatin modification-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544683|gb|CF690524.1,gi|41544693|gb|CF690534.1,
                     gi|41567834|gb|CF713675.1"
                     /transcript_id="XM_569964.1"
                     /db_xref="GI:58265615"
                     /db_xref="GeneID:3256194"
     CDS             complement(join(297465..297557,297616..297696,
                     297743..298728,298776..299939,299989..300622))
                     /locus_tag="CNC01040"
                     /codon_start=1
                     /product="chromatin modification-related protein"
                     /protein_id="XP_569964.1"
                     /db_xref="GI:58265616"
                     /db_xref="GeneID:3256194"
                     /translation="MRHVRAMERIEAKKAENRWSLRQPKKARGPGVPKSHWDYMLEEM
                     EWMRTDFAEERRWKVVEAREFAYQVVEWHLASPEEKKALMVGGRGWGECRNVPIPGHA
                     GKRKEVTVEVEAEDEDVEMLVGQEGELDGEGEANKVLESIDEMRVNEKERENRPEDPR
                     ETVNINQDIGEEVDAEGEADADGEPENGEADAEGEADADGGPVGDDVVGLSEIDAAQD
                     DTRETSERPSYRRDTVLPNGLVIHKRFANAYEIAIARGPVLDTPLANATVDLDTLTKS
                     SSAATPATVPAEPSVSPDEPASFDQLFPDLAMYSGPAPPENDKKYRRDEGGTYSHRMA
                     HTSRIMDIRPILVSTLQPAKNLIDGEWDLHDGPYYEEVKGAADIPPNVVAAFNTPFGG
                     KASRPLEHMRVPEVPKPAAHHLRAQLLWSPEEDKCLLKLVAMYPFNWDLIADSFNTEM
                     ILIPVEKRNPYECWERWYYTFGEGKNKPRQDAPPSAPPPAPASATQPGTATATPVPQS
                     AVTTPGVPPSANLPSASGRPQQTGGNSVSSLPTPTGEALPDGAPPPPGMSKRDRMAAK
                     PKYEGTKRSVRHQAIYDAVKRMNRRREAARAKSHKDNAQRKVINVHESHSMSFPHVAA
                     STPWELVEAKYQRDVQIAQQRQQRAMQEQQRQLAIRQQQAMMSAQQQAQMRPPNMPNV
                     PNMPNAQPIRMGPNGQPMPTMAPSQQQLLNAVAAATAANRQNANGAVQGNPNVRPMPV
                     VQGQSPQVQQQMLLQAQQMAAQQARVLQAQAQAQAQQGRAPSMGGNLQPPQLGVSSPF
                     AQSRTPDLPAEGAGPSGINPTPSPAMQAAAIGAQSSPQIATMGRAPSNNVPPHLRVPN
                     AGTSSPQISSPMALPQGIPNGAGMPVQGAQTQGIQIPAAMMNNATVQQLLATLAASGQ
                     QMTPEQLRGLMLRSAHMQAQAQSQVGNPGTPQMGVQNIQGVQHFARSPSLQNAQSQPR
                     SSPKPGPANGQGT"
     gene            <301999..>302993
                     /locus_tag="CNC01050"
                     /db_xref="GeneID:3256751"
     mRNA            join(<301999..302284,302338..302469,302529..302658,
                     302718..302848,302899..>302993)
                     /locus_tag="CNC01050"
                     /product="protein-S-isoprenylcysteine O-methyltransferase,
                     putative"
                     /transcript_id="XM_569424.1"
                     /db_xref="GI:58264535"
                     /db_xref="GeneID:3256751"
     CDS             join(301999..302284,302338..302469,302529..302658,
                     302718..302848,302899..302993)
                     /locus_tag="CNC01050"
                     /codon_start=1
                     /product="protein-S-isoprenylcysteine O-methyltransferase,
                     putative"
                     /protein_id="XP_569424.1"
                     /db_xref="GI:58264536"
                     /db_xref="GeneID:3256751"
                     /translation="MSDQTSQSPVSLPRTDQYDPRGSIPNTVFAVALIASILGAVGGS
                     SLALASQTLFNAFAGTWARPQLGIYLGAMCIFHLMEFFTTAGWNPQKLSVDAFLLNNG
                     RQYHFAHAIGLAEYFISSWLFPGKWNTFWGSFPWLTLVTLGMVAAQCIRSMAMIQAAQ
                     SFSHIVKSKKHDDHLLVTHGLYSWSRHPSYAGFFYWAVATQLLLGNIVSTLGFMIVLN
                     KFFSARIVDEEKWLVKFFGNDYVEYRKRVGTKLPFYFSK"
     gene            complement(303096..304764)
                     /locus_tag="CNC01060"
                     /db_xref="GeneID:3256487"
     mRNA            complement(join(303096..304040,304090..304197,
                     304256..304609,304670..304764))
                     /locus_tag="CNC01060"
                     /product="rRNA binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539434|gb|CF685275.1,gi|41539441|gb|CF685282.1,
                     gi|41550850|gb|CF696691.1,gi|41550857|gb|CF696698.1,
                     gi|41560311|gb|CF706152.1,gi|41560325|gb|CF706166.1"
                     /transcript_id="XM_569426.1"
                     /db_xref="GI:58264539"
                     /db_xref="GeneID:3256487"
     CDS             complement(join(303105..304040,304090..304197,
                     304256..304609,304670..304732))
                     /locus_tag="CNC01060"
                     /codon_start=1
                     /product="rRNA binding protein"
                     /protein_id="XP_569426.1"
                     /db_xref="GI:58264540"
                     /db_xref="GeneID:3256487"
                     /translation="MGRQRRKNRTHLKGPPKGETEENVPKSFVIKSGHVTKSISQLVR
                     DTRKVMEPNTASRLRERPNARLRDYLTIAPSLKVTHLLAFTLTDAANVHLRVARFPQG
                     PTMTFRVQKYSLMKDLFNSGLRNVGRSPAGEYRNPPLLVLNGFQQPQNGPALPQLRLM
                     STMFQGIFPPIQVEKSALPTFRRVLLISYSHVTGCISFRHFTITVRPHGVSRRVRKLL
                     SSTVTSANPTSSKSRKTVDLSNTDDIADYLLRRTGSETSGASTAGYDSASETEASEAE
                     SDTNAVELPEDYVGRGNKKGERKAVRLVETGPRMEWRLIKVVEGLVGSKKGEGETVFH
                     EFVHKSAKDANAQAQAHERKRKAKEARRAEQAANVARKKAERAKKKGKAVGDGEEDED
                     NDSEEEPDIEGLSDIDPEEELERLRERKVGFQDEDDDEDFEYEDRGANADDEDDDDWG
                     EDVGAGEGDVTSDDEESSEDEEAKPPPKKRASGKRK"
     repeat_region   303151..303293
                     /rpt_type=tandem
                     /rpt_unit_seq="cat"
                     /satellite="microsatellite"
     gene            305717..309352
                     /locus_tag="CNC01070"
                     /db_xref="GeneID:3256793"
     mRNA            join(305717..306187,306237..306826,306875..307012,
                     307065..308186,308235..308796,308851..309352)
                     /locus_tag="CNC01070"
                     /product="glycine dehydrogenase mitochondrial precursor,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531253|gb|CF677094.1,gi|41534821|gb|CF680662.1,
                     gi|41537065|gb|CF682906.1,gi|41543057|gb|CF688898.1,
                     gi|41562149|gb|CF707990.1"
                     /transcript_id="XM_569428.1"
                     /db_xref="GI:58264543"
                     /db_xref="GeneID:3256793"
     CDS             join(305730..306187,306237..306826,306875..307012,
                     307065..308186,308235..308796,308851..309124)
                     /locus_tag="CNC01070"
                     /EC_number="1.4.4.2"
                     /codon_start=1
                     /product="glycine dehydrogenase mitochondrial precursor"
                     /protein_id="XP_569428.1"
                     /db_xref="GI:58264544"
                     /db_xref="GeneID:3256793"
                     /translation="MSVSILRRAARLPLSRQHQPLFARPLSISSIVLRPTSTSPTRSS
                     TTATQPHPRSPSESFHPAPTSVFTPLDTFLPRHLGPREADIQAMLEVLGHKTLDEFVA
                     TTIPSEVRIDQLTNKEEKGKGLRALSELELRRRIEEIAAMNRPVKSYIGMGYHNAIVP
                     PVIQRNVFENPAWYTAYTPYSPEQSQGRLESLINFQTVAISLTGLPIANASLLDEGTA
                     AAEAMAMCLASVAKPKFNKGKKVFLVSPNVAPQTIEVLQTRASGFDIDLRIAESDANF
                     LSEVESLGEAQLMGALVQYPDVNGEIGDWEEVATKVKATGAKMVVTTDLLALTMIKPP
                     GEWGADIVCGNSQRFGVPAGYGGPHAAFFACTDDLKRKMPGRLVGLSKDSQGAPAYRL
                     ALQTREQHIRREKATSNVCTAQALLANMAAMYAVYHGPEGLRRIAGKVHSLTRVLSES
                     LASLGFTTVNKAFFDTLTIDVSSAGVTAADVHTASVKAGINFRKIDDKTIGITLDESV
                     GPLDLTDIINVFYAVKGQPAVEPEVLEALAQKLELSAESVTSPIATLARTTPFLTQPV
                     FNKHHSETDMLRYMMHLQEKDYSLVHGMIPLGSCTMKLNSTSSMVPLSWKEFGGLHPF
                     APTDQAKGYEVIIKELENDLSLVTGYDATSVQPNSGASGEYAGLRVIQAYHESRGEGH
                     RDVCLIPLSAHGTNPASAAMVGYKVVPIKALNDGSLDLADLKEKAEKHKDKLAAFMVT
                     YPSTFGVFEEGIEEACQIVHDNGGQVYVDGANCNSLIGLTSLGRVGGDVSHTNLHKTF
                     SIPHGGGGPGVGPISCKSHLAPFLPSHPIVPTGGSTPITAVSAAPYGSASINTISWAY
                     IKMLGGEGLTTVSKIALLNANYIAERLKPYYNLRYSNKNGRVAHECLIDLAEFEKSAG
                     LKVPDFSKRLQDYSFHPPTAQWPISTCWLIEPTESESKEEIDRFIEALISIRKEIDEI
                     VSGEQSKDDNVFKNAPHPLSLLTADKWDRPYSREKAVFPVPGLKKSKFWPSVGRLDDA
                     AGDLNLICECGSVEEYA"
     gene            complement(<309411..311476)
                     /locus_tag="CNC01080"
                     /db_xref="GeneID:3256612"
     mRNA            complement(join(<309411..311293,311344..311476))
                     /locus_tag="CNC01080"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546149|gb|CF691990.1,gi|41571470|gb|CF717311.1"
                     /transcript_id="XM_569430.1"
                     /db_xref="GI:58264547"
                     /db_xref="GeneID:3256612"
     CDS             complement(join(309411..311293,311344..311455))
                     /locus_tag="CNC01080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569430.1"
                     /db_xref="GI:58264548"
                     /db_xref="GeneID:3256612"
                     /translation="MDIAHVKASVKAWEKAFKAEHGREPTKEDIKNDTSDIAEQYALY
                     RKLSKSAASHGKPGESSKSSKQALSQQQQPQPRVTPRTIPTSAYPTTPTPPSRRSYTS
                     LSRPNGSQSMQNLTAGPSSNAESSANGKPSHTQSLKRKASHAKLSPPPSALESSSAAR
                     TLFTTPKKKAYSGPIIDPNPVNPFNILNSPGKARSITNGGFNPNSGTGLSGVERMGSG
                     AGAAGSKEAVSPFIHASSPKKLKQVLEANSYHKTLVSGPVTTVGCKVSERITPRTKAR
                     KRLRGEPVEDTPMKDRQVRRRRSHMAVSKSQSQSQLDSTRDVNFGKPLGSVFGDQNRD
                     PMDEGQEDEEEGDEDEDEEGLGPSPVKPLGGKTFTSLFDDEDMPPRSIVSAKAKAPGG
                     KMDGKGKSGKGASQPGIMGFFGKLKKAKEKEKEKEKEKEKEADVSTTPSLALDKSADN
                     TLNSDIPSPTSFNPDIDLPELSAPSSAPHLGRKDKILSLSEDEDDEWDPEGGKVQQKV
                     VIVPTRRQVKRRTSIDGLSGLLDGVEKGMVDEGQDEEVEEEGDVIFENGNGDTDGQSP
                     HIPLDLLAITSPHKQRSAELESLRVSAIFNPFARKRLLALKRGQEIHTTGEAAIGGEE
                     GDVDGWEGLDNVLEGEGKKDDDWESEDEGWKKIEEGLDDW"
     misc_feature    311628..311655
                     /note="AT_rich"
     gene            <311691..>312818
                     /locus_tag="CNC01090"
                     /db_xref="GeneID:3256699"
     mRNA            join(<311691..312049,312164..>312818)
                     /locus_tag="CNC01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_569432.1"
                     /db_xref="GI:58264551"
                     /db_xref="GeneID:3256699"
     CDS             join(311691..312049,312164..312818)
                     /locus_tag="CNC01090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569432.1"
                     /db_xref="GI:58264552"
                     /db_xref="GeneID:3256699"
                     /translation="MRPPALRTFRQLQLRQPNSFLRPLHSTPLLLAAENNDKKSKTKF
                     VTDRPVKVDRSPAFPPPANPFAPKPEPVHYSDLTLGILWKINKLLGYNGRRRTTARES
                     GRMLTGIIEAVKQDKVFWTFHTFFSVHLVYLLITLIRLRALPNQIPNPLSPIPQSALP
                     GQPGTTTPIQPPSLKDKFEDLVSPAHEYKYRQTLLTHFFNVVENEIRLMLGVEITRDS
                     AVQTRMKDYANWWREAQLGMDYAIGLTASEDPRERAVADAELASWVWRLIFGRRGEGV
                     NGQGELVYPEGEAMKEGKELEMAEQVEAIVRFIRREMARLDKISDRDVIAGNVGMFGK
                     VRE"
     gene            complement(312843..>313654)
                     /locus_tag="CNC01100"
                     /db_xref="GeneID:3256798"
     mRNA            complement(join(312843..312954,313012..313189,
                     313251..313279,313330..313437,313495..>313654))
                     /locus_tag="CNC01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_569434.1"
                     /db_xref="GI:58264555"
                     /db_xref="GeneID:3256798"
     CDS             complement(join(313127..313189,313251..313279,
                     313330..313437,313495..313654))
                     /locus_tag="CNC01100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569434.1"
                     /db_xref="GI:58264556"
                     /db_xref="GeneID:3256798"
                     /translation="MMCVCRERRLSVRKFIFGYLSEKERELTDSGAVIALGLLGLGWG
                     LFILHATNSERLSSSVLRQATFQLRNSKEVIALLGENVRLVEEWWALGAPWISGTINL
                     MQGRVDLSFRIRGSKGR"
     repeat_region   313888..314025
                     /rpt_type=tandem
                     /rpt_unit_seq="cgggg"
                     /satellite="microsatellite"
     misc_feature    313937..314026
                     /note="G-rich"
     gene            <314303..315588
                     /locus_tag="CNC01110"
                     /db_xref="GeneID:3256665"
     mRNA            join(<314303..314336,314387..314422,314485..314600,
                     314664..314786,314835..314978,315032..315196,
                     315237..315416,315467..315588)
                     /locus_tag="CNC01110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569957.1"
                     /db_xref="GI:58265601"
                     /db_xref="GeneID:3256665"
     CDS             join(314303..314336,314387..314422,314485..314600,
                     314664..314786,314835..314978,315032..315196,
                     315237..315416,315467..315481)
                     /locus_tag="CNC01110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569957.1"
                     /db_xref="GI:58265602"
                     /db_xref="GeneID:3256665"
                     /translation="MSAEDFELSPGQISDSVRHQLEIEEGNKNVQYQRFHTKQTQDYL
                     AHLRPKVKDVDQFWLIVLLSHQIVAPHVTSKLDQHALSFLEDIELKQDVNDFRPYELV
                     FHFKENPYFTNKTLSKKYTLKKGIKPAPADGSVTDELRKFNEEQDLEVNRATIDWKDG
                     QNLCERMPRQAQAQREGGEADDLEDGFEGDPGSFFWYFQEKADRFNFGEQFKDDILPE
                     AFAYFEGRGESGFGGESDDEDDSLDEEDDEDEDEIDLEEDEKPKKKRKVGAH"
     gene            complement(314366..315727)
                     /locus_tag="CNC01120"
                     /pseudo
                     /db_xref="GeneID:3256494"
     misc_feature    316201..316223
                     /note="G-rich"
     misc_feature    316229..316380
                     /note="G-rich"
     repeat_region   316388..316407
                     /rpt_type=tandem
                     /rpt_unit_seq="aggggg"
                     /satellite="microsatellite"
     gene            <316537..>318109
                     /locus_tag="CNC01130"
                     /db_xref="GeneID:3256172"
     mRNA            join(<316537..316731,316783..317735,317788..>318109)
                     /locus_tag="CNC01130"
                     /product="ribosome biogenesis-related protein, putative"
                     /transcript_id="XM_569958.1"
                     /db_xref="GI:58265603"
                     /db_xref="GeneID:3256172"
     CDS             join(316537..316731,316783..317735,317788..318109)
                     /locus_tag="CNC01130"
                     /codon_start=1
                     /product="ribosome biogenesis-related protein"
                     /protein_id="XP_569958.1"
                     /db_xref="GI:58265604"
                     /db_xref="GeneID:3256172"
                     /translation="MGKRTADAADLPVSKAAATGQATAREPAADDEMGEFEDRWEDEI
                     ESEEEVVEHDADGEADGKSCSEDAEPPAAPTQTYLPGTAIAEDEQLVPDNSVYLALHS
                     LSYAWPCLSFDVLRDSLGTDRATYPHTSWIVTGTQAGEVPGEGKAKDEVVIMRLGNLS
                     KTQHDDDDDSDDGKDDDDDEADDEDATLDFLTIPHVGSVNRVRAAPAPVGGAVPDPYH
                     VATFSETGKVHIFDVRPYIDTLAGPSRPRQKLPVHTISNHGRAEGFAVEWGATGLLTG
                     DIDRKIYLTTLTPSGFTTSPNPYLSHTSSVEDLQWSPTEPTVFASASADRTVRVWDVR
                     AKGRRSVVSVEAHSEDVNVISWNKTVDYLLVSGGDEGGLKVWDLRMFKDTPSPVAQFQ
                     WHTAPITSVEWHPTDSSVFAASGSDDQLTLWDLSVEPDEDEAPIGPADGNITAVPPQL
                     LFVHQGQKDVKELHWHPQIPGMVISTASDSFNVFKTISC"
     repeat_region   317078..317143
                     /rpt_type=tandem
                     /rpt_unit_seq="cga"
                     /satellite="microsatellite"
     gene            complement(318222..320005)
                     /locus_tag="CNC01140"
                     /db_xref="GeneID:3256692"
     mRNA            complement(join(318222..318907,318966..319112,
                     319185..319286,319345..320005))
                     /locus_tag="CNC01140"
                     /product="lipase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532112|gb|CF677953.1,gi|41532118|gb|CF677959.1,
                     gi|41540158|gb|CF685999.1,gi|41540164|gb|CF686005.1,
                     gi|41540944|gb|CF686785.1,gi|41540953|gb|CF686794.1,
                     gi|41548390|gb|CF694231.1,gi|41548402|gb|CF694243.1,
                     gi|41550722|gb|CF696563.1,gi|41550734|gb|CF696575.1,
                     gi|41552461|gb|CF698302.1,gi|41552472|gb|CF698313.1,
                     gi|41557817|gb|CF703658.1,gi|41557824|gb|CF703665.1,
                     gi|41557899|gb|CF703740.1,gi|41557910|gb|CF703751.1,
                     gi|41570801|gb|CF716642.1,gi|41570813|gb|CF716654.1,
                     gi|41571133|gb|CF716974.1"
                     /transcript_id="XM_569436.1"
                     /db_xref="GI:58264559"
                     /db_xref="GeneID:3256692"
     CDS             complement(join(318230..318907,318966..319112,
                     319185..319286,319345..319986))
                     /locus_tag="CNC01140"
                     /codon_start=1
                     /product="lipase"
                     /protein_id="XP_569436.1"
                     /db_xref="GI:58264560"
                     /db_xref="GeneID:3256692"
                     /translation="MYIPGPLRLSSYLLPFLSSPSPPAQSSPDTRTISFKPVHAHGHA
                     FVDNASTPTLLFLDQSPSASLYAHDYPIGAFGDDYVLPRLTSDVLEIRTRKKLIRRPK
                     VRPPRIISWAQSYRAQALHFNGINNNNDNSNKSISLPESWLAPDLANPSDEWSDVEVT
                     VPDLTDRQTVITLAKMSSNAYVTPGGAGWYTLNDWNASMPFGWEPDADGLRGHVFADE
                     KNETVIISIKGTSAGVLGSGGPTAKNDKFNDNLLFSCCCARVDFSWTPVCDCYAGGYK
                     CGQTCLEDALVSESVYATVGTNLYNNITYMYPNATIWLTGHSLGGAVSSLIGLSFGAP
                     AVTYESPGELLPASRLHLPLPPGMPANLSGITHVYHTADPIAMGVCNGPYSSCYAAGF
                     AMESKCHTGETILYDTVRVKGWSVDVRTHRIEEVIDKVLADPWPEEGEGKSGVWEKAV
                     EGWYRAADRVRAALDESVVRDDVNVWWGWGRRGPKRQPGGEDPGWRKHGGVPKPVSEE
                     DCVDCYKWEFGEWN"
     STS             319211..319512
                     /standard_name="CT7"
                     /db_xref="UniSTS:470766"
     repeat_region   319586..319612
                     /rpt_type=tandem
                     /rpt_unit_seq="ttg"
                     /satellite="microsatellite"
     gene            complement(320199..322923)
                     /locus_tag="CNC01150"
                     /db_xref="GeneID:3256725"
     mRNA            complement(join(320199..320640,320702..320712,
                     320769..320846,320903..321006,321054..321496,
                     321541..321606,321666..321740,321799..321865,
                     321918..321927,321988..322009,322058..322297,
                     322355..322450,322559..322923))
                     /locus_tag="CNC01150"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534252|gb|CF680093.1,gi|41534256|gb|CF680097.1,
                     gi|41559895|gb|CF705736.1,gi|41559907|gb|CF705748.1,
                     gi|41562410|gb|CF708251.1,gi|41562419|gb|CF708260.1,
                     gi|41564661|gb|CF710502.1,gi|41564668|gb|CF710509.1,
                     gi|41564875|gb|CF710716.1,gi|41564888|gb|CF710729.1"
                     /transcript_id="XM_569438.1"
                     /db_xref="GI:58264563"
                     /db_xref="GeneID:3256725"
     CDS             complement(join(320340..320640,320702..320712,
                     320769..320846,320903..321006,321054..321496,
                     321541..321606,321666..321740,321799..321865,
                     321918..321927,321988..322009,322058..322297,
                     322355..322450,322559..322815))
                     /locus_tag="CNC01150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569438.1"
                     /db_xref="GI:58264564"
                     /db_xref="GeneID:3256725"
                     /translation="MDPNSVVKPEIDTTSTSLGARQNTLIPPIDASIQGRYTKREDEA
                     TANKNMQAGTEEEKEMAGRAAVIIQKHYRGHAARKHVRELRLQREARWNDLVKHSQEV
                     TYAKDQLDNKNDVVSRWHRAAHAASRLQTGDGLYSSPISTLPSGQVEECDPKKLTDKE
                     LRARKATFWGSLSLGVGKDRDEKKELPFHSKELETQHWLEMIDGKHRYGSNMKYYFRK
                     WKEADTSDNFFRWLDKGEGKDLDLEEMPRERFEKERITYLSAEERLNYLVKVDKDGRL
                     RWVHNNEFVDTAAGRWKDAGDGTGIVPADPQSEEDENTPKPQPTIDPYATPHNHHIRK
                     VSRTSSLSSLSSDSYSPQSSELDENESTHYAGLDQKPEGWLERQRKRLTPGGVRRELL
                     RKTVRRNTWIYVSDMKLNLFVGIKQSGTFQHSSFLAGGKVTSAGIIVVKHGLIKSLNP
                     LSGHYRSSIDGFRSFIGQLEAKGVDLSHVKIAKSVLSLWGLSKYSKVTKAQNNLITHV
                     QRTLHLSHEPTEEEKSQALQENAEREEREHQERTKIVRDAEEEAKRSGEIKDDRDDVA
                     TEKDKEEMREFRREVLYGRRDRV"
     gene            complement(323097..324714)
                     /locus_tag="CNC01160"
                     /db_xref="GeneID:3256661"
     mRNA            complement(323097..324714)
                     /locus_tag="CNC01160"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532689|gb|CF678530.1,gi|41532706|gb|CF678547.1,
                     gi|41534869|gb|CF680710.1,gi|41534882|gb|CF680723.1,
                     gi|41540702|gb|CF686543.1,gi|41544936|gb|CF690777.1,
                     gi|41545654|gb|CF691495.1,gi|41545662|gb|CF691503.1,
                     gi|41548579|gb|CF694420.1,gi|41548587|gb|CF694428.1,
                     gi|41549712|gb|CF695553.1,gi|41549721|gb|CF695562.1,
                     gi|41551328|gb|CF697169.1,gi|41551341|gb|CF697182.1,
                     gi|41552109|gb|CF697950.1,gi|41558613|gb|CF704454.1,
                     gi|41558617|gb|CF704458.1,gi|41562664|gb|CF708505.1,
                     gi|41562675|gb|CF708516.1,gi|41563375|gb|CF709216.1,
                     gi|41563386|gb|CF709227.1,gi|41563451|gb|CF709292.1,
                     gi|41563454|gb|CF709295.1,gi|41563506|gb|CF709347.1,
                     gi|41563515|gb|CF709356.1,gi|41565570|gb|CF711411.1,
                     gi|41565582|gb|CF711423.1,gi|41569356|gb|CF715197.1,
                     gi|41569365|gb|CF715206.1,gi|41571136|gb|CF716977.1,
                     gi|41571143|gb|CF716984.1,gi|41572944|gb|CF718785.1,
                     gi|41573246|gb|CF719087.1,gi|41573252|gb|CF719093.1,
                     gi|41573573|gb|CF719414.1,gi|41573689|gb|CF719530.1,
                     gi|41573695|gb|CF719536.1,gi|41574351|gb|CF720192.1,
                     gi|415"
                     /transcript_id="XM_569423.1"
                     /db_xref="GI:58264533"
                     /db_xref="GeneID:3256661"
     CDS             complement(323255..324244)
                     /locus_tag="CNC01160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569423.1"
                     /db_xref="GI:58264534"
                     /db_xref="GeneID:3256661"
                     /translation="MRFTSPDTRPSLTPLGYRLLHLSELKLSSMDGSSYDEGVSLWKG
                     VLVREAVRSAWKSVQDGSVPEMNDWSARGAMGLDIYEEEVEEEEEQQEERWFEDMVTS
                     FGEEEYAVEAADGEHEWVESSVSIPEYDLDFNVDGMEAYTFPASSPSTPLLDDSHLEP
                     SGTVDIIEVDDDESDISDEDLASLAQSQHWHSPSTISMAATSPSTPILFGHPLSSPNS
                     PTLSPVPSPTLLAPTPMPLPAALTGSFVFPDPRSYYTDFEEYVDDFSLPPPLLRSMSS
                     STTESDVDDGEVCKTPPLRTEELEYESSEEENVKEEELLMGLGLRIGHLNLRL"
     gene            complement(<326794..327965)
                     /locus_tag="CNC01170"
                     /db_xref="GeneID:3256420"
     mRNA            complement(join(<326794..326894,326977..327473,
                     327531..327788,327862..327965))
                     /locus_tag="CNC01170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569963.1"
                     /db_xref="GI:58265613"
                     /db_xref="GeneID:3256420"
     CDS             complement(join(326794..326894,326977..327473,
                     327531..327788,327862..327869))
                     /locus_tag="CNC01170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569963.1"
                     /db_xref="GI:58265614"
                     /db_xref="GeneID:3256420"
                     /translation="MPYSQKLKALLIDLNGTLHIGSESTPSAVKAIERLRSVRIPFIF
                     CSNSTKESSASLLDKLKKIGFDVKKEELMTSLSACRMIVEEKGLKHPLLLMSPSAKEE
                     FSTLPPSQGINHDAVILGLHPDSLSYEHLNKAFRVLKGEPLSSQEKNNSTGEHRPVLI
                     APHASMFMQDPGSSSFPPGLSLGIGPFVRALEEAASVKAEIVGKPTKGFFELALEKLK
                     ELSGEDFERNEVAVVGDDVDNDLGEGARELGLKRILVKTGKYRTDVEKKIEHPPDTVY
                     DTFAAFVDDLL"
     gene            <328328..329456
                     /locus_tag="CNC01180"
                     /db_xref="GeneID:3256205"
     mRNA            join(<328328..328624,328681..328961,329027..329072,
                     329134..329456)
                     /locus_tag="CNC01180"
                     /product="Rossman fold oxidoreductase, putative"
                     /transcript_id="XM_569425.1"
                     /db_xref="GI:58264537"
                     /db_xref="GeneID:3256205"
     CDS             join(328328..328624,328681..328961,329027..329072,
                     329134..329382)
                     /locus_tag="CNC01180"
                     /codon_start=1
                     /product="Rossman fold oxidoreductase"
                     /protein_id="XP_569425.1"
                     /db_xref="GI:58264538"
                     /db_xref="GeneID:3256205"
                     /translation="MSVAVIQGASGGLGQALTRYILRHTGLTVYALTHQASSQGVRES
                     LLSEVWDKGKHDSERLTVVSNVDVREEEGLRRGAEMIRSREGSGSVRVVVCLAGILKA
                     EKSLSAINLHDALSSFQINALGQLITYKHIVPLIPTKNELSILKAKWNSEEEGHDPAK
                     GMVNGDHSICCSLSARVGSIKDNEKGGWYSYRSSKAAVNQIIRTLDHELYNRSSSAIA
                     YAYHPGTVLTSFTSPIIGSPKPHLSQGLLTVDQAIDRLVNIMSQVKRGVQGSQNGVDW
                     GGRCWDWKGDVVEW"
     gene            <329719..>330159
                     /locus_tag="CNC01190"
                     /db_xref="GeneID:3256449"
     mRNA            join(<329719..329880,330020..330073,330142..>330159)
                     /locus_tag="CNC01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_569427.1"
                     /db_xref="GI:58264541"
                     /db_xref="GeneID:3256449"
     CDS             join(329719..329880,330020..330073,330142..330159)
                     /locus_tag="CNC01190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569427.1"
                     /db_xref="GI:58264542"
                     /db_xref="GeneID:3256449"
                     /translation="MAPLDLGDVGNAIQGAGESAVNGAEGVVGTVTDKAAGAVATATD
                     KAKGAVASATNGASQAAGLLKWMEKIQDVTSSL"
     gene            complement(<331074..>331596)
                     /locus_tag="CNC01200"
                     /db_xref="GeneID:3256450"
     mRNA            complement(join(<331074..331123,331175..331353,
                     331409..>331596))
                     /locus_tag="CNC01200"
                     /product="thioredoxin (trx), putative"
                     /transcript_id="XM_569429.1"
                     /db_xref="GI:58264545"
                     /db_xref="GeneID:3256450"
     CDS             complement(join(331074..331123,331175..331353,
                     331409..331596))
                     /locus_tag="CNC01200"
                     /codon_start=1
                     /product="thioredoxin (trx)"
                     /protein_id="XP_569429.1"
                     /db_xref="GI:58264546"
                     /db_xref="GeneID:3256450"
                     /translation="MLGQLSRPVRLSVAPLRTILTQRAFHASPIARDHILDASNEVFE
                     KRALDADNSKPVLVDFYASWCQPCRVLTPLLKRVTGPESNYDLLTINVDEYPEVAAKY
                     KVSALPTVVAFKNGAVKNKFVGFRGQDDINKFLGML"
     gene            331896..334355
                     /locus_tag="CNC01210"
                     /db_xref="GeneID:3256299"
     mRNA            join(331896..331982,332031..332084,332135..332178,
                     332230..332539,332588..333121,333171..333606,
                     333660..334252,334309..334355)
                     /locus_tag="CNC01210"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545397|gb|CF691238.1,gi|41545402|gb|CF691243.1,
                     gi|41556477|gb|CF702318.1"
                     /transcript_id="XM_569431.1"
                     /db_xref="GI:58264549"
                     /db_xref="GeneID:3256299"
     CDS             join(331970..331982,332031..332084,332135..332178,
                     332230..332539,332588..333121,333171..333606,
                     333660..334252,334309..334334)
                     /locus_tag="CNC01210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569431.1"
                     /db_xref="GI:58264550"
                     /db_xref="GeneID:3256299"
                     /translation="MPKTNKGGKGQKNKVYALPTAQKKKGLDVPKFQMKAKAASQAQL
                     APTSLGALSSNDQDISNSSFDLGNVTFHDVIDTSLTKDSSSKAFMRELRKVIERSDVI
                     IQVLDARDPEGTRSRWVEDEVRKRDMQGKKLLGVLNKIDLVPRANLEAWLKHLRHSFP
                     TMPFKSSTQSQKQHLSQNAVPLAQPSTVPGKQAVLQELPTTSASLGAPALLHLLKQYA
                     LSTPHSSLTVGVVGYPNVGKSSLINSLKRSRACAVAAMPGKTRVVQEVALDKGVKILD
                     CPGVVLEDVGSHMEGEEGRRRQAEIMLRNCVKAELVQDPISPVEVILNKVEPAQLQKL
                     YNIPAYDDVRDFLIKMALIRGRLGKGGVPDLEASAVQVLRDWNSGKISYYTTPPKFHP
                     SSAPAPAPVVTPVLAPNEAAGDMEMGGDKVGDAKILTTLSEAFTIEGLFDNLGDDAAW
                     EGEGVVKEEGIAEDADLIAPEPVIPPALVPEQTAPRASLTKRPFMGSEDESDADSDAS
                     DSFRPRTTLGPSPASFQSTSSNALHFPAQPQTAQANRLFTAEELAVLPSGLLDRKKVK
                     SLAKKAKKRRAAVERTEGELMAGFMDMEMDEPGAREETEVQMPAFEQKSKKDKRKEKK
                     ETQAKQRKEMTKVVAEMEIDEDARKEAEFANFLANMNADGSDEEL"
     gene            335861..338039
                     /locus_tag="CNC01220"
                     /db_xref="GeneID:3256518"
     mRNA            join(335861..336075,336125..336963,337015..337368,
                     337422..338039)
                     /locus_tag="CNC01220"
                     /product="cystathionine gamma-synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534864|gb|CF680705.1,gi|41534872|gb|CF680713.1,
                     gi|41542172|gb|CF688013.1,gi|41542183|gb|CF688024.1,
                     gi|41544189|gb|CF690030.1,gi|41544194|gb|CF690035.1"
                     /transcript_id="XM_569433.1"
                     /db_xref="GI:58264553"
                     /db_xref="GeneID:3256518"
     CDS             join(335881..336075,336125..336963,337015..337368,
                     337422..338025)
                     /locus_tag="CNC01220"
                     /codon_start=1
                     /product="cystathionine gamma-synthase"
                     /protein_id="XP_569433.1"
                     /db_xref="GI:58264554"
                     /db_xref="GeneID:3256518"
                     /translation="MPTSTSNLPAPIPLGCSVPALTAHAISVSLPTWEDNIGYEEGHK
                     RVVDKMETGYPRFFIHRSIQKLAALCLSKFGQPNELCILLPAPRVAAAGRDFLAAQDP
                     PIPSRTVEFVICPSSKSLTDLSSAKSLGIDCIELQILLFDKDKWPYGKAFWQHTGDGV
                     SSRMAERALSFLGETPAGVQPRAPSPPTLERPASKAPSSRNRHYSKRTGSVPPTPTTP
                     SESPNSMPQSSTILEKPPVDPITDENLTSDLTTYLEERYGRNLPLFNAPLAKQALKRR
                     IAGGLLPSDEDYGKIEDVARGAGSGKKAVTEENVYLYPCGMSAIWHAHDISRIARKLQ
                     GEAEGISVCYGFPYTDTLKILNKWGPGCHFLGTGGSEDINALEKILVEAKENPNEPPI
                     LALFCEFPSNPLLRSPDLVRIRELADKYSFFIIVDETIGNFINVEVVTFADIVVSSLT
                     KIFSGDANVMGGSLILNPNGPHYDTLKAAQSSVYEDYYYPEDAVYMERNSRDYRARIK
                     KVNDNAYDMCDFLHKRSLDDESTPAEGKVLKKVYYPRYITPETYAQAQRHPTLGKGGY
                     GGLFSLTFTSLAASKAFYDAIGCAKGPSLGTSFTLASPYTILAHYLELDWAAGYGVEK
                     GLVRISVGQEDQSVLKTWFETALAASEAAGRAEKEGRKE"
     gene            complement(338102..>342193)
                     /locus_tag="CNC01230"
                     /db_xref="GeneID:3256122"
     mRNA            complement(join(338102..338656,338723..339053,
                     339108..339670,339724..339885,339937..340110,
                     340160..340357,340410..340577,340630..340892,
                     340948..341923,341971..342165,342188..>342193))
                     /locus_tag="CNC01230"
                     /product="DigA protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41567156|gb|CF712997.1,gi|41567161|gb|CF713002.1,
                     gi|41569348|gb|CF715189.1,gi|41569357|gb|CF715198.1"
                     /transcript_id="XM_569435.1"
                     /db_xref="GI:58264557"
                     /db_xref="GeneID:3256122"
     CDS             complement(join(338147..338656,338723..339053,
                     339108..339670,339724..339885,339937..340110,
                     340160..340357,340410..340577,340630..340892,
                     340948..341923,341971..342165,342188..342193))
                     /locus_tag="CNC01230"
                     /codon_start=1
                     /product="DigA protein"
                     /protein_id="XP_569435.1"
                     /db_xref="GI:58264558"
                     /db_xref="GeneID:3256122"
                     /translation="MTFARSSSVLVVEHTSGPSAASYAVSGIYQGSNNVGYGGSGIQA
                     VGYEGFEEGDEEQPGEDAVMVRALETGFIPSARSQALSPLFSLSLVQYSPPSSVLCLT
                     SVNNVLFLAIAPLALVIIDLEKPEELVTIDLPKPTPEKGSQRTKESPVVSQLFADPTA
                     RHLLISTSSGDTFYLPISPGNAAIQSRRPRPLRLRQSITAAGWSPISGVTVDANGEGT
                     GQGKGDAVTPPSTDVLLGTTNGQILSLLLPPQDDIFKSVSIGMSKPVERDLQTVYTLP
                     DQQPVAGIGFGFWPANGSSSDRHHKGGKKGAGKRAWVVITTKERLYEVQGNVSTTTAG
                     GKTGGWAEELFKPIRNSTPKFQELPGDIVNPSLVFYTPSTPAQSSSTLPAPSAIAWLT
                     APGLYTSSLSSAPSNDILLRPSLIPYPIFDDSALHDFAPRPAPSSPSLPAIPIAVAVT
                     QWHWLLLYSDRVAGVSRENEKVVWEEKLPLSVDEKAIGMSADPVSRTFWIYTNKSILE
                     ILVRNEDRDIWRAKLEKGEYTEALNFAKTLSQKDVILSKQGDYLFEQGRYIQSAQCYS
                     QTNRSFEYVTLRFIDADERDALRIYLSERLNRLDKKQRTQRMMLATWLIEIFLNKWNA
                     LEDLLAIDSANTDMDSLNIERQITEEDLKEFMNTYQNDLESKVVYELIQSHGRTDLYL
                     FYATLIKDHGKVIEHWITEEQWLKAIEALSRQNTIELYYRFASILMRHAPKETVDSWI
                     RQPALSPRRLIPAILQQHRRSEPMSSNHAVRYLSHVIHHQSCTDTTIYNLLLTFYATD
                     PDPDDGPLIRFLSSCPDDPETERPYYDLDYALRTCKQHGRIQPCVLIYSKLGLYESSV
                     DLALDKGDLELAKENADKPEDDDVLRKKLWLKIAKYVVQEQKDIKSAMQFLGSTNLLK
                     IEDILPFFPDFVVIDDFKIEICSALEEYSARIDALKAEMDEAITSSESIKRDISNLAK
                     RFVTVEQSDKCWKCGLELVSRQFYVFPCQHQFHGDCLISMAMEYLPSPSLRRILRLQN
                     ELVSRSGPSFGRHLLSSNFTPSGSGSSTPGRGKEHPFRQAPASSNVATDLLLGGVTGR
                     NKLIAAGDKLRELIIPDALAQAVSMVSVGVGVGGTGEAKKGGKREKPDDSRAEEFRNE
                     LDALVASNCPLCEGAVMSLDKPFIALSEDTADWEV"
     gene            343142..345253
                     /locus_tag="CNC01240"
                     /db_xref="GeneID:3256380"
     mRNA            join(343142..343858,343917..344023,344072..345253)
                     /locus_tag="CNC01240"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532745|gb|CF678586.1,gi|41532750|gb|CF678591.1,
                     gi|41536151|gb|CF681992.1,gi|41545424|gb|CF691265.1,
                     gi|41545433|gb|CF691274.1,gi|41548821|gb|CF694662.1,
                     gi|41548827|gb|CF694668.1,gi|41562960|gb|CF708801.1,
                     gi|41562964|gb|CF708805.1,gi|41564597|gb|CF710438.1,
                     gi|41564609|gb|CF710450.1,gi|41573203|gb|CF719044.1,
                     gi|41575425|gb|CF721266.1,gi|41575430|gb|CF721271.1"
                     /transcript_id="XM_569437.1"
                     /db_xref="GI:58264561"
                     /db_xref="GeneID:3256380"
     CDS             join(343157..343858,343917..344023,344072..345041)
                     /locus_tag="CNC01240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569437.1"
                     /db_xref="GI:58264562"
                     /db_xref="GeneID:3256380"
                     /translation="MCTHSMLTSHTELALEQLRLCHILNGETCPPISFADFATFLTNK
                     DYTAENLVFVLWYRDYRSKWKQVDKAVKIRVPVPSTILGHRYDPFAYLHHGPMNFPTK
                     VGEQEVEESRSSSISAGAYSTDATALHPNDGSGKPLRSCFSRVNSHFAGSRFGTSSST
                     CSSSPALHVLHRSHSPYLPDGTTFLPVDEQPLRDQALQAFATFFKNGGSKELSISDEL
                     REYVRTCLEVSSAPESFLPVLEEIYHTLESQCLPRFLETAKGNINRPKQLLWYFAGVI
                     GLLIGLAIFLLLTFLLPPSPFGLRTYRLFSTIFVSFGTMQVYSAYRGFCSQVWRRSSR
                     QIWPWELDALEDEHSKVGDMIGIPAIVGCGPKPEVKVLKEVVFPEEVRPLSNLGAIQD
                     FNSTCKVNIRENSINASQASLEKSGDYDLSSQTFGFRNALARQFAPICDTSSLEDKTG
                     LISRPCCMWLGILAAKGHKLPNPTQREISPFAFDSGGKEGETSLGNATITTPFPHSVP
                     AQSLHPLTSFMLISNPRSTKHEARVPPRRKAHTKIQVFGPERLVEDPRIKKVYRDIKR
                     DILIAGGIVSALWIVVCLVVPCTASS"
     gene            complement(345854..347977)
                     /locus_tag="CNC01250"
                     /db_xref="GeneID:3256343"
     mRNA            complement(join(345854..347492,347545..347703,
                     347756..347977))
                     /locus_tag="CNC01250"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542691|gb|CF688532.1,gi|41542696|gb|CF688537.1,
                     gi|41558808|gb|CF704649.1,gi|41558813|gb|CF704654.1,
                     gi|41566650|gb|CF712491.1,gi|41566662|gb|CF712503.1"
                     /transcript_id="XM_569439.1"
                     /db_xref="GI:58264565"
                     /db_xref="GeneID:3256343"
     CDS             complement(345980..347488)
                     /locus_tag="CNC01250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569439.1"
                     /db_xref="GI:58264566"
                     /db_xref="GeneID:3256343"
                     /translation="MPPFARRQARQISQVRGENTPVTGTARLQSVVPQRRRIEIVLPA
                     RSRRTPINRQSRIAPSHPPSPANPSSSEPESTTSAIASSSPPSSASEISAPPVIERRR
                     IEAVLMDCAAQGIDVDSWNITMSPSHYYQTFCNTLSIATIGSQGSHIYSQVKDDGMYA
                     KWVLIGDAGCRLLIAPEYKRRLIRAIKQKRPIHPSTSSCKLTDAPFTMSCFELMEHLT
                     SIGCRAIRIQLYGQKLPLHPRFFPQAPEEPVHYLAETNQWDIGVTYRSNKIFLFAPTK
                     GVSSGMDVYPMLIPISKDFGSISVKMSARGKECRVKIYPRLVHVLKSIRGQLQKYNSK
                     TMSGLMKQMTAAQELLKEITSMDEEECGGFRIEVSLNTFTLEEARTLAVESQLLEPET
                     WLLEGGPAYVQPYKLCLKLVTKAELLTNANRLVRVAVEQRLLTGDGNRHSEEWEKKVV
                     ADVFAAIGWNNGKRRLTKSTSTDAWWITGQGDTADDPRNEGDQILMDINRVE"
     gene            348156..351353
                     /locus_tag="CNC01260"
                     /db_xref="GeneID:3256405"
     mRNA            join(348156..348332,348397..348712,348789..348947,
                     349015..349228,349280..349559,349612..349851,
                     349903..350218,350274..350362,350410..350673,
                     350748..350905,350960..351009,351058..351353)
                     /locus_tag="CNC01260"
                     /product="SNF1 family protein kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532327|gb|CF678168.1,gi|41536027|gb|CF681868.1,
                     gi|41569777|gb|CF715618.1"
                     /transcript_id="XM_569959.1"
                     /db_xref="GI:58265605"
                     /db_xref="GeneID:3256405"
     CDS             join(348863..348947,349015..349228,349280..349559,
                     349612..349851,349903..350218,350274..350362,
                     350410..350673,350748..350905,350960..351009,
                     351058..351152)
                     /locus_tag="CNC01260"
                     /codon_start=1
                     /product="SNF1 family protein kinase"
                     /protein_id="XP_569959.1"
                     /db_xref="GI:58265606"
                     /db_xref="GeneID:3256405"
                     /translation="MEAAQTPRSVLTHIGGWKLGKTLGRGAYAHVRLATHKNGHQAAC
                     KILPALHKDPGLPVTWDETIDAVEAHKEVVLLKALCGAGVEGIAGLEGVVEEGGWTYV
                     FLTLYPCSISSISKPWASDAVVIFFRRLLHTVRNLHQLNVSHEDIKRSNVLADSQGSP
                     VLVDFGFSHFKANGGYVKSAGGTLDYSSPEKTADKHYDPKANDIWALGILLTKILCIQ
                     HPYAHSYVDDTSTTVKRRILTGDAKFHWKTDHLVPGGVAELIMGMLERDPQQRWTITR
                     ILGHPWLRTKYPDLRPFQLPSYELKLLHKPSQSVIEDLCFLAYLNGEFALCETSMRIE
                     EHLEGKEPCWEKRWAGMLGSWSQRAEMDWQDIPTAITPLPKSRSSFTRVNGPTKANAI
                     GNSKGGILKEIHLLPNAQALTTLGSNGDIKKGLRPARSRFYNMKTKNGAQNLLVCSLR
                     PGIHTQTTLQEKFVPDDLMAATNNQSSKAKPGIVRVKKPKAKQKSKADFKIFISDTDN
                     SGEENETVEKRQNQQGPRKLDKTGAKNLIIGESPTLAALVTDSKEGFITSVPDEQMKG
                     LFLSKPDPPRARCTQRRSPRLQEEKRIDLN"
     gene            complement(351437..356181)
                     /locus_tag="CNC01270"
                     /db_xref="GeneID:3256280"
     mRNA            complement(join(351437..351760,351811..355450,
                     355507..355938,355993..356081,356139..356181))
                     /locus_tag="CNC01270"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41549088|gb|CF694929.1,gi|41549096|gb|CF694937.1"
                     /transcript_id="XM_569441.1"
                     /db_xref="GI:58264569"
                     /db_xref="GeneID:3256280"
     CDS             complement(join(351509..351760,351811..355450,
                     355507..355938,355993..356042))
                     /locus_tag="CNC01270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569441.1"
                     /db_xref="GI:58264570"
                     /db_xref="GeneID:3256280"
                     /translation="MCQVLWTLRFKTQSAKQAPWTKQLISWFIDTSRYLIPSEEEQAT
                     KYLRAMYRTFSPETLPIDQSIGQPIVLPFSAPHASVNFNHEARIKILTRGIEDVLPPL
                     LVLTHDSLSTQDWETILPFLWAWYGTKASATREIGFLLEKCAEMAPAQLRSIVISDLT
                     STNAEVRCQALHNISILFAWRNQILSQPIFTSRRGPLFHFPAKTLEFVPTEIGSSKWV
                     SPQDVQDTQLQKFGQTLPLELRQRLNELRWSDEDELKGNSDWEQTPVSSLPGLAFQSD
                     GNLINGSSSGRPSSPVESLVRKGSNASAGSSSNKRRKAIFAPLFVNMTYDQMTILAGE
                     VDGPISATSLEVVRLLQRDDVVSFLRPFTERMKDQFLNAMERLDRVTNVLTPGFAYSA
                     INAIVGYLKSSLKANADVEYWDIALASVVRLVPSVSEISLRDIRKNKAEHVLLPASIH
                     EEDGGFRIHAPWRRGQRGVQTAQLLILNEILKVNPREVYLVKKMLHNLHIQSSINHLP
                     FARAWLVLVLTLFSFVNRNYNDRAELRHFLSNVGDILLLHGQSDLVIVAHAMRIFTLC
                     SARFRRVFSSMGFPTIMRPVYETYAASNAAIKDCIEYAAKSFYRIHEEVFVYQTCVVI
                     ADGGYDAEAVYAFLSSLSHESTVLSGVTSGIRGSNDKEETDALVQMVSGPEITLAEIG
                     KEAAERQAIKLASITLEDKLFPRENIVRLFVTAIASNPATTCAANFLRLLSALVPKMN
                     DSVSKDLLSEGVEALGSVIIKGKTGDDAAKSVFHPGANDSEADWTRARREYVFLVQSF
                     AKAGGHLGTSATRRTLDMVLDLLRKQPESVGPSASSIVGELAKTRLASGRPTPFLREI
                     APIFRAFISVVDFSGMLDSISALIRLSNYNLDEEITRIIVHDYVEPAVKLLASASKDS
                     LAFIVPLRSSAVKLLSVAVFLQGDALGALERHHASASLLASVVMPLCLLLEPPREVDR
                     QDIYSSLWIRLLHYVLKGSIEEGGDSRKSSNASLYHPRSIAASTVLVVQIVKIVLIRA
                     PGSINRVKGLWTYVARRILQIVDCGNARFMDSQRSLSPRVVDWLMWSVFELIALHPSA
                     LHIEFQARVHQALAMIDKQETYSSRPSSPALGPTLSASTYPQYYPGRARLSSNRPSSF
                     IGHARSPSNVGHDHTQFGSPDRSTTANLAVTPSRNRISSNNSSPNHSPSLLPSSLAQP
                     HGVGPGVEVVHSRSPSQRKTTGLSPAGAARPSFVALSARRASQPVFEAFSSAYPTKNR
                     FASSANIRDLGNSSEKPGGAIIHLLGAPNQVLSATSSGFPTLSLTNSSVISPTGPKIS
                     TQSVEKALRDVYIKSEELTQMASKAVRTVMLVYGWRFDKEEEDVVRNWTVLDALHIVS
                     KQTKVFVEEEFRDVFSPAADLYESDDAYIDSEKQEGVYDFPDRMRASESLEETSIEKE
                     RQLMDEKENDVPIVSVSSPYD"
     gene            359181..361171
                     /locus_tag="CNC01280"
                     /db_xref="GeneID:3256829"
     mRNA            join(359181..359462,359512..359694,359747..360350,
                     360403..360548,360601..360751,360809..361171)
                     /locus_tag="CNC01280"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41554851|gb|CF700692.1,gi|41555644|gb|CF701485.1"
                     /transcript_id="XM_569443.1"
                     /db_xref="GI:58264573"
                     /db_xref="GeneID:3256829"
     CDS             join(359205..359462,359512..359694,359747..360350,
                     360403..360548,360601..360751,360809..361155)
                     /locus_tag="CNC01280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569443.1"
                     /db_xref="GI:58264574"
                     /db_xref="GeneID:3256829"
                     /translation="MSTASPPALSPPAAKRIKLDTEGVPLSSPLKSQQDASELPPATS
                     APEALPAWTSTPPVDDFLSDEEELEDVKEEEDLTRRDMYLDTISRQSLDFDFEKLCSK
                     SLSNINVYACLVCGKYFQGRGKGSWAYRHAVGDNHRVWLNLDTEKFYVLPEGYPVSDP
                     SLNDILRVLHPRYNASDIKALSTLPAPSYTLSGQQYTPGFIGVNNIKKNDYCNVVIHL
                     LLHVPPLRNFLLNPDTPELQDDRRPTELVKRFATLARRLWNSHLFKSQISPHEFLQEV
                     SKRSNGKFKTTEQGDPVELLGWLVNTLHRDLGGSKKRNSSIIYSTFQGKVQIETQQVI
                     VHKEYARPVFDIGRDIQTISSPFLFLALDLPITPLFTDMNEKKIIPQVPLSQILAKFD
                     GKTTQEFGPSLKRHHLTSLPPYLILHIKRFTKNNFVEERNPTIVNFPLRGVEMSDYVD
                     PKPSDPMHTQYDLLSNVFLDTTTASTSSSGTGPGISKRNPAPGEENQMSWKIHVRAGR
                     AGGNANGSGEAENKGEKWFELQDLNVTEVRKEMVFLGETVVQVWERKDLSEGKK"
     gene            <361555..>362734
                     /locus_tag="CNC01290"
                     /db_xref="GeneID:3256169"
     mRNA            join(<361555..361693,361757..361789,361851..362130,
                     362186..362431,362486..362638,362704..>362734)
                     /locus_tag="CNC01290"
                     /product="aldo-keto reductase, putative"
                     /transcript_id="XM_569445.1"
                     /db_xref="GI:58264577"
                     /db_xref="GeneID:3256169"
     CDS             join(361555..361693,361757..361789,361851..362130,
                     362186..362431,362486..362638,362704..362734)
                     /locus_tag="CNC01290"
                     /codon_start=1
                     /product="aldo-keto reductase"
                     /protein_id="XP_569445.1"
                     /db_xref="GI:58264578"
                     /db_xref="GeneID:3256169"
                     /translation="MSLSLDSTIKLASGNLIPRLGFGVYQARSKECEDAVKKAIDTGY
                     RHVDTAQAYHNEENVGRAIRNSGVPRPSVFLTSKYMPSHTVYSPTEVLDVVRKSLKKV
                     DRCGDDKPYIDLMLIHAPWGGEEGRKNNWEALTIAQKEGWVKDIGVSNFGIHHLKALP
                     PPVPAVNQIELHPFCQQRDIVKYCEEHGIAIEAYSPLVRANKKHYDNEVLVKVAKKYG
                     KEVAQVLLRWSLQKGYIPLPKSVTPSRIESNADLYDFKLDQEDMAEIDGLDKGSEGAI
                     SWNPVNHDGEIDQDALR"
     gene            complement(362784..366806)
                     /locus_tag="CNC01300"
                     /db_xref="GeneID:3256418"
     mRNA            complement(join(362784..363486,363534..364051,
                     364104..364321,364374..364644,364701..364947,
                     365000..365898,365950..366501,366554..366806))
                     /locus_tag="CNC01300"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542523|gb|CF688364.1,gi|41542532|gb|CF688373.1,
                     gi|41552059|gb|CF697900.1,gi|41552071|gb|CF697912.1"
                     /transcript_id="XM_569447.1"
                     /db_xref="GI:58264581"
                     /db_xref="GeneID:3256418"
     CDS             complement(join(362908..363486,363534..364051,
                     364104..364321,364374..364644,364701..364947,
                     365000..365898,365950..366501,366554..366635))
                     /locus_tag="CNC01300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569447.1"
                     /db_xref="GI:58264582"
                     /db_xref="GeneID:3256418"
                     /translation="MIPSPRRAASTPAVQTWPDLDDDDGWQDMPVVRSDSNPFGLDEE
                     DQKKYHYRTSISLDDDPAGPSGTGNATGKHLELEADTLATDSWREKVEQDESDYTRIR
                     LDEDEESEEVHMRTKYLFNEDKAMTPLSQMQTTKELLTEGQRIAYVALCHLIMKRMLR
                     DMGRGWEGYKAKNKLGVKGKGKAEVPVVESGHIWMLKLMARLYQHMELTKDEQRMIES
                     LAEHGVDPSDLVPALMTTHTVNNPDFDPKEKERVDLEEALRKEAEADDEAEREAKAEE
                     ERHVVVEDQGASDTETEPPPPYEVEERSISFAASPMGKKASSSSLELLSKSINPFGFD
                     DDDVPKPLLGTKSPLSEGSFPNDSSTIISPQANVNPFGSDDENEGSLAVSEIRAPGAQ
                     SKAQTLSSFEKDEGDIGGAHSSPFSEPSNSPLDAAFASTADRPTPCRPQSLQTEDASQ
                     STSDATEKPSVDTKLTPKDEPVTLFDAADPQAPALLPALPGVSTSLSTTDEHVTLDIR
                     WTVLCDLFLVLIADSVFDARSRAFLVRVAAALGFDWLDVVRFENRVTEALEIQEGMEK
                     KGQHEIIEGRRKAARNKRYAMMGLAAVGGGLVIGLSAGLMAPFIGAGLGTAFATVGIT
                     GTTGFLAGAGGAAVITTGGVLTGANIAGKGMARRTREVRIFELKPLHNDKRVNCYITM
                     GGFMASKVDDVRLPFSVLDPVVGDVFSVLWEPEMMAEMGNALKILTSEILTQVGQQVL
                     QATVMTALMSALQWPLILTKLGYLIDNPWSNALDRARAAGLVLADVIIQRHAGVRPIS
                     LIGFSLGARAIFYALIELARQKAYGLVQEVFIFGTTVTASRDTWLDVRSVVAGRFVNG
                     YATNDWMLGYLFRATSGGLNTVAGLRPVETVWGLENVDVTEIITGHMSYRSCMPQLLA
                     KVGFPVTADYFDEPDDPEIDMNVQERTVVDEAEEEAKRNHKKVLGIFPVKKNRSSGSG
                     HNTPTTEKHSGASTPNPSVSQAAAGEYELEDDDLPPREEVDIGQMASEKDTSTPVEEE
                     KELEIKAVKQREEEEQKEREAIQAIPKTAGFDFQAISRELGKDIDVDKLKEPEPRYFP
                     PALMEIRAPLERSGSAPPPTSFVPPPAEKNVWV"
     misc_feature    363123..363192
                     /note="CT-rich"
     gene            complement(367009..369715)
                     /locus_tag="CNC01310"
                     /db_xref="GeneID:3256466"
     mRNA            complement(join(367009..367295,367355..367428,
                     367481..367524,367578..367711,367761..367783,
                     367838..368172,368227..368796,368850..368997,
                     369056..369061,369115..369178,369236..369297,
                     369540..369715))
                     /locus_tag="CNC01310"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546409|gb|CF692250.1,gi|41546417|gb|CF692258.1,
                     gi|41550519|gb|CF696360.1,gi|41552309|gb|CF698150.1,
                     gi|41552311|gb|CF698152.1,gi|41566028|gb|CF711869.1,
                     gi|41566039|gb|CF711880.1"
                     /transcript_id="XM_569962.1"
                     /db_xref="GI:58265611"
                     /db_xref="GeneID:3256466"
     CDS             complement(join(367163..367295,367355..367428,
                     367481..367524,367578..367711,367761..367783,
                     367838..368172,368227..368796,368850..368997,
                     369056..369061,369115..369178,369236..369297,
                     369540..369569))
                     /locus_tag="CNC01310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569962.1"
                     /db_xref="GI:58265612"
                     /db_xref="GeneID:3256466"
                     /translation="MPPKDPTFSDDEASSGRGDSAQPEDIHGRGSSSSARKAQNRIAQ
                     REFRLRKQQYIRDLEAKVQMLEGDKEERVELMTLLVRNLMKENKDLRHMLRLTASFIG
                     EGLGSCLPRLGLSADQLDAILNRADTDTVYEAFINLKASRELEMSNPGIKLGEPRRRA
                     GNLPPKRKRTEDEGGTPIGPAETPEDGASSAGKEKGKTSQNSDISNSKRIKSVFDQPI
                     PSDEYTYLFPDLDSMLMASESFDDPSISRFDINGQMGQSRVPNELPRVDYGQQQRLMS
                     SNTGNVRFPSYNGSTALAGDPLAANLAVSNSSSANYPPSNPSMPSCVTPVRPVAPLVN
                     EGNQSTRRSSTSNEPSTQSDSIRRLAAEHRGAFDGPGMTSQEIEERRKAEDSLIKSIE
                     EGDTPDRKLEAMQLITYHLNNFRMNHEYHLPPSLRPTVVQRTVPHEHAIDGICFPSLR
                     DRMILLRGRYDLVEVFHSLLAEFTLHGDDVLDHRSYEVSEKFIHDYSILVDDSIVAIS
                     NKWRALRGEPPIQWPLKDQGQNQLILSGATSQ"
     gene            complement(369798..370974)
                     /locus_tag="CNC01320"
                     /db_xref="GeneID:3256337"
     mRNA            complement(join(369798..370161,370215..370399,
                     370450..370507,370583..370716,370768..370974))
                     /locus_tag="CNC01320"
                     /product="expressed protein"
                     /transcript_id="XM_569961.1"
                     /db_xref="GI:58265609"
                     /db_xref="GeneID:3256337"
     CDS             complement(join(369907..370161,370215..370399,
                     370450..370507,370583..370716,370768..370954))
                     /locus_tag="CNC01320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569961.1"
                     /db_xref="GI:58265610"
                     /db_xref="GeneID:3256337"
                     /translation="MSLIPSSSPSSVPFFVPHLGPSSKHGVYPTPGGKGKGKELFGGG
                     KGFDPEEEVDDREWDMRVARAMIHLQETLPHFFNAEMTAATMLPPDIYSQNMLLKLPA
                     PLPLKISSLSGYSMAFSLTRNGMQALHTDLRSEMERMTFSPSPQDMGQESKRAAVLLA
                     RKGIPSHRMKQIRVLVSVYGTLRLPPHKEAKWHTSSLYTFSPTSGLIVSHEVETIRPL
                     PGEGVAEWMMSRLLGWTSKNAGHEGAIPCPRTVALPPEHRVARFREEREEKRED"
     STS             370143..370951
                     /standard_name="Xba14"
                     /db_xref="UniSTS:470777"
     gene            371473..374174
                     /locus_tag="CNC01330"
                     /db_xref="GeneID:3256639"
     mRNA            join(371473..372118,372174..372287,372351..372377,
                     372430..372487,372542..372598,372657..372793,
                     372854..373071,373137..373259,373313..373416,
                     373465..373518,373570..373670,373723..373777,
                     373844..373969,374023..374174)
                     /locus_tag="CNC01330"
                     /product="polyamine transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531531|gb|CF677372.1,gi|41531539|gb|CF677380.1,
                     gi|41535434|gb|CF681275.1,gi|41535439|gb|CF681280.1,
                     gi|41541845|gb|CF687686.1,gi|41541855|gb|CF687696.1,
                     gi|41551865|gb|CF697706.1,gi|41565854|gb|CF711695.1,
                     gi|41565865|gb|CF711706.1,gi|41575414|gb|CF721255.1,
                     gi|41575422|gb|CF721263.1"
                     /transcript_id="XM_569449.1"
                     /db_xref="GI:58264585"
                     /db_xref="GeneID:3256639"
     CDS             join(371673..372118,372174..372287,372351..372377,
                     372430..372487,372542..372598,372657..372793,
                     372854..373071,373137..373259,373313..373416,
                     373465..373518,373570..373670,373723..373777,
                     373844..373969,374023..374073)
                     /locus_tag="CNC01330"
                     /codon_start=1
                     /product="polyamine transport-related protein"
                     /protein_id="XP_569449.1"
                     /db_xref="GI:58264586"
                     /db_xref="GeneID:3256639"
                     /translation="MEKVGGTRNIVSEKGQSSMDHDYDTESYPIVNCGKPLPFQHNKR
                     RRSSTGVVETSTPAPPPEIELSSTSLSSREARQVITSFPTSPANPINWATRKKWTITA
                     ILALTGFISTAGSSIGVPGLHAVMSEFGETNEKIGVLIAGAYVLGLGTGPFVFAPVSE
                     LYGRQIAYISSQIFYVLFTLGTGFTQSMTALIILRFFCGCFASPPPSLGVATCADMFL
                     PHERGKPISLYALGPIGGPIIGNMIGYWLLFGGWRWAYYFMTIVAFFNFVLMVFFLRE
                     TYAPAIQKIMDYQITHPLSPSTSRRRHHLPKLTWMMAMVSKEDAKAVYGRAFSRPPRL
                     LFTNPVAFAFSLYYAYVYGIIYLFLVALPLLYGKPPFSQPALFSYEWPLATMGLPYIS
                     MGLGFVSAVAIASQCQDRIYKHFSKINGDNGQPEYRLVLTQIGMCIMPIGLFIFGWTA
                     NAEVHWMGPFVGQAVMGIGLMLAFNTIQNFFVDAFYPYSAAAVAGATAARSVVACIMP
                     LFTTTMFVKLGWGWGGTLIACIAIVGIPAPMIMFFFGQRLRERYAFQG"
     gene            complement(374149..376333)
                     /locus_tag="CNC01340"
                     /db_xref="GeneID:3256401"
     mRNA            complement(join(374149..374418,374479..374811,
                     374866..374943,375005..375520,375570..375664,
                     375721..375832,375893..376057,376115..376333))
                     /locus_tag="CNC01340"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534814|gb|CF680655.1,gi|41534819|gb|CF680660.1,
                     gi|41550563|gb|CF696404.1,gi|41570421|gb|CF716262.1,
                     gi|41570438|gb|CF716279.1"
                     /transcript_id="XM_569451.1"
                     /db_xref="GI:58264589"
                     /db_xref="GeneID:3256401"
     CDS             complement(join(374293..374418,374479..374811,
                     374866..374943,375005..375520,375570..375664,
                     375721..375832,375893..376057,376115..376261))
                     /locus_tag="CNC01340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569451.1"
                     /db_xref="GI:58264590"
                     /db_xref="GeneID:3256401"
                     /translation="MSMIQKTPPRLPASFLVEESSETPGPSRARINNLQHQVSELVRK
                     NQTLERKLTAVKSASENDLKEKAAKLNEMQVSLHNTQRELERSKKDLERCVLEGSEMK
                     EELQLHSMVQQQKALLAVAQEQMLVVELETRLLDAEKARILRDHKITLFQAKEEELVR
                     EIEERDIRIEDLEAMLERSNASLEQERNAIRKASSSQLTSSKDLTKAQMELEFARAEI
                     NTLEDKVTSLETKVRGLKDREKEARSELESWLREEGSASKHQKEKKESQIQLRAMKSE
                     LEKKKEEIEELKEELEEAVRSGKEKEKILKKRLRDANEEKERLLGIEEELHGLRAGIS
                     KTSPGNRKIRKESPVKEGSGDEVTTKKKAKKAETAVSPSKLSSKARAKTKASVDSSSE
                     LDDSAPAPIKKSKAARKSPIKSKPKSIAVEVSDAENEVDSLKTRSSKNEVVEHKPMEK
                     EEQAASANEKKKKKRILGTQPPPTFNWDPVMNSGDGVIPAYLSPLKPDSVRATGTIPR
                     AGFPSLPSSRLNRFG"
     gene            378309..379340
                     /locus_tag="CNC01350"
                     /db_xref="GeneID:3256349"
     mRNA            join(378309..378442,378502..378559,378612..378810,
                     378878..378969,379027..379340)
                     /locus_tag="CNC01350"
                     /product="expressed protein"
                     /transcript_id="XM_569453.1"
                     /db_xref="GI:58264593"
                     /db_xref="GeneID:3256349"
     CDS             join(378429..378442,378502..378559,378612..378810,
                     378878..378969,379027..379185)
                     /locus_tag="CNC01350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569453.1"
                     /db_xref="GI:58264594"
                     /db_xref="GeneID:3256349"
                     /translation="MAGSWFRSLKPFLMGLLLVTAYSSFILDIIMIIKVRHYSNTYPP
                     AVVALLVCSLLEALYCLCLLVKSGRGAAFRASAVAGALAFFACFSFACVVATTVLRHH
                     RQYCNPDLEDNSDLCGVLRGTMGLGWMLFGLNLIWLCLMPVLVSGQGTWSHYYNDLPY
                     EERDIEEEKAPVH"
     gene            complement(<379325..380805)
                     /locus_tag="CNC01360"
                     /db_xref="GeneID:3256492"
     mRNA            complement(join(<379325..379689,379743..379951,
                     379998..380043,380100..380370,380423..380504,
                     380553..380805))
                     /locus_tag="CNC01360"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41560807|gb|CF706648.1,gi|41560815|gb|CF706656.1"
                     /transcript_id="XM_569960.1"
                     /db_xref="GI:58265607"
                     /db_xref="GeneID:3256492"
     CDS             complement(join(379325..379689,379743..379951,
                     379998..380043,380100..380370,380423..380504,
                     380553..380740))
                     /locus_tag="CNC01360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569960.1"
                     /db_xref="GI:58265608"
                     /db_xref="GeneID:3256492"
                     /translation="MIMAEVSSSASATHTKQYKPYFSPANVERLSAKQRGKLSVSREE
                     RARQQACGFIDAVGVRCGFPRRTIATAQTLYMRFHLFFPYKDFSYIEVALATLYVSSK
                     LHDTLKKPRDIILASFPIRFPHLLRKGTIDPSVAQAHGLDSERARILSIERLVLESMA
                     FKFSANDGLRPVIKIGKKLGLNKDFCKICWKVAVDSYRTPAPLSYPPHIIALGSIYTA
                     ALLTMESLSLETAEIMDQTRTPRGIVELLGNTGSWEEDYVAGVTHVDEVVHALLDLYH
                     TVLSNPENQALQAPSPVSPKEPLGSTAATSALSSSGTTAFPLSAFWTPQTLTKLKISL
                     RERRGGLTAMPGWATEDTGETDEVAEGMGKNDVTIRFLWDEDLMACARECSH"
     gene            380964..>382639
                     /locus_tag="CNC01370"
                     /db_xref="GeneID:3256480"
     mRNA            join(380964..381181,381232..381404,381457..381512,
                     381566..381720,381769..>382639)
                     /locus_tag="CNC01370"
                     /product="pseudouridylate synthase 4, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544464|gb|CF690305.1,gi|41570051|gb|CF715892.1,
                     gi|41570062|gb|CF715903.1"
                     /transcript_id="XM_569456.1"
                     /db_xref="GI:58264599"
                     /db_xref="GeneID:3256480"
     CDS             join(381105..381181,381232..381404,381457..381512,
                     381566..381720,381769..382639)
                     /locus_tag="CNC01370"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /product="pseudouridylate synthase 4"
                     /protein_id="XP_569456.1"
                     /db_xref="GI:58264600"
                     /db_xref="GeneID:3256480"
                     /translation="MPKALPTPTLPLNGLFPIAKPSGKSSMRVIDRITPLLLDSKLFD
                     DPVKRAQPQMKGKRKKNLTQFGLKIGQGGTLDPLADGVLVLGVNRGTKHLNQFLECSK
                     EYESIGLIGATTTSMDADDPVLSTAPWEHITREDVEKVLDRFRGEIMQVPPIFSALKM
                     DGKPLYEYARESKPLPRPIPARKCQVSIELIDFTPASVTPGDGGHDYHWPEKRLTSEE
                     KETFRRLTEIVHNAQTGPVETAKTSGNKDQVEEEKLRVVEPLVPDLDAPEYPEISPNN
                     GLRPPTFTVRMTVSSGTYVRSIVNDIGLALGCGAHVVKLTRTRQGEFSLYGDEKALST
                     ASASAPAEGEEASVNEDRREAPGPSGGSIPWTVWERALAERDEMIKREKLEKEEAIMA
                     GMSAEEIHQVYNPEAIKQRRWEGGWKEWEVEVLKRFKPVPVPINGGHGFRI"
     gene            383914..385668
                     /locus_tag="CNC01380"
                     /db_xref="GeneID:3256555"
     mRNA            join(383914..384023,384086..384632,384685..384820,
                     384886..384975,385041..385230,385302..385668)
                     /locus_tag="CNC01380"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540531|gb|CF686372.1,gi|41540540|gb|CF686381.1,
                     gi|41568683|gb|CF714524.1"
                     /transcript_id="XM_569459.1"
                     /db_xref="GI:58264605"
                     /db_xref="GeneID:3256555"
     CDS             join(383920..384023,384086..384632,384685..384820,
                     384886..384975,385041..385230,385302..385566)
                     /locus_tag="CNC01380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569459.1"
                     /db_xref="GI:58264606"
                     /db_xref="GeneID:3256555"
                     /translation="MYWYISFLRPPPVSTSNTDQRITITPQVANDLRTELRYEPTTIY
                     YTWQRVIPSISIATTLQELTTFIPPGSTYKPLDVPLPKNVQVGESWRLGLFSHNENPH
                     SSNGLLSGEERKWKLEPTNELLDLIDDTPDVLGVWSEGIEIARAVSGLNSGTIRGLGR
                     QKEPSIDKGKSKGKSKGKEKEKERDDRPKQGRIMREWALPEEGTLRIIEQTSFDLDKK
                     VWDSGLALSAWFWKHLANEGSLPLTGQKIFTLLKRQEKLRIVELGTGTGLVSIVLSLA
                     LKRIASLERKITATDLESAIPLMDENIALNNLNSQMNHISTDHENEQGEQSKGTLVDA
                     RVLDWDQPIPAWVNNDHPELVIAADVTYNTSAFPSLLSTLTSLLLPSASSASLPNRPL
                     LVLAYKERDPAERELWGMLKEKGIDMVMVDEIKGAEDYGSTEIWIGGSSLS"
     mRNA            join(383922..384023,384086..384121,384190..384632,
                     384685..384820,384886..384975,385041..385230,
                     385302..385668)
                     /locus_tag="CNC01380"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41540531|gb|CF686372.1,gi|41568683|gb|CF714524.1,
                     gi|41568691|gb|CF714532.1"
                     /transcript_id="XM_569458.1"
                     /db_xref="GI:58264603"
                     /db_xref="GeneID:3256555"
     CDS             join(384094..384121,384190..384632,384685..384820,
                     384886..384975,385041..385230,385302..385566)
                     /locus_tag="CNC01380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569458.1"
                     /db_xref="GI:58264604"
                     /db_xref="GeneID:3256555"
                     /translation="MSPPRYTILGSTYKPLDVPLPKNVQVGESWRLGLFSHNENPHSS
                     NGLLSGEERKWKLEPTNELLDLIDDTPDVLGVWSEGIEIARAVSGLNSGTIRGLGRQK
                     EPSIDKGKSKGKSKGKEKEKERDDRPKQGRIMREWALPEEGTLRIIEQTSFDLDKKVW
                     DSGLALSAWFWKHLANEGSLPLTGQKIFTLLKRQEKLRIVELGTGTGLVSIVLSLALK
                     RIASLERKITATDLESAIPLMDENIALNNLNSQMNHISTDHENEQGEQSKGTLVDARV
                     LDWDQPIPAWVNNDHPELVIAADVTYNTSAFPSLLSTLTSLLLPSASSASLPNRPLLV
                     LAYKERDPAERELWGMLKEKGIDMVMVDEIKGAEDYGSTEIWIGGSSLS"
     gene            complement(<385648..388651)
                     /locus_tag="CNC01390"
                     /db_xref="GeneID:3256832"
     mRNA            complement(join(<385648..385749,385862..386235,
                     386288..386453,386520..386626,386681..386798,
                     386853..387298,387347..387431,387480..387743,
                     387791..387927,387983..388018,388078..388651))
                     /locus_tag="CNC01390"
                     /product="transcription coactivator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545227|gb|CF691068.1"
                     /transcript_id="XM_569461.1"
                     /db_xref="GI:58264609"
                     /db_xref="GeneID:3256832"
     CDS             complement(join(385648..385749,385862..386235,
                     386288..386453,386520..386626,386681..386798,
                     386853..387298,387347..387431,387480..387743,
                     387791..387927,387983..388018,388078..388135))
                     /locus_tag="CNC01390"
                     /codon_start=1
                     /product="transcription coactivator"
                     /protein_id="XP_569461.1"
                     /db_xref="GI:58264610"
                     /db_xref="GeneID:3256832"
                     /translation="MTVTQRKPRVDNAQNDSRPIIEPGIKYTCDFCHVDITHTVRIKC
                     AMKQCEEVDLCPTCFCEGKEGLQHKAWHDYMVVEQNSQPIFTPDWGADEELLLISGLI
                     QNGLGNWAEVAQHVGTRTKEECEQHYLQVYLGVGEHGEDLRVKEKEADEKVDESKRRR
                     REFMPPMDRSFPYDPDEFQQRKKARIEELRKPQALPPSNAAPPVSAPTNHEIGGFMPA
                     RLEFEHEVDNDAEMAVKDMEFGLVMQYGGDEQPQAKITRPPDEEEEEDEEGGGEDEKG
                     VEKKGKVKKEKQKEDEKEDKPVSPAIEDPDELEVKLAMMDIYFSKLDKREDAKEIIFD
                     RGLTEYRAIQAQDKKLTKEERELVQRYKPFAKLQTAEDFEVLVEGLIYEQTLRRRIAE
                     LQEYRRMGITTAAEADVYDNVKNTRSMEFPTQKPAEVLPSGARINAGQHRFLHGTMAT
                     PLPDAKTREPTPRAIPAVGRKPPQPLNLANSASLDLLSSEEQSLCSTLRVLPKPYLTI
                     KELYIRENERRQGLLRRRDARKMLNIDVNKSGRIFDFLVQSGMLVLAYEPQGKGKASL
                     QAAAAAVAHGAANGMTTMDGQSQGKDMLMERKKQGVQNDIFIEARQKYQNKQLALWFL
                     GCKKYA"
     misc_feature    386995..387102
                     /note="CT-rich"
     repeat_region   388540..388649
                     /rpt_type=tandem
                     /rpt_unit_seq="gggtg"
                     /satellite="microsatellite"
     gene            388938..390478
                     /locus_tag="CNC01400"
                     /db_xref="GeneID:3256334"
     mRNA            join(388938..389285,389332..390478)
                     /locus_tag="CNC01400"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535532|gb|CF681373.1,gi|41535546|gb|CF681387.1,
                     gi|41539690|gb|CF685531.1,gi|41539699|gb|CF685540.1,
                     gi|41540905|gb|CF686746.1,gi|41547385|gb|CF693226.1,
                     gi|41547390|gb|CF693231.1,gi|41553152|gb|CF698993.1,
                     gi|41553159|gb|CF699000.1,gi|41554365|gb|CF700206.1,
                     gi|41554377|gb|CF700218.1,gi|41565403|gb|CF711244.1,
                     gi|41565418|gb|CF711259.1,gi|41576510|gb|CF722351.1,
                     gi|41576521|gb|CF722362.1"
                     /transcript_id="XM_569463.1"
                     /db_xref="GI:58264613"
                     /db_xref="GeneID:3256334"
     CDS             join(388979..389285,389332..390437)
                     /locus_tag="CNC01400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569463.1"
                     /db_xref="GI:58264614"
                     /db_xref="GeneID:3256334"
                     /translation="MRTSLIRNMSKSYDSIILGAGWAGSVAAKELTSKGHRVLVLEAR
                     DRVGGRARTWTGGGAKIDIGCSWIHGYKEGNPARDIAKSLGVEARLPAAAEGVIYGPN
                     GPLSAEEADALRASLGTAVASSKLPHPSPPPTTSLASALFSPNSALLSTASDQSLAKA
                     LARSLEIPLGLKLEQASLKWAGWETTTSYAGSDAAPDGGYQSLVTKVLESSKAEVKLN
                     SPAVSIKETSSGVEVTTQSGETYSAASVLSTIPLGVLKSLPENFFTPALPAHLRETIG
                     GTHVGVLEKLLVQYPTAWWPNAEKVGSYTFLPTGPEPSASSTLEQVFEGSTLITANFA
                     APTLPGPTPTLLTYLSETPAKILLQHPTEKVAEAFHSFLVKRFSPSSRPPAPSASALT
                     TWLTDPLSRGATTTPSIISTGERSPMDFKELSRPVWGGKLGFAGEHTEMDNRGSVAGA
                     VISGFREADRIDKWLAARKE"
     gene            complement(390533..391120)
                     /locus_tag="CNC01410"
                     /db_xref="GeneID:3256469"
     mRNA            complement(join(390533..390724,390788..390887,
                     390956..391120))
                     /locus_tag="CNC01410"
                     /product="ribosomal protein S20, putative"
                     /transcript_id="XM_569465.1"
                     /db_xref="GI:58264617"
                     /db_xref="GeneID:3256469"
     CDS             complement(join(390571..390724,390788..390887,
                     390956..391061))
                     /locus_tag="CNC01410"
                     /codon_start=1
                     /product="ribosomal protein S20"
                     /protein_id="XP_569465.1"
                     /db_xref="GI:58264618"
                     /db_xref="GeneID:3256469"
                     /translation="MAEYKEDLEKTGAGAQKIHKIRITLTSKNVKPLEKFCADLINRA
                     KDRDLNVRGPVRLPTKVLKHTTRKSPCGEGSKTWDRYQMRIHKRLIDLNSSADVVKQI
                     TSISLEPGVEVEVTIAA"
     gene            <391376..>392067
                     /locus_tag="CNC01420"
                     /db_xref="GeneID:3256211"
     mRNA            join(<391376..391418,391498..391637,391714..391797,
                     391877..391954,392038..>392067)
                     /locus_tag="CNC01420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569469.1"
                     /db_xref="GI:58264625"
                     /db_xref="GeneID:3256211"
     CDS             join(391376..391418,391498..391637,391714..391797,
                     391877..391954,392038..392067)
                     /locus_tag="CNC01420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569469.1"
                     /db_xref="GI:58264626"
                     /db_xref="GeneID:3256211"
                     /translation="MVRLITHNMLACHVKNCTKDNFPLVFSEVELVERPAPINPDFIK
                     RFLPKLDWKALVDTARSLGDTSLPDTMPENWTDEEIQALHHVLFELHVEEGIMTCRGC
                     GHAYPVANGIPNMLLAEHEVGR"
     gene            complement(392120..394555)
                     /locus_tag="CNC01430"
                     /db_xref="GeneID:3256507"
     mRNA            complement(join(392120..393405,393457..393577,
                     393624..393969,394019..394123,394172..394240,
                     394290..394555))
                     /locus_tag="CNC01430"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544138|gb|CF689979.1,gi|41544141|gb|CF689982.1,
                     gi|41573141|gb|CF718982.1,gi|41573148|gb|CF718989.1"
                     /transcript_id="XM_569471.1"
                     /db_xref="GI:58264629"
                     /db_xref="GeneID:3256507"
     CDS             complement(join(392154..393405,393457..393577,
                     393624..393969,394019..394123,394172..394240,
                     394290..394535))
                     /locus_tag="CNC01430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569471.1"
                     /db_xref="GI:58264630"
                     /db_xref="GeneID:3256507"
                     /translation="MTAPTVPADQHGHPLPGPADPAANDTWRPSRYREPLHPDNEEVL
                     EQAAYQAAVTRSSGDDRKRKIKPRRTVDYQGGVQKWRMLNKLKGVHEFRPAIHPNPSD
                     IVNFLPPVALRSNPSTSICDYWVHTSINKERSPTRVVRWTPDARRLLTGNDKGQFTLW
                     NGASFNYESITQVHDDSIRSFTYSHNGQALVSADKGGTIKYFTPHLTNIHGFQGHREA
                     CHDVSWSPNDERFVTCGDDGLVKIWSYREAKEERSLSGHGWDVRCVDWHPTKGLIVSG
                     SKDMLVKFWDPRTGKDLSTLHSSKSTINTCRWSPDGHLVATAGQDSVIRLFDIRTFRE
                     LEVLKGHEKEVNCIEWHPIHHSLLVSGDALGTINYFSLLSPTPSTPITTLSAAHEDAV
                     FSLSFHPLGHILCSGSKDFTARFWCRARPPGGQEFDKWHLTEEGAAQKELERITKREW
                     GTNAPPANAAGGGGGGGGDKQQVALPGLSNLVAAVNSVKTGPTTTGGGPSGLPGLGAP
                     NVHAGTPPSRVSTPSSMGPPGPGAQGQAQGGQFPRGRSALPSQNDMLRHNHGSRGGFA
                     DRDRNGGGDRGGMDRDRDSRGGRQDPRGNQMYGRGPGGPPPGPPPGQGGYNYPPAPPN
                     YPPYPPSSYPPPPNNQPGYPPAPNYAMPPGPGAPPQSYPYNRPPQGPPQNNNPGGQGN
                     YGASASGGYGQYGGGGGGGGGGGYGRDGRR"
     STS             392775..392948
                     /standard_name="GGC5"
                     /db_xref="UniSTS:470778"
     repeat_region   392888..392912
                     /rpt_type=tandem
                     /rpt_unit_seq="ccg"
                     /satellite="microsatellite"
     gene            <394683..397472
                     /locus_tag="CNC01440"
                     /db_xref="GeneID:3256695"
     mRNA            join(<394683..395925,395990..396193,396267..396364,
                     396453..396647,396725..396888,396942..397105,
                     397181..397472)
                     /locus_tag="CNC01440"
                     /product="mRNA (guanine-N7-)-methyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538414|gb|CF684255.1"
                     /transcript_id="XM_569474.1"
                     /db_xref="GI:58264635"
                     /db_xref="GeneID:3256695"
     CDS             join(394683..395925,395990..396193,396267..396364,
                     396453..396647,396725..396888,396942..397105,
                     397181..397215)
                     /locus_tag="CNC01440"
                     /codon_start=1
                     /product="mRNA (guanine-N7-)-methyltransferase"
                     /protein_id="XP_569474.1"
                     /db_xref="GI:58264636"
                     /db_xref="GeneID:3256695"
                     /translation="MVYDPIRDCDVPAPHISAPPLSRSRSPPPPHRTPSASGSLRGLL
                     NDSPPPREPPRAASVHEDAESHRPKLSNILNDAEPPRQRSMLPPQQPIHAELEHGRRT
                     SAGSHAAQLARSPSMSLSPRSQNQSLPYPSSRPGSAAGSAHPFGYDPRQGTLSPVLSA
                     RRTSEDQPRPTSSSSASGRRYTEPASQTPAPAPLGSSAYRPRHTSTPGNPSSAYAPRF
                     TPQPTTTPSSPSTSQHTPYTPHHSAPPRILHYNPHRQSAPSSVLRPIYPDEVAHLRQL
                     AHANNPLRQKPAARRYSYSGGRAPEPTPTPRTSLPGENDHSYFPPQWDDRPSMPPSEV
                     SYGGPPSSTPGAPPSGYSQYPPNWEAQTPGGNWDGERPGRLGKRRARDEEDDEYERNK
                     RVVSGPVAGQAYSKKVTVVAEHYNSRPEVGVERREFSPIIGLKKFNNWIKSVLIGKFA
                     YRPRGKVLDVGCGKGGDLNKWKQARIALYVGLDVADQSVQQAADRYRRMPKPGFDAFF
                     YAHDCFSNPLSDVLSPELQIKDLYDNVTMQFCMHYAFENAAKARMMIENVSRYLRRGG
                     IFIGTIPNAELLLQLPDRDEELRFGNSCYSIQFTERRHKGVYGHDYRFYLTDAVEDVP
                     EYLVDWENFVSLASESGLRLVYKKAFHEILQEEKDSRDFGPLLGKMGVLNEYGESAMD
                     ADQWEAANLYMGFAFEKM"
     misc_feature    394712..394776
                     /locus_tag="CNC01440"
                     /note="C-rich"
     gene            complement(397490..399694)
                     /locus_tag="CNC01450"
                     /db_xref="GeneID:3256519"
     mRNA            complement(join(397490..397579,397655..397745,
                     397815..398254,398323..398497,398546..398624,
                     398776..399694))
                     /locus_tag="CNC01450"
                     /product="triacylglycerol lipase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537092|gb|CF682933.1,gi|41537105|gb|CF682946.1,
                     gi|41547005|gb|CF692846.1,gi|41547007|gb|CF692848.1,
                     gi|41558638|gb|CF704479.1"
                     /transcript_id="XM_569970.1"
                     /db_xref="GI:58265627"
                     /db_xref="GeneID:3256519"
     CDS             complement(join(397550..397579,397655..397745,
                     397815..398254,398323..398497,398546..398624,
                     398776..399646))
                     /locus_tag="CNC01450"
                     /codon_start=1
                     /product="triacylglycerol lipase"
                     /protein_id="XP_569970.1"
                     /db_xref="GI:58265628"
                     /db_xref="GeneID:3256519"
                     /translation="MLPRAPRTLYHPTKAMYQPHKVGNSARQTFNSQSRSDIRHHQQP
                     PSTETADGAAKSRRKGKQRADPLLIQPNPGKEREIEGSTSSVPALIDEAIHTSISPTS
                     LSSSLESSFDRACPSPIPEPPRVHYPPSLRPRHPRLLSQLARSTLPTASVSCPSLEQP
                     QHGRRWSVSESMVIGAGEGSSLWQRSVPTTALSDEPFPDLDPTTGLPLELSFHRRGSA
                     SSDTPSLHLQRTITGLLSAPTAKSAGESSVANMMPNFNFSLPRVSFPSKPSLDFGKRN
                     FSTSSSQDDWGSWANRSPKHPVVFCHGLLGFDYLGPASMPPLQISHWRGIREVLESNG
                     VEVLIARVPATSSIKDRARILADFISEKYPGREINLVGHSMGGLDCRYLVSQIKDKSF
                     KPISLTTISTPHRGSPFADYLIDNVIGRERLPSLLGLLETMRLPQSGDGSAFSALGTN
                     SMKEFNAEVVDSEDVKYYSWGASFEPGLLDTFKWPHSIIYAKEGANDGLVSVHSAMWG
                     EYRGTLVGVNHLDLVGWVNTVRYAVAGWTGKPIAFKPATFYLEVTDYLAEQGF"
     gene            402160..403089
                     /locus_tag="CNC01460"
                     /db_xref="GeneID:3256478"
     mRNA            join(402160..402466,402529..402631,402681..403089)
                     /locus_tag="CNC01460"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41562390|gb|CF708231.1"
                     /transcript_id="XM_569476.1"
                     /db_xref="GI:58264639"
                     /db_xref="GeneID:3256478"
     CDS             join(402173..402466,402529..402631,402681..402979)
                     /locus_tag="CNC01460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569476.1"
                     /db_xref="GI:58264640"
                     /db_xref="GeneID:3256478"
                     /translation="MDGCYEEVRNDGKFSTQISLLQDHVRSSLSMATELRLSSAPSHL
                     VLPHVLSAVQLSSELGMWRLYRFGVVVLAEVMLGMEAVPLSKKAIHEIESVWSQLIAS
                     DDYEALARGALVIAKGYIELSLDSGSTAEHDSANDHLFQAFTYAKLLESRSLVMEITS
                     LLALLSELRLSGEFADSAYIRGSKKSRDSMVDAYEEAQKGVGEAFSKGDMIVREVAEV
                     VKWVGVRVAEGWK"
     gene            403478..>406044
                     /locus_tag="CNC01470"
                     /db_xref="GeneID:3256187"
     mRNA            join(403478..403507,403563..403655,403708..404036,
                     404092..404361,404415..404887,404934..405350,
                     405398..>406044)
                     /locus_tag="CNC01470"
                     /product="GTP-binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533857|gb|CF679698.1,gi|41533875|gb|CF679716.1,
                     gi|41537450|gb|CF683291.1,gi|41537460|gb|CF683301.1,
                     gi|41572937|gb|CF718778.1,gi|41572945|gb|CF718786.1"
                     /transcript_id="XM_569478.1"
                     /db_xref="GI:58264643"
                     /db_xref="GeneID:3256187"
     CDS             join(403505..403507,403563..403655,403708..404036,
                     404092..404361,404415..404887,404934..405350,
                     405398..406044)
                     /locus_tag="CNC01470"
                     /codon_start=1
                     /product="GTP-binding protein"
                     /protein_id="XP_569478.1"
                     /db_xref="GI:58264644"
                     /db_xref="GeneID:3256187"
                     /translation="MPPRTKVQSSGLGKALINRKAKEAVAPKESQLYTLDDNNPLASV
                     THERDLDEFLANAALADQDFTTERTKLRVISAPNMPTPSTNPFLLSAEEEKEVTKKKR
                     DFQGDLTVPRRPPWTRQMTRLELEKQERESFLEWRRDIAKLAETSNLLLTPFERNVQL
                     WRQLWRVLERSQLVVQIVDARNPLGFRCQDLENYVKEIGSDENDEEITVAGKGKRRSL
                     LLINKADLLTYDQRSAWAEYFEKEGISYAFFSAANAAAAQEQAEKQRLRQQEEYDGPK
                     GSSEENEEESEEQQDETEDEQDETEEEHLINDLRETHLDEEDWSSESAGRSGNVSRSE
                     VDEKLAEGQTLSLSEVAQDVGARFGESTEQEDVRTRVLTVTELEDLFINAAPDLKDFA
                     TPQHPNPKLMVGLVGYPNVGKSSTINSLLGAKKVSVSATPGKTKHFQTLVLSDTITLC
                     DCPGLVFPQFANTQADMVVDGVLPIDQMREYSAPVDLLCKRIPREILEGTYGIRIDVK
                     DEEEGGTGKVGWEEFLSAYAIARGMTRSSFGMPDTSRAARYVLKDYVNAKLLFAHPPP
                     GIDADDFMSVSRAETIARIEESYENGRKRAPVTHVSKNADTYVQPASAKAKDSLDDET
                     EQGQDQTKRERQSTSRQVKSTAASAPARSGREKASALDSVYFNESGAQPRLVIKGRNQ
                     PGDAQEGGQGFSRTTRYPHQRLLGPDGMPILGAGGRDLGGANGKKHFKRKEGKKRSGK
                     GYD"
     gene            406538..408787
                     /locus_tag="CNC01480"
                     /db_xref="GeneID:3256271"
     mRNA            join(406538..406780,406880..407062,407126..407334,
                     407392..407722,407778..407905,407950..408158,
                     408218..408443,408494..408562,408613..408787)
                     /locus_tag="CNC01480"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542892|gb|CF688733.1,gi|41542898|gb|CF688739.1,
                     gi|41548036|gb|CF693877.1,gi|41548040|gb|CF693881.1"
                     /transcript_id="XM_569480.1"
                     /db_xref="GI:58264647"
                     /db_xref="GeneID:3256271"
     CDS             join(406625..406780,406880..407062,407126..407334,
                     407392..407722,407778..407905,407950..408158,
                     408218..408443,408494..408562,408613..408634)
                     /locus_tag="CNC01480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569480.1"
                     /db_xref="GI:58264648"
                     /db_xref="GeneID:3256271"
                     /translation="MLRTSGSTNKVLLSRLGCRLMQTQTAGGRAPNLPLPSMVGSKPP
                     RKEREEGNISSVFSSLSGEAEKPLPPRFAELKRTIIGEEANQRRLIAGWERLTKRLRD
                     AAEEIERKQQDNIPQTSYDEFINGGNASLIERIKACGAVIIRGVVDEQTALKWLEDVK
                     AYIAKNPSVKGFPENDKQVFELYWSKSQLAARSHPRSMAIQRALLSLFSHNPSAPVSL
                     HTPVTYADRLRIRHPGDAQFALGPHADGGSVERWEDETYRKVYQRCLEGRWEEFDAWT
                     IGERALANQNMYDGPGSCGVFRAFQGWTSMSDTGPNEGTLRVYPLIKELTAYTMMRPL
                     FREKQPRATLSRDEYLSPANWELDFETSRFPNSPLARCQEYNDETHPHLELERTMVSV
                     PRVKPGDQAWWHGDMIHSVESMHQGQGPSAVLYIPAVPLTPQNADYVRDQRSQFMQGR
                     PAPDFPGGVGESSFAGRGTQEDIESHDGRQAMGLEPFEINERLAPGERQVRQQANEIL
                     GF"
     STS             406711..407325
                     /locus_tag="CNC01480"
                     /standard_name="Sac3"
                     /db_xref="UniSTS:470779"
     gene            complement(408661..>409459)
                     /locus_tag="CNC01490"
                     /db_xref="GeneID:3256253"
     mRNA            complement(join(408661..408900,408957..408979,
                     409040..409190,409244..409315,409373..>409459))
                     /locus_tag="CNC01490"
                     /product="cyclophilin-like peptidyl prolyl cis-trans
                     isomerase, putative"
                     /transcript_id="XM_569482.1"
                     /db_xref="GI:58264651"
                     /db_xref="GeneID:3256253"
     CDS             complement(join(408709..408900,408957..408979,
                     409040..409190,409244..409315,409373..409459))
                     /locus_tag="CNC01490"
                     /codon_start=1
                     /product="cyclophilin-like peptidyl prolyl cis-trans
                     isomerase, putative"
                     /protein_id="XP_569482.1"
                     /db_xref="GI:58264652"
                     /db_xref="GeneID:3256253"
                     /translation="MSGPSPTYVTFDTSVGSFTVELYTAHAPKTCNNFAKLAERGYYN
                     GVIFHRIIPNFMIQGGDPTGTGRGGTSIYGDRFADEIHPELRFVGAGILAMANSGPNT
                     NGSQFFITCAPTPYLDGKHTIFGRVSSGMKTIQRLEAVRTDKDDRPVEEIKIHRARLG
                     DATQGGGLAVAMPA"
     gene            409865..411914
                     /locus_tag="CNC01500"
                     /db_xref="GeneID:3256587"
     mRNA            join(409865..409937,409991..410033,410091..410249,
                     410302..410418,410475..410562,410618..410699,
                     410755..410838,410898..411144,411194..411211,
                     411278..411409,411465..411510,411561..411629,
                     411681..411804,411859..411914)
                     /locus_tag="CNC01500"
                     /product="ER to Golgi transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545515|gb|CF691356.1,gi|41557322|gb|CF703163.1,
                     gi|41557334|gb|CF703175.1,gi|41558330|gb|CF704171.1,
                     gi|41558339|gb|CF704180.1,gi|41574136|gb|CF719977.1,
                     gi|41574148|gb|CF719989.1,gi|41575693|gb|CF721534.1"
                     /transcript_id="XM_569484.1"
                     /db_xref="GI:58264655"
                     /db_xref="GeneID:3256587"
     CDS             join(409884..409937,409991..410033,410091..410249,
                     410302..410418,410475..410562,410618..410699,
                     410755..410838,410898..411144,411194..411211,
                     411278..411409,411465..411510,411561..411629,
                     411681..411804,411859..411864)
                     /locus_tag="CNC01500"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein"
                     /protein_id="XP_569484.1"
                     /db_xref="GI:58264656"
                     /db_xref="GeneID:3256587"
                     /translation="MGRNGMFGSFQGFDAFGKTMEDVKIKTRTGALLTFISLSIILTS
                     VMLEFIDYRRIHMEPSIIVDRSRGEKLVIDFDIEFPRVPCYLLSLDVMDISGEHQTEF
                     EHQVTKTRMNKDGNVISKVQGGQLKGDVERANLNQDPNYCGSCYGALPPESGCCNSCE
                     EVRQAYGRKGWSFSDPEGIEQCVEEGWMDKMKEQNEEGCRIDGHIRVNKVIGNLHFSP
                     GRSFQNNMMQMLELVPYLRDKNHHDFGHIVHKFRFGADMTKAEELTVLPKEQRWRDKL
                     GLRDPLQGIKAHTEVSNYMFQYFLKVVSTNFISLSGEEISSHQYSVTQYERDLRTGNA
                     PGKDAHGHMTSHGMMGVPGVFFNYEISPMKVIHTEERQSFAHFLTSTCAIVGGVLTVA
                     SLVDSLIFNSSKRLKKKSEDSFRGPSGKIL"
     gene            complement(<412053..>412965)
                     /locus_tag="CNC01510"
                     /db_xref="GeneID:3256611"
     mRNA            complement(join(<412053..412082,412133..412281,
                     412341..412595,412645..412733,412783..412824,
                     412871..>412965))
                     /locus_tag="CNC01510"
                     /product="mitotic spindle checkpoint-related protein,
                     putative"
                     /transcript_id="XM_569486.1"
                     /db_xref="GI:58264659"
                     /db_xref="GeneID:3256611"
     CDS             complement(join(412053..412082,412133..412281,
                     412341..412595,412645..412733,412783..412824,
                     412871..412965))
                     /locus_tag="CNC01510"
                     /codon_start=1
                     /product="mitotic spindle checkpoint-related protein"
                     /protein_id="XP_569486.1"
                     /db_xref="GI:58264660"
                     /db_xref="GeneID:3256611"
                     /translation="MAQKQATRTNQAITLKGSTALVTEFFEYSVNSILYQRGVYPSDD
                     FRMVKKYGLPMLVTADEELKEYISTVLNQVQEWLLSSSLSRIVLAIKSVETGETLERW
                     QFDIYTDESALAPLPGGPPKSAGSKKKEKTEKEVQGEIREIMKQITSSVTFLPILEEQ
                     CTFTILAHTNDSPDVAIPATWNDADPHLIDKGKVEQVRLRSFSTNVHSLEAMVAYRVG
                     E"
     gene            413172..416036
                     /locus_tag="CNC01520"
                     /db_xref="GeneID:3256371"
     mRNA            join(413172..413546,413603..414156,414206..414827,
                     414877..415020,415076..415375,415440..416036)
                     /locus_tag="CNC01520"
                     /product="elongation factor g 1, mitochondrial precursor
                     (mef-g-1), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532739|gb|CF678580.1,gi|41547559|gb|CF693400.1,
                     gi|41547566|gb|CF693407.1,gi|41558936|gb|CF704777.1,
                     gi|41558943|gb|CF704784.1,gi|41570031|gb|CF715872.1,
                     gi|41570034|gb|CF715875.1,gi|41571605|gb|CF717446.1,
                     gi|41571616|gb|CF717457.1,gi|41574359|gb|CF720200.1,
                     gi|41574364|gb|CF720205.1"
                     /transcript_id="XM_569488.1"
                     /db_xref="GI:58264663"
                     /db_xref="GeneID:3256371"
     CDS             join(413196..413546,413603..414156,414206..414827,
                     414877..415020,415076..415375,415440..415904)
                     /locus_tag="CNC01520"
                     /codon_start=1
                     /product="elongation factor g 1, mitochondrial precursor
                     (mef-g-1)"
                     /protein_id="XP_569488.1"
                     /db_xref="GI:58264664"
                     /db_xref="GeneID:3256371"
                     /translation="MSAIARAAARVRQQNTTPLQRPLLLQRKPVLTHTLALHASPLKP
                     SLATSITSPNFQQSFQRRWASASATAEEGAKEEVWPQRKLPELTETDKLRLRRQRNVG
                     ISAHIDSGKTTLTERVLYYTGRIRDIHEVRGRDAVGAKMDSMELEREKGITIQSAATF
                     ADWVAPKPPTELKEGETVGNTDKQKFAINIIDTPGHVDFTIEVERALRVLDGAVLVLC
                     AVSGVQSQTITVDRQMRRYNVPRLAFINKMDRAGSNPFRVIGQLRGKLKMNAAAVQVP
                     IGSESDFAGVVDIVRMKAIYNEGVKGNQIVETDEIPESVRALAEEKRAELIEQLSEAD
                     ETLCDLFLDEAPITPTDIAQALQRATTSLRFTPVFMGSAIKNTGVQPLLDGVCAYLPN
                     PSEVQNQAMDATLPAHAPTIPLVPATDAPLVGLAFKLEEGRYGQLTYMRVYQGELKRG
                     SMIYNARTGKRVKVPRLVRMHADEMEDVDAVVAGEICAMFGVECSSGDTFTDGSSTYT
                     MTSMFVPEPVISLSIRPEGNETPNFSRALNRFQKEDPTFRVHVDSESQETIISGMGEL
                     HLDIYVERMKREYNVACVTGKPRVAFRETITEAAKFNYTHKKQSGGSGQFGRVIGSIE
                     PMETDPDTGKDTAFENRIIGGNIPNQFIPAIQKGFQEALDRGLITGHPITGCKFVLDD
                     GSAHAVDSNELAFRLAAIGAFREAFNKARPVVLEPVMTVEIVAPIEFQGNVIGAINQR
                     KGTIVDTEVRDDEFTLTAEVALNDMFGYSSQLRGMTQGKGEFSMEYKNHQPVLPNIQK
                     EMAEAFRKKQLSK"
     gene            complement(<416588..>426488)
                     /locus_tag="CNC01530"
                     /db_xref="GeneID:3256564"
     mRNA            complement(join(<416588..416638,416784..417414,
                     417468..418459,418507..419071,419122..420387,
                     420437..422479,422533..422653,422819..423172,
                     423220..423691,423749..424194,424239..424515,
                     424553..424728,424809..424960,425002..425143,
                     425183..425812,425853..426113,426266..>426488))
                     /locus_tag="CNC01530"
                     /product="fermentation-related protein, putative"
                     /transcript_id="XM_569490.1"
                     /db_xref="GI:58264667"
                     /db_xref="GeneID:3256564"
     CDS             complement(join(416588..416638,416784..417414,
                     417468..418459,418507..419071,419122..420387,
                     420437..422479,422533..422653,422819..423172,
                     423220..423691,423749..424194,424239..424515,
                     424553..424728,424809..424960,425002..425143,
                     425183..425812,425853..426113,426266..426488))
                     /locus_tag="CNC01530"
                     /codon_start=1
                     /product="fermentation-related protein"
                     /protein_id="XP_569490.1"
                     /db_xref="GI:58264668"
                     /db_xref="GeneID:3256564"
                     /translation="MAVPVNLLLLIELAAVIVASTAFLFYWNRLLASFVAFLIRLYAW
                     RVHHAYISIGSLQISPLAGRLSFRNAEYHSSKLPCRIIVYAKGVEAFVYNRTPAYDDI
                     VERMKKHENEAGGVKGASHGYGDFEEELGLRARLKNLARMSTKDSSAKGTPSDNGHSS
                     SSYPPVTHELPAQVKPVKPPPSDSINWFREALPLELRVVAGSIVLGNDATPTLLIGDF
                     KRAEGILETSDSRSLLDLYKMAVELKFHEANVLTRTNVDYSGPLLAHGKKVYDELLKQ
                     QVDLVNKPPSTISVFSGFHFLSRQFPFLYDPKFSTAPVPGLPTDKLWKGLARYRLPED
                     DTIQSPRKEGGDEREYAKATNLLEAPELTLTYYADIPGNVPDPLQTPYGDILDEIGNV
                     DLPPEYGIDIIIRKGTVKYGPWADRQREALQKAFAPALFFDSEPKARLRPGDTRVHTA
                     LVLRVMLEDETVLRIPTREKRRYGWLDVVVGPNSSVTYTQDQIATQRGYDSMLVLHLD
                     SLGISSSVNLDTFIQAKTCKLSMAMPTPLQWNAKRDWGMDVVFDTPSISLLRDHVTLI
                     SDLAKDWSSGTTGGDYHHFVPNHYNFRVSLINYAFHLYINDYNIVDAPGSRDSNAFMD
                     VYGPRLDAVVAVASTQYRPEASVVPFSISLSDARVELCVPKWDTHRTFGPEVLEVGQV
                     GQLIASGSYRYYAVPRPEHQETLTLHLEGKHVKFKMLGWVLRRLFCVKDNYFGSFTQF
                     TTMDEFLERFDHDPASVGDPVEEKYRPGRSDPYAVHITMNVEESLILMCDEIYNFSGG
                     IALPVPQLQMTIKSVEQFMELSLNATPTYIAAAPQLLPLYERGSAPVVSGEEAIFIEG
                     IELKASRLFGPKPRATTYLCLWEANIPKISAFLTPSLLTTLQAIGRSVGYTFSDPDNA
                     PDQNYQLKTPPDVTFFKFSINHALAMLTADSSAISLEALSGLTLDTSTWGTRSYSSNI
                     GLLLPSFTINIVHRSPRKTWRVVSSAAVGATLDVYNAPDRWRERVSAQQEFLKEQDSE
                     TGRVWYMYRGGQKPMEMIDEEESESLLSERHGYDSNDSQPSSSIESGPEESNPSKTWG
                     KRNPVKPFMTIQETDDSSVSSAGDESDSASGTSSDSASEVSFPAEYVFDMADVLANKL
                     RHFQFARDRYPPEIRLSASDSDYGGGEEEIKGKRKARDEMASGKVVRLVTHAAQVNLH
                     PESLQSISEIVSAISTGSVSYEKRLDSLLISQVQDVADSKIPEQQMVLDIHVPSATMR
                     LSGGEPSSALISHIQHIRCNIHRYTLINQRPVLDLIFSVVSITASAMSSSDTASSLKD
                     IVGPTTESPEYLPLAHFVASAITAGFHSGHGIRIHSKVSHAHFDTVTPAITFGSAFAE
                     RWQAVIQEANFSHPKTGSDAAMLCHILYSAINSQRGAYLPSFAYVTPHGLHEQDSQLG
                     NRRQTGWWLLTRFRDWLRGGLLDEADVVANISDMANYFVSNLIQVDDSLVGTENLVRD
                     QPFFKRAFNIGSSCTPETECDTPIDVFVYIDNASVRHYGRLLGSTATAMSYINISKLS
                     FGCATVIAMIEERKISQMRMVVAIQTVGLEVHDSILTLARLIVHIPCKPKPEFGKGES
                     PGESLPSFNAIGKSPSAIAINIQLETLDATIIGGGLRLRSGARQLQLTALTRHRLHSN
                     PVSGRSTRESLSLTCRLIEIILIQPVENPAAITHSTDRVVISLKTQGWRASGERIASV
                     DKPSTEIRAMAGLKLLEFDSRPQLRAFYSFIQQWKAKELPLYASAVDDMKGAIKAWTN
                     GPPSKSTPVLLTDLDITIEALHFQVRAAKALWLRWEVGKIYVVKSEKKKDIRFAVKVA
                     PQVVGAYYSRRSKSSESSSLNLPSVAIIGNHRHLQDKPHVFANLQLGLFSGVLRPAIL
                     DRLLSLHQNLQDDINHLVNDWRKDVRKAKEKLHAQKGWRSPSPGARKVSLNKILYDVH
                     VRVDGVRFGLRADDVPATIVFEALAAKGRATNQYHHGNGLHWRAKVDHFSLSLGHLDD
                     GYVSNDTEPFRRQRTASMTLDVEVEEIPATPLLTSQLIIHLSHVRTVMHVEALSELTD
                     LLKSWSSDLYILRDHRAREMAEVKQRTTKVLKRFESAEHVNRSEISWLANRLLTVEIG
                     GIGVAIPLVEGAVIEDCRKSDVPALLYSIRVISFHNRHNEAARFRLQNMALQFIDRFD
                     QSLPEHFTSDFHGSKNCMVVPSIESEAEMSSTHEAWHLSAHCSASDFKLTLSPDISDD
                     VIQLVELFERGKEKIAKVEAQYKVEVAGHAKETIASKYESPASPSARRQSQRIMVRTS
                     FTFNSGTVELHRDLSDTEKATLSSETRRGRGWHDTVVLPAVSLWMEYTGPKDEVPLFP
                     QDEGDGSLLFNLAVHESRNLLRPTILPFFLQIANRLGRKAKRTQSTPLDTSPKMPMEV
                     SPAVPQGLSRRPITRTVSTRVQVSVTLRIDKSELRLSCAPDSNAYVDLKWKSGGFFAS
                     TIIGDGSKATVAGTVSGVRAYLRHEFAEGKSCIEAGAKDMAFSIDYSFESLTGRKYLS
                     IVLDSLLSAQFRLEQFSAWLAFAAVWLDNAPNLELPSRPPLGEASSSSPSIHTASIPK
                     VTVSALVRFRTVDFDTNIGVTNAKLEMTPVVLRTSSNGVKAELELDLGVTQITAKGDI
                     SGEIRSESLIFRTARQSSRGGAPDDPTVLNMSINAGTLSSNLSLQELSVIRFTLDPAT
                     VTLADDWQAFAQDPSSQVLLSFAVKAGVFRSVIRLLSIPSLVSKFYSLSNTIESQERM
                     ACHRSSAYKSKRLRKSTEPSPMAAAILHTARKTGQTLTSTSTVKTAQNMRFDLGGVDI
                     GLFNSPPTDDHRGDFYRFTMGKVEADLERQLTAENLPKRDLNLLVSYVKWVSSDGVKA
                     AREVKKHRNLEESIQAASAHGRKEIASLPLMLSCPISSNRYTKHSTN"
     gene            426889..430864
                     /locus_tag="CNC01540"
                     /db_xref="GeneID:3256585"
     mRNA            join(426889..427290,427340..427744,427796..427888,
                     427936..428101,428151..428547,428598..429075,
                     429128..429424,429474..429834,429890..430864)
                     /locus_tag="CNC01540"
                     /product="DNA-directed DNA polymerase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41575593|gb|CF721434.1,gi|41575598|gb|CF721439.1"
                     /transcript_id="XM_569492.1"
                     /db_xref="GI:58264671"
                     /db_xref="GeneID:3256585"
     CDS             join(426904..427290,427340..427744,427796..427888,
                     427936..428101,428151..428547,428598..429075,
                     429128..429424,429474..429834,429890..430818)
                     /locus_tag="CNC01540"
                     /codon_start=1
                     /product="DNA-directed DNA polymerase"
                     /protein_id="XP_569492.1"
                     /db_xref="GI:58264672"
                     /db_xref="GeneID:3256585"
                     /translation="MTSNVLPLFWPLSNLSKETRLTASANLVSSLESFQRSFSQNAGS
                     SKGKEIEDDDEDEESASDSEESGMEVDASDDEEENDEKHSQAAKLDRQLSKDNAEDVV
                     YSVKRLVRGLGSSRESSRLGFAVALTELLSRIPTVTARQVFSLVIRNSQYSKNMKGSD
                     ERDMMFARLFGMTAIVQSQSLFAPSATKDDFRGVIEELEKLGQAKAWMRESAWWALVQ
                     SVLLLLESRVQWKEDALREVIDVVFEEKGWTQEKVALVLTLEQSGLDIDWKTHLAPTF
                     KHTPLLNTHNLVTLSRILKETSGDEEDGVSATITGSWKPQLHFVWNIILDRYFGPSAL
                     STTLASFQDFFRVVVDESLFSNTSSPQRRYWGFQVFERALPLLPSSQMPLIFTPNFMR
                     CWMNNLSSPDRYLHKAAQQIAKKVQDIIKENPKVGYTLLSQLVGKHGRPDFDKVTKTK
                     TVESIMGKLNEKGVRDFVDFLKETILGASSHENLDAARLAERRSWALDQIQALCRNGS
                     VPKDDAWVAPLFDFLLVHGFFIIRSVNKKSPITAIHTVPKPPLSENTSIACRAKFFAC
                     AVELTTASIPRKNGSEDSKARQQGCDASGRLWLRRAIDIISILVDDKKHVEVIADADE
                     EIKSIRNAALESLSSLDKVKEDRKSISRAFEILISFFILQTYDEVEDSLENLEEVNTA
                     AQQYLGQKEEEETQAADMLLDVLIALLDKGSSDLRNLANLVFDIISPELTKSSLNLLS
                     AQLEQSAAEAAANESAEESDEDADGDDAASDSDGGEANEEDEDEEEDEEHDEDLGDVD
                     PAFRQRVAEALKVSGMDAGEDVEEGSEAESEEYWDDDQMMKVDEQLAQVFRERAAAAS
                     KNDMKHILTESIHFKNRILDFYDTYAKRQPTNPLIIDVILTLLKLIRSGGVSEAEVTN
                     KAAGILRSKFNKPKDVPSTVNIEAASESLKTIHSMAQKAHSAEFSTLCSLCSLFVSRA
                     IDASGISSNSATSTVVEIYRATLKDFIIRKASLVHPPFLLEFVKRFPVRAFSLYHDLV
                     SYVAPGAAVNAFRQLQAYNALQILAQHLPVISKSVSPTEVIKFVQEASESVFTTLETA
                     AEANSDSKDALNAQKLKDVVKFALQLARNSKNVGISWDIRRVSEVGETLKHGRRTKEM
                     KGVHSMWIQLEAILSNKKGEKRKR"
     gene            complement(431367..436718)
                     /locus_tag="CNC01550"
                     /db_xref="GeneID:3256655"
     mRNA            complement(join(431367..431678,431731..431809,
                     431863..432032,432073..432196,432247..432257,
                     432319..432401,432457..432482,432536..432632,
                     432698..432929,432981..433025,433083..433147,
                     433208..433309,433368..433746,433799..433864,
                     433920..433929,433980..434032,434087..434136,
                     434186..434232,434280..434360,434413..434663,
                     434712..434838,434889..435103,435157..435282,
                     435344..435409,435463..435491,435542..435563,
                     435609..435624,435674..436434,436506..436550,
                     436612..436718))
                     /locus_tag="CNC01550"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539485|gb|CF685326.1,gi|41550949|gb|CF696790.1,
                     gi|41556432|gb|CF702273.1,gi|41556438|gb|CF702279.1,
                     gi|41564205|gb|CF710046.1,gi|41564210|gb|CF710051.1,
                     gi|41566232|gb|CF712073.1,gi|41566243|gb|CF712084.1"
                     /transcript_id="XM_569494.1"
                     /db_xref="GI:58264675"
                     /db_xref="GeneID:3256655"
     CDS             complement(join(431459..431678,431731..431809,
                     431863..432032,432073..432196,432247..432257,
                     432319..432401,432457..432482,432536..432632,
                     432698..432929,432981..433025,433083..433147,
                     433208..433309,433368..433746,433799..433864,
                     433920..433929,433980..434032,434087..434136,
                     434186..434232,434280..434360,434413..434663,
                     434712..434838,434889..435103,435157..435282,
                     435344..435409,435463..435491,435542..435563,
                     435609..435624,435674..436434,436506..436528))
                     /locus_tag="CNC01550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569494.1"
                     /db_xref="GI:58264676"
                     /db_xref="GeneID:3256655"
                     /translation="MPSEGSQQPSLDSFFKRKNPRVEPYSRTGNNAIIDLTDSPPNKK
                     IKLDDEGSQKNRSMTQTSSSYFKGHPTARPLSVDKRLPRKPSAAIQAYKLQDVIPPQP
                     SHSGLAFETCSLVPQASFVPDSQPEPSASPAPQRTTEQLKRHEEWKTRILAMSGSFRR
                     KRSLALDEAVAAEAREAAGLEDEGTPFDGSDGDDYKSESEKNAEEVGKQLKKYVAKEL
                     AGKGKSKGKKKEEIGPSGLAYTPLEKQFMEIKEQNRDVLLLMEVGYKYKFHGEDAKTA
                     SRELGIVAFPNRNFFTASIPTHRLHIHVKKLLSLGYKVGVITQTETAALKKIGDNRNA
                     PFARKLTHLFTAATYVEDPSLSSSSSSSSSVRFDDPVVPGTAPPPTNALVAIVEQPVD
                     RASDDRVKVGLVCVVPGTGDITWDEFDDSQIRTELETRLAHLSPAELLLPKQRLSKAT
                     EKVLTYFAGEPKHRGRNAVRIERIDNIPEYDAAFDFLTNFYHCKEHKATVSKGDVNDE
                     RHLMTEGNKQWSLQPKLSQDGADISLDEEIYLASGVSSSKAILTLVDFPKQVVISMAV
                     AIRYMKRFGLENAFKHTSSFVRFANRSHMLLSSNTLANLEIYQNQTDGGLYGSLIWLL
                     DHCKTRMGKRLLREWVGRPLLDVAALKARADAIEEIMENNSYHMEKLRSLLINMPDLV
                     RGLTRVQYGKATPNELATLLITLVRLASEFKPNMGNVFRSCLLNNIPNTLPTILDTSQ
                     RFLNALNLKQARENDVANLWADPDRFPDIQDVKDCISVCEMELNEHLMELRKILKKPT
                     LRYITVSGIEYLVEVPIRDTKIVPAQWMKISATRTVNRYHTPKILAITKERTQHLEKL
                     SIVAREAFIAFQSEVAEYHELVVVSKQIAVIDCLMSLAQTAAASGYCKPKFVAEPELK
                     ILAGRHPMVEMLREESYVPFDIHFSKEEGTTKIITGPNMAGKSSTVRAMALIVCMAQI
                     GSFVPAASVTLSVHDSVQTRMGASDEIGRGKSTFMVELSETSDILQTITPRSLVVLDE
                     LGRGTSTYDGIAIAYATLSHIAEIGCNTLFVTHYPTVAQDLAREKPDKISNWHMSFDE
                     IQMPDGGAEITFLYQLTRGLQEASFGVWCARLAGLPKPILDTAQMRSSSLKAETQERL
                     RGIVARRVGWMLHNLFDNKTSSSQVLRNVEMLHNSLSSSSISFSQ"
     repeat_region   435056..435082
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     gene            complement(436889..436970)
                     /locus_tag="CNC01560"
                     /db_xref="GeneID:3256390"
     tRNA            complement(436889..436970)
                     /locus_tag="CNC01560"
                     /product="tRNA-Met"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:3256390"
     gene            complement(437859..>439053)
                     /locus_tag="CNC01570"
                     /db_xref="GeneID:3256790"
     mRNA            complement(join(437859..438769,438834..>439053))
                     /locus_tag="CNC01570"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41565158|gb|CF710999.1,gi|41565164|gb|CF711005.1"
                     /transcript_id="XM_569496.1"
                     /db_xref="GI:58264679"
                     /db_xref="GeneID:3256790"
     CDS             complement(join(438081..438769,438834..439053))
                     /locus_tag="CNC01570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569496.1"
                     /db_xref="GI:58264680"
                     /db_xref="GeneID:3256790"
                     /translation="MGRSLDPVWEFYYRIEQDVQSLGLKAKANSAHNNGWCKNCVRMK
                     LVGPEMATWVPDDSVLAETGQIETARRYKAMSLCQPYTGVPSRLRSHLQRCSHSQGIM
                     IPDAVPLKKRKSHPGSPGTEAGPSGRHSTPVKAGGRGKLSDEQQGEFNVHLWHIFNML
                     DIPIETLTNPTFVQFFSKYIPQATLPSRSLFYTLSASRNIAPPNLSSAAATVGPTGSP
                     DFQGLARLAAGFASVPGVTGVSELSGVQGESGVPHHVESDGAHEPDLSHDSQMQQVSG
                     ASHIRGVPGVSEDDISDGGKGELSYE"
     gene            <439671..>440879
                     /locus_tag="CNC01580"
                     /db_xref="GeneID:3256586"
     mRNA            <439671..>440879
                     /locus_tag="CNC01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_569498.1"
                     /db_xref="GI:58264683"
                     /db_xref="GeneID:3256586"
     CDS             439671..440879
                     /locus_tag="CNC01580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569498.1"
                     /db_xref="GI:58264684"
                     /db_xref="GeneID:3256586"
                     /translation="MAYAISRLTAESDFSQCFDSHMLQQQSPDQEQTHVVAPGATIYD
                     DVTRLPIYDGEPWREAFNATKTTHKNGTNTAVSQLAGIDTSLLLSSPNSNASSPTNIF
                     VPELLDVHKALDSEPLNQNQFRQLDSITEQYIIPGSLDFTSPAIKLEFDSQARQQYEA
                     NSQFDHASLFRKLGKPLSTPQVQFNVFSQFFVSPADNESFLSVNPDDVTLKRKVFESE
                     LTNGREIKRRDVTSSFGDFTHGVQPPLLSQQLVSPVTDSGNVVFNSELHPKEGSDATH
                     NSKVSTTRPKSVVPEKFLNDGSAELALGMSVTKIQSFPTFEELLKHVQPCHYSHAKSF
                     GEKIARNRIKAKNAAKRSRDQRRAKIERVEDLEKRIEELKMQVKGMKLLLGRLVDSGA
                     INEDVVQAYL"
     gene            complement(441011..442758)
                     /locus_tag="CNC01590"
                     /db_xref="GeneID:3256559"
     mRNA            complement(join(441011..441347,441398..441801,
                     441855..442086,442138..442758))
                     /locus_tag="CNC01590"
                     /product="Rab escort protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546897|gb|CF692738.1,gi|41546907|gb|CF692748.1,
                     gi|41562997|gb|CF708838.1,gi|41563005|gb|CF708846.1"
                     /transcript_id="XM_569500.1"
                     /db_xref="GI:58264687"
                     /db_xref="GeneID:3256559"
     CDS             complement(join(441025..441347,441398..441801,
                     441855..442086,442138..442681))
                     /locus_tag="CNC01590"
                     /codon_start=1
                     /product="Rab escort protein"
                     /protein_id="XP_569500.1"
                     /db_xref="GI:58264688"
                     /db_xref="GeneID:3256559"
                     /translation="MSNIELESDSYDVVVIGTGIAESIAAAALAKAGKTVLHLDPNEY
                     YGGEQASLTLDELVEWSTTRVESSSAAVSYTHASTSVVTPTLQNDRRRYALSLFPAIL
                     PSRGPLIDVLISSDVSKYVSFKLLDSVNIWDEDCAGARKVPGSKEEIFKDKSVSLMDK
                     RKLMKFFMFAAGEFEHNDIIRGKETQPLLGFLQDSFALPTGLALSIAYAIAHCTSPED
                     QTLPALMKTRRYLKSLGRYGSSAFLVGQYGGAGEIAQGFCRGCAVYGGTYVLGQFGKP
                     TLIDANDDDVTLSLPCHPRPVTAKHLISSSNHLPPSLLIPKSEPSKRTITAHSIAIIS
                     SLPKVLQRQLPSADDENGRSQLPEENDDTGLIVFPPENGNPTVRCLINGEGTGSCPSG
                     QYILYFSCPASTASSPSNLLKPYLQRITSEPLFESYYVSTRATSSYSASSPKVIIVTP
                     FYRDDLITEGLDWEVKEAEKAYYSVVGQDGVPFFDVTESEADEMGIFEDH"
     gene            <443150..443977
                     /locus_tag="CNC01600"
                     /db_xref="GeneID:3256483"
     mRNA            join(<443150..443243,443309..443704,443762..443977)
                     /locus_tag="CNC01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_569502.1"
                     /db_xref="GI:58264691"
                     /db_xref="GeneID:3256483"
     CDS             join(443150..443243,443309..443704,443762..443799)
                     /locus_tag="CNC01600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569502.1"
                     /db_xref="GI:58264692"
                     /db_xref="GeneID:3256483"
                     /translation="MTTSLFVPVAYITVLVTAMAIFSRVYRRRRAVSKTSIEPWFPSH
                     PTREVYMSLLADEPPAPENLLKAALLSRAITDVQRIWRLKDDKTALASLHTRGLVGDD
                     TMARFAAAEKELEAEIVDVISEANTFKQGWGQFLFATATEMAQSEKTKEAVINMHKTR
                     IAEEKRLARRAKYDT"
     gene            complement(444374..445019)
                     /locus_tag="CNC01610"
                     /db_xref="GeneID:3256757"
     mRNA            complement(join(444374..444549,444603..444703,
                     444755..444814,444870..445019))
                     /locus_tag="CNC01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_569504.1"
                     /db_xref="GI:58264695"
                     /db_xref="GeneID:3256757"
     CDS             complement(join(444482..444549,444603..444703,
                     444755..444814,444870..444952))
                     /locus_tag="CNC01610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569504.1"
                     /db_xref="GI:58264696"
                     /db_xref="GeneID:3256757"
                     /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     A"
     gene            complement(445875..450164)
                     /locus_tag="CNC01620"
                     /db_xref="GeneID:3256358"
     mRNA            complement(join(445875..446251,446302..446910,
                     446957..448089,448138..449446,449494..449755,
                     449801..449959,450007..450164))
                     /locus_tag="CNC01620"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530499|gb|CF676340.1,gi|41530511|gb|CF676352.1"
                     /transcript_id="XM_569506.1"
                     /db_xref="GI:58264699"
                     /db_xref="GeneID:3256358"
     CDS             complement(join(445894..446251,446302..446910,
                     446957..448089,448138..449446,449494..449755,
                     449801..449959,450007..450154))
                     /locus_tag="CNC01620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569506.1"
                     /db_xref="GI:58264700"
                     /db_xref="GeneID:3256358"
                     /translation="MPSPPLSILQSLSPRIAVLTSEDVVKSSKENGCAGLHELLRPWE
                     GGTERVSILSTTLTPTVHPTFPVRFVSYDTVYTNPPRSAPSPDILVDIISSVVGAKKP
                     EDEQHYPLTRSLLLSSRPVAPYETFNHPVGVLFAVSTSTPDPLGALNKLHARTIAPSA
                     QSLPWLDGHTVLRFYVVVHDVSQMGDDMTPAHELLASVKRAYGPHSTLLVINSQVDRR
                     PEPPSPDTSTHPAIIVPRPFTPENVNPSALSQVYASALSSLTLSPMSATSPSMKDDNG
                     ELNGLDKPRKLYGSRLTAEDTQRLAALVRELVVQSLVPWMEARIREWSEIYHNNRRGI
                     TGRLFGAGRKFFGSRPNSPATNAVGYNASAGYYSLAAVEALSRRLADFEFMLRDYRSA
                     ANIYDSLRRDFAQDRAWRYASAATEMYGLSLLLAHSFFSPSIPPTTTPIPFTNLQHTE
                     ITSWLEQAVISYHQSGPSSQIQIDALRITVLYYEAWKAIREWRGVGAALVKGAGEADE
                     VPSAVLIEEAAVADTEGGKSGKGKRRSAFHLILAARRYETAGLKTYSRRCLDRASQIY
                     RSTPWTAAQDRIEYSLGRQAYTLGESDVAVEHFLRLLKKENTGVPGSQAGPLQDMALA
                     YEQLRVHPELLESSKDRLQLPTPIFDVKKTRIITSFSSSFESGPSKDNWAQLEEQALR
                     SWDRKGKKPSNLLPDEKRNIVGTDESFIVELVATNPINAPLFLSDIALAFSPSDNITV
                     SPVDEITLNPYETRAICVNVTANGAMSTTSVIRLFGVSFRFHKFFPCTQSLERKGRRL
                     HATKAHRLTPTYASDTSLSLSIIPERPRLDVDLVGIPDRVFVGEEVGGIIRVKNPGRK
                     TVKDLKMIWTKGVLIRRKNDADESSTMTISNRIENNKPSILLPEEIPAGQTKDIAIIL
                     SGFKQGQINLLGLITFESAGDGEIVAGIVKTCINVQPLMTFKTTITPIEASAKELALV
                     LEVMNVSSTEVRVDGVHGVSVLWNVKAHEVVGTLLPNQTLRSVVQIKQGATIADLSQT
                     AVVEALAKLIEGQAPDEIAADIQPTVSLCSELPIDTLPHYFASRNIHRISYLREQFPT
                     ISADFLPDLFPLLDPLDLDIVLSYTICSPNSLRKGRLISHSLRPAPSFSMVESLRRDV
                     EAAIAGGSKQTRTMYEETGRLRRVLMASVLDGCLGREEDPVEVTVKVGEDNGPIEHDF
                     KMGACKVPVAFTIHNRSPILPIRFILYLPSPSPSIPSIASEPSALIPARFIGNLIFRG
                     TLKSGETHVLNSAVWVYIAGLMSLNGWNLIVETGEIEVDTAGWIPRKIWSKKGSEKVV
                     EIRGL"
     gene            <450705..451728
                     /locus_tag="CNC01630"
                     /db_xref="GeneID:3256596"
     mRNA            join(<450705..451629,451683..451728)
                     /locus_tag="CNC01630"
                     /product="60s ribosomal protein l7, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_569508.1"
                     /db_xref="GI:58264703"
                     /db_xref="GeneID:3256596"
     CDS             450705..451601
                     /locus_tag="CNC01630"
                     /codon_start=1
                     /product="60s ribosomal protein l7, mitochondrial
                     precursor, putative"
                     /protein_id="XP_569508.1"
                     /db_xref="GI:58264704"
                     /db_xref="GeneID:3256596"
                     /translation="MGAQSVRSFTASASRVSLKRAAPISRHASTKAAVQQDEWSLPYI
                     HLGPTHASRYSQHYNNSLASDVMYMTYSHRLSQRPAKPETLQPPQTPYEANRARPPIM
                     RGNRAVRTKTTEITPATVPKLESIIVHTMVKEAIGNKNSLLSAIAALRAISGETPNGA
                     GRKGSSGVQVITAKKSAAAWKLREGMPVAVKVELKGEAMYDFIQSLVDFVLPRLRDFS
                     GVPLPPASTPKSSPASLAGVVSFGFGPTAMSFFPQIEANTDAYPKMHGFHVFFKTNLT
                     GENAQEHARTLVSGFRIPFHRR"
     gene            complement(<451769..>454703)
                     /locus_tag="CNC01640"
                     /db_xref="GeneID:3256516"
     mRNA            complement(join(<451769..452498,452550..452614,
                     452664..453150,453198..453417,453472..453610,
                     453666..>454703))
                     /locus_tag="CNC01640"
                     /product="glicosidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41555165|gb|CF701006.1"
                     /transcript_id="XM_569969.1"
                     /db_xref="GI:58265625"
                     /db_xref="GeneID:3256516"
     CDS             complement(join(451769..452498,452550..452614,
                     452664..453150,453198..453417,453472..453610,
                     453666..454703))
                     /locus_tag="CNC01640"
                     /codon_start=1
                     /product="glicosidase"
                     /protein_id="XP_569969.1"
                     /db_xref="GI:58265626"
                     /db_xref="GeneID:3256516"
                     /translation="MPIVERELFGFQLATSPSIGDSITSFSLVSSPESIYKDFTYSIS
                     FPLPNVYRILLTGPNRTRPLQDNVVLDTSESKFKVIALDNDGCEATFDFPSPISESLD
                     GAEKRRRQLHLSWKEHITLTTYETLLSTGQQLRLLGDLPNRSYALTEHGVMRHWWVEI
                     DNLHLGLGEKAAPLDLSNRSFMNHGSDSAAYDAYQTDPLYKHTPYLISTPKPTSEGEE
                     LPSTYAIYHPTNAGGEWNVRRLHDDPWGYFKSYTQDYGGLEEWVLVGKGVEQVVRTFA
                     EIVGRPRLVGRDWLGYLGESHRTKYVISDADSMKASGMGLGESDDPPAQELLSTWPEL
                     CRKYDIPCSAMHLSSGYTADKDGNRCVFTMNTKRYPDFKGMVAHFHKAGIKVVPNIKP
                     YVLQTHPHYKDLHSSNALFYDPYSKSPVVTRIWSSGVGDNEKGSWVDMTSEEGRQWWA
                     DGVKSLIDLGVDGMWDDNNEYYLHDDSFVCATSLPHEFTSSPSGPVTIGEIGRMINTE
                     LVNYVSHTTLEKAHPTRRTYVLTRSGNVGTFKYANSTWSGDNYTSWHNLRGSQAIQFN
                     AGMSLMQSYGSDIGGFGGPLPGEEMFVRWVQLGVTHSRFCIHSFKPDQSDISGVGATN
                     TPWMYPAVLPIIREAIKWRYEHLPFFNSLMWESHLRATPTTTWLGFGPFASDPALYEA
                     SILEGFDAWLGTGRILVCPALFEGQLTREVYFPKACMDDKSLYFDLHAPYRTYKAGDR
                     VMIATPMEHMGLFAREGAVVPVGKRYHTVTQKQGPARQTPDGVDVVLEDEGGVVGLDD
                     WRGVKIFPGHEGNAYRGQWTEDDGISATPDKTVVEVEYVGGKDEVTIGFKLTEHKFKT
                     LWGRKLAVLLPVGDERSVKGGKEDVWEGRKVWNIEF"
     misc_feature    454992..455016
                     /note="AT_rich"
     gene            complement(455044..457697)
                     /locus_tag="CNC01650"
                     /db_xref="GeneID:3256632"
     mRNA            complement(join(455044..455295,455362..455594,
                     455792..456067,456127..456358,456427..456541,
                     456607..456672,456723..456788,456838..457271,
                     457324..457697))
                     /locus_tag="CNC01650"
                     /product="peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagine amidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542415|gb|CF688256.1,gi|41544627|gb|CF690468.1,
                     gi|41544634|gb|CF690475.1,gi|41554484|gb|CF700325.1,
                     gi|41560125|gb|CF705966.1,gi|41565982|gb|CF711823.1,
                     gi|41570541|gb|CF716382.1,gi|41571959|gb|CF717800.1"
                     /transcript_id="XM_569511.1"
                     /db_xref="GI:58264709"
                     /db_xref="GeneID:3256632"
     mRNA            complement(join(455044..455295,455362..455690,
                     455768..456067,456127..456358,456427..456541,
                     456607..456672,456723..456788,456838..457271,
                     457324..457697))
                     /locus_tag="CNC01650"
                     /product="peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagine amidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542405|gb|CF688246.1,gi|41560764|gb|CF706605.1,
                     gi|41565975|gb|CF711816.1,gi|41570533|gb|CF716374.1,
                     gi|41571953|gb|CF717794.1"
                     /transcript_id="XM_569510.1"
                     /db_xref="GI:58264707"
                     /db_xref="GeneID:3256632"
     CDS             complement(join(455173..455295,455362..455594,
                     455792..456067,456127..456358,456427..456541,
                     456607..456672,456723..456788,456838..457271,
                     457324..457620))
                     /locus_tag="CNC01650"
                     /codon_start=1
                     /product="peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagine amidase"
                     /protein_id="XP_569511.1"
                     /db_xref="GI:58264710"
                     /db_xref="GeneID:3256632"
                     /translation="MFNQPSDSPFRDYQAYVHIVNYCAAALAAGIYQGIPQLSVPSPK
                     EVGDLNRLWREYLLTHKLEVLSSFRRRRSVVSDDMQGVIKNLQQHTYSLRDPRGDPSM
                     QGVSEYELRALVPDITSSIAFISSNPPFTPFGQVDAEVLALCRWFKDDYMRWVDPIKC
                     PTCDGPTFSAGTVPPDGTEHWEGAGRVELHVCKDKNCAAQRRFPRYGKVSTLLRTREG
                     RCGEWAHLFYVFLRAKGIESRYVWNSEDHVWCEYWSPALRHWVHVDPCEGAINKPLIY
                     ALGWGKKQAFCLAFGQYGAEDVSAAYIDDFDGDCRLRRRARGWKERDLRRALFAQTVA
                     LRLKMDLPQRSRLEVMDQLQALWISDREGRMREAEKSELIGRISGPDDWKRLRDELGL
                     NAKIIQKPQYTVVSNLESDNQALVTFGDAHWDGSTIVLTTGNSQTSAVFHPHPIDQSD
                     TFSCTVTFRLTSPPGAGEADGISIIFVPKKALGLGGYGLGYSGLGGCTAPGTLPKLSN
                     GKEHKLQILYRGEDRRVRGYLTISSEGSVKDETDIEVFDIVVPSGNEQKPWFIGVTGS
                     CGGLWQKQEIVDWSLQLVAFGDGQTILQKSSGKAKAGCERNDERDNI"
     CDS             complement(join(455173..455295,455362..455690,
                     455768..456067,456127..456358,456427..456541,
                     456607..456672,456723..456788,456838..457271,
                     457324..457620))
                     /locus_tag="CNC01650"
                     /codon_start=1
                     /product="peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagine amidase"
                     /protein_id="XP_569510.1"
                     /db_xref="GI:58264708"
                     /db_xref="GeneID:3256632"
                     /translation="MFNQPSDSPFRDYQAYVHIVNYCAAALAAGIYQGIPQLSVPSPK
                     EVGDLNRLWREYLLTHKLEVLSSFRRRRSVVSDDMQGVIKNLQQHTYSLRDPRGDPSM
                     QGVSEYELRALVPDITSSIAFISSNPPFTPFGQVDAEVLALCRWFKDDYMRWVDPIKC
                     PTCDGPTFSAGTVPPDGTEHWEGAGRVELHVCKDKNCAAQRRFPRYGKVSTLLRTREG
                     RCGEWAHLFYVFLRAKGIESRYVWNSEDHVWCEYWSPALRHWVHVDPCEGAINKPLIY
                     ALGWGKKQAFCLAFGQYGAEDVSAAYIDDFDGDCRLRRRARGWKERDLRRALFAQTVA
                     LRLKMDLPQRSRLEVMDQLQALWISDREGRMREAEKSELIGRISGPDDWKRLRDELGL
                     NAKIIQKPQYTVVSNLESDNQALVTFGDAHWDGSTIVLTTGNSQTSAVFHPHPIDQSD
                     TFSCTVTFRLTSPPGAGEADGISIIFVPKKALGLGGYGLGYSGLGGKGDFAVEVDTYR
                     TQDYADDPPTPHISVHSPPDAHHRNSIGCTAPGTLPKLSNGKEHKLQILYRGEDRRVR
                     GYLTISSEGSVKDETDIEVFDIVVPSGNEQKPWFIGVTGSCGGLWQKQEIVDWSLQLV
                     AFGDGQTILQKSSGKAKAGCERNDERDNI"
     gene            complement(457896..459116)
                     /locus_tag="CNC01660"
                     /db_xref="GeneID:3256784"
     mRNA            complement(join(457896..458482,458531..458745,
                     458803..458923,458974..459116))
                     /locus_tag="CNC01660"
                     /product="cytokine inducing-glycoprotein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546708|gb|CF692549.1,gi|41546717|gb|CF692558.1,
                     gi|41564261|gb|CF710102.1,gi|41564268|gb|CF710109.1"
                     /transcript_id="XM_569968.1"
                     /db_xref="GI:58265623"
                     /db_xref="GeneID:3256784"
     CDS             complement(join(458057..458482,458531..458745,
                     458803..458923,458974..459060))
                     /locus_tag="CNC01660"
                     /codon_start=1
                     /product="cytokine inducing-glycoprotein"
                     /protein_id="XP_569968.1"
                     /db_xref="GI:58265624"
                     /db_xref="GeneID:3256784"
                     /translation="MIFNRFTFTAAMAASAASAISVQRRAAITDFDTSPVAFAFPEPR
                     GFSASTASEAPCGGFDPVNRTSYPLSGGDVALIQQTDATNVNILWTSESDPTLFHSFS
                     TYSNSILDIAAGHYCQDAPDFSSLGFAEGDNATLLVIYQLDGADTYYYQCADVSLVSA
                     TSFTTDEQYVCGNYTSELEIASSEESLHLGNTTTSESTSSGTTGTASTSSGSTNPHVS
                     SSSSGSKLSAAEGGGIGASVTIFVFAVIAGLLWWSGLLRFGKKKQAVVHDHESVSSGV
                     PTKERL"
     gene            complement(461051..464101)
                     /locus_tag="CNC01670"
                     /db_xref="GeneID:3256340"
     mRNA            complement(join(461051..461535,461595..462092,
                     462142..462308,462367..462459,462579..462804,
                     462862..463006,463075..463461,463516..463596,
                     463662..463696,463758..464101))
                     /locus_tag="CNC01670"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535306|gb|CF681147.1,gi|41535313|gb|CF681154.1,
                     gi|41542161|gb|CF688002.1,gi|41542167|gb|CF688008.1,
                     gi|41557865|gb|CF703706.1,gi|41557876|gb|CF703717.1"
                     /transcript_id="XM_569967.1"
                     /db_xref="GI:58265621"
                     /db_xref="GeneID:3256340"
     CDS             complement(join(461412..461535,461595..462092,
                     462142..462308,462367..462459,462579..462804,
                     462862..463006,463075..463461,463516..463596,
                     463662..463696,463758..463966))
                     /locus_tag="CNC01670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569967.1"
                     /db_xref="GI:58265622"
                     /db_xref="GeneID:3256340"
                     /translation="MFSPILSPYRLPKPIFVLVCLLLILGLLFLSFASHDESRGYMID
                     IFKKAGANVGVSASRLSGNAEEDAMREWEFRRALQHEGTSARVQAFLDKARSGKAFTV
                     ASIGGSVSKGRGLTPPKPSQLVHNTFRRSSEGDSVRPSDVPDDSPQDNIDLTEVIPSS
                     AQSELEPTGSAIEENQGKNVSHPIAPLVHLGASTLYSHENLHVQIFEWLNETFPNPDN
                     RFINGAQGGVGAAYFGWCFKEHIPEDADLVLLELGINDLLEFDVFSQYEHLVRGLLEL
                     ENKPALINIETFTTLFPSLLSSSSFHNDVLSFYDVPSLSIRDVVLPRILADPQQQMRR
                     WFRTGDDVAMGDPKVKEWGGVPVDVMHIDRSTSYGLSALGRLTSTPKKPTVRIMDVPA
                     TTLTGLFNPDKADMRHAPVCRSQNSGKTHGKVSSLVDDFSEGTYKGLTLAEGSHGWSE
                     WSWKEKRYLIAREPGSRAIFDFTISLPQEPLISDDPSAFLLDGADDITAETPSQVHKT
                     EGEDDMPVEQEFPRGSLAHRSAGLRKIWSSAISHQPRPTSPTLPGRRYISQPNAKQNP
                     QAGGSILIGYQRSAKLGLGSVWCWIDDDRDGGQRVDGWWKLDKRNMGMVKEIAVGLEP
                     GKHTLTCEILEDTLDPMGGTEFRLFAIMHD"
     gene            complement(464420..467567)
                     /locus_tag="CNC01680"
                     /db_xref="GeneID:3256181"
     mRNA            complement(join(464420..464691,464749..464886,
                     464941..465666,465717..466076,466133..466258,
                     466311..466653,466704..466870,466933..467567))
                     /locus_tag="CNC01680"
                     /product="dynamin protein dnm1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530680|gb|CF676521.1,gi|41530695|gb|CF676536.1,
                     gi|41533825|gb|CF679666.1,gi|41536782|gb|CF682623.1,
                     gi|41536787|gb|CF682628.1,gi|41548130|gb|CF693971.1,
                     gi|41548931|gb|CF694772.1,gi|41551120|gb|CF696961.1,
                     gi|41551125|gb|CF696966.1,gi|41564274|gb|CF710115.1,
                     gi|41564282|gb|CF710123.1"
                     /transcript_id="XM_569513.1"
                     /db_xref="GI:58264713"
                     /db_xref="GeneID:3256181"
     CDS             complement(join(464506..464691,464749..464886,
                     464941..465666,465717..466076,466133..466258,
                     466311..466653,466704..466870,466933..467385))
                     /locus_tag="CNC01680"
                     /EC_number="3.6.1.50"
                     /codon_start=1
                     /product="dynamin protein dnm1"
                     /protein_id="XP_569513.1"
                     /db_xref="GI:58264714"
                     /db_xref="GeneID:3256181"
                     /translation="MSMDGDLIALVNKLQDTFNAIGGDAVDLPQIVVVGSQSSGKSSV
                     LETIVGRDFLPRGSGIVTRRPLILQLIHTPPRSSPRTLENIDDGYLPNLDQTPTAGAG
                     VMRPGGRSMGEGTGAEYAEFLHINRRFTDFEEIRKEIEAETFRVAGQNKGVSKLPINL
                     KIYGPGVLNLTLVDLPGLTKVPVGDQPTDIERQIKNLVLDYISKPNAVILAVSPANVD
                     LANSDALKLARSVDPRGLRTLGVLTKLDLMDAGTNALDILTGRTYPLKLGFVGVVNRS
                     QQDINENLPMEDARAKEEEFFRTHPVYRNIAHRCGTKYLAKTLNHVLMNHIREKLPDM
                     KARLNTLMGQTQQELNAFGDATFLGEQHRGSLILKLMTEFSKDFVSSIEGTSLEISTK
                     ELSGGARVYYIFNEVFGHALQGIDPAHNLSLADIRTAIRNSTGPRPSLFVPEVAFDLL
                     VKPQIKLLEAPSLRCVELVYEELMKICHNCTSPELQRFPRLLTQLVEVVSDLLRERLG
                     PTSDYVSSLISIQAAYINTNHPDFVAGSAAIARAGAPPTTQISKVQEATSEVDDEESE
                     AESEASAPNGYVTHPRSASASVPDIRRPTTALGGKETKSRKHIRTASGSHSGHTSGAR
                     QGANALLGAASAHNMAGTSPHTAKETFLNYFLGGRNGAGEDAGSVQRALGKSHVMQHH
                     AQGQYQPQQREKDLLPDLGGRRGGRLENSASFDMKSLGKHLEATTGDEMQLTPREEME
                     TTLIRSLIASYFGITRQTIQDLVPKAIMHLLVNFSRDAIQQRLVTQLYKPELFADLLF
                     EDEALVSERTRVKALLDAYKEAFKVLSEVSLKST"
     gene            complement(467940..469601)
                     /locus_tag="CNC01690"
                     /db_xref="GeneID:3256295"
     mRNA            complement(join(467940..468354,468412..468719,
                     468768..469539,469588..469601))
                     /locus_tag="CNC01690"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41557488|gb|CF703329.1,gi|41557493|gb|CF703334.1"
                     /transcript_id="XM_569515.1"
                     /db_xref="GI:58264717"
                     /db_xref="GeneID:3256295"
     CDS             complement(join(468111..468354,468412..468719,
                     468768..469539,469588..469598))
                     /locus_tag="CNC01690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569515.1"
                     /db_xref="GI:58264718"
                     /db_xref="GeneID:3256295"
                     /translation="MSAKPTVRRTYGKAPPRASSPLFDPSSPPPALSSTYRSSSPLSY
                     RLDSPLGSSPPRPIRTRAKSPLFLPSEDDDDMDEQDTSQPEPSIVADLLGKGKQRAKR
                     NPIMEKKQVQSSLKGFFTSLPKKRPLEPSMTVSAVKPKQPKVFGPSRPITIASFLKTP
                     QPSNAKTSGSVKAKTGSMAQMHLTHLPLLHTCPTCGMSFVRGGPDEGVHVTHHARVLR
                     GILWEGMKKREGEGWKVVQEDVEFGGKRRGRIIALDGSFGGNKLVEILSTVDRVLSAP
                     PLPPAILNRCKVFVFLTHSPPPPPSSSKRIKLDPTDNKLGKDKDKERVVSVVVAQGIK
                     WAMKVLKEGEMKTEKSKTIETGGFGSVTCDPTPLPTPLGIHRLYTTPSYRSHSLSSRL
                     LDVACEHTVYGCTFDPKKGEVAFSQPTESGRGVMERWGGGEVRVFVDDQSQL"
     gene            <469838..471806
                     /locus_tag="CNC01700"
                     /db_xref="GeneID:3256300"
     mRNA            join(<469838..469900,469950..470124,470174..470498,
                     470557..470920,470979..471157,471215..471501,
                     471558..471671,471735..471806)
                     /locus_tag="CNC01700"
                     /product="fumarate hydratase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529869|gb|CF675710.1,gi|41529876|gb|CF675717.1,
                     gi|41536042|gb|CF681883.1,gi|41536044|gb|CF681885.1,
                     gi|41537737|gb|CF683578.1,gi|41537742|gb|CF683583.1,
                     gi|41538837|gb|CF684678.1,gi|41538845|gb|CF684686.1,
                     gi|41543439|gb|CF689280.1,gi|41543443|gb|CF689284.1,
                     gi|41547176|gb|CF693017.1,gi|41547182|gb|CF693023.1,
                     gi|41551805|gb|CF697646.1,gi|41551817|gb|CF697658.1,
                     gi|41562274|gb|CF708115.1,gi|41562284|gb|CF708125.1,
                     gi|41562850|gb|CF708691.1,gi|41562856|gb|CF708697.1,
                     gi|41563392|gb|CF709233.1,gi|41563396|gb|CF709237.1,
                     gi|41568140|gb|CF713981.1,gi|41568149|gb|CF713990.1,
                     gi|41569087|gb|CF714928.1,gi|41569089|gb|CF714930.1,
                     gi|41570698|gb|CF716539.1,gi|41570703|gb|CF716544.1,
                     gi|41571658|gb|CF717499.1,gi|41571671|gb|CF717512.1,
                     gi|41572141|gb|CF717982.1,gi|41572150|gb|CF717991.1,
                     gi|41573047|gb|CF718888.1,gi|41573051|gb|CF718892.1,
                     gi|41573859|gb|CF719700.1,gi|41573869|gb|CF719710.1,
                     gi|41574111|gb|CF719952.1,gi|41575146|gb|CF720987.1,
                     gi|41575152|gb|CF720993.1"
                     /transcript_id="XM_569517.1"
                     /db_xref="GI:58264721"
                     /db_xref="GeneID:3256300"
     CDS             join(469838..469900,469950..470124,470174..470498,
                     470557..470920,470979..471157,471215..471501,
                     471558..471671,471735..471760)
                     /locus_tag="CNC01700"
                     /codon_start=1
                     /product="fumarate hydratase"
                     /protein_id="XP_569517.1"
                     /db_xref="GI:58264722"
                     /db_xref="GeneID:3256300"
                     /translation="MTTPTKTSSLKTTQMLARSLRLTRTLPRVSLASRGFSSTSYIMA
                     EQKFRKEKDTFGDLQVPADRYWGAQTQRSLMNFDIGGPTERMPPPLIKAFGVLKKAAA
                     AVNQTYGLPAEVAEHIQKAADEVISGKLIDEFPLVVFQTGSGTQTNMNVNEVISNRAI
                     EMMGGELGSKKPVHPNDHVNMSQSSNDTFPTAMHIAAVVEINEQLLPAMKELHAALKA
                     KQDAFENIIKIGRTHLQDATPLTLGQEFSGYVTQVERGIGRVEATLKNLSMLAQGGTA
                     VGTGLNTRKGFDEKVAAEISKITGYDFVTAPNKFEALAAHDAIVEASGALNVVAVSFM
                     KIANDIRYLGSGPRCGLGELELPENEPGSSIMPGKVNPTQCEALTMVAAQVMGNNTTI
                     SVAGSYGQFELNVFKPVLIKNLLQSIRLLSDGARSFTKNCVVGIKANEDRIKKIMNES
                     LMLATCLNSTLGYDDVAAIAKKAHKEGLTLKESTLALGKLTSEQFDEKVRPELMLAPT
                     DA"
     gene            472040..476196
                     /locus_tag="CNC01710"
                     /db_xref="GeneID:3256422"
     mRNA            join(472040..472359,472451..473398,473451..473567,
                     473619..473726,473819..474203,474223..474872,
                     475017..475211,475312..475572,475625..475884,
                     475936..476196)
                     /locus_tag="CNC01710"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41575617|gb|CF721458.1,gi|41575626|gb|CF721467.1"
                     /transcript_id="XM_569519.1"
                     /db_xref="GI:58264725"
                     /db_xref="GeneID:3256422"
     CDS             join(472189..472359,472451..473398,473451..473567,
                     473619..473726,473819..474203,474223..474872,
                     475017..475211,475312..475572,475625..475884,
                     475936..476104)
                     /locus_tag="CNC01710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569519.1"
                     /db_xref="GI:58264726"
                     /db_xref="GeneID:3256422"
                     /translation="MEAICPVGDQYQNNDSLSDSENSPVNNLPPPPEPFPVDLLSQNV
                     SSSIGSRAESDQTLIVKHLRSVQRSCIDALSALLPDHFTQNGDFDWDPTLIADSDDRL
                     AQALMELLEVTYELEDLTPSPAESVLQEERGEEVVIGDSGSLENLTSQLDKLQAARVA
                     SRPQTPIIGTYSDASAIHPAIRIVRLEFSWARLESLSLAVVELSRQRYQQSTEDRETS
                     PPSYETYHNGSHELPQYSEVNSHGSSASVSKLADSPTAKDDFTSRSSLESSRSRRPAD
                     REKMLNELEAVTSAIERLYSISPQLSNQRVEFRPLARSSTEGRHHQNNETVDLKVDER
                     VDEGQKMKELDEIWCQLQGAKKKRMEDQRAGVNTSQSRSKEKFIARLIEQAEKRRLPC
                     QDSEMAAVDGELAKARELKDRDHFLRGLIERSADRRFDNQDAAAPAEDRSAARLAKAT
                     RLSSQDFPLTLEDKLAENRSAFVSQLVEYSSAGRLYDQDSLPPSPREDENMRVGEEKD
                     PMEIVTVKDFLASSRPPVPQNKADAGEPAGKREMSSSEGGGKRRVVSKIAGMVRKGSV
                     HLGLKSTFSPVGEHKADESDENNVTYVVEHQENLRSLQVLVHGIGISSNLELNIQTLP
                     SSSGSTNTAVITSKREPSLSIDVALPVLVYSDQITPLVPQSLYQEAKLSALPTPPASN
                     ALIITHALSAPDFRSLKATVLCCAICERHLASLPFSQDPKQAYKDLPSDHWAEMIDIW
                     MCHDDPAFTARLAGMTEEGFWPRDGGVLVGGSYLLVEKTSGQWEILRMGTQKEEEALQ
                     QVSPFLSSDPGERTECWALAILPCPGRKLFWLIQRSKNKTIHPRVDQTFDLQRIREQR
                     LHNETWRLISCKCGEVVGKQRIDDGKPGSGTLRFSKWAIGLLDDGNDDGEITRFPLSV
                     FIVSDMLELAQAHASFRFIISEEETGVQKLYLWLFNASTSVSYFKPTPTSAQTSPLRS
                     SFTVCQASEKRSVRSRRSSTASSIKTSNSGGNGGSAKCDGRGKTIKAVKTMYKIVDES
                     TNIDRLPGFGPGGQIEHLTYSREVCSRLIATLKESTLVYPAAKRSMGAFDVGFLERA"
     gene            complement(476291..478054)
                     /locus_tag="CNC01720"
                     /db_xref="GeneID:3256206"
     mRNA            complement(join(476291..476436,476490..476705,
                     476761..477502,477564..477680,477743..478054))
                     /locus_tag="CNC01720"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538300|gb|CF684141.1,gi|41538301|gb|CF684142.1,
                     gi|41575089|gb|CF720930.1,gi|41575096|gb|CF720937.1"
                     /transcript_id="XM_569521.1"
                     /db_xref="GI:58264729"
                     /db_xref="GeneID:3256206"
     CDS             complement(join(476296..476436,476490..476705,
                     476761..477502,477564..477680,477743..478047))
                     /locus_tag="CNC01720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569521.1"
                     /db_xref="GI:58264730"
                     /db_xref="GeneID:3256206"
                     /translation="MPRITPAAILRSAAATRQPLTSRAAIRPILSPAVPSLLATTKRY
                     QSTSQQPNEHPKAENKEPDPKSTEPKPEGGKEGKKGLKVSWIFSGLAGLGALVTIYGL
                     LEFYSTLTTWPKEVRKPLRAALKAKLRGDYGKAETFFREALEIALQMGPSALQPEPLL
                     KISGIYVELANVLEIQRQRVSAFVELRTALEMFGPDPLRRPGILPLPEATTLGGGPGG
                     QWIGEGYRLTEKDHVRAIGLYQKLGQLALEVASSPTGSTYASTLGEGSTGQMFKTWDD
                     AAEYYLSSALTSMLHLGLPGSSPTPSTEGPVILGRDVSLPDALPSDNPEDVDQGGQVD
                     KRGLGMTMESLSEVYARKGQYDMAGQLLLQAISLLLPPQSKETPPMRDRCQAAMLMTT
                     VSSHALHPPTPKSLKVSRSWSLRSLQLSQQALAEAEGGSFKDTPLEAAEAVCQRARAV
                     GLHNMGMLAEMEKDYAGAQNLFKKALAASRETGFVEGKREALAALRRVQNLAGESA"
     STS             477116..477885
                     /standard_name="Pst6"
                     /db_xref="UniSTS:470782"
     gene            <478229..>479775
                     /locus_tag="CNC01730"
                     /db_xref="GeneID:3256399"
     mRNA            join(<478229..478357,478419..478476,478539..478675,
                     478754..478876,478944..479053,479109..479238,
                     479302..>479775)
                     /locus_tag="CNC01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_569965.1"
                     /db_xref="GI:58265617"
                     /db_xref="GeneID:3256399"
     CDS             join(478229..478357,478419..478476,478539..478675,
                     478754..478876,478944..479053,479109..479238,
                     479302..479775)
                     /locus_tag="CNC01730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569965.1"
                     /db_xref="GI:58265618"
                     /db_xref="GeneID:3256399"
                     /translation="MQYVASPQEYPDTPSQSSTSARIPSPRAFDVVTAYRRALEDDKV
                     PHPIAAILALVELMEASTASTVTGLASELTVGRQALINTQASLGVRAGCQLWERFFAL
                     FPGVGEDFPAYKKSLISQGRSFCAITAPQCREKIAELAVGFLRDDCVILTHSYSRTVI
                     QTILRAHKQHKRIRVYVTEARPGCLGMKTHQFLTANGIPCTVVLDSAVAYVMERVDMV
                     LVGSEAVVESGGLVSSVGTYQVALVAKVMQKPFYALAESYKFLRHYPLSQTDLPIPAS
                     SDRPAIPLEFPSTIPDTQFIPGFLSRGSSLTPQSRSPQAPATPPHAVGGGGVGVDGGK
                     KYERMEMTKEMEEINPMVDVTTPDLIDFIITDLGEPLSPTSVSQYLVAQFSS"
     gene            complement(479799..481733)
                     /locus_tag="CNC01740"
                     /db_xref="GeneID:3256453"
     mRNA            complement(join(479799..479972,480034..481733))
                     /locus_tag="CNC01740"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546965|gb|CF692806.1,gi|41546978|gb|CF692819.1,
                     gi|41547213|gb|CF693054.1,gi|41547218|gb|CF693059.1,
                     gi|41566793|gb|CF712634.1"
                     /transcript_id="XM_569523.1"
                     /db_xref="GI:58264733"
                     /db_xref="GeneID:3256453"
     CDS             complement(join(479933..479972,480034..481502))
                     /locus_tag="CNC01740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569523.1"
                     /db_xref="GI:58264734"
                     /db_xref="GeneID:3256453"
                     /translation="MLGGAIDEIGLIDSRDTPPPMVGEPGKKQKPDMRIELDKAKGLE
                     PAAEVVNKGPMTPTSLPARGASLSSTTSPPPPPPPPVQGPTEMGAGIASSFPLHQPEL
                     ETTSNNPFSSQAGPFTHSPTTLSFHSPTAHPWPSAMSMSTSALKSHKSAGARALAYAR
                     AINEIARAETGLKAWCAAAAAEAHRRPIHHAPSKTQAPASSSPPVGLSPHPRNVSTGS
                     EFPMRADSYTAREISQRVIDPADQPTALPPNLPYPQLQAQINYHHQLSPGGSSLVGGG
                     GLKPSQSMQSVSSFTSSKKGGGGGGGGGGGFFSAIRKGSSRKESMSMSLGPPGGYLGG
                     SASKKDVRGLPISAPRSASPQKPDGTTTTTSSPRSGSGSGSHTPRVQTVPSPMGPRPL
                     GPRGPGARGSFTPPGRTSLDTAAPSRISVVSPPRNLRASMDSVRLVGKTSAPPPSGTA
                     TVADSGEDVKYMADVLPYVEKSVLRAYLNRYGGDQMQALGAYLEDEKNGAVR"
     STS             480346..480552
                     /standard_name="CGT1"
                     /db_xref="UniSTS:470787"
     STS             480497..480764
                     /standard_name="CCG1"
                     /db_xref="UniSTS:470786"
     repeat_region   480585..480617
                     /rpt_type=tandem
                     /rpt_unit_seq="ccg"
                     /satellite="microsatellite"
     repeat_region   481105..481152
                     /rpt_type=tandem
                     /rpt_unit_seq="tggg"
                     /satellite="microsatellite"
     STS             481190..481340
                     /standard_name="GGC2"
                     /db_xref="UniSTS:470785"
     repeat_region   481263..481291
                     /rpt_type=tandem
                     /rpt_unit_seq="cgg"
                     /satellite="microsatellite"
     repeat_region   482151..482187
                     /rpt_type=tandem
                     /rpt_unit_seq="aggggg"
                     /satellite="microsatellite"
     repeat_region   482254..482293
                     /rpt_type=tandem
                     /rpt_unit_seq="cggggg"
                     /satellite="microsatellite"
     misc_feature    482368..482521
                     /note="C-rich"
     gene            485048..486640
                     /locus_tag="CNC01750"
                     /db_xref="GeneID:3256126"
     mRNA            join(485048..485248,485329..485488,485547..485670,
                     485747..485917,485985..486148,486200..486378,
                     486448..486640)
                     /locus_tag="CNC01750"
                     /product="Cdc2 cyclin-dependent kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539509|gb|CF685350.1,gi|41567098|gb|CF712939.1,
                     gi|41574293|gb|CF720134.1"
                     /transcript_id="XM_569525.1"
                     /db_xref="GI:58264737"
                     /db_xref="GeneID:3256126"
     CDS             join(485206..485248,485329..485488,485547..485670,
                     485747..485917,485985..486148,486200..486378,
                     486448..486503)
                     /locus_tag="CNC01750"
                     /codon_start=1
                     /product="Cdc2 cyclin-dependent kinase"
                     /protein_id="XP_569525.1"
                     /db_xref="GI:58264738"
                     /db_xref="GeneID:3256126"
                     /translation="MSLDNYQKIEKVGEGTYGVVYKAKDINTGHIVALKKIRLEAEDE
                     GVPSTSIREISLLKELSKDDNIVKLLDIVHSEAKLYLVFEFLDMDLKKYMDTIGEKDG
                     LGPDMVKKFSYQLVKGLYYCHGHRILHRDLKPQNLLINKSGDLKIGDFGLARAFGIPL
                     RTYTHEVVTLWYRAPEVLLGSRHYSTAIDMWSVGCIVAEMATRQPLFPGDSEIDEIFR
                     IFRVLGTPDEDVWPGVRGLPDYKPTFPQWHPVELADVVKGFEADGLDLIAQTLVYDPA
                     HRISAKRALQHPYFDTVNLSAA"
     STS             486251..487002
                     /standard_name="Sal5"
                     /db_xref="UniSTS:470784"
     gene            complement(<486707..>487805)
                     /locus_tag="CNC01760"
                     /db_xref="GeneID:3256552"
     mRNA            complement(join(<486707..487476,487540..487677,
                     487736..>487805))
                     /locus_tag="CNC01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_569527.1"
                     /db_xref="GI:58264741"
                     /db_xref="GeneID:3256552"
     CDS             complement(join(486707..487476,487540..487677,
                     487736..487805))
                     /locus_tag="CNC01760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569527.1"
                     /db_xref="GI:58264742"
                     /db_xref="GeneID:3256552"
                     /translation="MSPPPHSIPLYLVNGVATVWDAQTAATLHCVHNVSGLRAGTLPG
                     VAQQNGFLGLPLTLMQEETAYLVTQGIAHLVPLDPSPSPPSDETVKAHTAARVARLKA
                     LEEKTREAEAKRLEESKKAFDKGGEKARLKREARARAKAEKAKESGEGLFAEDVKENV
                     TAPIVVSPAKTKTKHAGAPAAGHFHIVPSHPVLSQHPPESQSITSLPHPLFPFPTTPR
                     QCALLGVFSKLQSLSYRVGLGPRFGGEWLIYPGDYLRYHAHFTSQVIVRDEPIRPTEI
                     VAWGRLGTGTKKAGLICCWDDGKREDGQDDQGGKEEDVEFYSLEWANFG"
     gene            <488010..488934
                     /locus_tag="CNC01770"
                     /db_xref="GeneID:3256459"
     mRNA            join(<488010..488082,488214..488280,488401..488461,
                     488693..488795,488847..488934)
                     /locus_tag="CNC01770"
                     /product="u6 snRNA-associated sm-like protein lsm2,
                     putative"
                     /transcript_id="XM_569529.1"
                     /db_xref="GI:58264745"
                     /db_xref="GeneID:3256459"
     CDS             join(488010..488082,488214..488280,488401..488461,
                     488693..488795,488847..488869)
                     /locus_tag="CNC01770"
                     /codon_start=1
                     /product="u6 snRNA-associated sm-like protein lsm2"
                     /protein_id="XP_569529.1"
                     /db_xref="GI:58264746"
                     /db_xref="GeneID:3256459"
                     /translation="MVSRFRSRVPIFLTHSSEIAHLLVNQVITVELKNDLSITGTLKS
                     VDQFLNIRLDNISVEDPERHPHMMAVKNCFIRGSVVRYVRMAARSVDTTLLEDATRRE
                     AKEGKK"
     gene            <489049..>490469
                     /locus_tag="CNC01780"
                     /db_xref="GeneID:3256501"
     mRNA            join(<489049..489352,489410..489562,489627..489744,
                     489807..489892,489951..490084,490143..>490469)
                     /locus_tag="CNC01780"
                     /product="prenyltransferase, putative"
                     /transcript_id="XM_569531.1"
                     /db_xref="GI:58264749"
                     /db_xref="GeneID:3256501"
     CDS             join(489049..489352,489410..489562,489627..489744,
                     489807..489892,489951..490084,490143..490469)
                     /locus_tag="CNC01780"
                     /codon_start=1
                     /product="prenyltransferase"
                     /protein_id="XP_569531.1"
                     /db_xref="GI:58264750"
                     /db_xref="GeneID:3256501"
                     /translation="MLLLSRTRLFPRPLLSPLSRPLPLRPRVLTTSAIRRASLPPTVP
                     RVSTELVHPKEQQQQLPAQPPTVFDKILPQWAQGAKPYLYLTRLDKPIGSVLLYWPCA
                     WSITMASTVNHLPPTTPLFYMSLFAVGALIMRGAGCTINDMWDWKMDAKVERTKTRPL
                     AAGDVTQFGALTFLGAQLTAGLAVLTQLNWYSIVLGASSLGLVVIYPFMKRITYFPQV
                     VLGFAFNWGALLGWSAVAGAVDWTIATPMYLGGAAWCVAYDIIYAHQDKKDDVIAGVK
                     SMALRFPDTSRQVISTLSASFVSLLTFTGYMAGLGPLYYLISCGGAAAHLAWQCLTVN
                     FDSRSDCWKKFSSNGWLGGLIWSGIAADYVQQVMFGVPA"
     misc_feature    489052..489124
                     /locus_tag="CNC01780"
                     /note="C-rich"
     gene            complement(<490557..>491622)
                     /locus_tag="CNC01790"
                     /db_xref="GeneID:3256566"
     mRNA            complement(join(<490557..490702,490755..490784,
                     490837..490918,490942..490989,491163..491291,
                     491347..491538,491593..>491622))
                     /locus_tag="CNC01790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569966.1"
                     /db_xref="GI:58265619"
                     /db_xref="GeneID:3256566"
     CDS             complement(join(490557..490702,490755..490784,
                     490837..490918,490942..490989,491163..491291,
                     491347..491538,491593..491622))
                     /locus_tag="CNC01790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569966.1"
                     /db_xref="GI:58265620"
                     /db_xref="GeneID:3256566"
                     /translation="MLSRSHALAGVLTCATVEKITLDPQEGGSTRMRGGIPAVSSYSV
                     LEKALANCLKITLPAGYLGSSFIGACLVACGFDINASKVACLVLAFIWILTLWWARSS
                     WVAWATIALMVGLVLWDIIDASILHERRRNMDTLARKINSSDASEYAHMIGCCGSRFW
                     GAFWLIISCCFFAAGVLVGIAAFKDDWQTQADKASNFLGGKLDVIICSRALSNITGTP
                     "
     gene            complement(492461..494175)
                     /locus_tag="CNC01800"
                     /db_xref="GeneID:3256217"
     mRNA            complement(join(492461..493282,493338..493414,
                     493462..493618,493676..494175))
                     /locus_tag="CNC01800"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531604|gb|CF677445.1,gi|41537385|gb|CF683226.1,
                     gi|41543121|gb|CF688962.1,gi|41543129|gb|CF688970.1,
                     gi|41548722|gb|CF694563.1,gi|41548732|gb|CF694573.1,
                     gi|41555339|gb|CF701180.1,gi|41557545|gb|CF703386.1,
                     gi|41557553|gb|CF703394.1,gi|41557977|gb|CF703818.1,
                     gi|41557988|gb|CF703829.1,gi|41568812|gb|CF714653.1,
                     gi|41568821|gb|CF714662.1,gi|41569738|gb|CF715579.1"
                     /transcript_id="XM_569533.1"
                     /db_xref="GI:58264753"
                     /db_xref="GeneID:3256217"
     CDS             complement(join(492528..493282,493338..493414,
                     493462..493618,493676..494129))
                     /locus_tag="CNC01800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569533.1"
                     /db_xref="GI:58264754"
                     /db_xref="GeneID:3256217"
                     /translation="MPASQPLQLLFLGTATSTGLPLTPCLTLSTPYPHRWSNMVPLLQ
                     GRDLSDRSPSPASTTISSTYSGSTYDPEGQWPKNIPCACCRSTVDPDVPEGWKNKRGN
                     TSVLLRKQSAEGDWKNVLVDVGKTFREQAMRFFPTWGVKTIDAVLLTHGHADAYFGLD
                     DLREWCVRQGKAIPVYLNKETFHKVEETFPYMVDKTKVSGGGDVPQLIWKIIEDEGEF
                     QVEGIDVKVLPVHHGIYFHSILPPTNAEPVREPPAKIEPEPLICLAFEFDDSIIYMSD
                     VSGIPQRTWDRMLQTSSRRQTIFPTPVDSRGGDDTPKGVPKNQSISDLANLSISPRVP
                     GRLEQLRTHNVPVLIIDALWPLQPHASHFSLAQALIAALRLRAANTYVIGSTHPTSHF
                     MWEEICNSLTHRDGRDYEVRDHPDAAQAEWLVKRVWDKVFGEGEHEGLGERWMEEGGK
                     VKPAWDGLVIEVGGDQGLERADLSSKGLLI"
     gene            <494481..>495397
                     /locus_tag="CNC01810"
                     /db_xref="GeneID:3256823"
     mRNA            join(<494481..494675,494731..495003,495056..>495397)
                     /locus_tag="CNC01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_569535.1"
                     /db_xref="GI:58264757"
                     /db_xref="GeneID:3256823"
     CDS             join(494481..494675,494731..495003,495056..495397)
                     /locus_tag="CNC01810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569535.1"
                     /db_xref="GI:58264758"
                     /db_xref="GeneID:3256823"
                     /translation="MSSSIPTPSASNRPFQSQFAGDQDQPGSFYRNLFYILVGLLCAF
                     SLFSFLTLMRARRRRRAVIDEALRLGVMVPGVPGYVPLQDRQALMWMKSDGNQLPDWW
                     EIGKLKGPDDPPLLNEEGRSNGPMDQQNSVAPPTGDLHQRQTNQESSSHNSDFFQPLA
                     IIPPVATETSAQPIPTSKLKFFPNHLAYRPSALLPPPARFNDINSENMMEKLDQLKGN
                     VVEVVTVIQMPVPSWTGTSTDDGDVQVFKEWGGIELGITNLRVAAESHQVS"
     gene            complement(495493..497975)
                     /locus_tag="CNC01820"
                     /db_xref="GeneID:3256398"
     mRNA            complement(join(495493..495745,495804..496041,
                     496107..496346,496407..496746,496807..496885,
                     496933..496972,497018..497115,497167..497283,
                     497345..497421,497471..497580,497632..497975))
                     /locus_tag="CNC01820"
                     /product="acetyl/propionyl CoA carboxylase, beta subunit,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539207|gb|CF685048.1,gi|41539212|gb|CF685053.1,
                     gi|41544080|gb|CF689921.1,gi|41544083|gb|CF689924.1,
                     gi|41552946|gb|CF698787.1,gi|41552955|gb|CF698796.1,
                     gi|41558566|gb|CF704407.1,gi|41558574|gb|CF704415.1"
                     /transcript_id="XM_569537.1"
                     /db_xref="GI:58264761"
                     /db_xref="GeneID:3256398"
     CDS             complement(join(495584..495745,495804..496041,
                     496107..496346,496407..496746,496807..496885,
                     496933..496972,497018..497115,497167..497283,
                     497345..497421,497471..497580,497632..497924))
                     /locus_tag="CNC01820"
                     /codon_start=1
                     /product="acetyl/propionyl CoA carboxylase, beta subunit,
                     putative"
                     /protein_id="XP_569537.1"
                     /db_xref="GI:58264762"
                     /db_xref="GeneID:3256398"
                     /translation="MYPRSLTLPPVRPRPFSPVFLSLARTLIPQPPPPLVSSRPLPTT
                     FKKVSPQSESNRLFMEGLIREIETLRAQAKEGGGQKVLDRWKAKGTGKLSVRERVSAL
                     LDPASPFLELSPLAAHDVYPDALPGAGLVTGIGMIAGRKCMIIANDPTVKGGTYFPLT
                     VKKHLRAQQVALENSLPCIYLVESGGAALPYQAEVFPDHDHFGRIFYNIARMSGMGIP
                     QISVVHGISVAGGAYMPAMSDVVIIVKDQGRIFLAGPPLVKAATGEIVDEEALGGGDM
                     HTSVSGVADYLATSDSHALRLAREAIRDLCPIPIAQALPSGSTAAGTREVVPPLYPTE
                     DLNAIVPADPRQTYDPREIIARLVDGSEFREFKKEFGKTIITGFAEVHGYTVGIIANA
                     GVLLSPSAQKATHFINLCSQRRIPLVFLVNVGGYMVGEKAERGGIAKDGAKMVRAVAR
                     AKVEKYTFVVGGSYGAGNYGMCGRAYSPRFLFMWPNARISVMGPDQLSTVMHTVQGKR
                     AQENGKAAEDAERKRQELRDAIEKQSMGIYSTARLWDDGIIKPSDTRDILGLALELAH
                     DERAKRPHGAQGTRGEIGADGDNGDWGVFRM"
     gene            <498603..>499534
                     /locus_tag="CNC01830"
                     /db_xref="GeneID:3256195"
     mRNA            join(<498603..498660,498719..498773,498835..498929,
                     498996..499162,499220..499275,499329..499375,
                     499434..>499534)
                     /locus_tag="CNC01830"
                     /product="RAS1, putative"
                     /transcript_id="XM_569539.1"
                     /db_xref="GI:58264765"
                     /db_xref="GeneID:3256195"
     CDS             join(498603..498660,498719..498773,498835..498929,
                     498996..499162,499220..499275,499329..499375,
                     499434..499534)
                     /locus_tag="CNC01830"
                     /codon_start=1
                     /product="RAS1"
                     /protein_id="XP_569539.1"
                     /db_xref="GI:58264766"
                     /db_xref="GeneID:3256195"
                     /translation="MSEKGYYGGDQRLVIVGCGGVGKTAITIRFVTSQFYDQEYNPTI
                     EDSYRKQVVVDNEATTLEILDTAGQEEYAAMADQWYTFGSGFLLVYSLTDRSSFEEIK
                     NFHREILRVKDRNYVPCVIVCNKCDLQKYRSVGQLEGRELARCSIQRIDQARAEGRTT
                     DISSCSKASRRPISLTTSTTATKTNKTNEGEG"
     gene            complement(<500290..502829)
                     /locus_tag="CNC01840"
                     /db_xref="GeneID:3256580"
     mRNA            complement(join(<500290..500299,500421..501221,
                     501403..502205,502262..502829))
                     /locus_tag="CNC01840"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541405|gb|CF687246.1"
                     /transcript_id="XM_569540.1"
                     /db_xref="GI:58264767"
                     /db_xref="GeneID:3256580"
     CDS             complement(join(500290..500299,500421..501221,
                     501403..502205,502262..502678))
                     /locus_tag="CNC01840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569540.1"
                     /db_xref="GI:58264768"
                     /db_xref="GeneID:3256580"
                     /translation="MPSPKVPSNDSLLLSGDSPGPRVQWRVGPPLSAGQNGQNTAQSS
                     TSDSSLSKKKKKHEIREKIINGFDSDSEDELDVGEETKPKTNVIGEVAEEPDLDGELA
                     ALVEEQEVDELEDDDDDVNEQIMQKRSVSIDDDISGELLELASGPPKKKKKQAMAPPL
                     SHRPSAQSQRSLSKSQVTPVQITSHRVSRHVPPPSVAPRPTPSVLQHFPSTPNTTIPF
                     IPGFPMNTTIISTANDPYSSPLQILAQSLPSPEMQNILFGTFFSDPILTEGLSLLQPQ
                     FMDHFNRFMERRPARLQRGDATTLALTFIILASALRILPEETSRLLLASHGGSNAPSQ
                     IPRSLAKIISGQSVSAADITPLDQRYLDLALLSAQIAEQADTYSIMLVMFKLVSYRYW
                     MLGHRREESVLAGTCETSLPYTILDAHQGIQLPSPLSEPDLYRVPQDARELPSVPPDS
                     PPTPCTALLAHTHLARRVTAMLDSFATISASNISPDMVHHYDQILDTFQDSLPPFFKV
                     FPMTDSRYDASFPYLPLQRVRLHTALFSYRCGLHRAQLPAYLWPTTSATARQVVAQIS
                     LSSLRVQRSARMLDAKVAFRLFSPVTVFENAATLCLIMYIDKAVSADAGLSPGPPRSA
                     EFMGMRAGVAEALELLDMTGAGVDAVALFSKKATVVIRGMVSHVDAPLESQM"
     gene            complement(503262..>505367)
                     /locus_tag="CNC01850"
                     /db_xref="GeneID:3256629"
     mRNA            complement(join(503262..503718,503780..503960,
                     504013..504070,504134..504422,504476..504526,
                     504587..504683,504754..504971,505031..505100,
                     505153..>505367))
                     /locus_tag="CNC01850"
                     /product="MFS transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539783|gb|CF685624.1,gi|41539795|gb|CF685636.1"
                     /transcript_id="XM_569541.1"
                     /db_xref="GI:58264769"
                     /db_xref="GeneID:3256629"
     CDS             complement(join(503422..503718,503780..503960,
                     504013..504070,504134..504422,504476..504526,
                     504587..504683,504754..504971,505031..505100,
                     505153..505367))
                     /locus_tag="CNC01850"
                     /codon_start=1
                     /product="MFS transporter"
                     /protein_id="XP_569541.1"
                     /db_xref="GI:58264770"
                     /db_xref="GeneID:3256629"
                     /translation="MPSQEDPKDSIKRDEEEWHENDLEKMDQLELAAQYEPNSDAEKA
                     LVWKIDKRIIPTIWALYTLSYLDRANVGNAKTGGLEADLNLTSTQYSIVLLVFFISYV
                     IFEVPSNMMISRLRPSLYLSGLCIIWGGIAACMAAAKTYQALAGIRFVLGFIEAGFAP
                     GVAFYLSSWYKRYELASRFSLYYTATAVSGAFSGLLAGAITGNLDGARGLAGWQWLFI
                     IEGCASSFLGFFTWFIMPDWPSTTKFLSSDERVLAVQRLAYDGLSSTAGAQGHISHWA
                     AFKMAACDWRTWVFALLYMLTQGAQTIQYFVPTLIGALGWTGYLGQYRTIPLYACAFV
                     CIIGFCWGADYYKAKPLFIIIGGALGTIFFIIVTCVTSHMVQYVFLIFAFGCVYALPP
                     LVLTWVPNVLSHPAEKRGVAIALVNALGCSASIYGVFLWPSEDAPRYIPGFAATTCFM
                     ALIVIITPIMWYLVNRYPIQGPDVDKAVREEIERQKGRGTA"
     STS             505283..506081
                     /standard_name="Xba3"
                     /db_xref="UniSTS:470783"
     gene            506176..>507733
                     /locus_tag="CNC01860"
                     /db_xref="GeneID:3256514"
     mRNA            join(506176..506468,506532..506642,506701..506829,
                     506884..507189,507248..507334,507393..507507,
                     507569..>507733)
                     /locus_tag="CNC01860"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541976|gb|CF687817.1,gi|41541983|gb|CF687824.1"
                     /transcript_id="XM_569553.1"
                     /db_xref="GI:58264793"
                     /db_xref="GeneID:3256514"
     CDS             join(506563..506642,506701..506829,506884..507189,
                     507248..507334,507393..507507,507569..507733)
                     /locus_tag="CNC01860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569553.1"
                     /db_xref="GI:58264794"
                     /db_xref="GeneID:3256514"
                     /translation="MSLANNLTLDILKKAEEGGYGIVAQTCYDANMAVALVRAAERNK
                     SPAILQLFPVTLAAGGGPLLQYCLDVAHNASVPISVHLDHATDPEHLELSIGLAEKGI
                     KFDSIMVDASHADTDEENIAIAVPYIKRCRAAGVATEVELGRLEGGEAGLREITGAML
                     TDPANAEEFMKATGADILAPSYGNLHGSYKFIGGPKYKLEILKDLQERFRGRIPYLCA
                     HGTDELPDSLFQDLVKAGVSKFNINSWARDPYVETLGKELSAGTPFPDASEKAIEAFA
                     QVCDHMMELLGSKGKAA"
     gene            complement(507801..509877)
                     /locus_tag="CNC01870"
                     /db_xref="GeneID:3256767"
     mRNA            complement(join(507801..507993,508041..508304,
                     508356..508485,508537..508886,508945..509146,
                     509200..509477,509527..509877))
                     /locus_tag="CNC01870"
                     /product="eukaryotic translation initiation factor 3 62
                     kda subunit, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41548386|gb|CF694227.1,gi|41555836|gb|CF701677.1,
                     gi|41561853|gb|CF707694.1,gi|41561858|gb|CF707699.1,
                     gi|41563998|gb|CF709839.1,gi|41572941|gb|CF718782.1,
                     gi|41573328|gb|CF719169.1"
                     /transcript_id="XM_569555.1"
                     /db_xref="GI:58264797"
                     /db_xref="GeneID:3256767"
     CDS             complement(join(507831..507993,508041..508304,
                     508356..508485,508537..508886,508945..509146,
                     509200..509477,509527..509822))
                     /locus_tag="CNC01870"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3 62
                     kda subunit"
                     /protein_id="XP_569555.1"
                     /db_xref="GI:58264798"
                     /db_xref="GeneID:3256767"
                     /translation="MTEKQQNSQQPSQLDSTASISALPPQLQQPAAGITGAPGNAEAT
                     TSEPPSTKRPRKAIESSEPLTEVILRRLTTIKEGDTVLLRLPSDLVKSVVVQGDNLVQ
                     LGKYGAFPASQLIGLHYDITYEIVSSSGSGASTPQPQSLDFSTEETQSKKGNKKNKNK
                     GKDTAAVSKNNPGWNNILRPLKRQLVVDAVIDDIVETNEFIEDLSETEKTTLSHDEIA
                     ELRAQGCTPEEIIQAQIARHEKFGLKTDFSKEKWRRRKEKKFYQTVQPLAPSIPNVLY
                     HYNLRSPQSILHLRDDTLSQLLTMANVRPGGRYLVVDDTGGLITAAVLERMGSEGSIL
                     LFNESDSPPAWGILQTMNFSDRELEPIKWLNWLEAEEEYQKPAPPVQAEPPTNPIKAA
                     AKQRKYAAQVAELNNTRNELHLGGWDGLILATTLNPISVVARLTPYLLGSAPIVVYSP
                     YYQVLAELLSWSKKDPNYLNDTLTESWERTYQVLPGRTHPMMTTSATGGYLWNATRVH
                     PSQFQPESHQRFKRRKTGKAPGKEQLSSVAKDEEAVNESLEIDPEELANEGE"
     repeat_region   509988..510085
                     /rpt_type=tandem
                     /rpt_unit_seq="cca"
                     /satellite="microsatellite"
     gene            <510122..511431
                     /locus_tag="CNC01880"
                     /db_xref="GeneID:3256303"
     mRNA            join(<510122..510556,510603..510807,510857..511170,
                     511225..511431)
                     /locus_tag="CNC01880"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_569557.1"
                     /db_xref="GI:58264801"
                     /db_xref="GeneID:3256303"
     CDS             join(510122..510556,510603..510807,510857..511170,
                     511225..511377)
                     /locus_tag="CNC01880"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein"
                     /protein_id="XP_569557.1"
                     /db_xref="GI:58264802"
                     /db_xref="GeneID:3256303"
                     /translation="MSIPAMAQQPYMSHSPPPLQHPKPTHIAYPPPEPPHTPAQSTDS
                     SPYSQAQRISQDGYLRYSSPPAGEPLASSSGFSSYAPPPTGQQPVQSRQTYGQAGTPG
                     VQGVHGYGVPGYAWPGMNDATAQMGMQFGKSAVAAGQEYVEKNFTRYLPLQLIKISFS
                     VTNSYVLNKLRLILFPWRHKPWSRQSRRSTDNGAVEGWQAPRDDINAPDLYIPTMALV
                     TYTLLCALASGLQSRFHPEVLGLSLSKALAVVITEFCAIKLGCYLLDVRGSGASGVEL
                     VGYGGYKFVGIIATIVVSLLGLGKMITLGVFIYTFAANAFFLLRSLKYVLLPDASVSS
                     SVTTLSHSQRSRRVQFLFFVAVAQVLWMGWLSRV"
     gene            complement(511749..515213)
                     /locus_tag="CNC01890"
                     /db_xref="GeneID:3256691"
     mRNA            complement(join(511749..512776,512835..513403,
                     513444..513596,513648..513780,513827..513953,
                     514004..514073,514125..514270,514335..514681,
                     514742..515213))
                     /locus_tag="CNC01890"
                     /product="Na+/H+ exchanger AnNHA1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531103|gb|CF676944.1,gi|41531110|gb|CF676951.1,
                     gi|41572091|gb|CF717932.1,gi|41575993|gb|CF721834.1,
                     gi|41576002|gb|CF721843.1"
                     /transcript_id="XM_569560.1"
                     /db_xref="GI:58264807"
                     /db_xref="GeneID:3256691"
     CDS             complement(join(511859..512776,512835..513403,
                     513444..513596,513648..513780,513827..513953,
                     514004..514073,514125..514270,514335..514681,
                     514742..515035))
                     /locus_tag="CNC01890"
                     /codon_start=1
                     /product="Na+/H+ exchanger AnNHA1"
                     /protein_id="XP_569560.1"
                     /db_xref="GI:58264808"
                     /db_xref="GeneID:3256691"
                     /translation="MTAFHPFEVTAPHLAYTFLGGFVVIFGMVSLFVKEKLYVGEAPI
                     ATVVGIIIGPHCLNFFNPAGWGSGTQEVANDITLEFTRVVIAISVFAVGVELPKAYMK
                     RHWRSLFFLLGPCMVWGWMVSALLIWGLIPDLTFLASLVVAAGVTPTDPILAQAVIGG
                     KFADKHVPAHIRHLLSAESGSNDGAAFPFLYIALYLLLDASPGHAVGEWFYMTWAYEI
                     ILGIVIGAILGFCARKFMKFAERKRLVDRQSYVAQYVSLAVLSIGVTSLLGSDDLLSA
                     FACGCAFAWDGFFNKATEDAVFSNVIDLLFNCAAFIYIGAIIPFNHFNDLPDLRVWRL
                     VVLAILVLLVRRLPSIIVCYKFIPDIKTFREALFTGWFGPMGVGAVFISTLARSSLPE
                     GEPEQNTEAVDRLKDVIMPVTLFLVLSSIVTHGMSIPFFSLGRRVHSITYTRSRNLSM
                     DTRGDEPAWTTHARRIIPGQEIIVNRDDDEEGDLGVRRRDTLTSDSNGRITEKIEEED
                     SGESGESSSSRTRQGEMIEMIEKRGSSRHGSQASQGEAAEEGERWRSSRGGSPDLAND
                     PETQREIEEGREEIEDKEGAGRRTPPLAKYREGNHLIVERKIRDSDEVEVEVIRNHFA
                     ENKKTESDRFNHPHRLKSRELDDLLHHLPKSLEHATSRVQDGGKDAVDRLGLGLMGIR
                     TPEPSPPIESHGDSRHDHGYGLERTQSPEGLAGEGRDTEGGGDVSHGSDYEEDEANYE
                     DVPDETPRQRRKRMKPPAIVVSRQNSAGPPKRSIRSRLFGRRQHSSNSPSRAEEGLAP
                     PNHSLLAPSSSRSRPRNIAAEPESILAEDSRGVSSPSQPQNLAIPLTRTLSASRSSPA
                     VRFADDASPSSETAPGQSNYGSNAPGFKKNPALAMYRSASVQSTGSNKDGPSVSFKEP
                     EIKR"
     gene            <515486..>516351
                     /locus_tag="CNC01900"
                     /db_xref="GeneID:3256136"
     mRNA            join(<515486..516074,516131..>516351)
                     /locus_tag="CNC01900"
                     /product="structural constituent of ribosome, putative"
                     /transcript_id="XM_569562.1"
                     /db_xref="GI:58264811"
                     /db_xref="GeneID:3256136"
     CDS             join(515486..516074,516131..516351)
                     /locus_tag="CNC01900"
                     /codon_start=1
                     /product="structural constituent of ribosome"
                     /protein_id="XP_569562.1"
                     /db_xref="GI:58264812"
                     /db_xref="GeneID:3256136"
                     /translation="MSRQNLLFTTLRATFAPLAGPSTPRAFSSSQPSLVSTRKLVAKR
                     RKAANLALQASRVRKPDSIDPVLGRVQYKGEAPTNPWEGCRLQRVLLDYNAIAYSMPP
                     DYTAGEQPPYLLPGVSKEDAELLFRAVPHASTELRYASGQGSEKTEQEQARQSEMMMR
                     ILDLRNANKNAINVLNRQRVIDEFGAGVDSGSSAVQAALLTAKIHNLLSHIEENPRDT
                     SNKRALRLLVQERARHLKYWKRKQGEEAYDKLLTDLGLQREAVEGELFIGF"
     gene            complement(516489..519480)
                     /locus_tag="CNC01910"
                     /db_xref="GeneID:3256510"
     mRNA            complement(join(516489..517222,517266..517436,
                     517486..517603,517659..517753,517804..517858,
                     517909..517929,518020..518085,518124..518217,
                     518268..518581,518633..518654,518707..518851,
                     518902..518949,518997..519044,519097..519199,
                     519240..519480))
                     /locus_tag="CNC01910"
                     /product="methylcrotonoyl-Coenzyme A carboxylase 1,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41553206|gb|CF699047.1,gi|41553213|gb|CF699054.1,
                     gi|41563745|gb|CF709586.1,gi|41564709|gb|CF710550.1"
                     /transcript_id="XM_569564.1"
                     /db_xref="GI:58264815"
                     /db_xref="GeneID:3256510"
     CDS             complement(join(516551..517222,517266..517436,
                     517486..517603,517659..517753,517804..517858,
                     517909..517929,518020..518085,518124..518217,
                     518268..518581,518633..518654,518707..518851,
                     518902..518949,518997..519044,519097..519199,
                     519240..519469))
                     /locus_tag="CNC01910"
                     /codon_start=1
                     /product="methylcrotonoyl-Coenzyme A carboxylase 1"
                     /protein_id="XP_569564.1"
                     /db_xref="GI:58264816"
                     /db_xref="GeneID:3256510"
                     /translation="MRPIRGILINRGALAMPQYIKPHRLTRAHHMVAANRTPCGGQYS
                     TVAQHGNLVHLFDGNTELKVGKRPFKKILIANRGEIACAIIRTARRLGIATVSVYSEA
                     DRNCQHVAMADEAYLIGPSPSSESYLKMEKILHIAKLTGAEAIHPGYGFLSESSDFAE
                     KVRDAGLIFIGPSAEAIKSMGSKRESKEIMVAAGVPCVPGYHGADQSYDALLKGSQQT
                     GYPLIIKPTHGGGGKGMRIVRDPLTLQDELLSAQREALKSFGNDEVLLERWLEKPRHV
                     EVQVFGDQFGNCVALWERDCSVQRRHQKIIEEAPAPGLSPALKRDFAEKAVAAAKAIN
                     YVGAGTVEFIMDAETGEHFFMEMNTRLQVEHPVTEMITGMDLIEWQLSIAAGNPIPYT
                     QDKIPCIGHAFEARIYAEKPEYNFLPDTGKLFHVRSPINTPHRLETGFQEGDEISSHY
                     DPMIAKLVVHGKDRPQALSLLRSALAEYQIVGPSTNIEFLKSVAEHDDFAAGSVETSF
                     IPSHHDELFPPRVVPQDILAQAAVFLVLRAESGQKSLAPAGPWASLVHRRFSDICTFS
                     FRLDSEQVTVNPVESGYHVAIAGQDLYSQLIQSCVTSSTEFSAQIGPKKIQSTIIPIF
                     VNGLEKLHIFSSSSHYVITHHPSPLEGIEGPQSSSSSGTGTLVSPMPATVIEVKVKKG
                     DKVKENQVLCVLESMKMEINLRAERDGVVGEVRAEKGKGVEEGEILVLLEP"
     repeat_region   517991..518015
                     /rpt_type=tandem
                     /rpt_unit_seq="ca"
                     /satellite="microsatellite"
     repeat_region   520137..520194
                     /rpt_type=tandem
                     /rpt_unit_seq="caccat"
                     /satellite="microsatellite"
     gene            521279..523892
                     /locus_tag="CNC01920"
                     /db_xref="GeneID:3256131"
     mRNA            join(521279..521527,521593..521822,521881..521928,
                     521989..522040,522091..522813,522860..522926,
                     522983..523353,523404..523468,523527..523892)
                     /locus_tag="CNC01920"
                     /product="cytosine-purine permease, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545917|gb|CF691758.1,gi|41555625|gb|CF701466.1,
                     gi|41555631|gb|CF701472.1,gi|41561579|gb|CF707420.1,
                     gi|41561585|gb|CF707426.1,gi|41564787|gb|CF710628.1,
                     gi|41565566|gb|CF711407.1,gi|41567630|gb|CF713471.1,
                     gi|41567635|gb|CF713476.1,gi|41569277|gb|CF715118.1,
                     gi|41569283|gb|CF715124.1"
                     /transcript_id="XM_569440.1"
                     /db_xref="GI:58264567"
                     /db_xref="GeneID:3256131"
     CDS             join(521637..521822,521881..521928,521989..522040,
                     522091..522813,522860..522926,522983..523353,
                     523404..523468,523527..523589)
                     /locus_tag="CNC01920"
                     /codon_start=1
                     /product="cytosine-purine permease"
                     /protein_id="XP_569440.1"
                     /db_xref="GI:58264568"
                     /db_xref="GeneID:3256131"
                     /translation="MSDIEKGLQPLDAPKVSDSYEGLPTVDAGVYSGKHNAGEPTSRW
                     AKFDELNRKLEHKMGIESRGIERVSESDRTDTRLHGNLFIWASANTVLPTLGVGILGP
                     LLFGLGLGDSMLSVFFFNAATACIPAFMSTFGPKLGLRQMTSARYSWGFWGAKLVALL
                     NCIACVGWSIVNTISGAQTLVAVSEYKISAAVGVVIIALVTLFIGLFGYRFVHQYERY
                     SWLPTFITFLVMLGVSAKHLANVPWGVGQAEAAGVLSFGGTIWGFAIGWSSLSSDFNV
                     YMPAEAKSWKVFAWTYTGLIFPLVLVEWLGAAIGCAALVVTDWSDAYHEHELGGLVGA
                     VFIPSMHNGGKFFMTLLVLSVVANNTVNVYSMGLSVSVISNWLAAIPRLVWPCVITAI
                     YIPVAIVGASSFATSLENFLNVLGYWLSIYATVVIEEHFIFRKGRYENYEAASTWNRS
                     DRLPVGFAAIAAGCCGAAGAVLGMAQAWFTGPIGKKVGGTADPSGGDIGWLLAFAFTG
                     VTYPAFRVLEKKWLRR"
     misc_feature    525165..525193
                     /note="AT_rich"
     gene            complement(526145..528473)
                     /locus_tag="CNC01930"
                     /db_xref="GeneID:3256649"
     mRNA            complement(join(526145..526361,526419..526744,
                     526802..526997,527047..527133,527198..527812,
                     527866..528473))
                     /locus_tag="CNC01930"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533334|gb|CF679175.1,gi|41533352|gb|CF679193.1,
                     gi|41542214|gb|CF688055.1,gi|41542219|gb|CF688060.1,
                     gi|41543381|gb|CF689222.1,gi|41543392|gb|CF689233.1,
                     gi|41545671|gb|CF691512.1,gi|41545674|gb|CF691515.1,
                     gi|41555459|gb|CF701300.1,gi|41555463|gb|CF701304.1,
                     gi|41556831|gb|CF702672.1,gi|41556838|gb|CF702679.1,
                     gi|41558805|gb|CF704646.1,gi|41559325|gb|CF705166.1,
                     gi|41559331|gb|CF705172.1,gi|41561124|gb|CF706965.1,
                     gi|41561128|gb|CF706969.1,gi|41562117|gb|CF707958.1,
                     gi|41562127|gb|CF707968.1,gi|41562346|gb|CF708187.1,
                     gi|41562349|gb|CF708190.1,gi|41562538|gb|CF708379.1,
                     gi|41562551|gb|CF708392.1,gi|41564708|gb|CF710549.1,
                     gi|41564716|gb|CF710557.1,gi|41566268|gb|CF712109.1,
                     gi|41566279|gb|CF712120.1,gi|41567795|gb|CF713636.1,
                     gi|41567806|gb|CF713647.1,gi|41567839|gb|CF713680.1,
                     gi|41572633|gb|CF718474.1,gi|41574668|gb|CF720509.1"
                     /transcript_id="XM_569442.1"
                     /db_xref="GI:58264571"
                     /db_xref="GeneID:3256649"
     CDS             complement(join(526273..526361,526419..526744,
                     526802..526997,527047..527133,527198..527812,
                     527866..528430))
                     /locus_tag="CNC01930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569442.1"
                     /db_xref="GI:58264572"
                     /db_xref="GeneID:3256649"
                     /translation="MPPLPTAPPASIPTPSASVSATPPPSSFLTRTQKFLEENQRLIL
                     LGCAVLAATGAGYYLYSRPDKSSPSTSTTSASKKNKKKKKKGGEKKDDKYLKNEGDRG
                     PLLEEIQPQAVKEDDSEEAIHLQGVPDQKELEGMSESARNELGATLKDRGNKLYSKKS
                     FQKAIECYTKAIEVSVKKVAVFYSNRAACYGNLTPPDYEKCVADCNEAIKLDRTYTKA
                     LKRRATAFENLNRNEEAVRDFTAVTIIERFQDDQASAAVERCLKKLASSRAAEILSKR
                     EANLPSPTFISAYLAAFRPHPKPALPENPSQGDLTLSLAFDALEAADYPHALTYAAES
                     IEQGISSKKGEAEAYNLRGTFKFLMGNAEGARDDLQKSLDIDSGFVQSWVKIASVHME
                     LGDPATAFGDFEAAIRHDADNPDIYYHRGQVYFITQEFDKALADYTKSVQLDSSFIFP
                     HIQTAVCQYKMGNVGSSMASFRRILREFPDRGEASNYYGEILLDQQKFSESLDRFDKS
                     IELDKERKPRNVLPFVNKALALFQWKQDIAGAEALCKEALEIDPDCDVAVATLAQLSL
                     QQGKIDEAIKWFEKSAQLARTEGELINAITYEHASKAQVHFLKTYPEFAERLSQIAQA
                     A"
     repeat_region   528177..528202
                     /rpt_type=tandem
                     /rpt_unit_seq="ttc"
                     /satellite="microsatellite"
     gene            533401..536011
                     /locus_tag="CNC01940"
                     /db_xref="GeneID:3256266"
     mRNA            join(533401..533807,533929..533981,534034..534450,
                     534519..534714,534765..534906,534958..535454,
                     535503..535560,535609..536011)
                     /locus_tag="CNC01940"
                     /product="monosaccharide transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41541516|gb|CF687357.1"
                     /transcript_id="XM_569444.1"
                     /db_xref="GI:58264575"
                     /db_xref="GeneID:3256266"
     CDS             join(533675..533807,533929..533981,534034..534450,
                     534519..534714,534765..534906,534958..535454,
                     535503..535560,535609..535912)
                     /locus_tag="CNC01940"
                     /codon_start=1
                     /product="monosaccharide transporter"
                     /protein_id="XP_569444.1"
                     /db_xref="GI:58264576"
                     /db_xref="GeneID:3256266"
                     /translation="MSSSEKGPVVGPGKIVTYGRLHGNALLYAIVGTATTGFSLFGYV
                     RLMSGIIASDQFNTEFPATFQHDVNDVHAGTVQGSVTSCYEVGCFLGALFAYFFGERM
                     GRRRVMLMGAVIMIIGTIISVCAFGPGDPRGNVGGFVQFIVGRVITGVGNGANTATIP
                     SWVAESSKAHNRGFLICMEASTVAVGTVIAYWIDFGLSFVNSSVSWRFPIALQILFAL
                     VLIGGVMVLPESPRWLIAHGYDHEGLRVIAALDSKAEDDPVAIADKNKVSDAIAAQQN
                     AKASRKRDILKGGKNQHLRRAMVGASTQLFQQIGGCNAVIYYSTVLFENQIGLDSTLA
                     LILGGVLSIVYAIFALTSFFLVERVGRRKLFLIGTFGQAAAMFITFGCLLPGDAQSAK
                     GGAFGLYLFIAFFGATWLPLPWLYPAELNSMAVRTQANAISTMVNWLFNFTVVQVLPT
                     MTASIGAYTFLFFACINCVFLPFIYLFYPETTGRTLEELDVIFAHAHLTERRPTLVAA
                     ELPKLTDFQVQEMTDRYDIHGGAADTENPSAYGAPINAGAPDTSLPPKHPQDDPNYYP
                     DGSRRPSGGTAESGEQTRVTTPSGEKAGATPPS"
     gene            complement(539342..540486)
                     /locus_tag="CNC01950"
                     /db_xref="GeneID:3256196"
     mRNA            complement(join(539342..539477,539543..539795,
                     539849..539923,540020..540265,540336..540486))
                     /locus_tag="CNC01950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569446.1"
                     /db_xref="GI:58264579"
                     /db_xref="GeneID:3256196"
     CDS             complement(join(539416..539477,539543..539795,
                     539849..539923,540020..540265,540336..540401))
                     /locus_tag="CNC01950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569446.1"
                     /db_xref="GI:58264580"
                     /db_xref="GeneID:3256196"
                     /translation="MSQPSKAVLFVFTSAEKLLNGAPTGWYLPEAAHPYYVLSPHYRI
                     EAISTKGGPVPVDETSVKNFQDEDSQKFLKDPEAQNLVKNTKKVEDVKAADYEAMFVI
                     GGHGPLIDLAKSEKFAKLVEDFYVAKKPVSAVCHGPGAFILATNPATRRSIFAGARVT
                     GFSNSEEAQTPYNDFVNILPFSLEDKIKELGGQYEKADQDWGVKVIWDQGVLTGQNPA
                     SAGPLAVKLKEILEA"
     gene            542536..544656
                     /locus_tag="CNC01960"
                     /db_xref="GeneID:3256506"
     mRNA            join(542536..542705,542763..542904,542971..543145,
                     543203..543323,543383..543471,543517..543711,
                     543765..544008,544084..544656)
                     /locus_tag="CNC01960"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543124|gb|CF688965.1,gi|41552187|gb|CF698028.1,
                     gi|41552196|gb|CF698037.1,gi|41555287|gb|CF701128.1,
                     gi|41555304|gb|CF701145.1,gi|41557916|gb|CF703757.1,
                     gi|41558874|gb|CF704715.1,gi|41558883|gb|CF704724.1,
                     gi|41566802|gb|CF712643.1"
                     /transcript_id="XM_569448.1"
                     /db_xref="GI:58264583"
                     /db_xref="GeneID:3256506"
     CDS             join(542643..542705,542763..542904,542971..543145,
                     543203..543323,543383..543471,543517..543711,
                     543765..544008,544084..544635)
                     /locus_tag="CNC01960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569448.1"
                     /db_xref="GI:58264584"
                     /db_xref="GeneID:3256506"
                     /translation="MKLDATDLRYISADEFRVLTAVEMGSKNHEVVPSQLAAELSQIR
                     GGNVKKALGDLAKRNLVARVQNVKYDGFRLTYGGLDYLALRTFSRRKPPSVHSVGTRI
                     GVGKESDIYVVADEHGEKRVLKMHRLGRISFRAIKSKRDYLGKRKSASWMYMSRLSAQ
                     KEFAFMKALYQHGFPVPVPIDQARHCVVMSLVDGYPLRSVEAVEDPADLYSKLMELIV
                     RLAHAGLIHGDFNEFNIMLLRKTGEPIVIDFPQMVSTRHENAEYFFNRDVNCIRRFFR
                     RRFRYEATSWPTWKNVLEIEAGNAENAVQEEVSDGLTDLAMVQNRVRIDLEVEASGFG
                     RALQRELEDYMIEVQDIPASESEEEEEEEEDEDKKEEEEAEALSSHVQGNDEEELSDE
                     AAVAAHLEALRLHRALGNDVSDEDAGPYSEHSLTDFASDDDSDDSDDSTGVAQTDFTT
                     YTPSMRNQPRHHTRLPVKEFEKKGGARSAIAKQVERERHQTERKANAGKTSVKLGKQK
                     GHKWKSSDKYVVGKDSGW"
     misc_feature    544123..544172
                     /locus_tag="CNC01960"
                     /note="GA-rich"
     misc_feature    545241..545264
                     /note="AT_rich"
     gene            545380..548579
                     /locus_tag="CNC01970"
                     /db_xref="GeneID:3256599"
     mRNA            join(545380..545531,545591..546484,546545..546746,
                     546803..547054,547105..547323,547372..547504,
                     547558..547619,547668..547819,547870..547973,
                     548028..548094,548153..548579)
                     /locus_tag="CNC01970"
                     /product="ATP-dependent peptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535847|gb|CF681688.1,gi|41535854|gb|CF681695.1,
                     gi|41544090|gb|CF689931.1,gi|41544104|gb|CF689945.1,
                     gi|41547721|gb|CF693562.1,gi|41547737|gb|CF693578.1,
                     gi|41558313|gb|CF704154.1,gi|41567493|gb|CF713334.1,
                     gi|41567504|gb|CF713345.1,gi|41573604|gb|CF719445.1,
                     gi|41573607|gb|CF719448.1,gi|41573778|gb|CF719619.1,
                     gi|41573786|gb|CF719627.1"
                     /transcript_id="XM_569450.1"
                     /db_xref="GI:58264587"
                     /db_xref="GeneID:3256599"
     CDS             join(545424..545531,545591..546484,546545..546746,
                     546803..547054,547105..547323,547372..547504,
                     547558..547619,547668..547819,547870..547973,
                     548028..548094,548153..548308)
                     /locus_tag="CNC01970"
                     /codon_start=1
                     /product="ATP-dependent peptidase"
                     /protein_id="XP_569450.1"
                     /db_xref="GI:58264588"
                     /db_xref="GeneID:3256599"
                     /translation="MLSRSVQVAGLDLFVSSRAASLRCQKYCARSPSNLKEMRIPRKT
                     SQMVSRPCISFRGLHSSTSWNGIFSSRSTTAKPSETQTDVDQPLTPFQARVAELEIKA
                     HANKEDPDAQLEFLRQLSEGGEFAGLVAYYEGMALAEDTSGSQALLRNDEAWAIFMDA
                     LARSGRLGDIVTKVRRRDQLLASIGANGGSSSSAPLVSNPTPSSVSANNSSTSTPSVS
                     SPGPSLTSSLLSRAVSPTSLANASNASTSQSHPGAGSPLNPIYVQMAPPTPQMNAWRA
                     LRWVAGFLLWGFIILTVMSMVIENTGLLKAGPGPVEFEPEEGKIVKFSDVHGVEEAKA
                     ELEEIVEFLKNPEKFSALGGKLPKGVLLTGPPGTGKTMLARAVAGEAEVPFLFASGSS
                     FDEMFVGVGAKRVRELFAAARKKAPAIIFIDELDAIGSKRSAKDQHYMKQTLNQLLVE
                     LDGFEQAEGVIIIAATNFPESLDKALTRPGRFDRHVVVGLPDVRGRIEILKHHMSEVQ
                     YDVDVDPSVIARGCPGMSGADLQNLVNQAAVKASRDGSNSVQLKHFEWAKDRILMGAE
                     RKSHYVTEESKRATAYHEGGHALVALHTPGAMPLHKVTIMPRGQALGITFQLPEQDKD
                     SYTRREFNAMIDVALGGRAAEEMIFGHDNVTSGCSSDLQRATDVATRMIRNYGFSDKV
                     GLVAHGDEESVYLSSKKKDEIESEIRSFLDQSMTRTENLLKTHENELHRLADALIEYE
                     TLSLDEVKQVLEGKRLSRPTTEGESLKGQGEKSGKGPIVDGI"
     gene            complement(<548753..>549556)
                     /locus_tag="CNC01980"
                     /db_xref="GeneID:3256712"
     mRNA            complement(join(<548753..548767,548995..549082,
                     549156..549234,549523..>549556))
                     /locus_tag="CNC01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_569452.1"
                     /db_xref="GI:58264591"
                     /db_xref="GeneID:3256712"
     CDS             complement(join(548753..548767,548995..549082,
                     549156..549234,549523..549556))
                     /locus_tag="CNC01980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569452.1"
                     /db_xref="GI:58264592"
                     /db_xref="GeneID:3256712"
                     /translation="MSNSPVDPPAPEEPNTLAKVLWKWGFLCPLLWFIGMTIMWIPLK
                     STEEEHGPEKAQKLEEMIVILRKGLGV"
     gene            550365..553373
                     /locus_tag="CNC01990"
                     /db_xref="GeneID:3256378"
     mRNA            join(550365..550660,550774..550879,550940..550961,
                     551076..551095,551143..551190,551242..551315,
                     551389..551425,551483..551567,551627..551704,
                     551772..551965,552025..552089,552148..552223,
                     552275..552389,552440..552516,552568..552636,
                     552709..552744,552803..552883,552940..553119,
                     553179..553373)
                     /locus_tag="CNC01990"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531269|gb|CF677110.1,gi|41531276|gb|CF677117.1,
                     gi|41535704|gb|CF681545.1,gi|41535713|gb|CF681554.1,
                     gi|41564628|gb|CF710469.1"
                     /transcript_id="XM_569455.1"
                     /db_xref="GI:58264597"
                     /db_xref="GeneID:3256378"
     mRNA            join(550365..550656,550713..550716,550774..550879,
                     550940..550961,551076..551095,551143..551190,
                     551242..551315,551389..551425,551483..551567,
                     551627..551704,551772..551965,552025..552089,
                     552148..552223,552275..552389,552440..552516,
                     552568..552636,552709..552744,552803..552883,
                     552940..553119,553179..553373)
                     /locus_tag="CNC01990"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531269|gb|CF677110.1,gi|41531276|gb|CF677117.1,
                     gi|41535704|gb|CF681545.1,gi|41564628|gb|CF710469.1,
                     gi|41564630|gb|CF710471.1"
                     /transcript_id="XM_569454.1"
                     /db_xref="GI:58264595"
                     /db_xref="GeneID:3256378"
     CDS             join(550407..550660,550774..550879,550940..550961,
                     551076..551095,551143..551190,551242..551315,
                     551389..551425,551483..551567,551627..551704,
                     551772..551965,552025..552089,552148..552223,
                     552275..552389,552440..552516,552568..552636,
                     552709..552744,552803..552883,552940..553107)
                     /locus_tag="CNC01990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569455.1"
                     /db_xref="GI:58264598"
                     /db_xref="GeneID:3256378"
                     /translation="MEKSSSGYGAAPVALSYEQQLKETGQSEFHESVGEAQAPSSMAL
                     KVAGLHDDGLAPGTEARKRIEKRLKLKLDLRFSILIVIYSANYIDRNNAAAARLKGFE
                     EDLNLTGQRFPTILSILYVGYILFQVPSNMLLNHIGRPSIYLPIAMLIWGMISVLTGV
                     CHNYVGVLLTRLFLGVVEAAFLPGALFILSKWYRKDEISLRYTLLYCGNLISNAFGSL
                     IAAGVLANMDGKLGHAAWRWLFYIEGALTMFFALIAMIMLPDFPHNSKRGFTEEELKV
                     AQLRMLEDVGEIDQDSKDEKWHTGFIMAITDWKIYILMGSLTTCVTGLSFNIYFPTLT
                     KTLGYGTTETLLLAAPPWIFSCLLALANSTHSDRTNEKFWHSTWPLLMGIVGFIISIA
                     VPPEKKAGRYVALFLQAGSYAGYIIMYTWMSSSFPRPPAKRAVALAFMNAMSQVGNIV
                     GSYIWPTKFGPSYAKSYGIVLSMFGATILLNMWFRIILMRANKRLEEGERAFDEHGDT
                     LERAAALESTTVQDAMRMQRGFRYLV"
     CDS             join(550407..550656,550713..550716,550774..550879,
                     550940..550961,551076..551095,551143..551190,
                     551242..551315,551389..551425,551483..551567,
                     551627..551704,551772..551965,552025..552089,
                     552148..552223,552275..552389,552440..552516,
                     552568..552636,552709..552744,552803..552883,
                     552940..553107)
                     /locus_tag="CNC01990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569454.1"
                     /db_xref="GI:58264596"
                     /db_xref="GeneID:3256378"
                     /translation="MEKSSSGYGAAPVALSYEQQLKETGQSEFHESVGEAQAPSSMAL
                     KVAGLHDDGLAPGTEARKRIEKRLKLKLDLRFSILIVIYILNYIDRNNAAAARLKGFE
                     EDLNLTGQRFPTILSILYVGYILFQVPSNMLLNHIGRPSIYLPIAMLIWGMISVLTGV
                     CHNYVGVLLTRLFLGVVEAAFLPGALFILSKWYRKDEISLRYTLLYCGNLISNAFGSL
                     IAAGVLANMDGKLGHAAWRWLFYIEGALTMFFALIAMIMLPDFPHNSKRGFTEEELKV
                     AQLRMLEDVGEIDQDSKDEKWHTGFIMAITDWKIYILMGSLTTCVTGLSFNIYFPTLT
                     KTLGYGTTETLLLAAPPWIFSCLLALANSTHSDRTNEKFWHSTWPLLMGIVGFIISIA
                     VPPEKKAGRYVALFLQAGSYAGYIIMYTWMSSSFPRPPAKRAVALAFMNAMSQVGNIV
                     GSYIWPTKFGPSYAKSYGIVLSMFGATILLNMWFRIILMRANKRLEEGERAFDEHGDT
                     LERAAALESTTVQDAMRMQRGFRYLV"
     gene            complement(557164..559141)
                     /locus_tag="CNC02000"
                     /db_xref="GeneID:3256541"
     mRNA            complement(join(557164..557481,557536..557687,
                     557735..557802,557858..558022,558072..558189,
                     558233..558291,558342..558511,558578..558658,
                     558706..558781,558830..558917,558965..559141))
                     /locus_tag="CNC02000"
                     /product="NEDD8 activating enzyme, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531587|gb|CF677428.1,gi|41531592|gb|CF677433.1,
                     gi|41553546|gb|CF699387.1,gi|41553555|gb|CF699396.1,
                     gi|41562157|gb|CF707998.1,gi|41570832|gb|CF716673.1,
                     gi|41570838|gb|CF716679.1,gi|41571975|gb|CF717816.1,
                     gi|41571982|gb|CF717823.1,gi|41572473|gb|CF718314.1,
                     gi|41572480|gb|CF718321.1,gi|41574721|gb|CF720562.1,
                     gi|41574727|gb|CF720568.1"
                     /transcript_id="XM_569457.1"
                     /db_xref="GI:58264601"
                     /db_xref="GeneID:3256541"
     CDS             complement(join(557289..557481,557536..557687,
                     557735..557802,557858..558022,558072..558189,
                     558233..558291,558342..558511,558578..558658,
                     558706..558781,558830..558917,558965..559081))
                     /locus_tag="CNC02000"
                     /codon_start=1
                     /product="NEDD8 activating enzyme"
                     /protein_id="XP_569457.1"
                     /db_xref="GI:58264602"
                     /db_xref="GeneID:3256541"
                     /translation="MTAAHIQSYHSDPTRYAAVDNLLHRKGPWTDERFQGGTETANFL
                     RTKAKILVIGAGGLGCEILQNLALSGFNDIHVIDMDTIDISNLNRQFLFREADVGKSK
                     ALVAAEFVMKRVPGCTVTPYHGRIQDHPTSFYSTFDVIVAGLDSISARRWINATLVQM
                     AQEDEENIKPLVDGGTEGFKGQARVILPTITSCYECSIDMLTPPTAFPICTIANTPRL
                     PEHCIEWASVLEWPKVFRDKKLDTDDPEHIEWLYKQAAARAGQFNIEGVTWALTQGVV
                     KNIIPAIASTNAIIAASCCNEAFKIATASAPYLNNYMMYVGNESVYTYTFEHEQRPDC
                     PVCGGESLVAEVKRDWTLQQLIESLSQRQDLQVSRPSLSFSSGKALFWPSPPDVYEAT
                     KANLELLLSDLVQDNDAIVLVDPALPVSASVTVKFV"
     gene            <559349..>560455
                     /locus_tag="CNC02010"
                     /db_xref="GeneID:3256461"
     mRNA            join(<559349..559512,559573..559692,559745..559847,
                     559897..560034,560087..560166,560215..>560455)
                     /locus_tag="CNC02010"
                     /product="exosome complex exonuclease rrp45, putative"
                     /transcript_id="XM_569460.1"
                     /db_xref="GI:58264607"
                     /db_xref="GeneID:3256461"
     CDS             join(559349..559512,559573..559692,559745..559847,
                     559897..560034,560087..560166,560215..560455)
                     /locus_tag="CNC02010"
                     /EC_number="3.1.13.-"
                     /codon_start=1
                     /product="exosome complex exonuclease rrp45"
                     /protein_id="XP_569460.1"
                     /db_xref="GI:58264608"
                     /db_xref="GeneID:3256461"
                     /translation="MVREIDPPSVQNEFLLAALAEGKRLDGRLPLQMRDVHYIFGDEL
                     GCVECRLGKTAILAQVSATIVKPRDDRPYEGFLLINSEIGPMASSVYENGRPGDDEVM
                     IGRLLEKSIRRTEAIDREALCILAGEKVWQLRLTLHFLSDSGNLLDCAALAGMAALKH
                     FRKPDVEVIGDEVIIHSPEERAPVPLAIHHTPLCLTFAYFENLPPILDPSHVEMMLCS
                     GTLTLTLNAQREICVLSKAGGAPLGAEEIMGVVKVGVDKVRELVRHLEEELEKDRTSR
                     VVEVR"
     gene            <562179..566495
                     /locus_tag="CNC02020"
                     /db_xref="GeneID:3256625"
     mRNA            join(<562179..563501,563552..565455,565505..565781,
                     565830..566495)
                     /locus_tag="CNC02020"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536526|gb|CF682367.1,gi|41536527|gb|CF682368.1"
                     /transcript_id="XM_569462.1"
                     /db_xref="GI:58264611"
                     /db_xref="GeneID:3256625"
     CDS             join(562179..563501,563552..565455,565505..565781,
                     565830..566333)
                     /locus_tag="CNC02020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569462.1"
                     /db_xref="GI:58264612"
                     /db_xref="GeneID:3256625"
                     /translation="MRGERPRRPSDVFSEGSRSATSSVFPFKTSPTNSTFTGRSANTL
                     TNTDSASPSRLPSSPRSHNLRAVVNEDIPPVPESTLTPTRLQPVKANSILSNASAAST
                     PTPSLVLHNPAYVPGQPRPIRPTHHGEGSLSSRAATPNGQPHFDILLNSRSVTPDSQS
                     PPNTLRSSAAYSDATQSTNTSPSPLLHYPISLAKATSLSRSYSVNQASLPIGGDSDQS
                     SVTRRRAGTITLGETESGRGLNFSSEAHPFLQREIVEEEEYEHEEEQKTRSREHLKEE
                     ENDAGSTLELKEAINRHSLGASWYDPKTSIDEEESFQNGHKSQARDVVETAIFSLDAL
                     RTDDETAEGAGFFSPIPLQRLSCDSLDSVFDPKQDVPQWIDIFDGNDFVRVDSETDDI
                     SDWPEKPELLLEKITGLGVEELMLLQEELVTKARREREAMGLGFSPLISDTPTIPKQY
                     CSLKQQSPRLNVEGPPAVDARTTNPMTMNGIIPVTSAMESSSSMASQIADTIPCAPQR
                     PVLDMPPQPLPAPPTQEVPNAESFSSATRMRGNVIDNTTESLETEKEKDFRTRIAAAT
                     AALNRNPSIQGARLERKNTKRGAAMVISSPKLLSSTAKVPTHPLTPPDHPSAVDSILE
                     KSLEKMSGSGSKMSQKWKKLMKKGPSVSSSEAFKPVHPMSAANSGSTDPNSIPQPAPV
                     ARLQRSNSQSVSRTLGAPIQLRQEANTAISLSSAPPDLKSFQFPRRIDQREGSNADQK
                     TCPAMTISQVPTRVITPPNTTVHGDAPLDQLSERTQSPTQDTAILNFLQAGRQLGLKE
                     DQLKAILVQKEMLNDSDTIASKDSALPNSEPVLKISPSSSARQRSPTPIWQAEKAIAK
                     QKKEGLFRSLSKKARELPIRMRTPEPPQKEVVTPVSVSRPLHDKVVLRRTMIFPDGLT
                     PSAFQMSSDVTPGSPSSSNVGRQPSQRKLSIRRKPLNLSKEDRELVSNSPPAHQTGFG
                     SNASPSQKHENIAHEDQNFGFVYRNPAHRADDSTKRRSLASMTLSRRSLSGMSERSST
                     AGSLIDMYGDDRNGGEEMLLKSPPLDRDSRIIETIQNGPAQAVEICEYADGQVVWSVV
                     DALRTSVAASVDENDGPFGHRLSQSSSNYSANKVSVFGEKHDYFTETESMSRPSGANI
                     APLNVRHIANRKSIIKPRPPTDVYFTSSHDVADLIDHLSRDLEASRGRIDIISSHDSS
                     VDTDRPFHHTPFNIEQHRTPGSPSSNSQFEDAPSPAPPPRRIPFSQRIHPRSPRSYHP
                     ASEINIEEETSLKHHVGHQIGRSSNTNSFTNCETHDPSSRHFANSSHVQGKSLEYRLQ
                     ELMDRMRNAKPDGRR"
     gene            complement(567293..569131)
                     /locus_tag="CNC02030"
                     /db_xref="GeneID:3256803"
     mRNA            complement(join(567293..567715,567771..568070,
                     568122..568221,568302..568488,568558..569131))
                     /locus_tag="CNC02030"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41562862|gb|CF708703.1"
                     /transcript_id="XM_569464.1"
                     /db_xref="GI:58264615"
                     /db_xref="GeneID:3256803"
     CDS             complement(join(567356..567715,567771..568070,
                     568122..568221,568302..568488,568558..568909))
                     /locus_tag="CNC02030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569464.1"
                     /db_xref="GI:58264616"
                     /db_xref="GeneID:3256803"
                     /translation="MFPHRHPHTIHWIVVSLVLFLSSLTSSQSTATVTSSSGVSSVTQ
                     SSWTESSLKEDTQTTARIAAVNDTTFGTAGGTAPQSDTTATTTTHNLVTATTPIPLAA
                     TLGLIMPNPWQTLYTELNYTFGFVDAVPRPAPTYGGWMREVVPLIIMSNYTVDVLPSS
                     GSEDPTSVEAIPVGSTGLCGTTAENFPIGYPFRFTTPGWYMFVVNQTYMQANITENNQ
                     CSWPILQQKSFFATQIFSLAAYPTVSPGPASPTSAYTVWADVSTTTPGSLPIDAEPTT
                     EGQKLGLALGIAGGVLGLAIIASIIWWVRKKRNLEAECLAFSRLPSQEQEAFLREHAK
                     NLRPFLNTRQPQYPDRNGLYRYQAPPSAPPGTMAYALWYSRQLWNNQVMQRQNPSIWN
                     NKYGFEPRMGNAVALGPESNMLNPVHIPYAQQHAQVYGPH"
     gene            569300..571582
                     /locus_tag="CNC02040"
                     /db_xref="GeneID:3256292"
     mRNA            join(569300..569589,569640..569750,569810..569890,
                     569943..570838,570888..571030,571318..571582)
                     /locus_tag="CNC02040"
                     /product="DNAj protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535877|gb|CF681718.1,gi|41536673|gb|CF682514.1,
                     gi|41536684|gb|CF682525.1,gi|41547403|gb|CF693244.1,
                     gi|41549724|gb|CF695565.1,gi|41549731|gb|CF695572.1,
                     gi|41554767|gb|CF700608.1,gi|41556880|gb|CF702721.1,
                     gi|41563797|gb|CF709638.1,gi|41563802|gb|CF709643.1,
                     gi|41576410|gb|CF722251.1,gi|41576417|gb|CF722258.1"
                     /transcript_id="XM_569467.1"
                     /db_xref="GI:58264621"
                     /db_xref="GeneID:3256292"
     mRNA            join(<569386..569589,569640..569750,569810..569890,
                     569943..570838,570888..571535)
                     /locus_tag="CNC02040"
                     /product="DNAj protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535875|gb|CF681716.1,gi|41547396|gb|CF693237.1,
                     gi|41556875|gb|CF702716.1"
                     /transcript_id="XM_569466.1"
                     /db_xref="GI:58264619"
                     /db_xref="GeneID:3256292"
     mRNA            join(<569386..569589,569640..569750,569810..569890,
                     569943..570838,570888..571260,571318..571535)
                     /locus_tag="CNC02040"
                     /product="DNAj protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41554758|gb|CF700599.1"
                     /transcript_id="XM_569468.1"
                     /db_xref="GI:58264623"
                     /db_xref="GeneID:3256292"
     CDS             join(569386..569589,569640..569750,569810..569890,
                     569943..570838,570888..571030,571318..571394)
                     /locus_tag="CNC02040"
                     /codon_start=1
                     /product="DNAj protein"
                     /protein_id="XP_569467.1"
                     /db_xref="GI:58264622"
                     /db_xref="GeneID:3256292"
                     /translation="MPPRITSRALSTLSTAQSSAGSSSTLPPSTFSLRQHKRSPSSHS
                     FTFRHFGPLLAHPRNPSTASLGWRRSFHSSTVHPASAKDPYNVLGVNKDASSSDIKKA
                     YYSLAKKWHPDSSKEKDAKEKFHEIQAAYDILSDDKKRQAYDRYGSASTQEGFDPNFA
                     HGAGGFGGFQGFGPGFGDGASDLFESLFGGAFGGGSSAFGGRQRPVRGDDLEVGVNLS
                     FLEACNGVTRKVTVTPVIDCKTCTGSGLKPGEKKSQCPACRGSGQRTFQVQGMVMAST
                     CQTCGGTGSTIPKNARCGECDGVGKVKEKKVLDVEIPAGVEDGMMIRVPGAGDKPLSA
                     SGPAGDLLVRVLVKPSSVFRRQGVNLYHDAKVPLHIALLGGVIRIPTLEGDVDVKVKN
                     GTQNGEEAVLKGRGVKSVYGGRRNDRGDLIVGWKVQIPRSLTPFQRKILQAYADDIEG
                     RNPQVHFGPLPSDPPVTNPSSPPKEPTNGETKKEIGEEGRQTKSEEDEVGGKI"
     CDS             join(569386..569589,569640..569750,569810..569890,
                     569943..570838,570888..571239)
                     /locus_tag="CNC02040"
                     /codon_start=1
                     /product="DNAj protein"
                     /protein_id="XP_569466.1"
                     /db_xref="GI:58264620"
                     /db_xref="GeneID:3256292"
                     /translation="MPPRITSRALSTLSTAQSSAGSSSTLPPSTFSLRQHKRSPSSHS
                     FTFRHFGPLLAHPRNPSTASLGWRRSFHSSTVHPASAKDPYNVLGVNKDASSSDIKKA
                     YYSLAKKWHPDSSKEKDAKEKFHEIQAAYDILSDDKKRQAYDRYGSASTQEGFDPNFA
                     HGAGGFGGFQGFGPGFGDGASDLFESLFGGAFGGGSSAFGGRQRPVRGDDLEVGVNLS
                     FLEACNGVTRKVTVTPVIDCKTCTGSGLKPGEKKSQCPACRGSGQRTFQVQGMVMAST
                     CQTCGGTGSTIPKNARCGECDGVGKVKEKKVLDVEIPAGVEDGMMIRVPGAGDKPLSA
                     SGPAGDLLVRVLVKPSSVFRRQGVNLYHDAKVPLHIALLGGVIRIPTLEGDVDVKVKN
                     GTQNGEEAVLKGRGVKSVYGGRRNDRGDLIVGWKVQIPRSLTPFQRKILQAYADDIEG
                     RNPQVHFGPLPSDPPVTNPSSPPKEPTNGEGSYPSYRSQNQPQAEHAPHRPSRPPAEP
                     YKPYNPLSSSEEPISLANKIASAIGGAIGWVERFMRGRR"
     gene            complement(573734..576428)
                     /locus_tag="CNC02050"
                     /db_xref="GeneID:3256698"
     mRNA            complement(join(573734..575316,575382..575441,
                     575506..575560,575617..575746,575800..575979,
                     576035..576428))
                     /locus_tag="CNC02050"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530772|gb|CF676613.1,gi|41530777|gb|CF676618.1"
                     /transcript_id="XM_569972.1"
                     /db_xref="GI:58265631"
                     /db_xref="GeneID:3256698"
     CDS             complement(join(573958..575316,575382..575441,
                     575506..575560,575617..575746,575800..575979,
                     576035..576335))
                     /locus_tag="CNC02050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569972.1"
                     /db_xref="GI:58265632"
                     /db_xref="GeneID:3256698"
                     /translation="MRHRFYLPTIVRDQTFLSFVRQRHHSHHHPYLTPSLPSLTPKHE
                     PDLSSDAPPGSSSAASEKDITSVLSLLREDYVAVKEHIKVMDYKQVLKRAAQRHMYKW
                     YAILIIAGTLTALITAKHDAVVDFCRPITEKIRSWPAGWLVPIAILVIVSFPPLVGHE
                     IIGILCGLVWGLWVGFAILAAGTFVGEIATWVAFKWCCQTRAAKFEKKNRLYAALTQL
                     IREKSFMFVLILRFSAVPGHITTAVSASAGANFWSYLLAAFLTLPKQWTIVYLGKAFG
                     TTNRTNTIISVLTTVLTILATAVAAVYIYYQMRLVMRRWTLALPAHVESSSTSNITLS
                     EWADEKGQDGLYTRRRWMASNGSDEYVNRCEGRTLTRSWSMPEHMSEEELKEWVKSLE
                     NEEYASSASAQLSAETGDDSASESAANIKINIQMELGSLLPTSWPPVTPRFPEPSNNV
                     MKSPGLGIPQSVSRDSNCSSPSPPLLELDNAYTPTLASRRPSYSRRIPSSSSISFDVP
                     CTIPGTTCPHRVGGREVADEADAYAIAHGARRPEFRRMRGDSRAALLGRPVDDAALHQ
                     CGSSWRREYSHSYGRSRGSSNATLSRSDIDELGRARGDSVSTAGTGYSYGPPTLADLG
                     VVRGEGGYVRMDQPQRGKGESSAAVLGGLIDEGLRTEISRDRNDMESYQREGSTILKG
                     NEGKNQLGDENV"
     gene            complement(576439..579436)
                     /locus_tag="CNC02060"
                     /db_xref="GeneID:3256683"
     mRNA            complement(join(576439..577318,577370..577521,
                     577577..577666,577717..577800,577858..577933,
                     577985..578093,578151..578243,578300..578441,
                     578490..578628,578684..578758,578825..578942,
                     579030..579436))
                     /locus_tag="CNC02060"
                     /product="histone deacetylase 1-1 (hd1), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532067|gb|CF677908.1,gi|41532075|gb|CF677916.1,
                     gi|41541657|gb|CF687498.1,gi|41541661|gb|CF687502.1,
                     gi|41571547|gb|CF717388.1,gi|41571556|gb|CF717397.1"
                     /transcript_id="XM_569971.1"
                     /db_xref="GI:58265629"
                     /db_xref="GeneID:3256683"
     CDS             complement(join(576723..577318,577370..577521,
                     577577..577666,577717..577800,577858..577933,
                     577985..578093,578151..578243,578300..578441,
                     578490..578628,578684..578758,578825..578942,
                     579030..579335))
                     /locus_tag="CNC02060"
                     /codon_start=1
                     /product="histone deacetylase 1-1 (hd1)"
                     /protein_id="XP_569971.1"
                     /db_xref="GI:58265630"
                     /db_xref="GeneID:3256683"
                     /translation="MSSAAIHPPLDFSPVRPDGRRVAYYYDHDVGNYHFGLGHPMKPH
                     RIRMTHNLVVNYGLADDYEAMEEEGRRKVNARMGMENDEARWVNAEMRGSRAKRMQIF
                     RPRRATKTDMTRFHTDEYIELLESVLPENADALTGNRSRGLTGSDCPAVEGIFEFSSI
                     SAGGSIGAAEKLNEGIADIAINWAGGLHHAKKTEASGFCYVNDIVLGILELLRVNSRV
                     LYIDIDVHHGDGVEEAFYSTDRVMTCSFHLFGNFFPGTGTLKDVGLGKGKGYAVNVPL
                     REGITDEGFHSIFKPVIAEIMEHYRPCVVVLQGGADSMSGDKLGRLNLSDKGHAECAK
                     FLRTFSVPLMLLGGGGYTTKNVARAWTRETAIACGQELSEDLPSNQYMEYYGPRYKLE
                     VLPSNVEDFNTPEYLEDLKRQISNHLKNLPFAPSAQMRQITGSNVSQAVGLSNEWETD
                     DPEDQIDQRLKKLFASKNLNGTYTQESDALLSDLTSISRIRRQGGPKKLPRSSGTCGR
                     ARKRYLEDIAMGEDPCCLLPAMTSKKNERKTIAKSGSSAPPTSAPEWHAHLTVHEMKS
                     RPSLGEILQQPSPGSEDECDRNRCITEGSQLHMIAQGRGKRSFFSRKGLPPSIISPQA
                     IIGGSTVKVDRLIRARMAAATNNSPVVVEWDRQQE"
     gene            complement(579848..583661)
                     /locus_tag="CNC02070"
                     /db_xref="GeneID:3256436"
     mRNA            complement(join(579848..579887,579939..580018,
                     580078..580462,580518..580691,580740..581043,
                     581089..581337,581389..581504,581561..581694,
                     581748..581894,581944..582146,582196..582264,
                     582310..582439,582494..582977,583031..583110,
                     583156..583323,583395..583661))
                     /locus_tag="CNC02070"
                     /product="importin-alpha export receptor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531894|gb|CF677735.1,gi|41548590|gb|CF694431.1,
                     gi|41548600|gb|CF694441.1,gi|41548841|gb|CF694682.1,
                     gi|41548844|gb|CF694685.1,gi|41572379|gb|CF718220.1,
                     gi|41572386|gb|CF718227.1"
                     /transcript_id="XM_569470.1"
                     /db_xref="GI:58264627"
                     /db_xref="GeneID:3256436"
     CDS             complement(join(579872..579887,579939..580018,
                     580078..580462,580518..580691,580740..581043,
                     581089..581337,581389..581504,581561..581694,
                     581748..581894,581944..582146,582196..582264,
                     582310..582439,582494..582977,583031..583110,
                     583156..583323,583395..583631))
                     /locus_tag="CNC02070"
                     /codon_start=1
                     /product="importin-alpha export receptor"
                     /protein_id="XP_569470.1"
                     /db_xref="GI:58264628"
                     /db_xref="GeneID:3256436"
                     /translation="MQATPETLSLLTNYLSSTVSPDAHTRRSAEESLRQAEGQQGFLL
                     LVLELVKADSVNMIVRQAGGVYFKNTVKRLWSGDEETQIDPADKAAIKSQLVPMMIAL
                     GTPQTSRLQSQIGEGLSHIASLDFPGEWEGLCDELVNSLTPDNFVINNGVLATAHSIF
                     KRWRSQFRTNELYSEINFVLSRFCEPYYRLFQHVDQLLQTPPASLPTNSSILLLGQSL
                     LLLIQLFHDLSSQDLPPFFEDHMTEFMGGDQPGWLRKYLDWEVKELKGDDDDEAPGPL
                     QKIRSSICEIAELYAQKYSDVFTQLGSFVDGVWNMLTRVGTSTREDVLVSRALRFLSV
                     VVKMGNHRAMFAASETLNAFCEKIILPNMAIREHEEEMFEDDPMEYIRRDLEPSTESD
                     TRRQAATDFTRALMELFEKEVTGIIKGYISVFLQEYNKNPVGNWKSKDTAIYLLTSIA
                     SRGSTQQLGVTSTNVLVDVVDFFGQNVFSDLQAAPGSVHPILTVDAIKFLYTFRNQLT
                     KDQLVSVLPLLVQHLASDNYVISSYAAITIERILFIKVERQALFTQADIRPFAENILM
                     ALFANIEKGGTPEKIAENDYLMKCVMRVIITARTSLTPSHEGILTRLVNIMGEISKNP
                     SNPKFNQYCFESVSALIRFVCEGTPAALPTFENALFGPAQHILTNDVAEFIPYIFQIL
                     AQLLELHSPSELPPAYQALTGPLLSAALWEQRGNIPALVRIWKALLLRGAPSIVAAGQ
                     VQGLLGIFQRLAGSKVNDVWAFELVQALYEFVPIEVMRPFSQTVFVLLLNRLQGKPST
                     QFNHCFVYFFAFLANLDSVGADFLVGVLEGIQTGLFGNLLTGVILSNSQKITARNRKL
                     VEVGLTKTLSRSDSLLVEPNRQFWPPIFLALLDMFTLPQDITYANPEGSGDITELDPE
                     EAGFQSSFSKLGASEKTVSDPTAGVEDSKVFAAKELAKRSNEKPGMLGPLIEAAQKEE
                     QVTVTNFVQFMATSGNTIS"
     gene            584566..586502
                     /locus_tag="CNC02080"
                     /db_xref="GeneID:3256756"
     mRNA            join(584566..585142,585217..585305,585363..585473,
                     585529..585690,585742..585901,585955..586077,
                     586132..586502)
                     /locus_tag="CNC02080"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530579|gb|CF676420.1,gi|41530588|gb|CF676429.1,
                     gi|41532878|gb|CF678719.1,gi|41536743|gb|CF682584.1,
                     gi|41536749|gb|CF682590.1,gi|41549391|gb|CF695232.1,
                     gi|41549400|gb|CF695241.1,gi|41551269|gb|CF697110.1,
                     gi|41551273|gb|CF697114.1,gi|41552608|gb|CF698449.1,
                     gi|41552622|gb|CF698463.1,gi|41556619|gb|CF702460.1,
                     gi|41556629|gb|CF702470.1,gi|41561116|gb|CF706957.1,
                     gi|41562500|gb|CF708341.1,gi|41563323|gb|CF709164.1,
                     gi|41564228|gb|CF710069.1,gi|41564238|gb|CF710079.1,
                     gi|41564590|gb|CF710431.1,gi|41564596|gb|CF710437.1,
                     gi|41567663|gb|CF713504.1"
                     /transcript_id="XM_569472.1"
                     /db_xref="GI:58264631"
                     /db_xref="GeneID:3256756"
     mRNA            join(584566..584797,584859..585142,585217..585305,
                     585363..585473,585529..585690,585742..585901,
                     585955..586077,586132..586502)
                     /locus_tag="CNC02080"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530579|gb|CF676420.1,gi|41536743|gb|CF682584.1,
                     gi|41549391|gb|CF695232.1,gi|41551269|gb|CF697110.1,
                     gi|41552608|gb|CF698449.1,gi|41556619|gb|CF702460.1,
                     gi|41561116|gb|CF706957.1,gi|41561120|gb|CF706961.1,
                     gi|41563323|gb|CF709164.1,gi|41564228|gb|CF710069.1,
                     gi|41564590|gb|CF710431.1"
                     /transcript_id="XM_569473.1"
                     /db_xref="GI:58264633"
                     /db_xref="GeneID:3256756"
     CDS             join(585021..585142,585217..585305,585363..585473,
                     585529..585690,585742..585901,585955..586077,
                     586132..586429)
                     /locus_tag="CNC02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569472.1"
                     /db_xref="GI:58264632"
                     /db_xref="GeneID:3256756"
                     /translation="MIRVNSPLQGLIAFSLLSTSVFARSDRICPEDPYASPSTDTCNP
                     MRYIPNKGINIAAAVLYFIVAAILTFHSFRQKANYFLALVIGAWCEGIGLVLRVAFRT
                     NPHSTGLYIVCYLFVVLSPCAFLAGDYILLGRLVQYLDAHHYLRPLRAQLVSWIFIVS
                     DVITFLIQAAGGGLSTATDVQTAQNGGHIFLAGIAAQMASFIFFTIAWLIFGIRAWRE
                     DKELWRRPGWKPLFFALGFTCICFLIRSFYRTVELSQGYVGYLAIHERYFLGLDCLPL
                     LLGIATYVFFWPGKYLRFAPKPKKSKESKESKKSKKSKKSKKSKNGVAEDVEEGLPMH
                     DLNGEGLGDMVKGDENYQMR"
     gene            complement(<586491..>587273)
                     /locus_tag="CNC02090"
                     /pseudo
                     /db_xref="GeneID:3256165"
     gene            588040..589625
                     /locus_tag="CNC02100"
                     /db_xref="GeneID:3256774"
     mRNA            join(588040..588394,588444..588532,588587..588735,
                     588797..588920,588970..589129,589190..589625)
                     /locus_tag="CNC02100"
                     /product="integral to membrane protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41554479|gb|CF700320.1,gi|41554487|gb|CF700328.1,
                     gi|41565803|gb|CF711644.1"
                     /transcript_id="XM_569475.1"
                     /db_xref="GI:58264637"
                     /db_xref="GeneID:3256774"
     CDS             join(588276..588394,588444..588532,588587..588735,
                     588797..588920,588970..589129,589190..589577)
                     /locus_tag="CNC02100"
                     /codon_start=1
                     /product="integral to membrane protein"
                     /protein_id="XP_569475.1"
                     /db_xref="GI:58264638"
                     /db_xref="GeneID:3256774"
                     /translation="MRRSTLFEVLILSSLVSSAYALGGDRDCPADPYADPANDTCNPL
                     RYIPNMALNCLGAALFLIVAAILTFYSFRRKANYFLCLVIGAWFEGIGFVLRVLMRDN
                     LHNLNLYIVANLFIVLAPCAFLAGDYILFGRLVQFLEAHHHIRPFKARQVSWIFISSD
                     ILTFLIQGSGGGLSASSSIDSAELGAHLFLAGIVIQMVSFIFFSCVWVLFGIRVFTGD
                     KQLWHREGWKPLYFALGFTCICFIVRSIYRTAELSGGYISYLSTHEGYFLGLDSLPLL
                     LGIATYIFFWPGNYLQFDGNPFKKSKTRRIEEGAQMYPLKAGDSYETQPGLDAKMTPT
                     YTNHYERR"
     gene            complement(<589936..591973)
                     /locus_tag="CNC02110"
                     /db_xref="GeneID:3256186"
     mRNA            complement(join(<589936..589978,590030..590879,
                     590916..591245,591329..591502,591571..591606,
                     591670..591973))
                     /locus_tag="CNC02110"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534799|gb|CF680640.1,gi|41534810|gb|CF680651.1"
                     /transcript_id="XM_569477.1"
                     /db_xref="GI:58264641"
                     /db_xref="GeneID:3256186"
     CDS             complement(join(589936..589978,590030..590879,
                     590916..591245,591329..591502,591571..591606,
                     591670..591748))
                     /locus_tag="CNC02110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569477.1"
                     /db_xref="GI:58264642"
                     /db_xref="GeneID:3256186"
                     /translation="MPPIVELLVPVGLFLLHSPACLPLAELPSSSSVDMPLEVTPAPF
                     AASQRLPYVPAVPRPADSGGGMFPSGASSLDGAGPAMAAASAIIPPAPGGVAGPHRAI
                     PALPDAGYTSVNPPWFSMRSQGPPSIYSSSYAGPCSLYDSELREPPHYQGHIYSHHPV
                     IRNENWASSSLPAPRRGPPSPDSVMIHHRHHHHHHRRHHDHDDDLDHKQRSRAGSVSS
                     VPDTEGLNESQAYRRRSRSISQGQTYKRHRSPSLPPGNVHHLHTSISPSPLAVNDGEL
                     PGNVGHSVLPPLDAARRPQRMSLPPEEEHRPRPQLFVPPGYEAPELRKGKKQDIRGGF
                     EATDERRGRHSSAASEDSVRSHLHRNNSTFIPGGFQTHSRHRSGSYLLPESGYDRSAS
                     PPLVMHGPASAVSGPHYPPDIEGNYRRRTASMQGLERPEQTSSEYQIPSMAGGQVVYD
                     DSASVASDSRMTLEDGAVSGRTSQYGLPRYPHQPKMDYRRFCVQRGNADVFLD"
     repeat_region   590922..590976
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     gene            complement(592254..595828)
                     /locus_tag="CNC02120"
                     /db_xref="GeneID:3256527"
     mRNA            complement(join(592254..592705,592754..592833,
                     592892..593162,593212..593327,593376..593753,
                     593803..593876,593925..594593,594643..594789,
                     594841..595226,595343..595434,595565..595698,
                     595755..595828))
                     /locus_tag="CNC02120"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535135|gb|CF680976.1,gi|41535138|gb|CF680979.1,
                     gi|41557843|gb|CF703684.1,gi|41557848|gb|CF703689.1,
                     gi|41573159|gb|CF719000.1"
                     /transcript_id="XM_569479.1"
                     /db_xref="GI:58264645"
                     /db_xref="GeneID:3256527"
     CDS             complement(join(592404..592705,592754..592833,
                     592892..593162,593212..593327,593376..593753,
                     593803..593876,593925..594593,594643..594789,
                     594841..595226,595343..595434,595565..595698,
                     595755..595793))
                     /locus_tag="CNC02120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569479.1"
                     /db_xref="GI:58264646"
                     /db_xref="GeneID:3256527"
                     /translation="MSDGRSTGRQDNLHYPVQAGHTVSLVPRSQTQERETHPELQGIT
                     RNYLGSDPNSGHIRDQSLDMPEGEGYGMTDIPHNSSKSHLTPADGNAPYTGASTPNRV
                     HYPPSPLMPRGQPQGDAYTTIPLQDGHSNASVSGATTPHSESMNKRKWSFLPGNRSSA
                     SLEKSGVDEKGTKRRPKNQRGTSWDLLGDRGEWEEFSPKNASVENLRFAEGDVGTNKF
                     SRLYYWALNKGIIVRWAMYIIPVLILFWIPGIIFYAGLRDAKVWSVTLNWWSIWLTII
                     WLTFWGATAAFMMLPHVWRNTVAVIVPSAKPLTDIIAALGRYAKLTIWCLAIWVSFTP
                     LIVNHYTGDESATSRSDLSTVANLLFGLFLCSIVYCVEKLIIQLIALQFHRDSYEDRL
                     QEQKFCLKALTYLYTNSHDIPGRTDTLTDAMSTKTKGSQMPKVALRKALKGLKEAAQT
                     TTTALGNVASEMAGQSVLQTNSPSNRVTMALNSANKSKALARRLFYSFRAPGAAHLDI
                     QDIVQYFPNLETAQAAFAIFDKDGNGDATRDEIESAVLGIHRERLALEASMRDLDGAV
                     RRLDDIFMVVVIAIVVLIMASMITNKLTTFVTSAGTFILGLSWLIGTTMQEVLGACIF
                     LFVKHPYDVGDRVDIDGVQYTVAKMQLLSSSFKGVDGKYVWIGHNVLTTKVIENIRRS
                     GAISEEFSFEVAFDTSFEALQALRSRMIVFLKENSRDFLPVFDVTVDDMPAQGKLVLK
                     ADIRYKSNWQQVSLKIQRRNKWICALKMALADLKIFGPDGAGNPNPEEAGPTQYTLVP
                     WEECRPNTTEGSTAPPPPFTSAAPSPPPLMDARAAVDDPYGDIWNEGDELLGFRSADP
                     SRPGTPGPGPATRQRQPQVPQHQDTLGMSEVAVDAKRQP"
     STS             597098..598491
                     /standard_name="ha2600"
                     /db_xref="UniSTS:515570"
     gene            complement(598937..>603492)
                     /locus_tag="CNC02130"
                     /db_xref="GeneID:3256765"
     mRNA            complement(join(598937..599126,599188..599303,
                     599353..599534,599592..600055,600109..602238,
                     602287..>603492))
                     /locus_tag="CNC02130"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546324|gb|CF692165.1,gi|41546339|gb|CF692180.1,
                     gi|41551830|gb|CF697671.1,gi|41551832|gb|CF697673.1,
                     gi|41562096|gb|CF707937.1,gi|41562106|gb|CF707947.1,
                     gi|41574356|gb|CF720197.1,gi|41574363|gb|CF720204.1"
                     /transcript_id="XM_569481.1"
                     /db_xref="GI:58264649"
                     /db_xref="GeneID:3256765"
     CDS             complement(join(599076..599126,599188..599303,
                     599353..599534,599592..600055,600109..602238,
                     602287..603492))
                     /locus_tag="CNC02130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569481.1"
                     /db_xref="GI:58264650"
                     /db_xref="GeneID:3256765"
                     /translation="MPSAALSPPTAAALAALALVLLPHIPRLLSCATLCLSILALALA
                     ALFCAALTTDYARTPQLLRQRSVLYRLRLSPAPSRSPTKSPISSFSSQVNAAISAFLD
                     LVVQHFVIPWYSRISPSPDFPDALEELIQNAIAQVAEKSDKVDWPSFVVSKILPIVTD
                     HLRHYRAIEHLPVGPQALPLPLPPHPHKALTDPHLAAQAIEEHLRQTLSRILPDLLPK
                     SEQTPVVFTLVQEILLGSVVLPGFQMVCESDFWNRQIDERVGQYLHEQKQVDQFLSAL
                     SSFPATSPSVRSPTVSRVRRKSHSKNPSIDANSSSSQFDVFLKSIRKLWTLGEARRLK
                     ADVERELRSARLALDEENKELDDAGPTHQSTDKAPSKGTRKSQKYVERLVRAKSAIDS
                     RIVELSGGSKPSNSGPTFVSLDTSQPISLYSILSNPSSLAYWLEFMDRRHRSRLVQYW
                     LTIEGFKDPLEATGTDVSEDSKSTERNIHDTTIEDAQSLYATYFSAPQSASVFISPQH
                     QHMIETAASSSHNLSPQDIARVRRAVFASQREVYEQMEDEDWSAFSKSELYLKAVGDL
                     QRTHSALKSASAVNADVQTPDNRRATLSRTPSPMAQVHHSLPRHQTPALLHRPLQQIT
                     PQTPKVINFLKPHSPASVSSPSLPPGPSSVQQKRQSLPPAILTAPTTPAGPSISVSEF
                     VRVASPPPFGRSVSDSRDSLNSSSNDSAGRRKGSANEMNSPSPSLSPSYASTPLILSP
                     KLVSPPPPSAKHSSQLNFLIGNEENGESHGRDRLFGDEPDDSREWERGEEARRIEAIQ
                     AALSEIIADDNGKRSNDGTPSDSLMSEREKPRERGNDMSSSLILGSATDKKERKRKSR
                     SLEDLKSASLLSSTTFSSAANLSQEPGRNSSKLLFEDDLPEDDLSSTPSVEEDSDIPH
                     NVPLPVPGDLQLTAQISELDANLLELDKQNELLSTLVRQAELTGNQKELKILRKSQSS
                     VQRETRAKQWQKQEYERVQDESRLVPGRTRVSIPSAAVTEDTENTSASTLGVVGPKQV
                     VRYTIHVCQIDDGHPAAKWAVSRRYNEFWELDKNLKEWASEHGDLETTETLRKVEIPG
                     KSLVGGISANFVESRRTGLEKYLQGLMTSPTICDSTHLRSFLSRSNSLVPSAIRTQPA
                     VTQLTKLPHNLMKSFYKSISLGPPSEDMFNANTADVMYSGLTRQINDLGGFVGLGLGS
                     PEVEVKEGHVQVTRDVSVEGMTSFTGPICDLFIELFDLKEKNWLRRQAVIVILQQFLG
                     GTIERKVRDYFRSVTSQSSFLRIIQNLQDTLFPSGKRRTSTASRSEEEKAETRARAGK
                     KLGLLIPDVAANMIGRGNARRAARRVFGVLQDERLNQQLMLRILDTVLDTIFPSMEGS
                     GVTY"
     gene            603695..>607033
                     /locus_tag="CNC02140"
                     /db_xref="GeneID:3256606"
     mRNA            join(603695..603832,603884..606585,606657..>607033)
                     /locus_tag="CNC02140"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41575474|gb|CF721315.1"
                     /transcript_id="XM_569483.1"
                     /db_xref="GI:58264653"
                     /db_xref="GeneID:3256606"
     CDS             join(603714..603832,603884..606585,606657..607033)
                     /locus_tag="CNC02140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569483.1"
                     /db_xref="GI:58264654"
                     /db_xref="GeneID:3256606"
                     /translation="MASVKALLRTPAYNPLPLPTLPSPEPHGRDAEQLPPLAESLVLP
                     YSLIQTRHHHLTSLLPLAFSHPPIPSHNKPRAKPLPKGVFVFPTPPPPVHPLPTREYH
                     GPRDLLNEASPSATPPANPASTPVPPQPKGRKRSGEPEPPAHEIECIARVTLALGPMS
                     FHGTELWVGRFVEPRANKPKKERAKPGERREREKKRREGIEKERQRTHSGPSATPKPA
                     ASVARPTVATAGPSAPRMRPPAPGPAVTNRTAASPQLIQLVNQAASRHPWLSSLIYKA
                     AGSTANQDELERLGRAVARLSKGEAIDDLAPQRVNIASSEVLKGKGKETAASTSHASK
                     TSVPAVPGPSSLSEKPTSAPAPLLSQNTSSSTLTPVVPAEKDKEDKKDDAESDWDSEV
                     EMKGPKQVGGGPIGPSTLDSAAAASTIPLTSTATQPSYAPSSVPASQAANPSVPSPVP
                     GIVPSPIPVSASTSSAVPLSPHAPPPKPNLPNPPPFLLIAFKEHPTDKFLIPLGSRSF
                     VSRVGGDWVTSKPPHLAPDTTLPLGQSLETSGNTNPTVAPQPAAQAAISRELQALQSS
                     AKSSSFELEAQSHSKRRGRTHVRPTNANSPSPAPPKVKTKPIEEPSLTTTTTTPEFPP
                     LPQLPGQNPPPGTVLISTLVPANKWNKVDWASLGKKVPWSEDWNSKVKAGTNENVREE
                     EPLPLPLSDASSQNHVQLLNLAAEDFLPENGPLKAITIRLGQVDDQIWGRMKDVMTLV
                     DRAEIMALSAMGVLPPAPDSITHPADDPEIREAYLLHKTSLFSSLMGRTRQPRRFLHT
                     RPSSPPAALVDATVDKMAPRPYPISTKPLYHVEEGDNEMEGRRDSVRQWSPDVEFDDG
                     LGRRKKKKTAQETVGFEMPVSLEALDERVEASAQKALLGKRGRAGGGEGARKEKQRRG
                     IEKGICEGCAREGIKIWRRGPSGKGTLCNSCGDLFTEGKLQYSDLKAPGAMKTLLAAN
                     QDVSGADAMHNQVEEKNDSVPVKAEQGRTTEEALGDGTAINSEEQKETSTQVVQAERP
                     PEHSPQHHAVESQPATQSLPETIEPGVDMQNQKSL"
     STS             605491..605701
                     /locus_tag="CNC02140"
                     /standard_name="AAC7"
                     /db_xref="UniSTS:470781"
     gene            complement(607238..609264)
                     /locus_tag="CNC02150"
                     /db_xref="GeneID:3256618"
     mRNA            complement(join(607238..607412,607470..607712,
                     607765..608640,608694..608752,608805..608903,
                     609104..609264))
                     /locus_tag="CNC02150"
                     /product="translation initiation factor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532996|gb|CF678837.1,gi|41533349|gb|CF679190.1,
                     gi|41533357|gb|CF679198.1,gi|41533494|gb|CF679335.1,
                     gi|41535180|gb|CF681021.1,gi|41535190|gb|CF681031.1,
                     gi|41535404|gb|CF681245.1,gi|41535412|gb|CF681253.1,
                     gi|41536610|gb|CF682451.1,gi|41536618|gb|CF682459.1,
                     gi|41547763|gb|CF693604.1,gi|41547776|gb|CF693617.1,
                     gi|41552224|gb|CF698065.1,gi|41552235|gb|CF698076.1,
                     gi|41559065|gb|CF704906.1,gi|41559077|gb|CF704918.1,
                     gi|41560285|gb|CF706126.1,gi|41560290|gb|CF706131.1,
                     gi|41562010|gb|CF707851.1,gi|41562019|gb|CF707860.1,
                     gi|41562438|gb|CF708279.1,gi|41562445|gb|CF708286.1,
                     gi|41563773|gb|CF709614.1,gi|41564740|gb|CF710581.1,
                     gi|41564747|gb|CF710588.1,gi|41567679|gb|CF713520.1,
                     gi|41567688|gb|CF713529.1,gi|41570289|gb|CF716130.1,
                     gi|41570291|gb|CF716132.1,gi|41571166|gb|CF717007.1,
                     gi|41571174|gb|CF717015.1,gi|41573086|gb|CF718927.1,
                     gi|41573090|gb|CF718931.1,gi|41574278|gb|CF720119.1,
                     gi|41574284|gb|CF720125.1,gi|41575165|gb|CF721006.1"
                     /transcript_id="XM_569485.1"
                     /db_xref="GI:58264657"
                     /db_xref="GeneID:3256618"
     CDS             complement(join(607368..607412,607470..607712,
                     607765..608640,608694..608738))
                     /locus_tag="CNC02150"
                     /codon_start=1
                     /product="translation initiation factor"
                     /protein_id="XP_569485.1"
                     /db_xref="GI:58264658"
                     /db_xref="GeneID:3256618"
                     /translation="MATVNIRRDVDDKFYRYKMPLLQIKIEGRGNGIKTVVPNMEDIA
                     RALNRPPTYPTKFFGFELGAQTSMANDRYIVNGAHTADRLRELLDVFIEKFVLCPSCK
                     NPETEIVITGRSGHEDMHRDCKACGRQNPIDMRHKLSVFIIKNPPKKKDKGGKKGKKS
                     GGMTAEANLGGPMVFEKTEDGSGEDDSSPDAGIAGVPTTGTEIDAVLGRGDPILGDPD
                     AAEAASKKLAKLDVNGGGDEEEDEDADSPYAALGSWLENNKEADDASIIAQIKDLGIA
                     GKHKVLVEIGQHLFSDDICDEIAGRTALLQALVTSEKHQKSLLGGIERLIGLSPSLES
                     LIAAGTTSKILMVLYQADIIEEDVVQQWGTHVSKKYVDKDKSKKVRKNAEAFLKWLEE
                     AEDESDSDEE"
     gene            complement(611658..614733)
                     /locus_tag="CNC02160"
                     /db_xref="GeneID:3256646"
     mRNA            complement(join(611658..612319,612377..612483,
                     612539..612785,612851..613199,613250..613956,
                     614016..614064,614143..614290,614341..614398,
                     614472..614733))
                     /locus_tag="CNC02160"
                     /product="glycerol-3-phosphate O-acyltransferase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544539|gb|CF690380.1,gi|41545940|gb|CF691781.1,
                     gi|41545951|gb|CF691792.1,gi|41550434|gb|CF696275.1,
                     gi|41550449|gb|CF696290.1,gi|41550888|gb|CF696729.1,
                     gi|41550898|gb|CF696739.1,gi|41551426|gb|CF697267.1,
                     gi|41551437|gb|CF697278.1,gi|41553149|gb|CF698990.1,
                     gi|41553150|gb|CF698991.1,gi|41558456|gb|CF704297.1,
                     gi|41558461|gb|CF704302.1,gi|41566978|gb|CF712819.1,
                     gi|41566986|gb|CF712827.1,gi|41571950|gb|CF717791.1,
                     gi|41571954|gb|CF717795.1"
                     /transcript_id="XM_569487.1"
                     /db_xref="GI:58264661"
                     /db_xref="GeneID:3256646"
     CDS             complement(join(611736..612319,612377..612483,
                     612539..612785,612851..613199,613250..613956,
                     614016..614064,614143..614290,614341..614398,
                     614472..614490))
                     /locus_tag="CNC02160"
                     /codon_start=1
                     /product="glycerol-3-phosphate O-acyltransferase"
                     /protein_id="XP_569487.1"
                     /db_xref="GI:58264662"
                     /db_xref="GeneID:3256646"
                     /translation="MAAGLAYDLVLIFWRIVINIFFREIRPRGAFNIPREGPVLFICG
                     PHANQFLDPLLLFSEARKEAGRRVSVLTAAKSMNRKFIGAVARIMDSIPVARAADYAA
                     AGKGRIILSESDPLIVTGIGTSFIEQVKPRSQLMLPKSAGYASAPVAEVISDTEIRLK
                     SEFVVPSKDGSANVKASHRVRNESELKEGLQFKVLPHVEQEDTYGACFQRLYEGGCIG
                     VFPEGGSHDRTDFLPLKAGFSIMALGAIAAHPGLDVKLVPVGLSYFHAHKFRSRAVIE
                     FGSPISVDPELVELYKQGGAKKREACGKLLEQVHDGLRAVTLRAPDWETMQVIQAARR
                     LYRVPGQHLTLGQVVELSKRMMEGYLTYKDEPKIIDLRQKVIAYNRLLRDMGIADHQV
                     ERASSRSIKSLLLLVYRVGLLLWWSILALPGALLHAPVFILAKLISIQKAKEALAAST
                     VKIQGRDVLATWKVLVSLAVTPLLYIFYSVLATFLAYKYDLAPEWRHWTPVVIFCWLP
                     GWAMASLKFGEAGVDVAKSLRPLFLSVWPYNQREVNRLREMREGLTNEISEVIDEFGP
                     QLYDNFQKGRILPSASVPQTGRNPGLLSRKSQTADSSVLSHPMLWLDERIFGWSRSAS
                     VGQSVWSSSAANKQQESEAAPASPYDSEGEEEEEADVDYDDVLAIIDTRRSSGGGVGL
                     ASPKGKKRRYTGQARSEGSVASPKSDIEGVPLPRADDNGVVRLHKRPGAAKDGISETK
                     GEEGLGLDTGREKGQ"
     gene            614934..617551
                     /locus_tag="CNC02170"
                     /db_xref="GeneID:3256634"
     mRNA            join(614934..615543,615592..617551)
                     /locus_tag="CNC02170"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531700|gb|CF677541.1,gi|41531707|gb|CF677548.1"
                     /transcript_id="XM_569489.1"
                     /db_xref="GI:58264665"
                     /db_xref="GeneID:3256634"
     CDS             join(615052..615543,615592..617463)
                     /locus_tag="CNC02170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569489.1"
                     /db_xref="GI:58264666"
                     /db_xref="GeneID:3256634"
                     /translation="MWALRTSAPLVRPPALTLLRSVPRLLLERGYSRPAGRAGSRGGH
                     SRTSLATAPGNTPRQPKRFELPPHHTPHTGKAKVPSDNTRSSSRPSRPIQNDDNPWTT
                     SVRLRRWIERHKLPLSPGQVDEVTKLVTEAPQHMLNAPVWNMLIGYMGRLRKLDRVWN
                     LYNQMKKRNFTPTARTYSTILNAYAGVAHSGQIPDFSFREPQKRTMSRVTIVYNNSQE
                     YMKKLIEAQEAEEDLGVATPGVQLREDRHQEPMESLQSDIDIAPTNAYLKFLSRHGLF
                     SEMQRTFLSLPQSGPLAPDTVTYSLMFTALYHVHRSLERDPNGKANAMMIGPTAKALW
                     DHCLKQYSKEEGQAGQVDNGLVAMYVRCLLRGRPEDQRLAVSVIEQVWNLPSPGNSNP
                     TSTSIYLPPPLLTTYPIPKLDIDVKSATALISSLHTAKLPVLATHYTHLILSSSSLIP
                     LFDLEFFKAAILALSVTGEVQSIVDIMDTYQPPSSGKEGWPRDTYRAALTAARWAGDY
                     VSALSIFRRATHLSSNVGCISTDPSTLPKKIEPYRWVTPNGLAHDKRGVFWVKPTKID
                     ADAQLLGLLVKTAMQKSNKEIRSALDVYARTGGESKFLALPSSVQAGNVSTGRKLLRD
                     GRPDEIDSSVIRKQVASSVDLARDIQRAAERLGKGYEKMAAEAGEVVTKWAWVERETR
                     KKTSDVKGDTKKVEMDIEGSAEDEELDWEDERSVDQRESRVRGNNQDRHHPTERRRWE
                     QRGTSKSRHDSPSHRRYGHEQDSNKVKPREREATMHEGKVSSFGLRR"
     gene            complement(<618841..>620495)
                     /locus_tag="CNC02180"
                     /db_xref="GeneID:3256623"
     mRNA            complement(join(<618841..619028,619086..619096,
                     619153..619229,619294..619627,619680..619862,
                     619934..620029,620083..620186,620260..620357,
                     620420..>620495))
                     /locus_tag="CNC02180"
                     /product="sulfonate dioxygenase, putative"
                     /transcript_id="XM_569491.1"
                     /db_xref="GI:58264669"
                     /db_xref="GeneID:3256623"
     CDS             complement(join(618841..619028,619086..619096,
                     619153..619229,619294..619627,619680..619862,
                     619934..620029,620083..620186,620260..620357,
                     620420..620495))
                     /locus_tag="CNC02180"
                     /codon_start=1
                     /product="sulfonate dioxygenase"
                     /protein_id="XP_569491.1"
                     /db_xref="GI:58264670"
                     /db_xref="GeneID:3256623"
                     /translation="MPIAVNDNVDKDTLGRPFSLAKSTRERLVQAGIDLSKGYPEYPI
                     RPKTIELASDIRKEGWEHKDPGARADKEKKALFGAAKEVIHLSPHLGTEIVGLQLNQL
                     SDQQKDELALLIAERTVVFFRDQDLTPQTQLELGKYFGTPEIHPSAARVPGLPGVSII
                     TDEVLRSTGRVPDYKNPFATQKWHTDLTHEPQPPGVTHLHLDHLPGVGGDTLWSSGYA
                     AYDKLSPAFQKVLDGLEGLYRSAHSYPNPVTGELEPIINAHPIVRVHPATGWKALFVN
                     SRYTIGIKGFEQSEAQAILQKLFQVYEQNPDTQVRFRWTPRSSALWDNRVSIHSAVYD
                     YLDEGSAEPRHGTRVSSLAEKPIPVSEGVGKSRREALGLNTGVVHELPIDTHAY"
     gene            complement(621603..>625336)
                     /locus_tag="CNC02190"
                     /db_xref="GeneID:3256650"
     mRNA            complement(join(621603..622219,622275..624038,
                     624099..624717,624805..625173,625226..>625336))
                     /locus_tag="CNC02190"
                     /product="GTP binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539682|gb|CF685523.1,gi|41539685|gb|CF685526.1"
                     /transcript_id="XM_569493.1"
                     /db_xref="GI:58264673"
                     /db_xref="GeneID:3256650"
     CDS             complement(join(621657..622219,622275..624038,
                     624099..624717,624805..625173,625226..625336))
                     /locus_tag="CNC02190"
                     /codon_start=1
                     /product="GTP binding protein"
                     /protein_id="XP_569493.1"
                     /db_xref="GI:58264674"
                     /db_xref="GeneID:3256650"
                     /translation="MEAPHKAHHKPSAGAKHAKKDAAKGVDRSGGKNFNPKAFTNTSF
                     RAADRAARRTAEKNQQRLHVPLVNRNPEERKVTNEKGKGMDEGALPPPPIVVGIVGPP
                     GVGKTTLLRSLVRRFTKHNLSQPQGPVTVVSGKTRRITFIECGNDLNSMIDLGKVVDL
                     ETFEFLNILQSHGFPKVIGVLTHVDLIKKASTLKDTKKRLKHRFWTEIYQGAKLFSLS
                     GVMNGRYPDAEINLLSRFISVMKFRPLVFRNQHPYLVADRIQDLTPREAIRENAKIDR
                     TITLYGYVRGPNLPPRNAKIHIPGAGDLEVKEVERLADPCPLPTLESERRRKMGEKAK
                     LIHAPMSDVGGVMYDKDAVYINVPGNFTKGGDTPQGEGEKMVMDLQDAEKTFADNIQA
                     SEIRLFGHSSAPLQVTEERKDRVRRKAEPRSGGPMLGKADEDEFDESEDDEFDDRSDT
                     EEGGVLNGESDEDDDQDERDVAYAESESDHDDLAFATGFEQEGGRINFDDEDDDDFPS
                     DEDDEDVPGWKRNLASRASSTLADRLRKKRNLMTLIYDTPLSPEEIVNGKTRPSSADA
                     SSSFAELQNEGLFRISHEENKGDDGDQVKEEVDRDQLKNKWADEEMLESLRGLFISGP
                     VAGEGVDEDGEAYEEEGEDFEDLEGGSDGRGDGEDDVPYVGVKPSQVSVEDARAAALA
                     KKKEALKIKFDEQYDDSDDEASKMDFYDQQKAEMARQKQINEEEFGNLDLDARTQIEG
                     YRSGMYVRLEIEAVPYELIENFDPRFPIIVGGLLAAEERFGFITVRIKRHRWFTKTLK
                     TNDPLIFSLGWRRFQTLPLYHLDDHSIRNRYLKYTPEHMHCFATFYGPVSAPNTGFCA
                     FNSLQGDAPGFRVSATGVVLDVDRSTKIVKKLKLTGAPYKIFKNTAFIKDMFNTGLEV
                     AKFEGANIKTVSGIRGQVKKALSKPDGAFRATFEDKILLRDIVFLRAWYSIEPKKLYN
                     PVCSLLLSNKESWQGMRLTGQIRREEGLKTPLDPNSAYRPIERTTRRFNPLKVPRKLA
                     ASLPFASKTPELSKQRKPTYMQSRAVVLGEDEKKAVTLLQQIQTLKKDKAERRKAKQD
                     ERKGAYRKKVGEKDEKREEKIREERRERFKKEGLKRKREEMSEGKGRGKKSRA"
     misc_feature    621662..621840
                     /note="CT-rich"
     gene            625520..628252
                     /locus_tag="CNC02200"
                     /db_xref="GeneID:3256229"
     mRNA            join(625520..626285,626341..626462,626529..628252)
                     /locus_tag="CNC02200"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535861|gb|CF681702.1,gi|41535870|gb|CF681711.1,
                     gi|41548016|gb|CF693857.1,gi|41548025|gb|CF693866.1,
                     gi|41548548|gb|CF694389.1,gi|41548558|gb|CF694399.1,
                     gi|41555476|gb|CF701317.1,gi|41555484|gb|CF701325.1,
                     gi|41555828|gb|CF701669.1,gi|41565477|gb|CF711318.1,
                     gi|41565481|gb|CF711322.1,gi|41572047|gb|CF717888.1,
                     gi|41572048|gb|CF717889.1"
                     /transcript_id="XM_569495.1"
                     /db_xref="GI:58264677"
                     /db_xref="GeneID:3256229"
     CDS             join(625562..626285,626341..626462,626529..628172)
                     /locus_tag="CNC02200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569495.1"
                     /db_xref="GI:58264678"
                     /db_xref="GeneID:3256229"
                     /translation="MVNSPPQGLPPIKLKLSLTNIHQPSTPTPTHNKKGKRAAPPIDA
                     HDANSSSLLPRPKLKPNAAGPSAFRISLPAVGSSTADLSTVATPVPSTASSPANPITP
                     SGSASKAQTSPGKKSSIKKSAKPLASKKKTGPRRPPSAIPQRLLSSTSTTPSKPSAAI
                     PETPTQVKAEPEDISPASSSIPPAEEVTGISTPSQNGGEETPGTGKRPTKWMRVKKPL
                     KELLQKIMVEIRKKDDYALFEEPVDLEAFPDYLDVIGGEDNMMDMGTMQAKVDRNEYR
                     NIEQIEADLRTLASAAQKFNPPGSVPHKSAGIILAHGLKHIERSRPLVLTPPSSPRDS
                     ATPARATSVLSTRELTAALEERKARDDVPPHLYIPEEMLSFPPNSVMARAVGWNLNGG
                     KRMYNKRISRAREKFGGKWRNWTTDGSRDIAEADDIHLLFDPWRVRTGEEWRKVPDWQ
                     ALRNETNWWELEMPPPPPQSAAQQAPLPFNPGEPRLDKVPLHDFVPYDFGQYPSISSE
                     ISFLRQRIPNLSEEEDILSEHIRPVYPRLKKGESAPPPNLVNIYDGPLRRTAGDWVRE
                     MATGGVIGEAYIDSLNRFVKGAMKEGAEKDLSGEQDTKPNLGSEQLPLDEYVMTSYHT
                     PFLQTSTRQTIHDTLGHLSPLSARPDYILPLAKAAYARVALRLLTGPSNPMDIKPLLR
                     EEGDFMYQGVGGKSGVNVGLEWTGEELRRLVEKMSVQKQYLAGKRKREEGNGVEGETK
                     RIKMEADSAAAITDKPSLISESVTSHPPQPRDAAVSEEPEKINDEELKRLRLELVALS
                     KFYPLPALKKMSKEEAAKLLPVNVRGLMCRP"
     gene            complement(628380..630266)
                     /locus_tag="CNC02210"
                     /db_xref="GeneID:3256452"
     mRNA            complement(join(628380..628878,628937..629226,
                     629278..629384,629433..629588,629635..630266))
                     /locus_tag="CNC02210"
                     /product="regulation of transcription from Pol II
                     promoter-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531530|gb|CF677371.1,gi|41531540|gb|CF677381.1,
                     gi|41534527|gb|CF680368.1,gi|41534540|gb|CF680381.1,
                     gi|41560036|gb|CF705877.1,gi|41560039|gb|CF705880.1,
                     gi|41563630|gb|CF709471.1,gi|41563647|gb|CF709488.1,
                     gi|41566545|gb|CF712386.1,gi|41566551|gb|CF712392.1,
                     gi|41576127|gb|CF721968.1,gi|41576132|gb|CF721973.1"
                     /transcript_id="XM_569497.1"
                     /db_xref="GI:58264681"
                     /db_xref="GeneID:3256452"
     CDS             complement(join(628731..628878,628937..629226,
                     629278..629384,629433..629588,629635..630265))
                     /locus_tag="CNC02210"
                     /codon_start=1
                     /product="regulation of transcription from Pol II
                     promoter-related protein"
                     /protein_id="XP_569497.1"
                     /db_xref="GI:58264682"
                     /db_xref="GeneID:3256452"
                     /translation="MFSHAPPHLPHQHQHHPLQHQSLHRPPTAPSTPDTEHSTHTWAP
                     TPSFPQHMSQQLQPASNIPAYLFDRRQFPYSAPSADATRQNAAHTPQIAAAQSTTPGA
                     SASGPLLPQNLAQHLNNPPPPTGSQQSINPPMQTQAGPGTGSVAGAAAGGKVLLMPNG
                     APPPAGSDEEKIYILITELLEPETREAALLELSKKRELYEDLALVLWGGFGIMSSLLL
                     EIVAVYPALSPPSLTAHASNRVCNALALLQCVASHSDTRALFLNAHIPLFLYPFLNTT
                     SKTRPFEYLRLTSLGVIGALVKQNDNSDVINFLLSTEIIPLCLRIMETGSELSKTVAI
                     FIVQKILADDLGLQYICQTYERFYAVGTVLANMVDALVESQAVRLLKHVVRCYLRMSD
                     NPRAREALRACLPKALQDNTFNPLLKGDMVTKRCLQTLLMNLNERPSSDIQ"
     gene            <630416..>632781
                     /locus_tag="CNC02220"
                     /db_xref="GeneID:3256651"
     mRNA            join(<630416..630432,630478..630510,630561..630606,
                     630659..630686,630754..630761,630816..631066,
                     631120..631153,631213..631227,631277..631306,
                     631363..631526,631582..631754,631811..631973,
                     632033..632646,632723..>632781)
                     /locus_tag="CNC02220"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539328|gb|CF685169.1,gi|41539332|gb|CF685173.1,
                     gi|41557099|gb|CF702940.1,gi|41568310|gb|CF714151.1"
                     /transcript_id="XM_569973.1"
                     /db_xref="GI:58265633"
                     /db_xref="GeneID:3256651"
     CDS             join(630416..630432,630478..630510,630561..630606,
                     630659..630686,630754..630761,630816..631066,
                     631120..631153,631213..631227,631277..631306,
                     631363..631526,631582..631754,631811..631973,
                     632033..632646,632723..632781)
                     /locus_tag="CNC02220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569973.1"
                     /db_xref="GI:58265634"
                     /db_xref="GeneID:3256651"
                     /translation="MQAPQIRLNERQANPNPYVVFIRSLQNKADHTDAEDILRAVAAQ
                     MRTIMKDRFMQIGTLEEAEFNRVVSQPRQATGESEKADATKFAGRNWNHGQVGMIWHV
                     QAVVVYSLTFQSIELVLRGPSGRFLPMPYIISVMCHEMAHIEQMNHGPKFQKLMREIK
                     ADVAKLQARGYYGDGFWSDGKRLADSVRMGGEGLRPSDFPEYICGVSSSDAKKARRGP
                     RRQANRTTGLVKGEASHRSGRQTEYRKKAGRRNNADMGDNGLRLDGIRVITKQDREER
                     KAFVDDKIQMLTRGGMPLARARKQAGEMWEQENPWWAESNTRSKVAKSKSAAALRAEA
                     AEARLRALAGPSRDTKHKLEPMSSNSEDEDESSDDGIEEIPDPHLSVEDRKKEMDEMD
                     EEEKDGLRGGWEDYITPPNVYRPITSTNSSDSSETKPSVKRPPPESSGPSKIRKLQHQ
                     APLPFTTKSIKKERSSFPGESTSALGGRPSIISPATPQMSKELGRGEDAFPREDGQPG
                     WRCRLCTFINLMDHGRCDICQARPDGTLPEDVQSII"
     STS             631146..631939
                     /locus_tag="CNC02220"
                     /standard_name="Pst7"
                     /db_xref="UniSTS:470780"
     gene            633233..>635030
                     /locus_tag="CNC02230"
                     /db_xref="GeneID:3256269"
     mRNA            join(633233..633656,633728..633950,634015..634184,
                     634251..634497,634556..634739,634803..>635030)
                     /locus_tag="CNC02230"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546920|gb|CF692761.1,gi|41546928|gb|CF692769.1"
                     /transcript_id="XM_569974.1"
                     /db_xref="GI:58265635"
                     /db_xref="GeneID:3256269"
     CDS             join(633446..633656,633728..633950,634015..634184,
                     634251..634497,634556..634739,634803..635030)
                     /locus_tag="CNC02230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569974.1"
                     /db_xref="GI:58265636"
                     /db_xref="GeneID:3256269"
                     /translation="MSQLLWISDASPLFFYSPAEAYFAGQGLNSWVGSAGLNSTTTVA
                     AANGGGGTTTYHSTTGMAGVIIPAIYATSFVPIFSAPDSYDVTMQQNSNDPQDWKSGQ
                     NWTSSGGDFSAQTFTIEVSCQGDCDDDFIFEGAWVETELAPEGSDTESVSLDDSSLLI
                     QYTGFTSVEANSQPVQVSSSDYNSSLSMTSTAGATAQVMFTGASVMVSGVSCPFCSTF
                     SVSLDSKTAATLDSANNATVHGTLLYFATNLDTSDTHTLILEAEGGGTLVIDEFTVNG
                     PKGRVGFIGTVDGLTTTVGPSSTGVISSDGSSSNTASNSGATALSAATEGGAPNVGVI
                     IGAILGSLAGVAILYFLCRKAVPAAKSSEKKKMDPWDEANLLQNMKNEGVHVTTVANQ
                     RYVYRGYHQLSNPSYQILNDPQSRINRP"
     gene            complement(635072..636970)
                     /locus_tag="CNC02240"
                     /db_xref="GeneID:3256213"
     mRNA            complement(join(635072..635282,635338..636221,
                     636269..636469,636524..636762,636812..636970))
                     /locus_tag="CNC02240"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534238|gb|CF680079.1,gi|41534247|gb|CF680088.1,
                     gi|41536776|gb|CF682617.1,gi|41536788|gb|CF682629.1,
                     gi|41539098|gb|CF684939.1,gi|41539106|gb|CF684947.1,
                     gi|41539900|gb|CF685741.1,gi|41543316|gb|CF689157.1,
                     gi|41543332|gb|CF689173.1,gi|41557867|gb|CF703708.1"
                     /transcript_id="XM_569499.1"
                     /db_xref="GI:58264685"
                     /db_xref="GeneID:3256213"
     CDS             complement(join(635090..635282,635338..636221,
                     636269..636469,636524..636762,636812..636947))
                     /locus_tag="CNC02240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569499.1"
                     /db_xref="GI:58264686"
                     /db_xref="GeneID:3256213"
                     /translation="MSSLSLTRDWLHSVLRPFPARETITQEVLYVLQQRRTLAVKTDA
                     FTFDSGHTALLLLLHGTLPVTYRGAIYQIPIHLWVPHEYPRAPPLIFVMPTKDMGVRK
                     SREVEPSGRVREEVVEGWWRAWEVKNLDMLLKHLADVFSAAPPVYAKPSTPSQSQGLP
                     PGARTSTPEGQTGAPQPPIPVTRPTFGHPNPEILPVYRSAPTPPPHPYSHNPTRQLSP
                     PTSSAPQHVQTPRESQYMSNQPRQTQSPSPSASAPPVPQRPYSGVGPLPQVAGSLQQH
                     YTGPQQVWQGVPASRPPPPAGMMSSQSTAAGQPWPIPSGENGNNAVHPSQQINHPPSH
                     PHQAQKSQSLPVPRQPPQDLLSSPGTQPTVLSNESDGASGPPPIPPSKPPPPSLLHLH
                     SILLPHLNASLPPLMNSLHSSVEHLRARQEDLVTGEPAIRDEMARLEAVKKVCDSVGK
                     KMEEVVAKGGERVADLESKGEVAVDELVCGISIVHNQLVDLVAEDNAIEDTIYHMTRA
                     LDAERVDLDRYLKSIRSLAREQYMKRALIERILQGMGQKQGW"
     gene            637732..639384
                     /locus_tag="CNC02250"
                     /db_xref="GeneID:3256245"
     mRNA            join(637732..638375,638434..639384)
                     /locus_tag="CNC02250"
                     /product="hydroxymethylbilane synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41550343|gb|CF696184.1,gi|41550347|gb|CF696188.1,
                     gi|41553254|gb|CF699095.1,gi|41553257|gb|CF699098.1,
                     gi|41565521|gb|CF711362.1,gi|41567115|gb|CF712956.1"
                     /transcript_id="XM_569501.1"
                     /db_xref="GI:58264689"
                     /db_xref="GeneID:3256245"
     CDS             join(637746..638375,638434..639249)
                     /locus_tag="CNC02250"
                     /codon_start=1
                     /product="hydroxymethylbilane synthase"
                     /protein_id="XP_569501.1"
                     /db_xref="GI:58264690"
                     /db_xref="GeneID:3256245"
                     /translation="MSCPFHTTTNTSNRSPLPDRALLLAMKSQTNTFILGTRKSNLAL
                     VQTGHVADDLRRLHSGAGSKFGETREEGDDAEQGDVPFVHPYTFSIESMTTVGDRNQT
                     TPLHLLSPYSSTQPAKSLWTDELEARLINGHFDMLVHSLKDVPTVLKDGCEIGCMAKR
                     HDPRDALVVKQGLPYKRLEDLPDGAVVGTGSVRRVAQLKRAFPNLVFEDMRGNLNTRF
                     NKLDNPQSPFSALILAMSGLERLGMAHRATSPLSSPTLMHAVGQGALAIEIRSTDPRV
                     RNCLRGLGHWQTEWSCGAERGCLRVLEGGCSVPVGVESELVELDEDEVAAHPELLEGV
                     EDPFKGQEEIPLEGDSPMLWFSGLVDTTSAPTPSTPTFSSHSLPPLRTRLAKLTLHSC
                     VTSTDGSKHVLFTPPPVLVRSYRQAEQFGEECARRLRGMGAGEILDEINKLRKERELR
                     DLESAIERSRAAQEESEKMGLVQDGTAEVVA"
     gene            <639838..651164
                     /locus_tag="CNC02260"
                     /db_xref="GeneID:3256417"
     mRNA            join(<639838..639940,640005..640420,640471..640680,
                     640728..640784,640833..642077,642129..642181,
                     642234..642423,642471..642932,642983..644784,
                     644835..645612,645666..645782,645836..645934,
                     645985..646302,646351..646705,646751..647110,
                     647164..647281,647331..647476,647618..647688,
                     647744..647851,647902..648098,648147..648373,
                     648422..648630,648681..649173,649221..649356,
                     649408..649551,649602..649926,649975..650202,
                     650268..650486,650547..650595,650647..650911,
                     650961..651164)
                     /locus_tag="CNC02260"
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534906|gb|CF680747.1,gi|41534912|gb|CF680753.1,
                     gi|41548685|gb|CF694526.1,gi|41548692|gb|CF694533.1"
                     /transcript_id="XM_569503.1"
                     /db_xref="GI:58264693"
                     /db_xref="GeneID:3256417"
     CDS             join(639838..639940,640005..640420,640471..640680,
                     640728..640784,640833..642077,642129..642181,
                     642234..642423,642471..642932,642983..644784,
                     644835..645612,645666..645782,645836..645934,
                     645985..646302,646351..646705,646751..647110,
                     647164..647281,647331..647476,647618..647688,
                     647744..647851,647902..648098,648147..648373,
                     648422..648630,648681..649173,649221..649356,
                     649408..649551,649602..649926,649975..650202,
                     650268..650486,650547..650595,650647..650911,
                     650961..651006)
                     /locus_tag="CNC02260"
                     /codon_start=1
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /protein_id="XP_569503.1"
                     /db_xref="GI:58264694"
                     /db_xref="GeneID:3256417"
                     /translation="MQALKNAALGLLNVYVSPYVENLNAQDLSLSLFSGNLQFHGLHL
                     KKSLLERFGLPVEIVAGDIGTLSISIPWTALKTQPVKIVIDDIYVLARARPPGKVDPE
                     EDERVEQATKQEKLKSAEAVDSAASQMGPQGGNEETKQTYVGAIVSKVVDNVQIHIKG
                     IHIRYEDGTSTPDHPFAAGVTLNEFKAVSTDANWMEAFIHDSLHGVHKLVQLEALAIY
                     FDTDTESLEKGPEERSETIQALKDMLDGPHNHQYILKPVTGEARAIINKHMSNDTPKF
                     DAQVIFDEIGVVIDRDQYRDVLSVIDVFHFYRRTHQYHKFRPSEEQFKANPAQARLKF
                     ALEAIRSEVHERNRRWSWDYLQERRDTRKQYVDLFVKKLALPEGKQLPVDEATALSGI
                     EVRSSYEDIRFFRSVARAKAKKDAATRRKMELERQKNQPQTQTWGQWLWGPSARSSDI
                     DGGISEEEKKELDDIIDYDSSAAQETIEATPRDFMKARVSAKLNKGSFSLRTDPHGKC
                     TDVMALVFDSFSADAVQLTDSMKGKFALGGFRVYDGTTPDSLYPQIVHVKDLVKNAGG
                     QARQAGLNEQGIQAAMDAVEEHLTDDKDPFFLMEVEHNPLDGRADNAVTVKMRHLEII
                     YHRGYVEAVVRFFRPPESQLESIGALLDAAGQTLDGIRKETRAGLEYALEQHKTIDLR
                     VDMNAPIIIIPMDVKVKQSQTLVLDAGHIFVGSKLADKEQLQEVQSKRGRQYNEDDYK
                     QLEDLMYDRLDLRLESTQLLMGDDVEACMRALEDTHSSSSYEFHILERIGMSFTVQNA
                     IVNAPNLTRFKVAGELPELHVNFSDRKYQALMKFIDVSIPKFESDQTQQEHVTPTTAA
                     QGRRHFGQREIEEYNFEDDRSIISARTTEERDTLDDGSSNGDKGDRFYEAHDQQTESQ
                     KSALRQVTFEFSFSVGKLQASLFKSVSPTTERPLADAVLEGFGLTFALRKWDMSVDLF
                     LRSVTLAMIEQGSARRPLLSSASEGGNSPSDLKLVQVKYLKAQKDSPEFMTKHEGVDT
                     SIDTELSTFKFTISPEPILYLYDFIMTTFVPNNQSSVNQPSQGVETQVLGVDQEEAQP
                     STDKMRIRVKLTSAQVALENNGNKFALLALPSADVAILLRNGGLRVGARLGNLSLEDL
                     SPEPVADTSFKKLLSIEGGELADFSYETFDPTDKETFPGYNSSVNLRAGSFKFTFMEK
                     PISDLYAFATKFARMKAVYDAAQQAAVQRASEVTRMHFDVVIKTPIIILPRDGITSPD
                     RLILRLGEIIAKNEYFNDPDDTSAIDASLRGINVASEIMVGDKKAILQMIDDVAITAS
                     IRQAGGTAHRSDPHHADTEITTNMSDVKLSLTQRQYVLLMCVLEALPRALNDVSDAET
                     PAESLEDTPETSTPSTPDSVEIREATGVSLEPELVVSQDQRQLDVKLWTAFDFVFSVD
                     TIALEIYSVDAITEDDLKSNSIARFALVKSHLGFKKLSDGATEAEFSLKTLSFSNTRT
                     GNSVFRDIIPPASHEGNQIMLQYTMTGGTDPSALAIVTVDSPQLILAVDPLAALLEFA
                     VSPFKKHADAELQPQENVEQADEFEEGPKQGASLSFRVEVVKATVVVIADDTNPKTQA
                     IQLNIKEVLLSQQSILALKVDRIGMSFGRMDRPNDRVKFLDDLSMALSLDTRRKGSQQ
                     MTSFEVEIPDPVIFRASYTNIMLIIDIVNKATTVAAKALAPAEGTGRAEKDSKSLTKD
                     SAYGTSSAAVMDPRRSRRRSSVTRRTSISKRRRSLEGPQVIISKEQLEARVNGFQFVL
                     VGDLQEMPMAHLSTDAFNVSIQDWSGDLKLATSITTSVRYFNLANSYFEPLVDPWNFD
                     LTVNRVSAGPQNSPLNVKLSARERLEVNLTSAFIELAITSMTIWSKEGERAMAGRGSD
                     APFRVRNLTGLSILIWPEATDLGKAVTGVKRLDDGADVPWRFEDRKHTRENISAVRHN
                     SLGIQLQDTPWDPLRDISVDRAGDHILTLRPRLDRVSHQIACEIKLVNNIKVITFRST
                     LNVENKTSLPVEMIVVDSHGKAASAALKINPGESCPLPLEAAFEKRFRLRPLRGFGFD
                     FSWSAPLHWKTLLAKPIRPISCKHQTPKEPAFYFQAQANFDPKDPAARIYPRMALVLR
                     APVELENLLPYDLKFRVHDKNSGLSSSSFLVKGGSSPIHTVELSHMFLLNVTPEETSF
                     KQSEYAIINTDDPELPIEDNFQLTDQQGLKTTLKLHYTTYPNSGGAFKVQIYSPFIFM
                     NKTGLPFDLAAKTWAGGQRPIAGRDQFEIFSFPNEDRRSRLHIRVNNSKWSQPVSFEP
                     VSADMQIVVPSASGDNDNYVGLSYAEGIGKYKLTKVITIAPRFLVKNIYSRPIKIRQY
                     GTRHEYSVGVGERIAIHQLQRGAPPQLAMAFDEPNVTWSAPFNIADLGRTNITVRRQS
                     GSNSKTYLMRVETHLEGSSIFLYVSKEKDDAWPLRLRNDTNLSLAFQQIVSVLGFPLT
                     DRERARPVHFLPPRSVQNYAWDWPTAGNKRIKLYVDPGNTSSGEKGVELPNAIDMMAI
                     GIQPPMKVPSTTANKRSTTVSIDVRADGGSQLLTISPYNEETSVYKPTRPGAGIRRSE
                     STTSLSSSTVAFETISVSEKPTMNITVELEGIGISVISRRPDELLYFSLRGLKLGYSD
                     YPQYYDVFVDCKWIQIDNQLFGGLFPIIFYPTVVPKDGKELESHPTLQSSVTVLKDQS
                     HGVIFVKYATILLQSMTIEMDEDFLFALLDFVKFKNASWKEEGQDVLIEHPKDIPEPD
                     ISTTKADVFFEALQLQPVALELSFMRTDRVNVDEKVSTRNPFYYALNALTMTIGNVNA
                     APLAFRALFLENVRLSIPSLQERVILHYQEQFISQIYRVLGSADFLGNPVGLFNNISS
                     GFSDIFYEPYHGMVMHGNKDIGLGIARGATSFAKKTVFGISDSVTKFTGSIGKGLSAA
                     TLDAEFQSKRRMTQRRNKPKHALYGVAAGASAFADSVTSAFEGVASKPMEGAEKGGAA
                     GFAKGVGKGFVGLFTKPAVGVMDFLSASTEGIRNTTTVFDQAELDRVRLPRYIASDGV
                     LRPFSAREALGQSWLKDLDAGAFFHDSYIAHIDLPGDDAISILSNNRILQVQLRKLRV
                     IWQVPFEELQSLSLEANGINLVNRDGRGGPFLPIPDQKAREWYFKQIGKVVVAYNKAH
                     SQRED"
     gene            complement(651188..653440)
                     /locus_tag="CNC02270"
                     /db_xref="GeneID:3256553"
     mRNA            complement(join(651188..651613,651674..651977,
                     652024..652840,652894..653035,653091..653440))
                     /locus_tag="CNC02270"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532709|gb|CF678550.1,gi|41532713|gb|CF678554.1,
                     gi|41568639|gb|CF714480.1,gi|41568643|gb|CF714484.1"
                     /transcript_id="XM_569505.1"
                     /db_xref="GI:58264697"
                     /db_xref="GeneID:3256553"
     CDS             complement(join(651519..651613,651674..651977,
                     652024..652840,652894..653035,653091..653418))
                     /locus_tag="CNC02270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569505.1"
                     /db_xref="GI:58264698"
                     /db_xref="GeneID:3256553"
                     /translation="MASFHPTRREIVLVLTMTVILGLFFQFGSMGFTDPDSSDSLLRF
                     RMGFGHRCQDDWGENSRGEERGKWIEDVDTEVGFPKAAKIAGMAETKVKWGEQGPPRT
                     QVLAHAPGWTVFDDVYLFNGTWFIVTDHPSSIPLLRLMASTGNEIWNDEESIRGREPT
                     EKDMRIIFPSEAKKLWGQSASLVSGASFVVNDPPQFLDHYYHFAAELLLGLWRTYSSL
                     DPTISAQGVTHLPSPSRMIFPHVSAGKWNDYAKMNSYLSRAIFPSMSYEYQNDFLDRV
                     DTGRAFLLERVVFADRAAAFRGPEFSKTWRTASEAVTLQASKYWWSPIRKNLLEFVGD
                     GYGGDIDLGEMGIGVGVEIPDIEEDIEAFEAEEGAMEEEKEEVREKIMKEKEAEASKP
                     VITYVSRQDWGRRMLKKESHDSLVKELHDLEEKYGWEVNIVSMDKLTREEQIRLSART
                     TIMMGVHGNGLTHLLWMNGQNPRATVIEFFFPGGFAEDYEFTSRALGIKHYGVWDGQT
                     FTAPDTPQVAYPEGFQGNEIPLDGKAVSDLIVKRLLVDRPSRHLNDSDGVHDQ"
     misc_feature    652153..652215
                     /note="CT-rich"
     gene            complement(654002..654971)
                     /locus_tag="CNC02280"
                     /db_xref="GeneID:3256465"
     mRNA            complement(join(654002..654492,654545..654618,
                     654682..654830,654895..654971))
                     /locus_tag="CNC02280"
                     /product="expressed protein"
                     /transcript_id="XM_570037.1"
                     /db_xref="GI:58265761"
                     /db_xref="GeneID:3256465"
     CDS             complement(join(654460..654492,654545..654618,
                     654682..654830,654895..654908))
                     /locus_tag="CNC02280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570037.1"
                     /db_xref="GI:58265762"
                     /db_xref="GeneID:3256465"
                     /translation="MRIPLIIHHFLTIIAISFTVAVFEYTMSTTYLNSACIWLFQATL
                     EQPTFLGLLGYRLGWNPKQVARLLKFAAVQTFLFKSASALTLIIY"
     gene            complement(655781..657103)
                     /locus_tag="CNC02290"
                     /db_xref="GeneID:3256736"
     mRNA            complement(join(655781..655952,656004..656023,
                     656078..656152,656208..656250,656303..656357,
                     656421..656495,656561..656567,656613..656636,
                     656700..656709,656761..656798,656863..657103))
                     /locus_tag="CNC02290"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534685|gb|CF680526.1"
                     /transcript_id="XM_570036.1"
                     /db_xref="GI:58265759"
                     /db_xref="GeneID:3256736"
     CDS             complement(join(656137..656152,656208..656250,
                     656303..656357,656421..656495,656561..656567,
                     656613..656636,656700..656709,656761..656798,
                     656863..657020))
                     /locus_tag="CNC02290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570036.1"
                     /db_xref="GI:58265760"
                     /db_xref="GeneID:3256736"
                     /translation="MMVVQQSTVIFLLCFSLPIVNALSEYQYLSSVNNFATSFLSPYN
                     VEVVKSINSTLFSEDVTGTADVSTNFDGRELSTEYLFGLFVKTADDSHDPSPFGSPIS
                     YNVTGLLIENEFVSASIKFEFYYPVLNKTFPIQVELTYP"
     gene            <656179..>657194
                     /locus_tag="CNC02300"
                     /pseudo
                     /db_xref="GeneID:3256795"
     gene            659470..663658
                     /locus_tag="CNC02310"
                     /db_xref="GeneID:3256484"
     mRNA            join(659470..659613,659666..659773,659833..659923,
                     659980..660063,660122..660218,660275..660359,
                     660409..660524,660574..660652,660704..661057,
                     661113..661243,661296..661398,661450..661944,
                     661994..662892,662953..663082,663136..663235,
                     663284..663370,663436..663658)
                     /locus_tag="CNC02310"
                     /product="transcriptional elongation regulator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531347|gb|CF677188.1,gi|41536244|gb|CF682085.1,
                     gi|41536255|gb|CF682096.1,gi|41550540|gb|CF696381.1,
                     gi|41550555|gb|CF696396.1,gi|41555204|gb|CF701045.1,
                     gi|41555210|gb|CF701051.1,gi|41556463|gb|CF702304.1,
                     gi|41556478|gb|CF702319.1,gi|41556724|gb|CF702565.1,
                     gi|41556737|gb|CF702578.1,gi|41561255|gb|CF707096.1,
                     gi|41561261|gb|CF707102.1,gi|41562450|gb|CF708291.1,
                     gi|41562460|gb|CF708301.1,gi|41568621|gb|CF714462.1,
                     gi|41568630|gb|CF714471.1,gi|41569312|gb|CF715153.1,
                     gi|41569324|gb|CF715165.1"
                     /transcript_id="XM_569507.1"
                     /db_xref="GI:58264701"
                     /db_xref="GeneID:3256484"
     CDS             join(659545..659613,659666..659773,659833..659923,
                     659980..660063,660122..660218,660275..660359,
                     660409..660524,660574..660652,660704..661057,
                     661113..661243,661296..661398,661450..661944,
                     661994..662892,662953..663082,663136..663235,
                     663284..663370,663436..663515)
                     /locus_tag="CNC02310"
                     /codon_start=1
                     /product="transcriptional elongation regulator"
                     /protein_id="XP_569507.1"
                     /db_xref="GI:58264702"
                     /db_xref="GeneID:3256484"
                     /translation="MSDIRLDSATFFKRAAKIFDSWEKPSGDTQALEDINSIAIILGD
                     PNDEVASYTKTTALQLWLLGYEFPSTLMVFEKSPRKVTFVCGSSKAKLIRQLQPSDGI
                     EIDVKVRSKDATAAKETMEEVVASLNGKFGSLPKDRPIGKLVDEWNSAVESKGDLEVV
                     DVAIPISAVLAEKDGEELKTIITSAKLTSTVMINYFKSKMESIIDRGTKMSHEALAQL
                     VEEKIGNEEKGPDMKLWNKNPSLGEIDFASSEFVYSPVIQSGGKYDLKVTAASNNDNL
                     KPGIILANMGIRYKNYCSNMGRTFLISPSKKQETQYTTLLEVRKEALALLKTGAVASD
                     VYNSVHQSLETKNATLADSFLKNLGFATGMEYRDSSFLLNAKNNRELKENMVLVLTIG
                     VADLPDAKNKGKTYSLLLSDTVKIGQNGAVVLTEGCTRLSDVVMDMEEEEEEDVKPQI
                     DKKPKINNSPKKPRSSTVGGRVLNAKTRGANREQATQTTAEKIKTNQQRLHAQLNADG
                     VKRWEADAGGKNGAQQKVVKRYESYRREEQLPRAVEDRRIYVDEQRQSVVLPINGYAV
                     PYHISTIKNVTKTEESNHMVLRINFQSPGQIAGKKEDMPFEDPDANFIRSVSFRSQDQ
                     RHMLKVYEAITALKKAAVKRETERKELADVIEQEKLIEVKGRHPYVLKNVFPRPGPEG
                     KKTDGNVEIHQNGIRFRPDGPASKIDILFSNIKHLFFQPSEKELIVIIHVHLKAPIML
                     GKKKTSDVQFYREVADMSFDETGGKKRRARYGDEDEIEQEQEDRKRRAELDKLFHDFA
                     RRIETAAQAQQFELEVDVPFRELGFNGVPHKSIVALLPTTNCLIHISELPFTVITLSE
                     VEIVHLERVQFGLKNFDMVFVLQDLKKPPVHINSIPVAHLDNVKEWLDSCDVPISEGP
                     VNLSWPAIMKTVNEDPHAFYAEGGWNFLTGSGSDDGSEESEEGSEFEGDSDVFDESSG
                     SDEDSESAFEGDSDSASAESLSDEGEDWDELERKAKRADEKHRTDRGGDSDDDGKKKK
                     KGSRR"
     gene            663795..666389
                     /locus_tag="CNC02320"
                     /db_xref="GeneID:3256505"
     mRNA            join(663795..664015,664070..664124,664186..664439,
                     664493..664904,664964..665760,665814..666080,
                     666136..666389)
                     /locus_tag="CNC02320"
                     /product="heat shock protein 70, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530145|gb|CF675986.1,gi|41530161|gb|CF676002.1,
                     gi|41531085|gb|CF676926.1,gi|41531092|gb|CF676933.1,
                     gi|41531353|gb|CF677194.1,gi|41531360|gb|CF677201.1,
                     gi|41531691|gb|CF677532.1,gi|41534314|gb|CF680155.1,
                     gi|41534319|gb|CF680160.1,gi|41534427|gb|CF680268.1,
                     gi|41534429|gb|CF680270.1,gi|41535445|gb|CF681286.1,
                     gi|41535461|gb|CF681302.1,gi|41536732|gb|CF682573.1,
                     gi|41536735|gb|CF682576.1,gi|41537981|gb|CF683822.1,
                     gi|41537988|gb|CF683829.1,gi|41540117|gb|CF685958.1,
                     gi|41540896|gb|CF686737.1,gi|41540903|gb|CF686744.1,
                     gi|41541466|gb|CF687307.1,gi|41541473|gb|CF687314.1,
                     gi|41542768|gb|CF688609.1,gi|41542771|gb|CF688612.1,
                     gi|41542952|gb|CF688793.1,gi|41542960|gb|CF688801.1,
                     gi|41544913|gb|CF690754.1,gi|41544925|gb|CF690766.1,
                     gi|41545666|gb|CF691507.1,gi|41546122|gb|CF691963.1,
                     gi|41547043|gb|CF692884.1,gi|41547053|gb|CF692894.1,
                     gi|41547536|gb|CF693377.1,gi|41547550|gb|CF693391.1,
                     gi|41547880|gb|CF693721.1,gi|41547882|gb|CF693723.1,
                     gi|41547911|gb|CF693752.1,gi|41547919|gb|CF693760.1,
                     gi|415"
                     /transcript_id="XM_569509.1"
                     /db_xref="GI:58264705"
                     /db_xref="GeneID:3256505"
     CDS             join(663989..664015,664070..664124,664186..664439,
                     664493..664904,664964..665760,665814..666080,
                     666136..666246)
                     /locus_tag="CNC02320"
                     /codon_start=1
                     /product="heat shock protein 70"
                     /protein_id="XP_569509.1"
                     /db_xref="GI:58264706"
                     /db_xref="GeneID:3256505"
                     /translation="MVKAVGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFND
                     SERLIGDAAKNQVAMNPYNTVFDAKRLIGRKFEDAEVQADMKHWPFKVIDRAGKPAIQ
                     VEYRGEEKVFTPEEISSMVLIKMKETAEAYLGGTVSKAVVTVPAYFNDSQRQATKDAG
                     AIAGLDVLRIINEPTAAAIAYGLDKKSEGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK
                     ATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLSSNARALRRLRTACERAKRTLSSAA
                     QTSIEIDSLFDGIDFYTSITRARFEELCQDLFRSTMDPVEKVLRDSKIDKSSVNEIVL
                     VGGSTRIPKIQKLVSDMFSGREPNRSINPDEAVAYGAAVQAAILTGDTSEATQDLLLL
                     DVAPLSMGIETAGGIMTPLIKRNTTVPTKKSEVFSTYSDNQPGVLIQVFEGERAKTKD
                     CNLLGKFDLSGIPPAPRGVPQIEVSFDVDANGILNVNAADKSTGKSSKITITNDKGRL
                     SKEEIERMLAEAEKFKAEDEAAAATVQAKNGLESYSYSLKTTLSDNQDKFDAADHETL
                     SKKVDEVISSLDTMQSASKEEFESLQKELEAVANPIMTKFYGAQGGAPGGAPGGFPGA
                     GGAPAQEEGPSVEEVD"
     gene            <666537..668311
                     /locus_tag="CNC02330"
                     /db_xref="GeneID:3256228"
     mRNA            join(<666537..666566,666615..667070,667120..667189,
                     667256..667461,667517..667583,667723..668311)
                     /locus_tag="CNC02330"
                     /product="expressed protein"
                     /transcript_id="XM_569512.1"
                     /db_xref="GI:58264711"
                     /db_xref="GeneID:3256228"
     CDS             join(666537..666566,666615..667070,667120..667189,
                     667256..667461,667517..667583,667723..668294)
                     /locus_tag="CNC02330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569512.1"
                     /db_xref="GI:58264712"
                     /db_xref="GeneID:3256228"
                     /translation="MFTNLSPEDKDAFFSLLDEYFASRPHNLPSPPAIDSSSHPARSN
                     AALSPSPSAGYASPSYSSARHPMPPPERTEQPDSAQRFISSSIKYGTAGTKSSMNAVS
                     KNKDAMDLLGKVGMSSMVGRANERMNKPAEAGVKEEAGRKAAPPPIAAKKGGVSGLVS
                     SRSFGHVDTSNKMSAFTSMWRDPQKSKPPAVEQTISPTLSYSNTALPPPIRRDGSGSY
                     QSSSPNPASSAAAEVGPELANGDEGQAQALYDYTGNDKGDLSVQANQVVNIIEKTSSD
                     YSDRSNLPSCRCCHRHQFTLLVSPRSGPAIRGVYCKLYAMLLKLSSLPGLMTPFILID
                     IPSRKKGTSLPLLLHQAQNRHISSSPMMMRIWQTSCRSPTLSPLRSLRSSQVKLPQVP
                     PDLHVLHNPYINFTSCDPSTGCQVSNGNRISSMRFQLAMTWKASLMRKSSPQQPTTMM
                     NGLVLTCRVSLIPVED"
     gene            <668793..673127
                     /locus_tag="CNC02340"
                     /db_xref="GeneID:3256474"
     mRNA            join(<668793..669002,669049..669480,669537..670461,
                     670511..671188,671247..671396,671447..672267,
                     672320..672436,672493..673127)
                     /locus_tag="CNC02340"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546016|gb|CF691857.1,gi|41546021|gb|CF691862.1,
                     gi|41567596|gb|CF713437.1,gi|41567606|gb|CF713447.1"
                     /transcript_id="XM_569975.1"
                     /db_xref="GI:58265637"
                     /db_xref="GeneID:3256474"
     CDS             join(668793..669002,669049..669480,669537..670461,
                     670511..671188,671247..671396,671447..672267,
                     672320..672436,672493..673047)
                     /locus_tag="CNC02340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569975.1"
                     /db_xref="GI:58265638"
                     /db_xref="GeneID:3256474"
                     /translation="MAGPPVRQRYNAKARGSVAGGSSHKKRKNLSKERTEEDAQDNET
                     DQHAAVFEDPTAGMSSKKRKRFESYMHSTQAKKLKSEQRLETFKLLQSLAPSSSTSAS
                     LLSASTLGQNPMNPTSAKERQEKREDRLVRRGIDRLSRRFGEGDDHSGESENDASSRK
                     GKGKAKEVTVEVIRDGQAEETEEVKTTVIPSKGERKAEIKAAEKGKGKGKLPKKAGWN
                     PNLLSTQAPNSSSSEFDSSDSGNDNSDDEEPKKAAEPSPRLEVGPEPVSETIKPPVSA
                     PSAPTVLGGALKKSTDGQVVKPRVEVRRKKGFVYGMFGRRGIEHREDSDDEDEDDEDE
                     DDADDDDEEEEDDDEMDSDEEASDEEDGEDSEEEGSEEDEEEEVAPPKKKRSLGFKDW
                     ALKQMGQTSQPSAPDLLAAEPTTTLYKSQPLLAARVGEYIGPLGQELVIPTTSLLDQS
                     KDSDKSKVRPNISRRPSVSETRMGLPILAEEQSIIESILMHPVVIICGETGSGKTTQV
                     PQMLYEAGFGYKGSDNPGMVAVTQPRRVAAVSLAERVRSELNLPPNSSLVAHQIRYSS
                     TTSPDTAIKFMTDGVLLRELASDFLLSRYSVVVVDEAHERGVNTDVLVGVLSRVAKLR
                     EKLWREGKQDVKPLRIVVMSATLRVSDFAENPTLFSKPPPVIHIAARQHPVTVHFSRR
                     TVSDYVTEAYKKVSKIHARLPPGGILVFMTGQGEIQALCRKLEKKYGAKKSSQKTQVI
                     NDNSLPPEEREAEEVEFGKDEDLAADVDDGAAESDPEALDTDDEIEGIPGLEFDEPAD
                     APLHVLPLYSLLPNDQQMLVFKPPPEGHRLVIISTNVAETSLTIPGIRYVVDSGRAKE
                     RHYDPINGVQSFQVSWISKASASQRAGRAGRTGPGHCYRLYSSALFEDHFEQFSKPEI
                     LRMPIEGVVLQMKSMNIDAVINFPFPTPPDRAALRRAENLLTNLGALSLPTLTKMING
                     VQHKGSGGGQITDLGKAMAGFPVSPRFAKMLAIGTQHDCMSYIIAIVAGMSVGDPFIH
                     EQSLEVDEEEDKVAEISHIKSEDIREKEQRKETRRRFFKAQQQFLALGQGTSDMFKLL
                     AAIGAYEFDPSPAFCAKTFIRLKAMQEIHQLRAQISSIAKVPLSKLLPPSDTQLKVLR
                     QILAAGFIDQVAVREDLVLKKGVSYESTRGVAYRAVGLGSEPVFIHPSSALFHCAPPD
                     FVVFSEIVRTSKPWMKGVTKINPIWLPSLGKGLCTFSKPMEMPTKGFARKSGLKDDER
                     EVFVTPHFKDLGIDLPVMKKKQRREGTRWILVD"
     repeat_region   669867..669940
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     STS             669920..670123
                     /locus_tag="CNC02340"
                     /standard_name="AG27"
                     /db_xref="UniSTS:470882"
     misc_feature    669966..670026
                     /locus_tag="CNC02340"
                     /note="GA-rich"
     gene            complement(<673131..>675000)
                     /locus_tag="CNC02350"
                     /db_xref="GeneID:3256750"
     mRNA            complement(join(<673131..673292,673333..673398,
                     673456..673848,673902..674026,674117..674238,
                     674289..674443,674494..>675000))
                     /locus_tag="CNC02350"
                     /product="MAP kinase kinase, putative"
                     /transcript_id="XM_569514.1"
                     /db_xref="GI:58264715"
                     /db_xref="GeneID:3256750"
     CDS             complement(join(673131..673292,673333..673398,
                     673456..673848,673902..674026,674117..674238,
                     674289..674443,674494..675000))
                     /locus_tag="CNC02350"
                     /codon_start=1
                     /product="MAP kinase kinase"
                     /protein_id="XP_569514.1"
                     /db_xref="GI:58264716"
                     /db_xref="GeneID:3256750"
                     /translation="MHPQNSSTPSTNSPSTFSLPKSSISRKKPPGLDISKSILRPTRT
                     APVLPANGSSPSNFVSEADRLRDDIANLQLSSRSTGSNHSPEALDSPRAFQSDSSVAS
                     GLAKKEKSRDGKERGDKEKRKKKHKDKDGEDLVKDEDLEILHDLGAGNGGTVTKVWNK
                     KRKCVMARKLILVDAKPSIRKQILRELQIMNDCDSPYIVGYYGCFPVDVHVGIVMEFM
                     DAGSLDYIYRHHGAIDIDIVGKVAQAVLEGLIYLYDKHRIIHRDIKPSNVLANTRGEI
                     KICDFGVSGELINSIANTFVGTSTYMSPERIQGAPYTIKSDIWSLGISLIELAVGRFP
                     FSDSPDSEELSPSVSDFDPDPTLPRSVRRPKIESNSRHNGVSQSGGPHAMSILDLLQH
                     IVNEPAPRLASRRRRFPQEAVAFVEGCLIKDPDQRRSPKELLSSSWITNLKTTKEDLQ
                     TWAQSMIIFRLRIFFNVDTLLCISLITISHIPVHHMPCVYLLLMTISSADEEMMHVWL
                     M"
     misc_feature    674603..674684
                     /note="CT-rich"
     gene            complement(676391..678874)
                     /locus_tag="CNC02360"
                     /db_xref="GeneID:3256348"
     mRNA            complement(join(676391..676435,676525..678542,
                     678596..678730,678778..678874))
                     /locus_tag="CNC02360"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532061|gb|CF677902.1,gi|41532066|gb|CF677907.1,
                     gi|41574926|gb|CF720767.1,gi|41574932|gb|CF720773.1"
                     /transcript_id="XM_569516.1"
                     /db_xref="GI:58264719"
                     /db_xref="GeneID:3256348"
     CDS             complement(join(676743..678542,678596..678730,
                     678778..678873))
                     /locus_tag="CNC02360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569516.1"
                     /db_xref="GI:58264720"
                     /db_xref="GeneID:3256348"
                     /translation="MNNQQLVQQHYDIALKFMQAANYLDAWKNFDKAINFGGKNPVLL
                     DCKAAAMSKLPEWRNHALEVTKDMIAKWPKDFRGYYRQASVLYAMKAYDHAFKVISKA
                     VDIGPTRSQDERKYKAIQQLRATIIIQKTEADRLRAANDETEAQRQAIARQAAKKARI
                     NYTHLLSRDILLIIAEQGMADHPGFIFRMAGVCKSWRETLLSQPSLWDTIVLGRKRKD
                     QKVTLFIERSRGRIKEVKIACHLDQFLAGKIGLSLAPYMPNVERLTVHAPYRINLNLL
                     TQWRGLLRNVEYLSLSHDDGGATLRKNFTHDLLPPGPSRLRHLAIANFQTGPESDSTY
                     TPLKQVETVSIRSTDLFLPLDSAEETLLSTFPAATSIELINNRYFDSSRGALPIVAEL
                     PNLRSYTNNKASSNVFKTIRVPSLQDLSVDSLRASSLKTWLSAPGLATCLTTLRSLSI
                     SCTSFTDTDVLSALAFLPGLQFLNVSACPLTNTFLEGLVRRPADSDQENLCPKLTALS
                     ISINDNITGGPLTRFVRSRVASSAGLASSSSDLDLNTQAQGKSTQTELKKNMSSSFRP
                     SARSAFGRPTKPPSVRTDSDQSISSTLPQSQTCAPSQPSSSSSSTLPEITWLNLFHCG
                     GIDPSAISYIRQYVKFVGHSLAAHGGDRNEGKGRWKWNVEWKDVVEGRAGLD"
     gene            <679108..681652
                     /locus_tag="CNC02370"
                     /db_xref="GeneID:3256137"
     mRNA            join(<679108..679110,679154..679371,679415..679712,
                     679761..680702,680756..681007,681087..681216,
                     681306..681652)
                     /locus_tag="CNC02370"
                     /product="ER-associated protein catabolism-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536898|gb|CF682739.1,gi|41539124|gb|CF684965.1,
                     gi|41539140|gb|CF684981.1"
                     /transcript_id="XM_569518.1"
                     /db_xref="GI:58264723"
                     /db_xref="GeneID:3256137"
     CDS             join(679108..679110,679154..679371,679415..679712,
                     679761..680702,680756..681007,681087..681216,
                     681306..681544)
                     /locus_tag="CNC02370"
                     /codon_start=1
                     /product="ER-associated protein catabolism-related
                     protein, putative"
                     /protein_id="XP_569518.1"
                     /db_xref="GI:58264724"
                     /db_xref="GeneID:3256137"
                     /translation="MLLRIRSPAGTARLTVQPETTGEDFAEAILNTIPAADPQPDPAT
                     LALSNQPGAAGESVPFHALSGRTVGDMGFSHGDLLFLSYKPRAADPDSHPAMQATAPH
                     PQPAQPDPSHPKTHTDPPMPNTIPLRDLSSVQEPEIDQYWEKQTGKIERKRDPAFCRH
                     GDKAMCDYCMPLEPYDPKFQSEHQIKHLSYHAYLRKLLSSRPPTASSATDLPPLSPTS
                     LSVITPCPTGAHPSFPDGICSTCQPSAVTLQSQPFRMVDHIEFASPSIIEGLLSAWRR
                     TGTQRIAFLIGREDKYEKVPMGIKVIVEAVWEPKQEGELDGLTVETPWSDESRVQEIA
                     KWCDKGLSVVGMIYTDLTPSPDDITKTLYKRHAQSYTASSLEMLLSAAYQLSHPLSTR
                     MSPTGHYSSRFVTCCLTGDKDGGVDILAWQASEHAEAMVKAGIVEASVDPAVVRVRKP
                     GEGEYVPEVFYSYKNEYGLQVKMPAKPTFPVEYLYVNITHGFPLAPSPLFLSNAFPTE
                     NRPGLHDQSMQVVITQLAAILKTSDAEIGDAGTWPGRIKKDVEKWLSDWHLVTFLCMQ
                     GLFSLKEQQILCRAATAHAHPNDTHALEELFASGGWQTLLTIVDSEASANARSNPPPT
                     SSFNNLGIDSPAFAGPSTESSAPPSGPDSVGAGAGAGAGGGRERVCPHCTFVNEHGGS
                     DCEICGLPLDG"
     gene            complement(681773..>683724)
                     /locus_tag="CNC02380"
                     /db_xref="GeneID:3256476"
     mRNA            complement(join(681773..682885,682939..683076,
                     683150..683236,683289..683418,683470..683538,
                     683585..683668,683709..>683724))
                     /locus_tag="CNC02380"
                     /product="nuclear matrix protein NMP200, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532724|gb|CF678565.1,gi|41532733|gb|CF678574.1,
                     gi|41536404|gb|CF682245.1,gi|41536413|gb|CF682254.1,
                     gi|41536664|gb|CF682505.1,gi|41536676|gb|CF682517.1,
                     gi|41538186|gb|CF684027.1,gi|41552647|gb|CF698488.1,
                     gi|41552652|gb|CF698493.1,gi|41552976|gb|CF698817.1,
                     gi|41552982|gb|CF698823.1,gi|41555191|gb|CF701032.1,
                     gi|41556390|gb|CF702231.1,gi|41556394|gb|CF702235.1,
                     gi|41556419|gb|CF702260.1,gi|41556428|gb|CF702269.1,
                     gi|41558683|gb|CF704524.1,gi|41558692|gb|CF704533.1,
                     gi|41561974|gb|CF707815.1,gi|41564815|gb|CF710656.1,
                     gi|41564819|gb|CF710660.1,gi|41567536|gb|CF713377.1,
                     gi|41567841|gb|CF713682.1,gi|41567846|gb|CF713687.1,
                     gi|41570907|gb|CF716748.1,gi|41570916|gb|CF716757.1,
                     gi|41573084|gb|CF718925.1,gi|41573092|gb|CF718933.1,
                     gi|41573174|gb|CF719015.1,gi|41573183|gb|CF719024.1"
                     /transcript_id="XM_569520.1"
                     /db_xref="GI:58264727"
                     /db_xref="GeneID:3256476"
     CDS             complement(join(681886..682885,682939..683076,
                     683150..683236,683289..683418,683470..683538,
                     683585..683668,683709..683724))
                     /locus_tag="CNC02380"
                     /codon_start=1
                     /product="nuclear matrix protein NMP200"
                     /protein_id="XP_569520.1"
                     /db_xref="GI:58264728"
                     /db_xref="GeneID:3256476"
                     /translation="MFFCAISGSPPTVPVVSKTSGAVYEKALIERYIEENGTDPISGE
                     ALTKDDLVDVKAKPSTIPPRPANQTSIPALLTALQSEYDSIMLESLEIKKAFQSSRQE
                     LANALYREDAATRVIARLMKERDEARQALSSIQSTIGFQPPAAAEEPAADVEMAQEGA
                     LPADVEAKVMETNQALSSVRKKRKPAPGYKKVDDIKSYTQINHVPSLHATKPAGITAL
                     DLAQDGNTVVTGGADKAVQVFDLEASKVLGTLKGHTKAVTHVAFREHEGEPRLAISAS
                     ADKTVRVWGEDDGKWGARATLSGHKGEINGLAVHPSGSYVAAGSADSTWSLYDLSTAK
                     EVTKYTAIPGIDGSFAYTSFAVHPDGVLHGGGTKDGAVRVWDARQSNSLAATLSSHAK
                     DLSTLSFSENGYYLATSSISGPPTVKIFDLRKLDILSSWTLPEENTIREVKFDPSAQF
                     LSVVGTDARVYANKTWQELVTFEENAGDLVGARFGKLGSEIVLAGMDRTLRVLGKKE"
     gene            683894..687781
                     /locus_tag="CNC02390"
                     /db_xref="GeneID:3256412"
     mRNA            join(683894..683949,683998..684046,684097..685248,
                     685318..685763,685829..685931,686015..686307,
                     686381..686890,686978..687313,687369..687555,
                     687621..687781)
                     /locus_tag="CNC02390"
                     /product="pre-mRNA splicing factor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41550415|gb|CF696256.1,gi|41550422|gb|CF696263.1,
                     gi|41563600|gb|CF709441.1,gi|41563607|gb|CF709448.1"
                     /transcript_id="XM_569522.1"
                     /db_xref="GI:58264731"
                     /db_xref="GeneID:3256412"
     CDS             join(683911..683949,683998..684046,684097..685248,
                     685318..685763,685829..685931,686015..686307,
                     686381..686890,686978..687313,687369..687555,
                     687621..687733)
                     /locus_tag="CNC02390"
                     /codon_start=1
                     /product="pre-mRNA splicing factor"
                     /protein_id="XP_569522.1"
                     /db_xref="GI:58264732"
                     /db_xref="GeneID:3256412"
                     /translation="MDLKNFISDNVVRILGSSDSATVDYVQSLAISSKTPGDLYNSLL
                     STGMASTPETQAFAAQVHSLVPRKNKTKAPKADKAASGQRFTLLMDEDAESSGSRKEK
                     KKKKEKEKEKEGSRERDVVGVKKARHSRKRDTEGNWDSDEEDKEIKRLRTRSPLPDGD
                     DQAELPLEPEETEEERLERERLEDLRQRDEFAERMKEKDRDRTKRIVEDRTSKALGGV
                     DASRRANLMDDPAAREAAIADLRNRSRQEYLSKRELQQLDLLKMEVEDEKILFRNQKL
                     SRKEERELERKKELIKLMEERKKIDDGTNGYMLPDDYITEQGRLDQKKKKDALYKRYE
                     ESKPVEGQFVTDVDQWEAAQQERTDLTTGALDKEILVEDYDYVFDESQEIKFLKEGKM
                     DGTLTAEAQALLDQVDKLEKNAQSIQETRNSLPIYEFRDELLEAIAEHQVLVVVAETG
                     SGKTTQLPQYLYEAGYCKNGMKVGCTQPRRVAAMSVAARVAEEMGVRLGQEVGYSIRF
                     EDMTSDKTALKYMTDGMLLREFLTDPELSTYSALVIDEAHERTLSTDILFGLVKDIAR
                     FRPDLRLLISSATLNAQKFADFFDQAPIFDVPGRRFPVDMFYTQQPEANYMHAAVTTI
                     LQIHTTQPKGDILLFLTGQDEIEAAEESLKETMYALGDKVPELIIAPIYANLPSEMQS
                     KIFEPTPEGARKVVLATNIAETSITIDGVVYVIDPGFVKQNNYNPKTGMSSLVVEPIS
                     RASAQQRAGRAGRVGPGKAFRLYTKWAFKNELLQDTIPEIQRTNLSMVVLMLKSLGIN
                     DVLNFDFLDKPPADTIIRSFELLYALGALNHKGELTRLGRRMAEFPVDPMLSKAIINS
                     ENYKCTHEVLTIISMLQESGSLLYRPKDKRVHADKAHKNFIKSGGDHFTLLNIFEQWA
                     ESNYSQQFCYENFVQFKSLCRVRDIRDQLAQLCDRVEVVIESTPNDVVPVQKAITAGY
                     FYNTARIDRGGGYRTTKNNHSVYLHPSSCLIGMQPPPRFILYYELVLTSKEYMRQCMP
                     IEGSWLSELAPHYFNKSEIDQLMGSASKVKMPKRIEPPKVGPVNS"
     repeat_region   684305..684346
                     /rpt_type=tandem
                     /rpt_unit_seq="ggagaa"
                     /satellite="microsatellite"
     gene            complement(687887..688390)
                     /locus_tag="CNC02400"
                     /db_xref="GeneID:3256330"
     mRNA            complement(join(687887..688045,688105..688189,
                     688254..688390))
                     /locus_tag="CNC02400"
                     /product="expressed protein"
                     /transcript_id="XM_569524.1"
                     /db_xref="GI:58264735"
                     /db_xref="GeneID:3256330"
     CDS             complement(join(687994..688045,688105..688189,
                     688254..688326))
                     /locus_tag="CNC02400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569524.1"
                     /db_xref="GI:58264736"
                     /db_xref="GeneID:3256330"
                     /translation="MAEQTQGQPGGTGIAGSTGQQDYLDKGVDTALNKAGHGQSHSTT
                     EKISDGIRNVFKKATGKDVPIKDKQ"
     gene            690025..691506
                     /locus_tag="CNC02410"
                     /db_xref="GeneID:3256813"
     mRNA            join(690025..690331,690386..690463,690514..690804,
                     690859..691158,691228..691506)
                     /locus_tag="CNC02410"
                     /product="C-4 methyl sterol oxidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539638|gb|CF685479.1,gi|41539642|gb|CF685483.1,
                     gi|41539666|gb|CF685507.1,gi|41548944|gb|CF694785.1,
                     gi|41549154|gb|CF694995.1,gi|41549160|gb|CF695001.1,
                     gi|41556823|gb|CF702664.1,gi|41564927|gb|CF710768.1,
                     gi|41564935|gb|CF710776.1,gi|41574900|gb|CF720741.1,
                     gi|41574911|gb|CF720752.1"
                     /transcript_id="XM_569526.1"
                     /db_xref="GI:58264739"
                     /db_xref="GeneID:3256813"
     CDS             join(690116..690331,690386..690463,690514..690804,
                     690859..691158,691228..691374)
                     /locus_tag="CNC02410"
                     /codon_start=1
                     /product="C-4 methyl sterol oxidase"
                     /protein_id="XP_569526.1"
                     /db_xref="GI:58264740"
                     /db_xref="GeneID:3256813"
                     /translation="MAAAAAFDLLDKYIPGASDSLTIVNATTAQNTLYPGVDFAALNW
                     LERLWASYYVWVGNPIIATGLMSFLLHEIVYFGRCIPWLIIDAMPYFQKWKLQPNKHV
                     SRAQILKCTKVVLLTHFTCEAPLILAFHPICCLFGMKTYEIPFSSIGLMAAQIAFFFV
                     FEDTFHYWAHRALHYGPLYKHIHKLHHEFSAPIGIAAEYAHPLEVLILAQGTISGPFL
                     YAVFRNDLHILTVYVWITLRLWQAVDAHSGYDFPWSLRHFLPFWAGADHHDFHHATFT
                     SCFSTSFRWWDYYFGTDVKYHAYKARVAAAGVKERAAVEKREMEKLEKEGIIEERAAA
                     SHSKRGKKE"
     gene            complement(<692091..>695002)
                     /locus_tag="CNC02420"
                     /db_xref="GeneID:3256219"
     mRNA            complement(join(<692091..692138,692203..693645,
                     693701..>695002))
                     /locus_tag="CNC02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_569528.1"
                     /db_xref="GI:58264743"
                     /db_xref="GeneID:3256219"
     CDS             complement(join(692091..692138,692203..693645,
                     693701..695002))
                     /locus_tag="CNC02420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569528.1"
                     /db_xref="GI:58264744"
                     /db_xref="GeneID:3256219"
                     /translation="MWVFTTYFAGGGKRTTTDFLAHSMEHPPLPLDVLSNVAALIPPP
                     YYPWPHPAAQTTATTPAPDVIRNLDPAPAPLQTDLQAISAITRASSRLLEAARPWLWE
                     DVDVKTGRGWLAIVNALTEEVIEQDVESLTPIAGSAPASDGTGSGRATPVPPQEPPRQ
                     PGTIPQATHAYTSSSSSALPFPIASGPGHVASGSSAYPQMSTSPPQPTHIHQLLTPPT
                     SRNTSPRARTSPALPPILTNPQPRAEQSPSPGPPAPPGPSAPPGPPGPSTGPGPSNGV
                     SPSAVARTKLRGRSRSPRRSVGFDTEGIQAVLERSRSASSHRSNGPSGSVRGAFMHRR
                     TSLSRSRTWHDGPRDEEEDEDEDEVMPLTGPPARYKAGVITPRLLPAERETANADLLP
                     PPGPYIRHLNFTNFRTIGSRRSQEEAVRGRFVTAGRLEGVIKNAPNLVSLCMTEYVDS
                     SLSYPVIEEIFFRGSRRPRYRSPSLTRTRSLSIGQPPSVTSTAHDQLDPPRPEYVPYE
                     DETEDQKWNRRAMFTPLEALDLTGCVSQAFTEAMQKFYNTWLAPDDETEDEEEERGRG
                     RWRGRGKRAHSPDATEDDSDTHSHSVSRDRQSHRRPPRFRAMRRLCLRMCTSLDSQII
                     ASLVWSFPCLTHLDLSNTRVPDELLNYLTDYCPRAFRLTSLSLARCPRLNSYAVVDFL
                     CRSPAVRDLVDLNLYVNPTQGKAIESDALMRLITEAPCMRSGRLRYLDLSSAKFTPAH
                     LAADVFPPQASLISLGLSHIPTLGLTPIADFLLSVAFNVEILTLVGTATTSSLDPSRS
                     PLQITLELHSRLINPLTTIPFSLSSLYLSPGSGTPANLNPGPTRLRVIELIGPVRRSI
                     APDGNGEWKVVKSKGSRGWYVDQSAGWRRVQPPLSPSPLSPASESGAMDEGDTEAQWE
                     FEESEVTLGGIRGKWK"
     gene            695146..698051
                     /locus_tag="CNC02430"
                     /db_xref="GeneID:3256652"
     mRNA            join(695146..695361,695413..695807,695871..695904,
                     695962..696087,696144..696299,696383..697704,
                     697811..697897,697952..698051)
                     /locus_tag="CNC02430"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41551756|gb|CF697597.1,gi|41552552|gb|CF698393.1,
                     gi|41555363|gb|CF701204.1,gi|41555365|gb|CF701206.1,
                     gi|41564364|gb|CF710205.1"
                     /transcript_id="XM_569530.1"
                     /db_xref="GI:58264747"
                     /db_xref="GeneID:3256652"
     CDS             join(695158..695361,695413..695807,695871..695904,
                     695962..696087,696144..696299,696383..697704,
                     697811..697897,697952..697985)
                     /locus_tag="CNC02430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569530.1"
                     /db_xref="GI:58264748"
                     /db_xref="GeneID:3256652"
                     /translation="MPLLAQLGNRASLLLHRLVYAFPAAPPPSHSPTPASDASPNFDP
                     APAPEPTPALSFVGSGYGVTLILMGILLNRIHHTVRRPRQPPPDDHPRPINPSYFYRL
                     RASVSDFFTSPDAARYIRLPGIVCLLRAWILFTVLLIQVIGLWPEFQHDRTTAMWRRA
                     TSRLGNWAGEMEMNDICWQVFVSVCVGLLCSGIANGLDTIRRRDVAASFNLTGYSFMM
                     HLYSSPLTHQHTERAVAHGRPDAHALFQLWLSLTELTWLQILELSLTLRDNVLLPTSV
                     CGIVGVVHFAYVLFSSPLRFPSFTFLTHMLALFLSVVILSTVILRAITFIFSYGYIPS
                     LTSLLPHEGVIPDRRDDFGVTLLKIGTACIEATSLSGLRNELANIDKPEAPWVEITSD
                     GSEFHHGLLQHSPTPGFCTEISNIKVSEAEDSERLNPQWREVRAFARALFTAILSALI
                     RFIMSTRVGRSMFRLGAKIWRARWWYGPRSWKFWRRDAWREPPENIRARERARLRARA
                     SAIIEQISGSGESSHQLAHTANLHRTGYTRGTSTSVSLRDHGGSTATIQRNRQPRREM
                     WTYADYLLKDVDGEIEDDEEWIQEMSDDSDSEQMSIADANEEEEEEEDLFDEGMDVEE
                     EEMKQRGMLYGDLVSQTTESDGRQSSDDFQPVLLAHLTSRTAAPLTRQRYTSLMTLYS
                     SDSLHTPALPSLVSMHNENVLGLRDVMHERRQAMKGYEEEDEETKRTCVVCMVSMRDT
                     ILWPCRCLAVCNDCRESLAARLPAQNHMCPCCRKKVEGYSRIYIP"
     misc_feature    695196..695315
                     /locus_tag="CNC02430"
                     /note="C-rich"
     repeat_region   697286..697308
                     /rpt_type=tandem
                     /rpt_unit_seq="gaa"
                     /satellite="microsatellite"
     STS             697512..697814
                     /locus_tag="CNC02430"
                     /standard_name="AAG30"
                     /db_xref="UniSTS:470774"
     gene            complement(698068..700018)
                     /locus_tag="CNC02440"
                     /db_xref="GeneID:3256688"
     mRNA            complement(join(698068..698374,698425..698493,
                     698541..698800,698850..699045,699095..699212,
                     699266..699532,699585..699666,699748..699799,
                     699854..699866,699931..700018))
                     /locus_tag="CNC02440"
                     /product="cytokinesis-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531466|gb|CF677307.1,gi|41531477|gb|CF677318.1,
                     gi|41533085|gb|CF678926.1,gi|41533096|gb|CF678937.1,
                     gi|41542615|gb|CF688456.1,gi|41542628|gb|CF688469.1,
                     gi|41543131|gb|CF688972.1,gi|41543142|gb|CF688983.1,
                     gi|41543861|gb|CF689702.1,gi|41546846|gb|CF692687.1,
                     gi|41546857|gb|CF692698.1,gi|41548947|gb|CF694788.1,
                     gi|41548953|gb|CF694794.1,gi|41549521|gb|CF695362.1,
                     gi|41549533|gb|CF695374.1,gi|41553367|gb|CF699208.1,
                     gi|41553372|gb|CF699213.1,gi|41554118|gb|CF699959.1,
                     gi|41554129|gb|CF699970.1,gi|41556111|gb|CF701952.1,
                     gi|41556122|gb|CF701963.1,gi|41558547|gb|CF704388.1,
                     gi|41558555|gb|CF704396.1,gi|41575223|gb|CF721064.1"
                     /transcript_id="XM_569532.1"
                     /db_xref="GI:58264751"
                     /db_xref="GeneID:3256688"
     CDS             complement(join(698315..698374,698425..698493,
                     698541..698800,698850..699045,699095..699212,
                     699266..699532,699585..699666,699748..699799,
                     699854..699866,699931..699956))
                     /locus_tag="CNC02440"
                     /codon_start=1
                     /product="cytokinesis-related protein"
                     /protein_id="XP_569532.1"
                     /db_xref="GI:58264752"
                     /db_xref="GeneID:3256688"
                     /translation="MSDGIGIANLPNQRHKITSQRGAHFTIMVVGQSGLGKTTLINTL
                     FATEICSPRNYRQRFAKQLDKTTEVEILKADLEERGFNIKLTVIDTPGFGDYVNNRDS
                     WGPIVDFIDDQHESYMRQEQQPFRKEKQDLRIHACLYFIKPTGTTLKPLDVEIMKKLG
                     TRVNLIPVIAKADTMTPEDLHNFKTIVRETVIAQNISVYTPPVDLDDEAAAEHARAMQ
                     AVMPFSIIGSTQDVTTPDGRVVKGREYLWGVAEVENEDHCDFKKLRSLLIRTYMLDLI
                     TSTEEKHYEAYRLAQMETRKFGEPKVKKLDNPKYREEEETLRKRFTEQVKLEEARFRQ
                     WEQHLIAERDRLNKDLEQAHSAIKALEAELDQVAAYHRQGGTVGRR"
     gene            complement(701544..703322)
                     /locus_tag="CNC02450"
                     /db_xref="GeneID:3256154"
     mRNA            complement(join(701544..701771,701830..702155,
                     702221..702317,702364..702448,702514..702626,
                     702679..702853,702906..702971,703036..703105,
                     703166..703322))
                     /locus_tag="CNC02450"
                     /product="water channel, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41548104|gb|CF693945.1,gi|41559312|gb|CF705153.1,
                     gi|41559319|gb|CF705160.1,gi|41575675|gb|CF721516.1"
                     /transcript_id="XM_569534.1"
                     /db_xref="GI:58264755"
                     /db_xref="GeneID:3256154"
     CDS             complement(join(701670..701771,701830..702155,
                     702221..702317,702364..702448,702514..702626,
                     702679..702853,702906..702971,703036..703105,
                     703166..703247))
                     /locus_tag="CNC02450"
                     /codon_start=1
                     /product="water channel"
                     /protein_id="XP_569534.1"
                     /db_xref="GI:58264756"
                     /db_xref="GeneID:3256154"
                     /translation="MPDLVVTTQELRPSSPVYGHARTIIKNNFVAMAGEYVGTTLFML
                     CCLGGTHVALLPEKSVTGDLSQPLNTSSLFYISLSIGLSLTVNVWIFFRVSGGLFNPA
                     VSLGMVLAGCLPPMKGALLTVAQVLGGITGAAIINVLLPGELNAGTTLGGGASIAQGL
                     FIEAILTALLMLTVFFTAAEKNEATFLSPLAIGMALFIAEMVGVPYSGGALNPVRSLG
                     PAVVTHNFPGYHWIYWVGPALGSVLATCFYSLLKYLEYESVPGPGEAPHVPPFWRLPA
                     RGYLSTLSHPFAKRASTGTYSHEDDPEKGLRSGKDSQANTDNPTRVNRRGSGDAEIQS
                     PVEDTTMANARLDRIEMLLTQLMQVRTSEGTQKSPAV"
     misc_feature    704444..704492
                     /note="A-rich"
     gene            704731..705249
                     /locus_tag="CNC02460"
                     /db_xref="GeneID:3256429"
     mRNA            join(704731..704855,704925..705031,705104..705249)
                     /locus_tag="CNC02460"
                     /product="expressed protein"
                     /transcript_id="XM_569536.1"
                     /db_xref="GI:58264759"
                     /db_xref="GeneID:3256429"
     CDS             join(704756..704855,704925..705031,705104..705142)
                     /locus_tag="CNC02460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569536.1"
                     /db_xref="GI:58264760"
                     /db_xref="GeneID:3256429"
                     /translation="MDVNENIHATEQPDSAPSVNTRVQQVGTQQDTLDKGVAQVIKEF
                     ISPSQAQDPSVVEKASDAVRSGFKQSTGKDFPVQDKQ"
     gene            complement(705805..707581)
                     /locus_tag="CNC02470"
                     /db_xref="GeneID:3256120"
     mRNA            complement(join(705805..706609,706662..706811,
                     706862..707104,707159..707459,707530..707581))
                     /locus_tag="CNC02470"
                     /product="phosphatase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533279|gb|CF679120.1,gi|41533283|gb|CF679124.1,
                     gi|41533634|gb|CF679475.1,gi|41543286|gb|CF689127.1,
                     gi|41543295|gb|CF689136.1,gi|41553271|gb|CF699112.1,
                     gi|41553282|gb|CF699123.1,gi|41561957|gb|CF707798.1,
                     gi|41561966|gb|CF707807.1,gi|41567450|gb|CF713291.1,
                     gi|41567466|gb|CF713307.1,gi|41575302|gb|CF721143.1,
                     gi|41575311|gb|CF721152.1"
                     /transcript_id="XM_569538.1"
                     /db_xref="GI:58264763"
                     /db_xref="GeneID:3256120"
     CDS             complement(join(706047..706609,706662..706811,
                     706862..707104,707159..707438))
                     /locus_tag="CNC02470"
                     /codon_start=1
                     /product="phosphatase"
                     /protein_id="XP_569538.1"
                     /db_xref="GI:58264764"
                     /db_xref="GeneID:3256120"
                     /translation="MSVFTKSAFTMSALPSPNTSQPPSAAPSRRGSFANGLASGQLTP
                     VTDPHIVSINVESVLFDMDGTLINSSPAVVKAWELFAEKYPLDLDDILRSAHGMRTID
                     VLKKWCKITDPELLASEVIRFETAILNAAEDIAKNSGKAGIEVLPGVAKLLADLGEEA
                     DKRDGEEKWAICTSSTYFYAGKAIPIAGLPTPKVFVTADSVTRGKPFPDPYLLGASGC
                     NASPFESLVVEDAPTGIRSGKASGALVLATCTSHEREELERERPDFLVDDLSHVKATW
                     DAATNTFNLIIEQPIDRYTPRPTPDVTPVITPAMSRSNSFSGVGQDRPSVRTSQAIMK
                     GSDDLTGNDSVVGSPAASRPGSPGADDSIEKRAEMEFHRRASQSGQAGVTLDAFRRAL
                     AGNAAKRRAQSQGEMSQDE"
     gene            708333..710361
                     /locus_tag="CNC02480"
                     /db_xref="GeneID:3256593"
     mRNA            join(708333..708595,708659..708849,708938..709277,
                     709325..709607,709657..710361)
                     /locus_tag="CNC02480"
                     /product="glycerol-3-phosphate dehydrogenase (NAD+),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538105|gb|CF683946.1,gi|41538112|gb|CF683953.1,
                     gi|41543668|gb|CF689509.1,gi|41543680|gb|CF689521.1,
                     gi|41546675|gb|CF692516.1,gi|41546688|gb|CF692529.1,
                     gi|41548631|gb|CF694472.1,gi|41548637|gb|CF694478.1,
                     gi|41554187|gb|CF700028.1,gi|41556160|gb|CF702001.1,
                     gi|41556165|gb|CF702006.1,gi|41560383|gb|CF706224.1,
                     gi|41560390|gb|CF706231.1,gi|41564559|gb|CF710400.1,
                     gi|41564568|gb|CF710409.1,gi|41564812|gb|CF710653.1,
                     gi|41571833|gb|CF717674.1,gi|41571848|gb|CF717689.1"
                     /transcript_id="XM_569542.1"
                     /db_xref="GI:58264771"
                     /db_xref="GeneID:3256593"
     CDS             join(708508..708595,708659..708849,708938..709277,
                     709325..709607,709657..709936)
                     /locus_tag="CNC02480"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase (NAD+)"
                     /protein_id="XP_569542.1"
                     /db_xref="GI:58264772"
                     /db_xref="GeneID:3256593"
                     /translation="MSAASTAPSSPEVVQQFSDLDIGSTVTTPAVTRPSSPSPPSLPP
                     SPLSSGKHKIAVIGSGSWGTALAKIAAENAWRRKEDFHSEVRMWVREKIVNGKPLTHV
                     INKTHLNSRYLPDVVLPRNLVAVPHLKDVVKDATLIVFVVPHQFLHTVLNELARPGVL
                     LRGAKAVTAIKGVEVNGTDIQTFASLIEAKVGLPCSALSGANIALEVAMGQFCETTIG
                     CPTPDQSLLWHAVFNSPSFRVNTVEDVSGVSLAGALKNVVALAAGMVDGLGLGGNTKA
                     AIMRIGLKEMTQFCLEFFEGVRPETFSNESAGVADLTVTCFSGRNRKCAEEFVRSGQP
                     FDVVEKKLLNGQKLQGTATAEEVNAFLFARKRAHAYPLFEKVYKIAFEGMPPKNLVVG
                     L"
     gene            complement(710104..712686)
                     /locus_tag="CNC02490"
                     /db_xref="GeneID:3256574"
     mRNA            complement(join(710104..710278,710335..710801,
                     710861..711571,711621..711791,711845..712296,
                     712365..712686))
                     /locus_tag="CNC02490"
                     /product="regulation of translational termination-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41543451|gb|CF689292.1,gi|41543459|gb|CF689300.1,
                     gi|41547947|gb|CF693788.1,gi|41547962|gb|CF693803.1,
                     gi|41563457|gb|CF709298.1,gi|41563467|gb|CF709308.1"
                     /transcript_id="XM_569938.1"
                     /db_xref="GI:58265563"
                     /db_xref="GeneID:3256574"
     CDS             complement(join(710567..710801,710861..711571,
                     711621..711791,711845..712296,712365..712442))
                     /locus_tag="CNC02490"
                     /codon_start=1
                     /product="regulation of translational termination-related
                     protein"
                     /protein_id="XP_569938.1"
                     /db_xref="GI:58265564"
                     /db_xref="GeneID:3256574"
                     /translation="MYHDMDHHEIRQQCESMQEDELTVLESIYPGQIKIHPNPNNRPG
                     RILTLTLPVKLSSPTKVSISTASNNGESSIPSLTLSHLPALSLCVALPETYPLLVPPA
                     PISLRAPLFKGHDDKLGSWLFQNDLREIESRLRRMWDDDKEAWDQGQGVLWRWWDWVV
                     NGDFLRETQRLIHDSLTLTVPPPLSPATFFTALKSYDSYQIQNEFEQTAFPCSICWEN
                     RKGGRCVEMPGCGCVFCTECLGECWTLAISEGTLEAVACPSVACVKQRATNEKASRLD
                     QGVTAPLVEKVVGKELRERWEVFKDRRIVEIDPSFCICPQPKCQAAVPPPTPSGTCGN
                     SSAPKAIRLADLTKPSSGSLHVPADVPRGSGQSVPLTEDRWAAYRLCPKCNFSFCLYC
                     SSTWHGPHTVCSLPQASQLVLEYLKYPEGSEGRLAMERQRGKANLERMVSKWREDEMN
                     TQWLHSRTKACPSCSVRVEKSVGCNHMQCGRCSAHFCYLCGQSIKPTDPYKHFNTPGQ
                     PCYGKLFEAMDFEDVLDPVLNLEQFTEDDLLDWDFGAARI"
     misc_feature    712853..712873
                     /note="AT_rich"
     gene            712975..716877
                     /locus_tag="CNC02500"
                     /db_xref="GeneID:3256282"
     mRNA            join(712975..713073,713128..713241,713291..713377,
                     713426..713640,713694..713899,713950..714111,
                     714169..714368,714418..714505,714798..716045,
                     716097..716272,716325..716476,716536..716571,
                     716628..716877)
                     /locus_tag="CNC02500"
                     /product="ATPase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532514|gb|CF678355.1,gi|41532521|gb|CF678362.1,
                     gi|41540418|gb|CF686259.1,gi|41548879|gb|CF694720.1,
                     gi|41549398|gb|CF695239.1,gi|41576316|gb|CF722157.1,
                     gi|41576323|gb|CF722164.1"
                     /transcript_id="XM_569543.1"
                     /db_xref="GI:58264773"
                     /db_xref="GeneID:3256282"
     CDS             join(713055..713073,713128..713241,713291..713377,
                     713426..713640,713694..713899,713950..714111,
                     714169..714368,714418..714505,714798..716045,
                     716097..716272,716325..716476,716536..716571,
                     716628..716744)
                     /locus_tag="CNC02500"
                     /codon_start=1
                     /product="ATPase"
                     /protein_id="XP_569543.1"
                     /db_xref="GI:58264774"
                     /db_xref="GeneID:3256282"
                     /translation="MIGGIKAIDTSLIHRIHSGQVVLDLQSAIKELLENSLDAGATAI
                     DVRIKDNGLDSIEVVDNGSGIAEADWESIALRHHTSKLPSLEDLHKVTTFGFRGEALS
                     ALAALCDSITVVTATKETAPMGAVIKLGKDGRTIETSGRVARPRGTTVTLSGLFNPLP
                     VRRKEFERNAKKEVSKALVLLTAYALVPASASVQDARNGVRLKVELTAGGGRASKRSI
                     HLMTDGRGQLRSSVGAVWGPSALDNVEDINLRLEVEIDRVMARREGITERKQTVEVKG
                     LISSAQWGCGFSTSSRQFFYINGRPCNLTKVARAINEVYKSFNTNQLPLAILDFKIPT
                     ESVDINVSPDKRTIFVHSEDCLIDSLKVLMCSQTTGSIPSSPHEEQMKGSITSAATLT
                     SSLCELNEARLSSPSSQASLRQRSLSTSKPSLNPAQTVSAIQALNNCEAVSKDRMSKL
                     RENSQGSTSQKATAKHESDDETQISVVEEQEVMEDMPEDANQDEGRNTEIVSPNHETP
                     KISEGEAAVEAIEIEDQTIETASGVQDHTIKHSTHANRPILEIESSTDENLLLSTRHS
                     ASAVWCGVDQQLSEQTSASPQHILSGSGRDLSIRTDPPPENRKIDFSTSCDPQRTSAS
                     SSSSPIVKPRVSQRLKPDKAYRDEIISTAPQGEVIMRFDLSRLRKRFANAGNRQAGAQ
                     SKRVSQLVKQGDLEEAAGIKNKDSELAEETLSRVISKADFEKMEVKGQFNKGFIIARL
                     QSTDNGTDDLFIIDQHASDEKYNFETLQQTTKIKAQALIKPRALHLTAGDEIVAMENI
                     DILNANGFDVHVDESKPAGKGERISLLAMPVSKETVFDFKDLEQLLHLLSDDSRPSGQ
                     MVRCMKARAMFASRACRKSVMIGKTLTKGQMSQLLRNMGTIDQPWNCPHGRPTMRHLT
                     KLNPAPESSKIKGRFDWTRWKEALA"
     gene            717602..720718
                     /locus_tag="CNC02510"
                     /db_xref="GeneID:3256463"
     mRNA            join(717602..718358,718413..718625,718675..719202,
                     719256..720173,720224..720718)
                     /locus_tag="CNC02510"
                     /product="beta-glucosidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531822|gb|CF677663.1,gi|41531827|gb|CF677668.1,
                     gi|41535057|gb|CF680898.1,gi|41535065|gb|CF680906.1,
                     gi|41535832|gb|CF681673.1,gi|41535842|gb|CF681683.1,
                     gi|41538425|gb|CF684266.1,gi|41538440|gb|CF684281.1,
                     gi|41540865|gb|CF686706.1,gi|41540879|gb|CF686720.1,
                     gi|41542059|gb|CF687900.1,gi|41547884|gb|CF693725.1,
                     gi|41552095|gb|CF697936.1,gi|41552111|gb|CF697952.1,
                     gi|41555798|gb|CF701639.1,gi|41555809|gb|CF701650.1,
                     gi|41557574|gb|CF703415.1,gi|41560495|gb|CF706336.1,
                     gi|41560505|gb|CF706346.1,gi|41562206|gb|CF708047.1,
                     gi|41562212|gb|CF708053.1,gi|41562630|gb|CF708471.1,
                     gi|41562637|gb|CF708478.1,gi|41563202|gb|CF709043.1,
                     gi|41563207|gb|CF709048.1,gi|41568662|gb|CF714503.1,
                     gi|41568672|gb|CF714513.1,gi|41570911|gb|CF716752.1,
                     gi|41570918|gb|CF716759.1,gi|41572190|gb|CF718031.1,
                     gi|41572199|gb|CF718040.1,gi|41575440|gb|CF721281.1,
                     gi|41575715|gb|CF721556.1"
                     /transcript_id="XM_569544.1"
                     /db_xref="GI:58264775"
                     /db_xref="GeneID:3256463"
     CDS             join(717880..718358,718413..718625,718675..719202,
                     719256..720173,720224..720545)
                     /locus_tag="CNC02510"
                     /codon_start=1
                     /product="beta-glucosidase"
                     /protein_id="XP_569544.1"
                     /db_xref="GI:58264776"
                     /db_xref="GeneID:3256463"
                     /translation="MLALPVTLLWLSTGFPLLTYASPVTSDADNHTISATEANSSSST
                     SFLPHNTSRHHESSSQSPITYISPQIAAPINATYVNPSHKWEKAYRKAKKYLDDWTLE
                     EKVQLTTGVGWENGRCVGNIGAIPSRNFSGLCLQDSPLGVRLADFVSAFPAGINAAAT
                     FDKDLIYARGYALGQEFKGKGVHVALGPMTNMGRVAAGGRNWEGFGGDPYLSGWATEM
                     TVRGIQDAGVQACVKHYVGNEQERNRTTESSNIDDRTLREIYTHPFLRAVQADVASVM
                     CSYNLINGSWACENPKTLNGVLKTDFGFQGYVLSDWGAQHSGVVSANNGLDMSMPGDI
                     VLGSLTSYWGSNLTESVKNGSVSEERLDDMAERIMAAYFLVDQDKDYPEVNFDSFRLS
                     GSNNSHVDVRGDHWKIIRQMGAASTVLLKNVDHALPLRKPRSMTLIGSDLGPSLRGPN
                     GFSDRGGLSGTLAMGWGSGTAEFPYLVDPLSSISLQAREDGTILNWWLDDWNLSNASY
                     WASVAEVAIVGINSDSGEGYITVDDNEGDRNNLTAWNNGDELVKAVASANNNTIVIVH
                     SVGPMIIEDWIDHPNITAVLWAGLPGQESGNSLVDVLYGAYNPSARLPYTIAKKREDY
                     SADIDYVTSDIPAITQVNYTEGLFIDYRHFLAKDITPRYEFGFGMSYTSFEFGDVSLE
                     EIKEEGAGDDIYNFQEVDDGTVKAGRFLLDYLHKAQWTVTIDITNTGGVNGCEVPQLY
                     LAYPADSGEPPKVMRDFARINLDPGASQTVTFNLSRYDVSIWDVESQKWTIPDGTFVV
                     EVGKSSMDKDAKTASFCPGSC"
     gene            complement(722402..724981)
                     /locus_tag="CNC02520"
                     /db_xref="GeneID:3256537"
     mRNA            complement(join(722402..722668,722730..722996,
                     723057..723853,723912..724323,724383..724636,
                     724691..724981))
                     /locus_tag="CNC02520"
                     /product="chaperone, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530908|gb|CF676749.1,gi|41531591|gb|CF677432.1,
                     gi|41533477|gb|CF679318.1,gi|41533487|gb|CF679328.1,
                     gi|41533918|gb|CF679759.1,gi|41533923|gb|CF679764.1,
                     gi|41535393|gb|CF681234.1,gi|41536277|gb|CF682118.1,
                     gi|41536286|gb|CF682127.1,gi|41540729|gb|CF686570.1,
                     gi|41540744|gb|CF686585.1,gi|41543656|gb|CF689497.1,
                     gi|41543662|gb|CF689503.1,gi|41544888|gb|CF690729.1,
                     gi|41544895|gb|CF690736.1,gi|41545288|gb|CF691129.1,
                     gi|41545293|gb|CF691134.1,gi|41546706|gb|CF692547.1,
                     gi|41546718|gb|CF692559.1,gi|41546958|gb|CF692799.1,
                     gi|41546969|gb|CF692810.1,gi|41551586|gb|CF697427.1,
                     gi|41555690|gb|CF701531.1,gi|41555704|gb|CF701545.1,
                     gi|41558897|gb|CF704738.1,gi|41558904|gb|CF704745.1,
                     gi|41559337|gb|CF705178.1,gi|41559346|gb|CF705187.1,
                     gi|41559476|gb|CF705317.1,gi|41559479|gb|CF705320.1,
                     gi|41562167|gb|CF708008.1,gi|41564203|gb|CF710044.1,
                     gi|41564212|gb|CF710053.1,gi|41566090|gb|CF711931.1,
                     gi|41566094|gb|CF711935.1,gi|41569205|gb|CF715046.1,
                     gi|41569209|gb|CF715050.1,gi|41569287|gb|CF715128.1,
                     gi|415"
                     /transcript_id="XM_569545.1"
                     /db_xref="GI:58264777"
                     /db_xref="GeneID:3256537"
     CDS             complement(join(722546..722668,722730..722996,
                     723057..723853,723912..724323,724383..724636,
                     724691..724772))
                     /locus_tag="CNC02520"
                     /codon_start=1
                     /product="chaperone"
                     /protein_id="XP_569545.1"
                     /db_xref="GI:58264778"
                     /db_xref="GeneID:3256537"
                     /translation="MTKAIGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFND
                     SERLIGDAAKNQVAMNPYNTVFDAKRLIGRKFNDAEVQADMKHWPFKVVEKGGKPVIK
                     VEYKGEEKTFTPEEISSMVLTKMKETAEAYLGGTVSKAVVTVPAYFNDSQRQATKDAG
                     AIAGLDVLRIINEPTAAAIAYGLDKKSEGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK
                     ATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLSSNARALRRLRTACERAKRTLSSAA
                     QTSIEIDSLFDGIDFYTSITRARFEELCQDLFRSTMDPVEKVLRDSKIDKSSVNEIVL
                     VGGSTRIPKIQKLVSDMFSGREPNRSINPDEAVAYGAAVQAAILTGDTSEATQDLLLL
                     DVAPLSMGIETAGGIMTPLIKRNTTVPTKKSEVFSTYSDNQPGVLIQVFEGERAKTKD
                     CNLLGKFELSGIPPAPRGVPQIEVSFDIDANGILNVNAADKSTGKTSKITITNDKGRL
                     SKEEIERMLAEAERFKAEDEAAAATVQAKNGLESYAYSLKTTLSDNKDKFDSADHETL
                     SKKVEEVINALDTMQSASKEEFESLQKELEGIANPIMTKFYGASGGMPGGAGAPGGFP
                     GGGAGGGAAQEEGPSVEEVD"
     gene            727225..728083
                     /locus_tag="CNC02530"
                     /db_xref="GeneID:3256257"
     mRNA            join(727225..727434,727490..727511,727572..727652,
                     727712..727725,727807..728083)
                     /locus_tag="CNC02530"
                     /product="expressed protein"
                     /transcript_id="XM_569546.1"
                     /db_xref="GI:58264779"
                     /db_xref="GeneID:3256257"
     CDS             join(727267..727434,727490..727511,727572..727652,
                     727712..727725,727807..727854)
                     /locus_tag="CNC02530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569546.1"
                     /db_xref="GI:58264780"
                     /db_xref="GeneID:3256257"
                     /translation="MYTTAFLRSTVTGLRPALHRPASVVDSSQTLLTSSRLGRVAKRF
                     NSSGPRTDKPKLVFRFGLRDIPVELYPILFVTGAACVGGGVALGRQLYLGDLRFKPTG
                     PASAQGQQ"
     gene            complement(728162..>729665)
                     /locus_tag="CNC02540"
                     /db_xref="GeneID:3256393"
     mRNA            complement(join(728162..728260,728311..728423,
                     728472..728517,728572..728650,728704..728761,
                     728816..729080,729135..729202,729250..729353,
                     729413..729429,729483..729524,729638..>729665))
                     /locus_tag="CNC02540"
                     /product="organic acid transporter, putative"
                     /transcript_id="XM_569547.1"
                     /db_xref="GI:58264781"
                     /db_xref="GeneID:3256393"
     CDS             complement(join(728205..728260,728311..728423,
                     728472..728517,728572..728650,728704..728761,
                     728816..729080,729135..729202,729250..729353,
                     729413..729429,729483..729524,729638..729665))
                     /locus_tag="CNC02540"
                     /codon_start=1
                     /product="organic acid transporter"
                     /protein_id="XP_569547.1"
                     /db_xref="GI:58264782"
                     /db_xref="GeneID:3256393"
                     /translation="MSTELKTPLPLPFIYTFASGAIAGCTELLLLYPLDVVKTRQQLD
                     TGKQGANMVQVFKNIVAQEGPRRLYRGILPPLMLEAPKRAVKFAANGSWGAFFTNNGQ
                     RKNTQAIAILTGCFAGATESVVVTPFELVKIRMQDKSSTFKGPMDVVKQALAKSGPLG
                     LYQGMESTFWRHWWWNGGYFGAIFAVRNLLPKATSKKQELSNNLIAGTVGGFIGTSLN
                     TPFDVVKSRIQLHGTGEWAYPALLKVAKQEGMAGLYKGFAPKVLRLAPGGGVLLLVVE
                     ALSTVFRNYLGPPYV"
     gene            730125..731389
                     /locus_tag="CNC02550"
                     /db_xref="GeneID:3256400"
     mRNA            join(730125..730272,730326..730429,730486..730549,
                     730605..730732,730807..731389)
                     /locus_tag="CNC02550"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539264|gb|CF685105.1,gi|41539270|gb|CF685111.1"
                     /transcript_id="XM_569548.1"
                     /db_xref="GI:58264783"
                     /db_xref="GeneID:3256400"
     CDS             join(730215..730272,730326..730429,730486..730549,
                     730605..730732,730807..731253)
                     /locus_tag="CNC02550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569548.1"
                     /db_xref="GI:58264784"
                     /db_xref="GeneID:3256400"
                     /translation="MGIFGTSDPVKQTEKALAKEAKAEEKNIKQNVKSLSHAEKAESK
                     AAKAEQKAEKHHLKASKFEEKTAGVLNKATNKHEEAYHKENVAASEVVQKQHAHGTLS
                     NAVEQKKAQLEALQKKHEVNEQSRESKLHEVSGPAASNDNKVGAASQHHPSSQAGSQP
                     AGTTVGGQNSGAGAPATSGAGGNVGTADYQQQGNGAGGAFSQSQQGVPAGNLAAQSDS
                     YGAAQGVTSQGNASQSTANANRGYGGITAGDNQRMGQEEKVTEAVRRM"
     gene            complement(732042..735287)
                     /locus_tag="CNC02560"
                     /db_xref="GeneID:3256345"
     mRNA            complement(join(732042..732404,732455..732673,
                     732723..732961,733012..733179,733231..733504,
                     733554..733674,733714..733795,733849..733971,
                     734137..734289,734338..734850,734914..734943,
                     734999..735168,735225..735287))
                     /locus_tag="CNC02560"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546640|gb|CF692481.1,gi|41546653|gb|CF692494.1,
                     gi|41548625|gb|CF694466.1,gi|41555014|gb|CF700855.1,
                     gi|41555027|gb|CF700868.1,gi|41558974|gb|CF704815.1,
                     gi|41558990|gb|CF704831.1,gi|41569373|gb|CF715214.1,
                     gi|41569376|gb|CF715217.1"
                     /transcript_id="XM_569549.1"
                     /db_xref="GI:58264785"
                     /db_xref="GeneID:3256345"
     CDS             complement(join(732095..732404,732455..732673,
                     732723..732961,733012..733179,733231..733504,
                     733554..733674,733714..733795,733849..733971,
                     734137..734289,734338..734850,734914..734943,
                     734999..735168,735225..735246))
                     /locus_tag="CNC02560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569549.1"
                     /db_xref="GI:58264786"
                     /db_xref="GeneID:3256345"
                     /translation="MPTDIFLDHKPFLSDSFDVHSYTNAILQGRQYTPDQSQQNNNKE
                     DNDKADLDVGAELARLNYGIEDVTKQLRQEITASHLLLLNHLTTSLSLSSHLSPIRSS
                     LISLSASIDRLHSKIHTPYTNLSTLVRRQQNLRQIKDIARRASRFVIVARRLENQLER
                     MGNAPEEDGEKGKTERRAELAKAALSCAELDSLLRDESNERGDDTTSIALLDIDFVKA
                     YSPLISRARDTVIEEMETMVFAGLQELNQTVLSSALQTAHNLRLLPDLVSNLLDDLND
                     AVTLRVTKAFDVTAIGKEVARLERVIDDVANCCIKVYTLEKVLRIKRDTLTQVEFFDE
                     VMKRLDEKPSFTYWTTLAKAFETQTKEAAKTSSWLQQALSVGYPRLLRLFHDFFSRIA
                     VHTDTVYTQEHQSPEAVLVLRSISSFETLYLTRSTNRMSDVVASAVEQYLSARGNPPG
                     PSDGVSIARTVINELDSARFDPLLVRTVARNAAKILDGFIQTVDGMLIEDFTATSLIG
                     PNATSAQQVNAQLVGCLYHCWLNLAYVEHDLTGKVWDILSPSVNSLETTYRRITKSLD
                     AAFRKEITSTLSRIHRVNFDTPVDPLAMGMDARGGSPYMQDLVDKIGFVRNQILGRMS
                     LGEYMKAWVLDLSKFIVRTFLLHASIARPMGESGALKLTGDMTELEMGVTNLLSTGKV
                     QGAKDSVKVEQVGDDYFALRTFRTLLFANLESLVNPVETVHIPPLIVLHHIIVRSPLR
                     LPHEVHGWSESEYVLWIDKHKDAKEQWELVEKTVEDQDVTNSEEETKVDIYVKLIKEV
                     LAHARHDEQ"
     gene            <735520..>737167
                     /locus_tag="CNC02570"
                     /db_xref="GeneID:3256543"
     mRNA            join(<735520..735886,735953..736191,736259..737075,
                     737142..>737167)
                     /locus_tag="CNC02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_569550.1"
                     /db_xref="GI:58264787"
                     /db_xref="GeneID:3256543"
     CDS             join(735520..735886,735953..736191,736259..737075,
                     737142..737167)
                     /locus_tag="CNC02570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569550.1"
                     /db_xref="GI:58264788"
                     /db_xref="GeneID:3256543"
                     /translation="MPKEHIRKRGKRKTKANDDPPLQPTTDVSEPEPSVSTGIHPARA
                     AMLAGQSIPVQTHSPSQDTQLEDSEREEADQTQWIRGPRMESEFPFGVLDPDVKAYFK
                     SIEEQIKDWEGVSSAGEEREDRQNFLSSVLSELRGHELSAATDPETSIILERIMPSLS
                     DWGRRVIGDSFGDKWEELIRHRFGSHVVQTWMTLAADTLDRESKDIWPPQQAKQDPLA
                     GRLPTMTLLFSSVITTLLPSVHLLISSPYASPPIRLLLLILTPRRVLPALGSERSANE
                     GLIRSKKSDKWRKNQEVKGKSILGDDQSTAQSSNRALPEDLRLCRKEIRQALMEGLGE
                     AEWKAMGVDAVGSPTVQLILEFEVDEGDAEKQGSLFDVLTEGIVTQICSNDQSVFEAR
                     PYLLSLITTQTGTRLSECILSLAPQKVFDAIWSTYFEGKLGKLAGHPYANFVVAKGVS
                     RLELDKIEKLIEEVLGNSGGRGLIKQALYKPL"
     gene            complement(<738359..>739081)
                     /locus_tag="CNC02580"
                     /db_xref="GeneID:3256470"
     mRNA            complement(join(<738359..738368,738423..738583,
                     738636..738841,738895..>739081))
                     /locus_tag="CNC02580"
                     /product="import inner membrane translocase subunit tim22,
                     putative"
                     /transcript_id="XM_569551.1"
                     /db_xref="GI:58264789"
                     /db_xref="GeneID:3256470"
     CDS             complement(join(738359..738368,738423..738583,
                     738636..738841,738895..739081))
                     /locus_tag="CNC02580"
                     /codon_start=1
                     /product="import inner membrane translocase subunit tim22,
                     putative"
                     /protein_id="XP_569551.1"
                     /db_xref="GI:58264790"
                     /db_xref="GeneID:3256470"
                     /translation="MSIPLPSAMPLLPPIYLPGQEPLPAGTSDWERQEMQTALKYQRY
                     MGMVMESCPLKVTIAGVGGLAIGGFFSLMSATFAYEDPLSRASNKLTTTRAQTMFVFK
                     EMGRNMWSSGRGFAKVGMVYSGVECCIEGYRAKNDIYNGVSAGFLTGAILARNAGPTA
                     MLGGGVAFAAFSGAIDWWLRSAPADEI"
     gene            complement(<739743..>741668)
                     /locus_tag="CNC02590"
                     /db_xref="GeneID:3256355"
     mRNA            complement(join(<739743..739992,740044..740097,
                     740173..740289,740343..740440,740505..740638,
                     740695..740733,740797..740984,741054..741302,
                     741361..>741668))
                     /locus_tag="CNC02590"
                     /product="polygalacturonase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531612|gb|CF677453.1,gi|41531621|gb|CF677462.1"
                     /transcript_id="XM_569552.1"
                     /db_xref="GI:58264791"
                     /db_xref="GeneID:3256355"
     CDS             complement(join(739743..739992,740044..740097,
                     740173..740289,740343..740440,740505..740638,
                     740695..740733,740797..740984,741054..741302,
                     741361..741668))
                     /locus_tag="CNC02590"
                     /codon_start=1
                     /product="polygalacturonase"
                     /protein_id="XP_569552.1"
                     /db_xref="GI:58264792"
                     /db_xref="GeneID:3256355"
                     /translation="MRFLCLFACVLSSAVVQGSLFVLSESQDQKIIPEILEKDNSIWP
                     YHHEVFEFHPEHKDLSTGLVRPLCVLHTLGEGADDSYNFEKAVHQCGRGGIVRLPDAN
                     YTISRPLDIYLSNSVLDLHGWLSFSANVSSWIENRMPLGFQNQSLAFVVRGNDYILEG
                     NDKGGINGNGQAWYDYAKDYGNKFGRPMSLAIKNSKNVIIKNFSIVQPQFWASLIWGS
                     ENVYIKDFYVNATSFNPESSSDQKNWLQNTDGSDTYQSHNVTYENMIYQGGDDCVALK
                     PNSTSITLRNVTCYGGTGIAFGSIAQYAGVKDVIEDVFMEDIRLYPSNQCPAYQGVYF
                     KSWLGYSIGQPPNGGGGGYGYCRNVTVKDVYMEDIWHPLVVQSDLTYLTLDREKFTDS
                     GLFEWYDIHLKNFTGKALGNRIAWMSCSKLTPCHDWTFEGMDIMPGKQDHPEIHYTCN
                     NFVLGGNDGLNQCHPSNSKLETENGGTL"
     gene            742164..>744102
                     /locus_tag="CNC02600"
                     /db_xref="GeneID:3256485"
     mRNA            join(742164..742362,742444..742670,742729..742913,
                     742965..743447,743520..743632,743789..>744102)
                     /locus_tag="CNC02600"
                     /product="vacuolar membrane protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537650|gb|CF683491.1"
                     /transcript_id="XM_569933.1"
                     /db_xref="GI:58265553"
                     /db_xref="GeneID:3256485"
     CDS             join(742464..742670,742729..742913,742965..743447,
                     743520..743632,743789..744102)
                     /locus_tag="CNC02600"
                     /codon_start=1
                     /product="vacuolar membrane protein"
                     /protein_id="XP_569933.1"
                     /db_xref="GI:58265554"
                     /db_xref="GeneID:3256485"
                     /translation="MVLPRFLNTGVLCPMVLSTCWAVLHIMQYGFAITSLNGIQQSVT
                     CQKAENHTGILQIPIATPVDCIPMTTSSFGLVVSIFTLGGLLGSLAASTTTLRYGQVA
                     TLRLSAAMVLAGSTCIGFAGGTSSMLIGRVFVGIGCGLSTVTVPVFVAQLAPPSMKRS
                     LGISNQISIVIGMLAAQSLSFPFAHPDRWRFVFIAPAMLALIQLAGSLLVNNPVVESQ
                     EAPEIEALLETSQEAETLTIKDLFLSREPDVIKGCEYSVALYLKSFVLMFDVRLRSPC
                     RSCNTDVAAIMRCCTSDVLFNTDFNSSISGRLSADGSHRGLDQASHHCTSNIFGLSIV
                     GIILFVVAFSVGLGPVTWVVLPEVMPSHAVNAAGSVGLALNWVLNFAMGATFLPIQQT
                     LSGGVESKEGNVFFILSVTCAIAAFAIRLTFKRYDRRITLA"
     repeat_region   746366..746394
                     /rpt_type=tandem
                     /rpt_unit_seq="tag"
                     /satellite="microsatellite"
     gene            complement(<746774..>749087)
                     /locus_tag="CNC02610"
                     /db_xref="GeneID:3256717"
     mRNA            complement(join(<746774..747696,747758..748000,
                     748058..748151,748208..748455,748505..748577,
                     748636..748943,749012..>749087))
                     /locus_tag="CNC02610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569937.1"
                     /db_xref="GI:58265561"
                     /db_xref="GeneID:3256717"
     CDS             complement(join(746774..747696,747758..748000,
                     748058..748151,748208..748455,748505..748577,
                     748636..748943,749012..749087))
                     /locus_tag="CNC02610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569937.1"
                     /db_xref="GI:58265562"
                     /db_xref="GeneID:3256717"
                     /translation="MVALASNFLGNPFITRDDVERGCIALLDPLSHHTSPGGAIIDIG
                     NTATHYDQKAVALETFARPLWGLAPLLLGGGKYIGVERWIKGLASGTDPNSFEYWGAS
                     ADKDQRMVEMSPLSFAVAIAPEVFYAGHTDAVKENICHFLRSCIGKQMPDTNWLWFRV
                     FANLALRTVGSAFYNPVQMEKDLERLEEFQLTGHPACGHESSSAGWSRDGPEEVKQLD
                     YYSSSFAIQVAQMIYAKLAIETDPERCKRYKQRARDFIQDFYYYFSDEGAAIPFGRSM
                     VYRFAAIATASAMPFADVEPPKPLQWGHIKGLVLRHLRYWNDAKDIFRSDGTLNIGYR
                     FDCMNMTENYNAPGSPYWCMKAFLCLGVPPDHPFWTSEELCWPSDLFPPIKSLPDPMH
                     IMCRQGGHTFLLSSGQKPHYAMRHGVAKYCKFSYSSAFGFSCPTGDMDLGQLAGDSMI
                     ALYDNSDSAKGGDGETWRVRREPFDCSIVGRGTAQVHLRSKWKPWNDVLVETWLIPPQ
                     ATSPNWYLRVHKITSERKLKSAEGGWTNYGQGINGRALIQSFSGLTSPGGDQEVGWAR
                     AVTEGGAVGILDLSNCSSSGRRLGQLVQIDPNANVIFSRGILPSLVGDIAKGETWLAT
                     AVFGLPSLTGKPLDWQKGWDEPPQIPSWIS"
     gene            complement(750042..750907)
                     /locus_tag="CNC02620"
                     /db_xref="GeneID:3256524"
     mRNA            complement(join(750042..750256,750315..750767,
                     750835..750907))
                     /locus_tag="CNC02620"
                     /product="expressed protein"
                     /transcript_id="XM_569554.1"
                     /db_xref="GI:58264795"
                     /db_xref="GeneID:3256524"
     CDS             complement(join(750138..750256,750315..750767,
                     750835..750856))
                     /locus_tag="CNC02620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569554.1"
                     /db_xref="GI:58264796"
                     /db_xref="GeneID:3256524"
                     /translation="MSPPTDPEATAPHRRFSVRTLFSSTRHIFYVVLFTLWICIDIAL
                     LGLVSEQIHKYGRYRENYPTAQYQNALGLLLFSTIIGLLFGIFHWALGLTMYLPIFLA
                     FGVWFGTGAGILEPTPFGHGFQCRHTWDLSRFPANWQPYVGECSRVTAIEGLAWAMFA
                     LSVFGLFWVIADKYNFTSKRSSVYELAEQGEPIAEKH"
     gene            752244..756268
                     /locus_tag="CNC02630"
                     /db_xref="GeneID:3256438"
     mRNA            join(752244..752595,752701..752718,752803..752810,
                     752880..753010,753064..753167,753214..753384,
                     754309..754463,754521..754540,754590..754729,
                     754782..754916,754970..755011,755059..755083,
                     755136..755277,755329..755350,755399..755413,
                     755454..755573,755626..755969,756014..756101,
                     756153..756268)
                     /locus_tag="CNC02630"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530270|gb|CF676111.1,gi|41530283|gb|CF676124.1"
                     /transcript_id="XM_569556.1"
                     /db_xref="GI:58264799"
                     /db_xref="GeneID:3256438"
     CDS             join(752466..752595,752701..752718,752803..752810,
                     752880..753010,753064..753167,753214..753384,
                     754309..754463,754521..754540,754590..754729,
                     754782..754916,754970..755011,755059..755083,
                     755136..755277,755329..755350,755399..755413,
                     755454..755573,755626..755969,756014..756101,
                     756153..756199)
                     /locus_tag="CNC02630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569556.1"
                     /db_xref="GI:58264800"
                     /db_xref="GeneID:3256438"
                     /translation="MEKRNFNDLPLFENGRQSSTCTPDPSQPSRSNENYEPVQSDANR
                     SVTVNRACDECHRLKMRCTKDKDSQSCTRCLQGSRPCTFEGPRKSKTSKVEDRLRVVE
                     GQITSIQGSIEELLRLQRDAACKSSSVENSHPFVQKPHGQEFETKYFQKSSSHTQQDP
                     LHCQSEASTLALSRTQNHPHRKAWTTEKLFIGHAVRMAMDLGLHHCLPYLTDRDTDIH
                     KSHEELAQERHIVVGARIWLTLFKIDTEMSFAYCRPAIFSPEGAINNARRFLEHPLSI
                     PTDIRLVSTCENLTFRMPLHQHFALSLGRRQSVGAAVDVDQLLRRCNCALKDWFQYWD
                     RYCAQRGISADHFLRETLVTGRAGTFLNANSHVLHDVRNRRDLMRLSEERRRWFQEAG
                     EMAHQLVNTCLRGQQYTENFQYANRLTHYNMVYAARFMIRMASLLPEACDLHQVGRDV
                     EQVAVMLTQVPGFQLAHFLREIMSKARQDHVLPPSLSVSRAPSPCAAANSAWSAADHS
                     GSQNYHLNELGYKSRDCSTNFIPNWEMMTTGTEQTPYGDDVSYLNFLYADQLFSHYEN
                     PADIGQSFALLQGNSRTETTSNSVFNFDTTWFPFPPLDDDMQTGQAVGTNFE"
     gene            complement(756467..758862)
                     /locus_tag="CNC02640"
                     /db_xref="GeneID:3256260"
     mRNA            complement(join(756467..756912,756964..757000,
                     757062..757206,757266..757469,757536..757693,
                     757747..757816,757874..758179,758233..758239,
                     758288..758373,758430..758687,758744..758862))
                     /locus_tag="CNC02640"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41556824|gb|CF702665.1,gi|41563715|gb|CF709556.1,
                     gi|41569198|gb|CF715039.1,gi|41569686|gb|CF715527.1"
                     /transcript_id="XM_569558.1"
                     /db_xref="GI:58264803"
                     /db_xref="GeneID:3256260"
     mRNA            complement(join(756467..756912,756964..757000,
                     757062..757206,757266..757469,757536..757693,
                     757747..757816,757874..758179,758284..758373,
                     758430..758687,758744..758862))
                     /locus_tag="CNC02640"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546229|gb|CF692070.1,gi|41546236|gb|CF692077.1,
                     gi|41556819|gb|CF702660.1,gi|41557154|gb|CF702995.1,
                     gi|41563705|gb|CF709546.1,gi|41569185|gb|CF715026.1,
                     gi|41569675|gb|CF715516.1"
                     /transcript_id="XM_569559.1"
                     /db_xref="GI:58264805"
                     /db_xref="GeneID:3256260"
     CDS             complement(join(756482..756912,756964..757000,
                     757062..757206,757266..757469,757536..757693,
                     757747..757816,757874..758179,758233..758239,
                     758288..758373,758430..758687,758744..758790))
                     /locus_tag="CNC02640"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_569558.1"
                     /db_xref="GI:58264804"
                     /db_xref="GeneID:3256260"
                     /translation="MQTTPKGYDPITLSLFSNRFMCIAEAMGRSLKQTAISTNIKERL
                     DFSCAVFSPTGDLVANAPFVPVHLGSMSWSVKYQLELHGKSLKDGDVLLTNSPLAGGS
                     HLPDLTVITPCFDENDPNKIIFFTASRGHHSDIGGILPGSMPPTSTNINEEGANILSL
                     KIVSDGVYDHEGLYRVMVEEPSKYPGCSGCRNFRDVESDIKAQIAANNKGSSLLRALV
                     EEYDLKTVHEYMDHIRNNAEQAVRNMLRKAAANAKTNILHGIDYLDDGSPIALEITID
                     TDSGSAIFDFEGTGPELRGNLNAPICVVHAAVIYCLRSMIGEDIPLNAGCLVPIEVRI
                     PEGSLLSPSPESAVCGGNVMTSQRITDVVLLAFRACAASQGCCNNLTFGAGGKDFETG
                     EVIDGWGYYETIAGGSGAGDGWHGTSGVHCHMTNTRITDPEILERRYPVILREFGLRS
                     NSGGSGKYNGGEGCVRSLQFLQPLQVSILSERRARGPYGLNGGACGAPGLNLWIKQAH
                     GGSAKGKPRVINIGGKGTMQFETGDLIVLHTPGGGGWGKLEDTDSKLKQEDEPLLQAI
                     KWEARGSWADMAKVDF"
     CDS             complement(join(756482..756912,756964..757000,
                     757062..757206,757266..757469,757536..757693,
                     757747..757816,757874..758179,758284..758373,
                     758430..758687,758744..758790))
                     /locus_tag="CNC02640"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_569559.1"
                     /db_xref="GI:58264806"
                     /db_xref="GeneID:3256260"
                     /translation="MQTTPKGYDPITLSLFSNRFMCIAEAMGRSLKQTAISTNIKERL
                     DFSCAVFSPTGDLVANAPFVPVHLGSMSWSVKYQLELHGKSLKDGDVLLTNSPLAGGS
                     HLPDLTVITPCFDENDPNKIIFFTASRGRDDIGGILPGSMPPTSTNINEEGANILSLK
                     IVSDGVYDHEGLYRVMVEEPSKYPGCSGCRNFRDVESDIKAQIAANNKGSSLLRALVE
                     EYDLKTVHEYMDHIRNNAEQAVRNMLRKAAANAKTNILHGIDYLDDGSPIALEITIDT
                     DSGSAIFDFEGTGPELRGNLNAPICVVHAAVIYCLRSMIGEDIPLNAGCLVPIEVRIP
                     EGSLLSPSPESAVCGGNVMTSQRITDVVLLAFRACAASQGCCNNLTFGAGGKDFETGE
                     VIDGWGYYETIAGGSGAGDGWHGTSGVHCHMTNTRITDPEILERRYPVILREFGLRSN
                     SGGSGKYNGGEGCVRSLQFLQPLQVSILSERRARGPYGLNGGACGAPGLNLWIKQAHG
                     GSAKGKPRVINIGGKGTMQFETGDLIVLHTPGGGGWGKLEDTDSKLKQEDEPLLQAIK
                     WEARGSWADMAKVDF"
     gene            759010..762186
                     /locus_tag="CNC02650"
                     /db_xref="GeneID:3256364"
     mRNA            join(759010..759146,759224..759422,759478..759681,
                     759744..759914,759964..760298,760349..760449,
                     760508..760625,760681..760841,760905..761031,
                     761091..761234,761285..761361,761419..761713,
                     761768..762012,762069..762186)
                     /locus_tag="CNC02650"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533649|gb|CF679490.1,gi|41543251|gb|CF689092.1,
                     gi|41543258|gb|CF689099.1,gi|41549575|gb|CF695416.1,
                     gi|41549577|gb|CF695418.1,gi|41550382|gb|CF696223.1,
                     gi|41550389|gb|CF696230.1,gi|41552162|gb|CF698003.1,
                     gi|41574689|gb|CF720530.1,gi|41574702|gb|CF720543.1"
                     /transcript_id="XM_569561.1"
                     /db_xref="GI:58264809"
                     /db_xref="GeneID:3256364"
     CDS             join(759099..759146,759224..759422,759478..759681,
                     759744..759914,759964..760298,760349..760449,
                     760508..760625,760681..760841,760905..761031,
                     761091..761234,761285..761361,761419..761713,
                     761768..762012,762069..762135)
                     /locus_tag="CNC02650"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_569561.1"
                     /db_xref="GI:58264810"
                     /db_xref="GeneID:3256364"
                     /translation="MSRSIPDHSIRISIDRGGTFTDVHASIPAANHSETREEFIFKLL
                     SQDPSNYKDAPTEGIRRVLEKVTGQGIERGKPLPVDKLEYVRLSTTVATNALLERKGQ
                     KHALMITKGFKDLLEIGNQARPNIFDLNIKRAKPLYSRTVEVDERVTLVGFSSDPNYE
                     KHAVKFNDDGSIGESYSGVGADEQKIVIPGRIVRGLSGEAVNILREPNLEAIKVDLQN
                     LYDDGYSSIAVCLAHSYTFPDHELAIGKIATEVGFPHVSLSSQLLPMIKMTPRGQSTT
                     ADAYLTPILRDYLEGFYSGFEGGKNGSLHVEFMGSDGGLVDLKNFSGLKSILSGPAGG
                     VVGCALTSWDKDEKIPIIGLDVGGTSTDVSRYAGHYESVYETTTAGISINTLQLDINT
                     VAAGGGSCLTYKNGLFRAGPESAGAHPGPACYRKGGPLALTDGNLFLGRLIPKYFPRC
                     FGPNEDQDLDPEASHKKFEQLAEMIRKESGTEKSLDEIVYGFVKVANETMARPIRTLT
                     EARGFKTEKHILASFGGAGGQHACEIAELLGIQRVLIHKYSSILSAYGLALADRVFEL
                     QEPAAVIFSQENKAGLNARLDKLERDVFKTLLDAGFADDKIGINRILNMRYDGSDTAL
                     MISNEGSGDYEKEFKRAYKEEFGFLLNKNIVVDDVKVRGVGKTFDSLGPPPTQEVKSL
                     ELSVVSPEHADCSQNCYVWYGKSGKREEVPVFKIESLSVGNMVIGPAMVIDETQTIFV
                     NQGWKAISTNSHLLMVQEKKKGD"
     gene            complement(762516..765491)
                     /locus_tag="CNC02660"
                     /db_xref="GeneID:3256610"
     mRNA            complement(join(762516..763046,763100..763565,
                     764218..764353,764399..765491))
                     /locus_tag="CNC02660"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538452|gb|CF684293.1,gi|41538459|gb|CF684300.1,
                     gi|41547384|gb|CF693225.1,gi|41547387|gb|CF693228.1,
                     gi|41565169|gb|CF711010.1,gi|41565180|gb|CF711021.1"
                     /transcript_id="XM_570038.1"
                     /db_xref="GI:58265763"
                     /db_xref="GeneID:3256610"
     CDS             complement(join(763102..763565,764218..764353,
                     764399..765055))
                     /locus_tag="CNC02660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570038.1"
                     /db_xref="GI:58265764"
                     /db_xref="GeneID:3256610"
                     /translation="MSCPSPGSSPSTSATVPLAVHRQNDYQTASPISLPPSLSPSASP
                     VAIFRRAIVLHDHSDAEKNFPGESNTQENVGPIMSSVPFAASPLIAATTFSLAPNLEQ
                     QRGKRKRRRSGSDSDYSPPYSLRGGGRPQKSKTRRNANNGSHSGQCQNVRSSRRTTRS
                     KARRANSPSSLIITSLEDIKLEDAAVKSEISRLGLTLRDVQGDGNCLFRCLSDQLYGT
                     EKRHAEIRKIVCDYLDSHKETMEGFVVPFMKEGERYEGYVQRMRQSTDKESESSSDQR
                     VEELLHELAPSNTACPSDSSAIEHCSLSSEGVSYRPRSPALSSTTGTRSRSESVSERS
                     SNGSVTSDLAQSQSSRSTTVSSGQDAPRVTPEIISDSKLRTKSDKLGKDLQGMVLRSR
                     ESSREPKRSHDEPQKRRASLRLKNRL"
     gene            767710..769179
                     /locus_tag="CNC02670"
                     /db_xref="GeneID:3256445"
     mRNA            767710..769179
                     /locus_tag="CNC02670"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41575396|gb|CF721237.1,gi|41575403|gb|CF721244.1"
                     /transcript_id="XM_569934.1"
                     /db_xref="GI:58265555"
                     /db_xref="GeneID:3256445"
     CDS             767897..768775
                     /locus_tag="CNC02670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569934.1"
                     /db_xref="GI:58265556"
                     /db_xref="GeneID:3256445"
                     /translation="MVLMCKDAGDWTKRLFDYSRALEASTTEPESGAGRNVKIIIEGP
                     YGGTGNTMLSSFSSLVLIAGGSGITHALAVAHDLVMRAPTGAVRARIVDLVWIVKTEQ
                     EAKPLMATLLELVSDAKSWEAASIEGQRRQANYASPTALRIQIFVTRCPASSPLALIP
                     DATALSSFNVETSAEKSGMVGHMSGTNTEKVAYLSRNLSAASTMSTMRDKYVQLSGIT
                     ARPARPNLNIIISKIVDETIAHHRQNLTEANGMYITACGPEGLVYSTMQAVKALQAYK
                     RTAVGGVEFEEERFGF"
     gene            770156..772842
                     /locus_tag="CNC02680"
                     /db_xref="GeneID:3256370"
     mRNA            join(770156..770647,770750..770813,770872..770883,
                     770968..771037,771101..771174,771241..771360,
                     771424..771653,771709..771835,771887..771932,
                     771989..772114,772176..772450,772506..772842)
                     /locus_tag="CNC02680"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541860|gb|CF687701.1,gi|41541862|gb|CF687703.1,
                     gi|41549562|gb|CF695403.1,gi|41561536|gb|CF707377.1,
                     gi|41561542|gb|CF707383.1,gi|41562933|gb|CF708774.1,
                     gi|41573515|gb|CF719356.1,gi|41573520|gb|CF719361.1"
                     /transcript_id="XM_569563.1"
                     /db_xref="GI:58264813"
                     /db_xref="GeneID:3256370"
     CDS             join(770575..770647,770750..770813,770872..770883,
                     770968..771037,771101..771174,771241..771360,
                     771424..771653,771709..771835,771887..771932,
                     771989..772114,772176..772450,772506..772725)
                     /locus_tag="CNC02680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569563.1"
                     /db_xref="GI:58264814"
                     /db_xref="GeneID:3256370"
                     /translation="MATSVIPPQTACSLTDSNPVRKYSFFRSVTFQIAIACAVSFTAP
                     GMWDALGGLGAGGAAEPYAVSAANALVYGLFAIVCVAAGAINNRIGLKWGLALGSIGY
                     PLYGAGLYVNNHTSHTAFMLWGSAMCGISAGFFWAAEAAIIIGYPSPKDRGFYLAVWQ
                     TAKAVGPIVGGAINLGLNANRETAGSVGSATYIVFIVIMCLGLPFAICLSPAQKVHRK
                     DGTRVIVHKQPSWTKEFKAVLDLALTRRIALLLPSFFISYFYNGFLSTWLTTYFTVRS
                     RAFSSFFTNFAGIFSSFIVGTLLDSQKINIKTRGKIAFASIVIILTGTWIWAIILQKQ
                     FYDADVAPVYDWFKGGFGKAYGVVFFWTFAGQAYQQFLYWVVGQYATDISSLSHHTGI
                     LRGVEALGQTVAWAMQSEGNANHFVSIGINFGITLLSIVPTWIVLSELEGSHEIVVVE
                     SDQESNNEGKESTEGPSAKSSVKDLPLA"
     gene            complement(773862..777414)
                     /locus_tag="CNC02690"
                     /db_xref="GeneID:3256579"
     mRNA            complement(join(773862..774153,774191..774215,
                     774277..774395,774451..774545,774614..774629,
                     774680..774699,774755..774767,774829..774851,
                     774904..774996,775049..775074,775127..775145,
                     775207..775471,775526..775557,775609..775734,
                     775780..775872,775921..776048,776096..776104,
                     776168..776401,776457..776525,776579..776652,
                     776700..776740,776799..776809,776875..776943,
                     776996..777081,777169..777414))
                     /locus_tag="CNC02690"
                     /product="mitochondrial inner membrane protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537761|gb|CF683602.1,gi|41537773|gb|CF683614.1,
                     gi|41539134|gb|CF684975.1,gi|41539147|gb|CF684988.1,
                     gi|41540012|gb|CF685853.1,gi|41541253|gb|CF687094.1,
                     gi|41541258|gb|CF687099.1,gi|41549421|gb|CF695262.1,
                     gi|41550239|gb|CF696080.1,gi|41552575|gb|CF698416.1,
                     gi|41552582|gb|CF698423.1,gi|41557745|gb|CF703586.1,
                     gi|41557754|gb|CF703595.1,gi|41561789|gb|CF707630.1,
                     gi|41561798|gb|CF707639.1,gi|41566783|gb|CF712624.1,
                     gi|41566794|gb|CF712635.1,gi|41572195|gb|CF718036.1,
                     gi|41572198|gb|CF718039.1"
                     /transcript_id="XM_569565.1"
                     /db_xref="GI:58264817"
                     /db_xref="GeneID:3256579"
     CDS             complement(join(773904..774153,774191..774215,
                     774277..774395,774451..774545,774614..774629,
                     774680..774699,774755..774767,774829..774851,
                     774904..774996,775049..775074,775127..775145,
                     775207..775471,775526..775557,775609..775734,
                     775780..775872,775921..776048,776096..776104,
                     776168..776401,776457..776525,776579..776652,
                     776700..776740,776799..776809,776875..776943,
                     776996..777081,777169..777329))
                     /locus_tag="CNC02690"
                     /codon_start=1
                     /product="mitochondrial inner membrane protein"
                     /protein_id="XP_569565.1"
                     /db_xref="GI:58264818"
                     /db_xref="GeneID:3256579"
                     /translation="MAQNPQEPLSSRLSSTLKATAGSLTSSVKPAESELGRWRRTFDK
                     FAKEEVDGQKFLNPSQFIDAIAPTDEGFSKIKREQYANLFRVADSARRGLVSFEDFVV
                     FETLLKRPDADYQLAFQVFDVDASGTIDFDEFKAVLSANTAASGIPFDFDCAWMKLYV
                     GKRGDRHVLGYHEFTQLIKGYQGERLRQAFHFFDADGDGYINPEEFQRIIVEIAGHKL
                     SDSVLGRLPTLCTLNPGRRISYSEVIAFHNIIREMDTVERIIEHAVKKSKDGRIDISD
                     FLDEAAGSMRYGMFTPMEANIIWHFASRGNAGTGQRLALADFQALLDAKWQPPETASI
                     KQPSTVSGGFLAEAAQSTYNFVQGGIAGGLGAYAVYPIDLVKTRLQNQRSTVVGEVLY
                     RNAFDCVKKVYTNEGGIRAFYRGVLPQLVGVAPEKAIKLTVNELVRKKATDPETGRIP
                     LLMEIVAGGSAGGCQVVVTNPLEIIKIRLQMAGEITRAEGGTAAPRGAFHVIKQLGLI
                     GLYKGATACFARDIPFSMIYFTSYAHLKKDVFHEGHHGKVLSFGELLAAAGIAGMPAA
                     YLTTPADVVKTRLQSQARAGQTVYKGIIDGLSKIFREEGLRTLFKGGLARVIRSSPQF
                     AVTLACYELLHKHFPYPYAPTPVVHRPVLQVHQEISRIRARNALRILLDCSSRFGMVD
                     SSTASKRMQLIPKSFR"
     gene            complement(777957..780394)
                     /locus_tag="CNC02700"
                     /db_xref="GeneID:3256817"
     mRNA            complement(join(777957..778295,778348..778650,
                     778703..778810,778875..779129,779181..779384,
                     779433..779564,779615..779758,779814..780394))
                     /locus_tag="CNC02700"
                     /product="mitochondrion organization and
                     biogenesis-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540585|gb|CF686426.1,gi|41542270|gb|CF688111.1,
                     gi|41542280|gb|CF688121.1,gi|41550525|gb|CF696366.1,
                     gi|41550531|gb|CF696372.1,gi|41552214|gb|CF698055.1,
                     gi|41552351|gb|CF698192.1,gi|41552352|gb|CF698193.1,
                     gi|41553564|gb|CF699405.1,gi|41553573|gb|CF699414.1,
                     gi|41556332|gb|CF702173.1,gi|41560896|gb|CF706737.1,
                     gi|41560902|gb|CF706743.1,gi|41561217|gb|CF707058.1,
                     gi|41561225|gb|CF707066.1,gi|41561501|gb|CF707342.1,
                     gi|41561510|gb|CF707351.1"
                     /transcript_id="XM_569566.1"
                     /db_xref="GI:58264819"
                     /db_xref="GeneID:3256817"
     CDS             complement(join(778083..778295,778348..778650,
                     778703..778810,778875..779129,779181..779384,
                     779433..779564,779615..779758,779814..780374))
                     /locus_tag="CNC02700"
                     /codon_start=1
                     /product="mitochondrion organization and
                     biogenesis-related protein"
                     /protein_id="XP_569566.1"
                     /db_xref="GI:58264820"
                     /db_xref="GeneID:3256817"
                     /translation="MSAGTTVTYARLPPPHALLRGAPLPLRAYIRSPQAFTASAPIPL
                     ATRARLPQLIPLASLRFVSTQPQPSSPPPPYPPPVHSPAPAAHRINSAEPAIGTPPPL
                     PPAPQGSLPPKVTDLAAAHEKALEKKDEKKKPTGPLPARVWASVKKEAAHYWAGTKLL
                     GQEIKISGKLQWKVLNGGTLTRRERRQLRRTTIDLLRLLPFSVFLVVPFMELLLPVAL
                     KLFPNMLPSTFEGEFAANEKQRKLLRVRIEMAKFLQETVRESGLKADSVVRSDEFKEF
                     FRKVRSTGETPNQTDVVRVAKLFHDDITLDNLSRSQLVSMCRYMNINAFGTDNFLKHQ
                     IRSKLEKFRVDDMMIHAEGVDSLSTKELQHACQSRGIRFLGVSPARLREELEKWIELH
                     YINGISGVLLVLSRAFNFEQKGDDIMESLVITLSSLPENLLNEAELHVLDEASYKQKL
                     EVLQQQQELIEDEAEQEKEEQDALKEEQEKKEAEETARREQEEADKAVEVSPAAKEEE
                     TSKEQVEESVQPAPDQKDARMSEEQLSEIAEALSVLTARSSIMKERDELKSLLEDNLL
                     SEAESKERQEGASPTVAVSKRVRAMIKKIDTQLEKYDERVDSSLNVIKTTPLGQIPLE
                     DLKKALKEMKHRPAD"
     misc_feature    780120..780265
                     /note="G-rich"
     gene            <780546..781440
                     /locus_tag="CNC02710"
                     /db_xref="GeneID:3256745"
     mRNA            join(<780546..780843,780933..781007,781067..781124,
                     781201..781279,781346..781440)
                     /locus_tag="CNC02710"
                     /product="sterol metabolism-related protein, putative"
                     /transcript_id="XM_569568.1"
                     /db_xref="GI:58264823"
                     /db_xref="GeneID:3256745"
     mRNA            join(<780546..780843,780933..781001,781064..781124,
                     781201..781279,781343..781375)
                     /locus_tag="CNC02710"
                     /product="sterol metabolism-related protein, putative"
                     /transcript_id="XM_569567.1"
                     /db_xref="GI:58264821"
                     /db_xref="GeneID:3256745"
     CDS             join(780546..780843,780933..781007,781067..781124,
                     781201..781273)
                     /locus_tag="CNC02710"
                     /codon_start=1
                     /product="sterol metabolism-related protein"
                     /protein_id="XP_569568.1"
                     /db_xref="GI:58264824"
                     /db_xref="GeneID:3256745"
                     /translation="MSLSNPLNLLLVPPLLFLAYRILVPPPPHTPPEYNSLPAEHPHV
                     ICHSTFTPAQLAQYDGTNGDRILLAIMRVAPDGKIDPNGERTVFDVTAGRTFYGPDGV
                     YGNFAGRDASRGMAKQSFEPGKFLTSIDEPLDDLSDLTPSEIENMRGWHQHFEGKYIV
                     CGELVNG"
     CDS             join(780546..780843,780933..781001,781064..781124,
                     781201..781273)
                     /locus_tag="CNC02710"
                     /codon_start=1
                     /product="sterol metabolism-related protein"
                     /protein_id="XP_569567.1"
                     /db_xref="GI:58264822"
                     /db_xref="GeneID:3256745"
                     /translation="MSLSNPLNLLLVPPLLFLAYRILVPPPPHTPPEYNSLPAEHPHV
                     ICHSTFTPAQLAQYDGTNGDRILLAIMRVAPDGKIDPNGERTVFDVTAGRTFYGPDGV
                     YGNFAGRDASRGMAKQSFEPEVLTSIDEPLDDLSDLTPSEIENMRGWHQHFEGKYIVC
                     GELVNG"
     repeat_region   780569..780599
                     /rpt_type=tandem
                     /rpt_unit_seq="tcc"
                     /satellite="microsatellite"
     gene            complement(781526..783271)
                     /locus_tag="CNC02720"
                     /db_xref="GeneID:3256503"
     mRNA            complement(join(781526..781762,781831..781899,
                     781961..782045,782115..782201,782287..782371,
                     782422..782444,782518..782671,782731..782798,
                     782862..782953,783014..783108,783173..783271))
                     /locus_tag="CNC02720"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41564323|gb|CF710164.1,gi|41564326|gb|CF710167.1"
                     /transcript_id="XM_569569.1"
                     /db_xref="GI:58264825"
                     /db_xref="GeneID:3256503"
     CDS             complement(join(781548..781762,781831..781899,
                     781961..782045,782115..782201,782287..782371,
                     782422..782444,782518..782671,782731..782798,
                     782862..782953,783014..783108,783173..783237))
                     /locus_tag="CNC02720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569569.1"
                     /db_xref="GI:58264826"
                     /db_xref="GeneID:3256503"
                     /translation="MVNLADLSNSLASQDFTSIPVIDLSDAQSPSLQKRKAVAAEIRN
                     ACLNAGFFYVKNHGVPLQVVDRTFEQSKEFFNQPDGLKKSVDISKSGGNFRGYMGLLS
                     ENNDPKNKGDMHEAFNMGLDPSVDASAFIQDVKEGELRHSENLWPDKKDWQGADVFKQ
                     ANLDYYKEVLGLGQSLFPLFALALDLPEDFFSDKIEHPAAIMRILFYPALGERQVDEL
                     MPGIGAHTDFECFTILRQDDVPSALQVQNRKGQWIDAPYMPDTFVINIGDQFARWTND
                     IFVSTRHRVLPALSKDRYSIPFFFGCDHDVPLIPPDTCVTADRPAKYETMTAGAYVHM
                     RLSDIYKVKET"
     STS             782680..783157
                     /standard_name="Eco19"
                     /db_xref="UniSTS:470772"
     gene            783523..785410
                     /locus_tag="CNC02730"
                     /db_xref="GeneID:3256443"
     mRNA            join(783523..783577,783622..784367,784421..784738,
                     784792..785007,785061..785410)
                     /locus_tag="CNC02730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569570.1"
                     /db_xref="GI:58264827"
                     /db_xref="GeneID:3256443"
     CDS             join(783542..783577,783622..784367,784421..784738,
                     784792..785007,785061..785343)
                     /locus_tag="CNC02730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569570.1"
                     /db_xref="GI:58264828"
                     /db_xref="GeneID:3256443"
                     /translation="MPPAQLCQRCNQPMQLDPSVAEITPAQYSLIVSSLPPPSPATSS
                     SSSTPRDLTHKLADLPPFTREAAKIWRDANDPPLSGDSSIQTGLRSVAESFILLSDSA
                     LHPKSSKSPSKSLPPHDLDLSAQLHQILSSNTPVSHPLCTECTALLTAEFQRMAEELG
                     KERDAYIWFEQAIRKNKELLETAESSRRTVSTRHVDGLAKYDVEGTEEEWGALLKRKE
                     QLEIEEEQLKRLLELTEKELEAVLEEERLVELEAKAVEQEENDFLTSHSALSIHLTQL
                     ASTLNTAHTSLLLSRSLLAHLESTNVYNDAFHIGHVPLLPLASSSITVGTINGLRLGG
                     RPVVEWDEINAAWGLAALCLHRIAEKVGCVFETYKIVPLGSYSRVEELPPSKSTYELY
                     ASSDMTPARLLQNRRFNHAMVAFLECLRQLLEFGKKHGKQWAQANIDICKDKISNHSI
                     RLPGISSMPLGLPSMAIMSLAGNGPNHPGTNGSNGKSQSGSSTGDSTAEEGWTRACRT
                     VLGVLKRVLIMESETDRGNINEQS"
     gene            complement(785377..789735)
                     /locus_tag="CNC02740"
                     /db_xref="GeneID:3256222"
     mRNA            complement(join(785377..787264,787313..788303,
                     788963..789735))
                     /locus_tag="CNC02740"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534362|gb|CF680203.1,gi|41534647|gb|CF680488.1,
                     gi|41554468|gb|CF700309.1"
                     /transcript_id="XM_569571.1"
                     /db_xref="GI:58264829"
                     /db_xref="GeneID:3256222"
     CDS             complement(join(785427..787264,787313..788303,
                     788963..789574))
                     /locus_tag="CNC02740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569571.1"
                     /db_xref="GI:58264830"
                     /db_xref="GeneID:3256222"
                     /translation="MGPLSLLKGQAAISQAENWDDDFEFSLSFPIDYNNSTATLKENK
                     YQNMYDRNGDIPSSVRPKSLSLSPTKPGRSGAPSCPKITAPLHTPCPQSPRHSPSYPS
                     DFTSFPSKTKPSSSNPDPVSPPLLSTRSNAYLPQRHGRGFRSRAGSTTAINGDVAPKK
                     LTKRCPSASFIPIPSSHSSRSLRRNDSATSLSCSLHRSATCPDLSYSRGFHLPSPSLG
                     SPYRRARKSLHIPEHPLPESSSLHIMAPGQTPGGNASICFSMRSESPSEAKIIDVKAP
                     RKRVKEPHSFFPASSVEMAEKLRNDNEAVAMANTRPYTTGDCPTAGSPDNLNAVTAHP
                     TLVRFGRKTSGNGHTGAGSSGASFTSTVRRLGSISKKHGRRISGGWKFGAQPSSSSAS
                     LTLQEVKPTGAVFDQSRAEEEARLGTVMGSPVKEDVTKLADDELVKQAMGSECTKNCG
                     TRQDRRSPPSEQWDQDFPLESEFQHIGPSINGSSLIRPESKRREDKNRRRQSWNDFVI
                     PRNVMEKQREVKEGIGAIKMFARGVESLKSLIAAHASLSNQLHSHKSSSPDSLRFDAL
                     HAEFAQWWEMAIVLVEVGSTGRDDNSHGPIDGSKRERRVTLATEEARIAEDAPRHVSG
                     SITSTEMSSVPSEGGLMASGHRNISLPETVEHLPSLRSPPRASPPPEHWRASTGRQNL
                     SKRQLEVLRTMLRTPVSESSKGVDMTGHQESTQRADYEAVNATKTKKGGNASKAITSM
                     APKSQNDLPIGVDLLQERRAEPLNATIKSRRRYTSKVGLAGLKEFLRSLRMERSTGKA
                     DEQNLSLTTIKSQAHGVEDIAAVIRSRSSATNPSTATEGSALLEHPSSFRSASPTGHS
                     CEVSHNSISVRNLQIEPSSSKQVLMPDKSRSKSSSRVRQIPSTASPSVLSKSTQNPRL
                     EPKRPSIRNIFRTSSGNWSELISLNSGSPAPSSTKNSSPALRKSDSMRRTFGQVSEAK
                     DRPERGEKVDNDSAEAKAAKMGSFKGHDELSVDGRGLILIGDPPPGTYIRSKPPTETS
                     ATVKQLGVEEEMTLKPSKKTRATGLGWPERKAEGGDIKDFISPVFSGISNTTQVSSTP
                     MMGQREDSEGNVVVALTPDNLPTLLEYMKQCEVKLHEWKKKVQMEGLDKELIMNSVKA
                     "
     gene            <792864..794012
                     /locus_tag="CNC02750"
                     /db_xref="GeneID:3256304"
     mRNA            join(<792864..792931,793001..793106,793175..793303,
                     793374..793593,793642..793758,793822..794012)
                     /locus_tag="CNC02750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569572.1"
                     /db_xref="GI:58264831"
                     /db_xref="GeneID:3256304"
     CDS             join(792864..792931,793001..793106,793175..793303,
                     793374..793593,793642..793758,793822..793973)
                     /locus_tag="CNC02750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569572.1"
                     /db_xref="GI:58264832"
                     /db_xref="GeneID:3256304"
                     /translation="MESKTFLKNALAQKKPGLGFWCTLPGAATVATALSAGGFNWTLI
                     DAEHGMITDKDYFELVTTVTSLGASPIIRIPWNEEWMIKRALDAGAQGVMTPMCHSAE
                     DAKRIVSYSKYPPTGSRGYGPMFCPPVFGCKGSDYDAGADKNLLVIVQIESRKGVENV
                     EEIAKVEGLDCLFIGPFDLSKQMNVPFGGEEHEAAIEKTLQAAHSAGKIAAIFCSNGE
                     IARKRLAQGFDMVSIAVDSSCLAAEMERQLSLVTGEAGKGDRSYS"
     gene            complement(794157..795797)
                     /locus_tag="CNC02760"
                     /db_xref="GeneID:3256455"
     mRNA            complement(join(794157..794317,794369..794431,
                     794490..794619,794675..795049,795116..795195,
                     795261..795335,795388..795623,795727..795797))
                     /locus_tag="CNC02760"
                     /product="glyoxylate reductase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41562871|gb|CF708712.1,gi|41575356|gb|CF721197.1,
                     gi|41576175|gb|CF722016.1"
                     /transcript_id="XM_569573.1"
                     /db_xref="GI:58264833"
                     /db_xref="GeneID:3256455"
     CDS             complement(join(794256..794317,794369..794431,
                     794490..794619,794675..795049,795116..795195,
                     795261..795335,795388..795623,795727..795743))
                     /locus_tag="CNC02760"
                     /codon_start=1
                     /product="glyoxylate reductase"
                     /protein_id="XP_569573.1"
                     /db_xref="GI:58264834"
                     /db_xref="GeneID:3256455"
                     /translation="MPKILVTRNLGEHAMTILRQSGYDLIVNPDDAPPSREWVLNHLA
                     DPQVYAACIMHSQPSDKVDKELIATANDNLRCISSFSVGYDHIDVKAANARGIKIGHT
                     PGVLSDAVADIAVILVLSTLRRIGEGINLVKSGNWKQQPWAPFVNCGLSIGHPSLTIG
                     FLGFGRISQATVQRLLAFTNKEQPPRILYTSSYRRDNQDEIDAGFSKTFGVEVRREER
                     ETLASQADILIVLCDLNPSTKDLVNKNFLQKMKKSAILVNVARGPIVNSEDLHEALVS
                     GQIFGAGLDVLTGEPDIPADHPLLTLDNCLVLPHLGSADYDTRNAMAERCVRNAIAAA
                     NGEPLVAEVKV"
     gene            796054..797509
                     /locus_tag="CNC02770"
                     /db_xref="GeneID:3256777"
     mRNA            join(796054..796404,796466..796545,796599..796719,
                     796786..796848,796916..797509)
                     /locus_tag="CNC02770"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530915|gb|CF676756.1,gi|41530924|gb|CF676765.1,
                     gi|41542014|gb|CF687855.1,gi|41542028|gb|CF687869.1,
                     gi|41567321|gb|CF713162.1,gi|41568510|gb|CF714351.1,
                     gi|41568520|gb|CF714361.1"
                     /transcript_id="XM_569935.1"
                     /db_xref="GI:58265557"
                     /db_xref="GeneID:3256777"
     CDS             join(796250..796404,796466..796545,796599..796719,
                     796786..796848,796916..797456)
                     /locus_tag="CNC02770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569935.1"
                     /db_xref="GI:58265558"
                     /db_xref="GeneID:3256777"
                     /translation="MFDFIFTFFLATAILAAVMALSVAITLPFAGALVRWRANYNPLA
                     VGLDQESRVGPTLTTLFGTMKRIKRLEGWQGLWKGMYPTLMYSTLLSVLSIVFVGGSA
                     TKGPKNAYSVPEAGGVLMAIFTILLTIISLPMTILINRAIITPYKLPNSVKGSLRILL
                     TPLELSKPYTLYLTPGLLATTMTHVVCATLLARTTRIFFLGVSSVTNDETVGNIAWWR
                     WILYLAWQCLSTLWFTPLEVIATRLSVQPNNSGDALSTEEEAPEGVSFCGAGEDVIGL
                     RPSTEPYLGMADCAKKIIEEEGWASLYRGFLFTMLGSVFGSTV"
     STS             797343..798145
                     /standard_name="Eco23"
                     /db_xref="UniSTS:470773"
     gene            complement(797545..799164)
                     /locus_tag="CNC02780"
                     /db_xref="GeneID:3256320"
     mRNA            complement(join(797545..798199,798256..798509,
                     798558..799164))
                     /locus_tag="CNC02780"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41552723|gb|CF698564.1,gi|41552733|gb|CF698574.1,
                     gi|41553105|gb|CF698946.1,gi|41553110|gb|CF698951.1,
                     gi|41565890|gb|CF711731.1,gi|41565898|gb|CF711739.1,
                     gi|41575171|gb|CF721012.1,gi|41575181|gb|CF721022.1"
                     /transcript_id="XM_569936.1"
                     /db_xref="GI:58265559"
                     /db_xref="GeneID:3256320"
     STS             797621..798379
                     /standard_name="Pvu1"
                     /db_xref="UniSTS:470770"
     CDS             complement(join(797681..798199,798256..798509,
                     798558..799026))
                     /locus_tag="CNC02780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569936.1"
                     /db_xref="GI:58265560"
                     /db_xref="GeneID:3256320"
                     /translation="MAHPLTQQPSSSLPFPFAARPSPLTFGFGLPSTAPSETCTQTSN
                     AHSPYRMAGPAHSSPPKNSFARPRPNQAFTPPTGSLKRTRRSRSPSTSPTGSIQSPRS
                     RSPTPMASRLGHLPPPKNMRTDPSYASKTVKRSKLQNSTSDERSAEGMDVGIMLAALP
                     PSAHLPILLQLLQRDPSLSSTVLGIMPKLEFRSCLKEMEKLFAEIEKLAGPVVNVSFY
                     PGALAESRRWDRVSNNIEVYCRTVATYIKCFTSANQQPAIDCPTLFLFLESHTRHLLT
                     ILSYIPSSSQLDGSSPPPASLVLDLAKLSLTIWTSWVSDLSSDVNDRGGMYPHSAVAH
                     WNDTLEQLVGGIPSPSIPSASNAPGTGSHWSSSTPLTAGNPSPAKLLVSSFQEAFIPI
                     RDQFVSQVGWLIGRQPAMEYH"
     gene            799548..801551
                     /locus_tag="CNC02790"
                     /db_xref="GeneID:3256672"
     mRNA            join(799548..799618,799696..799731,799799..799815,
                     799870..799892,799947..800074,800127..800155,
                     800209..800312,800372..800577,800638..800789,
                     800838..800913,800967..801058,801119..801243,
                     801303..801357,801411..801431,801483..801551)
                     /locus_tag="CNC02790"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569574.1"
                     /db_xref="GI:58264835"
                     /db_xref="GeneID:3256672"
     CDS             join(799601..799618,799696..799731,799799..799815,
                     799870..799892,799947..800074,800127..800155,
                     800209..800312,800372..800577,800638..800789,
                     800838..800913,800967..801058,801119..801243,
                     801303..801357,801411..801431,801483..801507)
                     /locus_tag="CNC02790"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_569574.1"
                     /db_xref="GI:58264836"
                     /db_xref="GeneID:3256672"
                     /translation="MTTIQKIKDIEDEMARTQRNKNTEYHLGQLKAKLAKLRRELIAP
                     SGGGGGGPGIGFDVARSGQATVTVIGFPSVGKSTFMSKLTGTHSEAASYEFTTLTTVP
                     GQMTYNGARIQILDLPGIIEGAKDGKGRGRQVIAVARTCNLIFIVLDVLKPLNDLAIL
                     TNELEGFGIRLNKKPPAITVKKKESGGVAITNTVPLTKIDAQEIRAVLQEYRMSNAAV
                     SIHQPDATIEDFIDVVEGNRVYIPAIFVLNKIDAISIEELDLLYKIPNSVPISSKLWL
                     NIDELLEVMWDKLNLVRIYTKPRGQQPDYSSPVVLQRGKCTVEDFCNAIHKEIVKQFK
                     NAMVWGTSAKHARGQKVGLDHVLEDEDIICIFKK"
     STS             804229..805071
                     /standard_name="Sal1"
                     /db_xref="UniSTS:470803"
     repeat_region   814808..814852
                     /rpt_type=tandem
                     /rpt_unit_seq="cata"
                     /satellite="microsatellite"
     repeat_region   816947..817064
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     repeat_region   822435..822477
                     /rpt_type=tandem
                     /rpt_unit_seq="cata"
                     /satellite="microsatellite"
     repeat_region   842730..842772
                     /rpt_type=tandem
                     /rpt_unit_seq="tatg"
                     /satellite="microsatellite"
     repeat_region   847004..847168
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     repeat_region   847604..847625
                     /rpt_type=tandem
                     /rpt_unit_seq="ta"
                     /satellite="microsatellite"
     repeat_region   848122..848164
                     /rpt_type=tandem
                     /rpt_unit_seq="tatg"
                     /satellite="microsatellite"
     repeat_region   853535..853652
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     repeat_region   860970..861014
                     /rpt_type=tandem
                     /rpt_unit_seq="tatg"
                     /satellite="microsatellite"
     misc_feature    891186..891278
                     /note="G-rich"
     repeat_region   893543..893707
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     STS             901598..901724
                     /standard_name="Taq3"
                     /db_xref="UniSTS:470771"
     misc_feature    901995..902111
                     /note="GA-rich"
     misc_feature    911670..911703
                     /note="T-rich"
     gene            complement(<911882..>913029)
                     /locus_tag="CNC02800"
                     /db_xref="GeneID:3256589"
     mRNA            complement(join(<911882..912202,912263..912348,
                     912408..912577,912643..912687,912738..912869,
                     912926..>913029))
                     /locus_tag="CNC02800"
                     /product="tRNA guanylyltransferase, putative"
                     /transcript_id="XM_569939.1"
                     /db_xref="GI:58265565"
                     /db_xref="GeneID:3256589"
     CDS             complement(join(911882..912202,912263..912348,
                     912408..912577,912643..912687,912738..912869,
                     912926..913029))
                     /locus_tag="CNC02800"
                     /codon_start=1
                     /product="tRNA guanylyltransferase"
                     /protein_id="XP_569939.1"
                     /db_xref="GI:58265566"
                     /db_xref="GeneID:3256589"
                     /translation="MAKSRFEYVKKFELPDPLVPNTYIIVRIDGKGFHKFSDVHSFDK
                     PNDIRALKLMNTAAKAVLNEYKDVVMAFGESDEYSFLLRRTTTLYNRRRSKINSSIVS
                     LFTSAYVFHWASFFPNTPLLYPPSFDARVVLYPNVKEVRDYFSWRQADTHINNLYNTT
                     FWALVHDGLTTAEANKALQGTNSKDKNEILFTKFGINYNTLPEMFRKGSVCVRSLSLE
                     EPQGSLAEQQAAHGIMTLSIVPSTSGNSNTILSQKEKVYQGTEGSPMVLHMDIINDIF
                     WSERPWLLS"
     STS             912488..913277
                     /standard_name="Hind2"
                     /db_xref="UniSTS:470767"
     gene            complement(<914332..>915414)
                     /locus_tag="CNC02810"
                     /db_xref="GeneID:3256468"
     mRNA            complement(join(<914332..914383,914445..914618,
                     914688..915058,915114..915201,915274..915335,
                     915403..>915414))
                     /locus_tag="CNC02810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569575.1"
                     /db_xref="GI:58264837"
                     /db_xref="GeneID:3256468"
     CDS             complement(join(914332..914383,914445..914618,
                     914688..915058,915114..915201,915274..915335,
                     915403..915414))
                     /locus_tag="CNC02810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569575.1"
                     /db_xref="GI:58264838"
                     /db_xref="GeneID:3256468"
                     /translation="MAKQLVQRLSPLIEELLQASDLSTVSAKAIRKELIARGADKYEI
                     KNFRAEIDDKITEIYNSLGSKEAPAPKIEGSVSPSAKAPSSPHSLIEPKTVTRKRKAP
                     TSENEETDEQMARRLQGEYGGSRTRKQRSSRSARPAKKTRPKSHAHIDNETEKNGDKK
                     DDTKTKRGGAFNKELLLSDSLAELVGSHSLSRPQVVKHIWAYVKERNLQDSNDRRYIL
                     CDDKLREVFHTDRLHMFTMNKILVNHLRDPDDIA"
     gene            complement(916122..918174)
                     /locus_tag="CNC02820"
                     /db_xref="GeneID:3256542"
     mRNA            complement(join(916122..916419,916481..916796,
                     916848..916998,917056..917083,917144..917226,
                     917279..917864,917919..918174))
                     /locus_tag="CNC02820"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539399|gb|CF685240.1,gi|41539404|gb|CF685245.1,
                     gi|41545344|gb|CF691185.1,gi|41545357|gb|CF691198.1,
                     gi|41568445|gb|CF714286.1,gi|41568454|gb|CF714295.1"
                     /transcript_id="XM_569576.1"
                     /db_xref="GI:58264839"
                     /db_xref="GeneID:3256542"
     CDS             complement(join(916381..916419,916481..916796,
                     916848..916998,917056..917083,917144..917226,
                     917279..917864,917919..918020))
                     /locus_tag="CNC02820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569576.1"
                     /db_xref="GI:58264840"
                     /db_xref="GeneID:3256542"
                     /translation="MPKDKKIQNAFKRSEVHRKTKREKEQAKLQRRLEIKKAEKDKVT
                     GAALRAERLSKNIPVTLDNTRVYDSSSYLTANPASLQNLAQEAKEASALINENDLMGK
                     QPSKELSNREDSAVLTSGPSSDQEEDADGSSEMSDKEIEEKLDGEDQEASAMRDITTQ
                     SPPRILITTSPSPCKQTYQFCDDLKNVFPGGEFFKRPKGRGFEIGRVSRWASKRGYRA
                     LIVVNEDHKIPNAITLINLPSGPTAYFKLSSITLSSNIYGHARPTPHSPELILNNFTT
                     LLGNSVGRLFGSLFPPQPQFRGRQVVTLHNQRDFLFFRRHRYMFPSATSAKLQEIGPR
                     FTLKLRWLRKGLPSVTAPDGHASIGGDPADEIYGTEVGPSKEEIAQDELDEEDEALKE
                     IGQPAQKKNVYEGTEVPPLDEEQEYEWKWKPKMEVSRRTFFL"
     gene            <918605..921240
                     /locus_tag="CNC02830"
                     /db_xref="GeneID:3256361"
     mRNA            join(<918605..918756,918807..919148,919199..919374,
                     919419..919670,919725..919958,920008..920627,
                     920694..920864,920919..921240)
                     /locus_tag="CNC02830"
                     /product="DNA repair and recombination protein pif1,
                     mitochondrial precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544910|gb|CF690751.1,gi|41544927|gb|CF690768.1,
                     gi|41555349|gb|CF701190.1,gi|41571667|gb|CF717508.1,
                     gi|41571684|gb|CF717525.1"
                     /transcript_id="XM_569577.1"
                     /db_xref="GI:58264841"
                     /db_xref="GeneID:3256361"
     CDS             join(918605..918756,918807..919148,919199..919374,
                     919419..919670,919725..919958,920008..920627,
                     920694..920864,920919..920981)
                     /locus_tag="CNC02830"
                     /codon_start=1
                     /product="DNA repair and recombination protein pif1,
                     mitochondrial precursor"
                     /protein_id="XP_569577.1"
                     /db_xref="GI:58264842"
                     /db_xref="GeneID:3256361"
                     /translation="MPILTARTLSSSNPNNTSKGTLSRVTSFKRSWGEEDGPESSQLD
                     WSPSPEIVQRKGNILPSSGPLQSTTTSPSLPESAAKEIASQRRRKAILAALNQNKETV
                     YASPVLDWRSGQTSSTFASPQDINCDISVPSVATHCPGSSIRHVNQTLPSLPKRPLPW
                     EGDQKARKKVYTQTSLTPKENAQPKSTSSALNIKQRVTLSEEQQKVLSLVVQQQKNVF
                     FTGSAGTGKSVLLREIIHSLRNKYARNPDAVAVTASTGIAACNIGGVTLHSFGGVGLA
                     TDTPEILLRKLKMNKKASGRWTKTKVLIIDEVSMVDGAMFDKFCKLGQLIRKNSKPWG
                     GIQIIVTGDFFQLPPVTKNGGMPKFAFEAEMWDETIHLSVNLTKVFRQKDQRFVDMLN
                     EMRFGRLSNESIIAFKSLARPLKFNDGIEPTALFPRREDVDRANLSRLNQLDSVGFTY
                     HSIDGGSAEANQREKLLSNFMAPKIIELKENAQVMLVKNLDETLVNGSMGKVIGFTYK
                     NMFQCDDLGKWTPDADLKDLEEEDKMKSLAVRQALRDKYQAKGANPLPVVRFKVPGGG
                     TRDVLMEMDVFKAELPNGEVQASRSQLPLILAWAMSIHKSQGQTLDRVRVDLGKVFEK
                     GQAYVALSRATSLEGLQVTGFTAEKVMAHKKVAVWSSTLKDLNLV"
     misc_feature    921272..921313
                     /note="A-rich"
     gene            923394..925580
                     /locus_tag="CNC02840"
                     /db_xref="GeneID:3256808"
     mRNA            join(923394..924762,924819..925084,925144..925580)
                     /locus_tag="CNC02840"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41555801|gb|CF701642.1,gi|41555817|gb|CF701658.1"
                     /transcript_id="XM_569578.1"
                     /db_xref="GI:58264843"
                     /db_xref="GeneID:3256808"
     CDS             join(923396..924762,924819..925084,925144..925523)
                     /locus_tag="CNC02840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569578.1"
                     /db_xref="GI:58264844"
                     /db_xref="GeneID:3256808"
                     /translation="MILPEDTKAPISSDDEFDDDFASLPPSPYLPSRLLPAQDANQQY
                     PFEYPASPSSAVTQPLFLPESDDIELGPAPPYTPNDPFQSQLQRRNERKSYLRGKAGK
                     RFILGIVWGMGLWVGMMGMGALGWRFLGPGSQPRHRGPRQPQSVFPETPPAKDPWLRQ
                     SIECVPFSSTGWAPFSPSDLVGFSDPLEQIKEEQRSLNATFYLPLDSEVFVEMWQGPA
                     AIGPIIFSSYDAHSEEEWKGIDDQGSIVAHDGQGRKPGQGEYVRVIVETIIDVELGAR
                     DELDGQNSAGWEMLAASSVCLNRRGPTINVTLSEEDLDDTVGDGSQNEEHNRFIWDRP
                     TKNGYGVEIVTNHPLESLYPDRKGNPLQFRVHVALPSLATQEHKHDIAPSSSFVRSLD
                     VRAGNSAIYVDGLQDVRIGELSLFSEFGEVTLQKPRLENLMVRTTGKVVGEVAVSNDM
                     TIDTPIGEIHLNISLAAPPRFNLINCPTSESVHQSASDVPHLLTPGPPPFMSTLPPVN
                     VNVRSGGDRVIVHYADWEVPCRDLRMDVFSLIGDVQIFPHPLFQGPFRLMTSKGPINV
                     DLGNALIPDPEGLGRWRNITLEERDRMGSHFYLGNVAWQAESVANHLDQSTHEVISVS
                     LPVDGQGIVDRKMHPSSAEDHGSRPDSKTERGIHVRTSVGAINVTF"
     gene            926386..927944
                     /locus_tag="CNC02850"
                     /db_xref="GeneID:3256800"
     mRNA            join(926386..926499,926570..926643,926707..926896,
                     926947..927458,927515..927637,927695..927944)
                     /locus_tag="CNC02850"
                     /product="2-hydroxyacid dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532793|gb|CF678634.1,gi|41532803|gb|CF678644.1,
                     gi|41533894|gb|CF679735.1,gi|41533911|gb|CF679752.1,
                     gi|41534948|gb|CF680789.1,gi|41534956|gb|CF680797.1,
                     gi|41539713|gb|CF685554.1,gi|41539720|gb|CF685561.1,
                     gi|41565193|gb|CF711034.1,gi|41575895|gb|CF721736.1,
                     gi|41575902|gb|CF721743.1"
                     /transcript_id="XM_569579.1"
                     /db_xref="GI:58264845"
                     /db_xref="GeneID:3256800"
     CDS             join(926472..926499,926570..926643,926707..926896,
                     926947..927458,927515..927637,927695..927775)
                     /locus_tag="CNC02850"
                     /codon_start=1
                     /product="2-hydroxyacid dehydrogenase"
                     /protein_id="XP_569579.1"
                     /db_xref="GI:58264846"
                     /db_xref="GeneID:3256800"
                     /translation="MSKPQVLIAANPKTGIVWSKEEQSSKLGAVAEVLELASASRSEF
                     FQDLAPNGKYANIVAIYRHNDSVSAIGLFDEELINKLPASVKYICHNGAGYDQIDVAA
                     CTARGIQVSHTPQAVDDATATVGAFLAISAMRQFWRAEVNVRSGKWKAGLSPARDPEG
                     KTLGIIGMGGIGSALARRLLAFDMKVIYYNRRPIQPPPNFPCTYVSSIEELLKQADVV
                     SLNLPLNEKTKGSFGRQEFGLMKDGSVLINTARGAVIDEEAFIEALESGKLYSAGIDV
                     YPDEPNVNPKLLAMDNITLLPHMGTETRDSQKKMELLVLDNMISALAGKGLLNQVPEQ
                     K"
     gene            complement(928125..931450)
                     /locus_tag="CNC02860"
                     /db_xref="GeneID:3256590"
     mRNA            complement(join(928125..929665,929730..930699,
                     930757..931159,931222..931450))
                     /locus_tag="CNC02860"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537334|gb|CF683175.1,gi|41537341|gb|CF683182.1,
                     gi|41538357|gb|CF684198.1,gi|41538365|gb|CF684206.1,
                     gi|41564345|gb|CF710186.1,gi|41564358|gb|CF710199.1"
                     /transcript_id="XM_569581.1"
                     /db_xref="GI:58264849"
                     /db_xref="GeneID:3256590"
     CDS             complement(join(928323..929665,929730..930699,
                     930757..931159,931222..931448))
                     /locus_tag="CNC02860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569581.1"
                     /db_xref="GI:58264850"
                     /db_xref="GeneID:3256590"
                     /translation="MHRRQATRISPTATPSSLLSPIVSHFPALSVISPFKALRQSPSS
                     DHHHPTLASPPRLELTKAVWQEADLGDGKGIVPLLLLTSPTSALQIFSVPTPVASQDP
                     RSSESFSDPEEVFAMSTITYDSSLYQCSLSGVNDGDPLPFSAHNETVLDMALMEGGRV
                     ALVTCHSNKTFIGPLALVVVNLKSGRAEARVDLGAGSTADVHVSHKVIVITVSHPTPS
                     IHFLDPASFTPLFPPIVDAAPNALTQLPTIALSGRILAYVTSTPANISTPSDMGSLVT
                     SSSLRASHSRNRQGPSSQVESHQGALISSAVEIGGGVARGVWAGIKLGAKAASAATRA
                     RSDRLAQSAPDDTTAFGRDQEAAILGDTESRSLDEGSMLDEALPISAANAKSIDKGEW
                     IHVIDLFSRHPSSTRQVSPPGNVTSKSTPSFTTVAHFRLPPSSVVPIDTSHSSQYHSL
                     PVQHLSFSPSGTALLAAPADGRSFHIMEFHPAGPMKGNTRTGTQSQAWHLYELKRGHT
                     IANVRWTSWDRMGNWVGVGTDRGTIHIYPIHPSGGQPSAFTHVAGCRNAQRLFALSIP
                     VSPIARIRPPRLAMDTSHLDGSLDSDLTYSENSVFGFLPYRQHQKLDQKHIQDIGIFR
                     WPSGVLELIRMAVRGCREDDSEAGVAKYSSRSPPHRTRSALTELMLSRAVRERNSFAA
                     EKAAQARWVLPSAVAMSAPTLLSSTIAEKSQPSRVGALAAAEIRTHHFNPHVLPSSIY
                     LSRQIEFFSARPIDDYSPLSILDLEARTDKLVFRQEVEARSPPNEDTEAPLSFDRPLL
                     SALHDLIESPSDRQIPGLPNGHGRTGIWTGDPIQTVKYGFNEGVDRVRREYVRAQLVK
                     EHKLTKQNKETSGLSLSFEDDAVLAVSSSDLRLDNLSLDQSEPAAVSGRSSSIHTSEN
                     LTSPPGSGDLPPTKVDSSDGDSQWGEVWEEEYRKAVEDDGGPDDLVLGLLDEEEDERR
                     QWEARQKL"
     STS             929141..929661
                     /standard_name="Bam11"
                     /db_xref="UniSTS:470768"
     gene            932042..934374
                     /locus_tag="CNC02870"
                     /db_xref="GeneID:3256174"
     mRNA            join(932042..932144,932856..932990,933046..933240,
                     933294..933395,933446..933615,933674..933768,
                     933820..934031,934087..934374)
                     /locus_tag="CNC02870"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535857|gb|CF681698.1,gi|41537676|gb|CF683517.1,
                     gi|41537682|gb|CF683523.1,gi|41538602|gb|CF684443.1,
                     gi|41538919|gb|CF684760.1,gi|41539718|gb|CF685559.1,
                     gi|41541665|gb|CF687506.1,gi|41541678|gb|CF687519.1,
                     gi|41541995|gb|CF687836.1,gi|41553076|gb|CF698917.1,
                     gi|41555621|gb|CF701462.1,gi|41555720|gb|CF701561.1,
                     gi|41556789|gb|CF702630.1,gi|41557470|gb|CF703311.1,
                     gi|41557932|gb|CF703773.1,gi|41568443|gb|CF714284.1,
                     gi|41569647|gb|CF715488.1,gi|41570117|gb|CF715958.1,
                     gi|41574092|gb|CF719933.1,gi|41574166|gb|CF720007.1"
                     /transcript_id="XM_569584.1"
                     /db_xref="GI:58264855"
                     /db_xref="GeneID:3256174"
     mRNA            join(932042..932144,932856..932990,933046..933240,
                     933294..933395,933446..933615,933674..933764,
                     933816..934031,934087..934374)
                     /locus_tag="CNC02870"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533226|gb|CF679067.1,gi|41533236|gb|CF679077.1,
                     gi|41535857|gb|CF681698.1,gi|41537676|gb|CF683517.1,
                     gi|41537682|gb|CF683523.1,gi|41538593|gb|CF684434.1,
                     gi|41538602|gb|CF684443.1,gi|41538910|gb|CF684751.1,
                     gi|41539712|gb|CF685553.1,gi|41539718|gb|CF685559.1,
                     gi|41541401|gb|CF687242.1,gi|41541409|gb|CF687250.1,
                     gi|41541678|gb|CF687519.1,gi|41541984|gb|CF687825.1,
                     gi|41541995|gb|CF687836.1,gi|41547045|gb|CF692886.1,
                     gi|41548056|gb|CF693897.1,gi|41548063|gb|CF693904.1,
                     gi|41551777|gb|CF697618.1,gi|41553069|gb|CF698910.1,
                     gi|41553076|gb|CF698917.1,gi|41555093|gb|CF700934.1,
                     gi|41555614|gb|CF701455.1,gi|41555621|gb|CF701462.1,
                     gi|41555713|gb|CF701554.1,gi|41555720|gb|CF701561.1,
                     gi|41556779|gb|CF702620.1,gi|41556789|gb|CF702630.1,
                     gi|41557457|gb|CF703298.1,gi|41557470|gb|CF703311.1,
                     gi|41557924|gb|CF703765.1,gi|41557932|gb|CF703773.1,
                     gi|41559355|gb|CF705196.1,gi|41559360|gb|CF705201.1,
                     gi|41559869|gb|CF705710.1,gi|41567385|gb|CF713226.1,
                     gi|41569637|gb|CF715478.1,gi|41569647|gb|CF715488.1,
                     gi|415"
                     /transcript_id="XM_569583.1"
                     /db_xref="GI:58264853"
                     /db_xref="GeneID:3256174"
     CDS             join(932118..932144,932856..932990,933046..933240,
                     933294..933395,933446..933615,933674..933768,
                     933820..934031,934087..934137)
                     /locus_tag="CNC02870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569584.1"
                     /db_xref="GI:58264856"
                     /db_xref="GeneID:3256174"
                     /translation="MSATEQVNQAPAETANALVAEATPPSQEAKEIFKAQEPVSEVAA
                     PNITEPLVKEQPTVANTEAGTAQPGPELGNKVDNTEADKLVEGTTTGEGAKTTEEVPK
                     PSEIKEGKKEVKKSAVKERTEKTKAEGKGFFAKFFGNRDKSPKKEKKKTPKAEKADPV
                     TAAAPVETEGDDAAPPSVPTTSEPVIGTSAPIEAVEPTVKSPDTGALKGIDTATSADA
                     PAEVAPAPEENKIEDKKDEAKDATAKSNLKAHRRLSARIGDIFKPKKKEGIPTSTEET
                     SKEEATKPLNEAPVVASEAPKLEQPVATAPLELEEEPKATQPPAAAPVAASA"
     CDS             join(932118..932144,932856..932990,933046..933240,
                     933294..933395,933446..933615,933674..933764,
                     933816..934031,934087..934137)
                     /locus_tag="CNC02870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569583.1"
                     /db_xref="GI:58264854"
                     /db_xref="GeneID:3256174"
                     /translation="MSATEQVNQAPAETANALVAEATPPSQEAKEIFKAQEPVSEVAA
                     PNITEPLVKEQPTVANTEAGTAQPGPELGNKVDNTEADKLVEGTTTGEGAKTTEEVPK
                     PSEIKEGKKEVKKSAVKERTEKTKAEGKGFFAKFFGNRDKSPKKEKKKTPKAEKADPV
                     TAAAPVETEGDDAAPPSVPTTSEPVIGTSAPIEAVEPTVKSPDTGALKGIDTATSADA
                     PAEVAPAPEENKIEDKKDEAKDQAAKSNLKAHRRLSARIGDIFKPKKKEGIPTSTEET
                     SKEEATKPLNEAPVVASEAPKLEQPVATAPLELEEEPKATQPPAAAPVAASA"
     gene            complement(934430..>935388)
                     /locus_tag="CNC02880"
                     /db_xref="GeneID:3256597"
     mRNA            complement(join(934430..934658,934717..935054,
                     935130..>935388))
                     /locus_tag="CNC02880"
                     /product="expressed protein"
                     /transcript_id="XM_569988.1"
                     /db_xref="GI:58265663"
                     /db_xref="GeneID:3256597"
     CDS             complement(join(934452..934658,934717..935054,
                     935130..935388))
                     /locus_tag="CNC02880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569988.1"
                     /db_xref="GI:58265664"
                     /db_xref="GeneID:3256597"
                     /translation="MSLSAPTRILRKPTLSRQFSTSLPVLASRGSSKPEGLGARSRPW
                     SVQNVPKFAFDDATSLGWMRMFRIQEGEGLVRKIEEDREALRTANQTKFTPPTAPIRL
                     TSTIDLARPDSRYHTKCVLLVPIAALPLSTPEAVHRFKLLAGPRWTPGKPGRNEFIKD
                     ENSDGENGWIKVSEERFESARQNRRSASDILERLVNAANDRESPLPADLPIDTRHLLA
                     RHRKKRSRQNTFKWAPGQEFLSRHQEVGGVRGFPVSWLPEELRERVSKK"
     gene            <937170..>938224
                     /locus_tag="CNC02890"
                     /db_xref="GeneID:3256129"
     mRNA            join(<937170..937460,937663..937952,938014..>938224)
                     /locus_tag="CNC02890"
                     /product="phosphatase activator, putative"
                     /transcript_id="XM_569586.1"
                     /db_xref="GI:58264859"
                     /db_xref="GeneID:3256129"
     CDS             join(937170..937460,937663..937952,938014..938224)
                     /locus_tag="CNC02890"
                     /codon_start=1
                     /product="phosphatase activator"
                     /protein_id="XP_569586.1"
                     /db_xref="GI:58264860"
                     /db_xref="GeneID:3256129"
                     /translation="MAIPASSNPITSVSPNSSPITSVSPNNYAASPLYPSATNPQLLS
                     RLNLDLRGTIFPVEREMLMLLPESVLLGLFPQGLILSKPASWEGADDGIFTVDRIPTI
                     DALSDHSQNPLLSKQAIIVLREELEYFSITKPGAAARTDIATGLANEDLRVLKRNCGR
                     ALEEKKAIFAALERNVNNSANLAERHLIDMLCVSGFNRDDEWGYRACEPQRNVISSMA
                     LVLLKTGINHREDDKEGPPEIDPVQMGTAQKLLLFWRKPAVRMLP"
     gene            complement(938884..939697)
                     /locus_tag="CNC02900"
                     /db_xref="GeneID:3256495"
     mRNA            complement(join(938884..939062,939153..939266,
                     939322..939376,939633..939697))
                     /locus_tag="CNC02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_569987.1"
                     /db_xref="GI:58265661"
                     /db_xref="GeneID:3256495"
     CDS             complement(join(938973..939062,939153..939266,
                     939322..939376,939633..939676))
                     /locus_tag="CNC02900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569987.1"
                     /db_xref="GI:58265662"
                     /db_xref="GeneID:3256495"
                     /translation="MRPTAPAHSGMPGRKLVGGVTWEDPSKRVSRHMVSPLTANAPLP
                     VCSVPMSSTVPSERCNNFLTSPPLLFSSTASTTGQRPSTTTTTPSRATMTTSSRRV"
     gene            <939748..940218
                     /locus_tag="CNC02910"
                     /db_xref="GeneID:3256182"
     mRNA            join(<939748..939876,939957..940069,940117..940218)
                     /locus_tag="CNC02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_569588.1"
                     /db_xref="GI:58264863"
                     /db_xref="GeneID:3256182"
     CDS             join(939748..939876,939957..940069,940117..940216)
                     /locus_tag="CNC02910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569588.1"
                     /db_xref="GI:58264864"
                     /db_xref="GeneID:3256182"
                     /translation="MRRRRFGKLRVCACGLAHPHIFTLPLPPRLPLPLPPTNHVPPHV
                     SHAARTALTPPAFHGHAYAAIGFGVLGAGAYHVDQKQTALLAKKKKAMLEQREIENRE
                     WAARKGEAHAV"
     repeat_region   939817..939853
                     /rpt_type=tandem
                     /rpt_unit_seq="ccccct"
                     /satellite="microsatellite"
     gene            complement(941419..943008)
                     /locus_tag="CNC02920"
                     /db_xref="GeneID:3256235"
     mRNA            complement(join(941419..941725,941794..942522,
                     942579..943008))
                     /locus_tag="CNC02920"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542929|gb|CF688770.1,gi|41542936|gb|CF688777.1"
                     /transcript_id="XM_569590.1"
                     /db_xref="GI:58264867"
                     /db_xref="GeneID:3256235"
     CDS             complement(join(941667..941725,941794..942522,
                     942579..942756))
                     /locus_tag="CNC02920"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_569590.1"
                     /db_xref="GI:58264868"
                     /db_xref="GeneID:3256235"
                     /translation="MPAPVPPTAFAQPSGPATQLVLGSMQRAPEYQALLTSLKSAAPP
                     SSSVQGEMVDRILDNATTLPPPPLTIHLVLPLPLPSNLLSAIPPSTQIFIHIPADSES
                     QLGALHSALASHSFTPVLPTPSPSTLAYTSPSAPSLPAVASEPSPAPSSSTPVTLSGA
                     RPLQLRRNGDKARKAALWAIDSPLIPDGGKSLLTPADRTRPDCVFPAENGKPVKRRRA
                     CKDCTCGLKELEQEEEAQTSAAVQEAQKAFFLEGDDDIPENLKKATEGMEGIWPADKR
                     AEAKKTSSCGSCYLGDAFRCSSCPYLGLPPFKPGEQVQVSIGDDI"
     gene            944130..944878
                     /locus_tag="CNC02930"
                     /db_xref="GeneID:3256775"
     mRNA            join(944130..944627,944690..944878)
                     /locus_tag="CNC02930"
                     /product="expressed protein"
                     /transcript_id="XM_569940.1"
                     /db_xref="GI:58265567"
                     /db_xref="GeneID:3256775"
     CDS             944296..944523
                     /locus_tag="CNC02930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569940.1"
                     /db_xref="GI:58265568"
                     /db_xref="GeneID:3256775"
                     /translation="MTSIAQPINFPSRPSYSTTASPSNSPSRSNSYDLSSSPKMGSSP
                     GQHPCPHLSEFVQSLYKAWGSKSDIQERRRW"
     gene            complement(946617..947306)
                     /locus_tag="CNC02940"
                     /pseudo
                     /db_xref="GeneID:3256617"
     gene            947321..951090
                     /locus_tag="CNC02950"
                     /db_xref="GeneID:3256486"
     mRNA            join(947321..947418,947486..947531,947929..948099,
                     948331..949306,949361..949466,949529..949728,
                     949781..950160,950218..951090)
                     /locus_tag="CNC02950"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532987|gb|CF678828.1,gi|41532992|gb|CF678833.1,
                     gi|41566601|gb|CF712442.1,gi|41566612|gb|CF712453.1"
                     /transcript_id="XM_569592.1"
                     /db_xref="GI:58264871"
                     /db_xref="GeneID:3256486"
     CDS             join(948350..949306,949361..949466,949529..949728,
                     949781..950160,950218..950752)
                     /locus_tag="CNC02950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569592.1"
                     /db_xref="GI:58264872"
                     /db_xref="GeneID:3256486"
                     /translation="MTSMIHTQSFDGGRTQGGLHTSPAASPRSDRPHSQSSLHIAPQS
                     TYSPPLPTQSPHPISAYPVQAYRPYPQGVSLQLPNLMNSTYPSTAPALPFYPAGPTPM
                     YDSRGPQQMIRTISHAHPMNSATEQTISSRYSSSPHSVHEHLGDAPSITGGDQPNPWG
                     HPAFHVQTEDDRSINPSMFGPGGDYSMSRSTSGASDSGHDTMRLLTPSLDYRPDRRSP
                     HELDLRKVSDSLGDKKHFSQVAFTPHFDLQSHSLGLGPHPQPENMFFGDRGYSNTSFN
                     LSSERIAGKDTDLTGETEYERERAEQIVNNRKLLEDVGLGSHSLSFGSRHMSGTKGSD
                     SKKNRKVSTPAKKRLQLEGPVRASPRIRSMGRNISYANLDGGSASDNDEYSSEQDPEE
                     EEEFRPSKRSRGQMGFRQKSSSYSQSSNKASSKPQLSLWGLLQVYPEIPHLFPLFYYT
                     LNNDLTINSDSVPLIGSIPSNCTPVAKAETLQAYFHRGRRVLSQLDAFTSRCDRKYEG
                     PEVRWPELDYHTRIAIRDVRRKVVERCENYKYTRRDILDKHVGKGKWQSIEQGMIEWR
                     AGMTVNDPANDLANVTLTLPTPPPNAYGHQIRQQPTPALYSDRVFKPFPQGRRPTSIA
                     PRTVSVMMAEPDEQAPFTYPPTANSAVEFYGYAPQQPPIPPMYGEDQVPMSVQMPESV
                     TAGPTGASLDQANKEASASWGESRGLKRARDDDQVGVSNDNEG"
     gene            951313..955573
                     /locus_tag="CNC02960"
                     /db_xref="GeneID:3256515"
     mRNA            join(951313..951411,951489..951709,951764..951800,
                     951857..951995,952046..952127,952177..952431,
                     952480..952814,952866..953032,953089..953698,
                     953755..954464,954533..954677,954787..955573)
                     /locus_tag="CNC02960"
                     /product="ATP dependent helicase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41573571|gb|CF719412.1,gi|41573577|gb|CF719418.1"
                     /transcript_id="XM_569594.1"
                     /db_xref="GI:58264875"
                     /db_xref="GeneID:3256515"
     CDS             join(951379..951411,951489..951709,951764..951800,
                     951857..951995,952046..952127,952177..952431,
                     952480..952814,952866..953032,953089..953698,
                     953755..954464,954533..954677,954787..955325)
                     /locus_tag="CNC02960"
                     /codon_start=1
                     /product="ATP dependent helicase"
                     /protein_id="XP_569594.1"
                     /db_xref="GI:58264876"
                     /db_xref="GeneID:3256515"
                     /translation="MEFSNFEGASQYGPDIDDNTSLYSSIPPSVVTAPTISGDIASQL
                     GDLNLGETTSGHAAAGQVYIDDFDEEIERNSFGEGVEHACSYCGIHNPQCVVKCLHCN
                     KWFCNSRGNTSASHIVNHLVKAKHKEVILHKESALGDTIPECYNCGSKNVFMLGFIPA
                     KSDTVVVLLCRQPCAALTSSRDINWDTSQWSAIIDDRQFLSWLVKVPSEAEQLRARQI
                     SLAQISKLEELWRENPNAKLEDAEAQSGEEEMQPILLKYEDAYQYQNILGPLVKVEAD
                     YDKRMKESQTENDITIRWDMGLNQKRLAWFCMPKLESGEVRLAVGDELKLKFAGTTSS
                     VGIKGLQAFNKAGWGSSGDAVWEGVGSVVKIPNNASDEICLELRRNDGVPFDCTHGFS
                     VDFIWKSTSFDRMQAAMKTFAIDEKSVSGYIYHKLLGHEVEPQVLRTQMPKRFAAPNL
                     PELNHSQMSAVKAVLQKPLSLIQGPPGTGKTVTSASIVYHLAKMNPGQVLVCAPSNVA
                     VDHLCEKIHQTGLKVVRLAAKSREALDSSVDFLSLHSQVANADTHHELQKLIQLRNDQ
                     GELSQSDERKYKALVKACEKDILNAADVICTTCVGAGDPRLAKFKFRTVLIDEATQSA
                     EPECMIPLVMGCKQAVLVGDHQQLGPVIMNKKAARAGLSQSLFERLVILGNHPIRLQV
                     QYRMHPCLSEFSSNLFYEGTLQNGVTAPERLRKHVDFPWPVADTPMFFHQNLGTEEIS
                     SSGTSFLNRTEASNVEKMVTKFFKSGVLPNQIGVITPYEGQRSYIASYMQLHGSLKKD
                     LYKEVEVASVDAFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGVVILG
                     NPKVLSKHPLWLYLLSHYKEKGCFVEGPLSNLQPSMVQFSRPKKSLAAAMDPFKRHMG
                     HGQAQSAAANRFDPAYYRTHNPLSFIPSDAQSVVSQAMTSSAFPLFGGVGGGVGGGGG
                     GGKNKTYTGYASSVVSQQPIDGGNASAFAPPRAGQSQFDRFASIVGSAGSAGSAGAGG
                     AGVGAGGGGGGGGGNVMMGKGRRLSIGSEAASASMYAYGYKAGEDDTQSIAPSQAGMT
                     EF"
     repeat_region   954933..954973
                     /rpt_type=tandem
                     /rpt_unit_seq="tgg"
                     /satellite="microsatellite"
     repeat_region   955127..955184
                     /rpt_type=tandem
                     /rpt_unit_seq="cggggg"
                     /satellite="microsatellite"
     repeat_region   955327..955350
                     /rpt_type=tandem
                     /rpt_unit_seq="taaaa"
                     /satellite="microsatellite"
     misc_feature    955509..955530
                     /locus_tag="CNC02960"
                     /note="GC_rich"
     gene            complement(<955804..>957362)
                     /locus_tag="CNC02970"
                     /db_xref="GeneID:3256306"
     mRNA            complement(join(<955804..955806,955950..956011,
                     956091..956204,956290..956311,956370..956519,
                     956579..956760,956815..956950,957006..957017,
                     957077..957237,957281..>957362))
                     /locus_tag="CNC02970"
                     /product="oxaloacetate carrier, putative"
                     /transcript_id="XM_569945.1"
                     /db_xref="GI:58265577"
                     /db_xref="GeneID:3256306"
     CDS             complement(join(955804..955806,955950..956011,
                     956091..956204,956290..956311,956370..956519,
                     956579..956760,956815..956950,957006..957017,
                     957077..957237,957281..957362))
                     /locus_tag="CNC02970"
                     /codon_start=1
                     /product="oxaloacetate carrier"
                     /protein_id="XP_569945.1"
                     /db_xref="GI:58265578"
                     /db_xref="GeneID:3256306"
                     /translation="MTQPQQPLSLLESFLCGGLAGCGAVTITNIPETMKTRLQLQGEL
                     QRNDPSAPRVYRNVLDVFRKTWQHEGIRGLQRGLVPAYGYQTLLNGSRLGLYEPCRRL
                     FNRAIGKDPNEGVFITAITAGAVTGCIGASLGSPLFLIKARMQAYSPHIPVGAQHYYK
                     NSYDALRTILKSDGFFGLWRGVSTAILRTAMGSSVQLPSYNLSKYYLVSSAGMASDSF
                     WTFLAASSVSGVCVCIAMQPPDTALTRMYNQNTIKDPITGKVRGALYTNPFDCLWKTF
                     KAEGIAGWYKGTTAHFLRITPHTIFTLVFNE"
     gene            <957390..>959286
                     /locus_tag="CNC02980"
                     /db_xref="GeneID:3256140"
     mRNA            join(<957390..957413,957497..958213,958261..958775,
                     958833..>959286)
                     /locus_tag="CNC02980"
                     /product="small nuclear ribonucleoprotein hPrp3, putative"
                     /transcript_id="XM_569946.1"
                     /db_xref="GI:58265579"
                     /db_xref="GeneID:3256140"
     CDS             join(957390..957413,957497..958213,958261..958775,
                     958833..959286)
                     /locus_tag="CNC02980"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein hPrp3"
                     /protein_id="XP_569946.1"
                     /db_xref="GI:58265580"
                     /db_xref="GeneID:3256140"
                     /translation="MHVEIAMDRPGSPAAPPPAKRPPPAAPLDIAAIRAQLAAKKAAL
                     QPPPGPAALPPQPPVHADVAHKLAAAKARIEALNARAANPYLSGAPAPAPAPAAPQPG
                     VTSIALHPLLMGGDAQQPAAQADRNEKRAMRDRYKTMAPKFTSVRANASAAASQAPSR
                     ASPAVTAAPVLNPYASASAANSPAPDEERAPTRKSKKLQFSRAGKYVEQGEQLRNEQK
                     MEALRQRIAEASRKAGLDSEFDTLERSLKRQPPPAVEWWDEAILPKGVTYEDDLESAY
                     NNLSTSSDSLITHLVLHPIPIPAPMDRRQPERGLMLTKKEQKKMRRQRRQAELEDKRD
                     RQKMGLLPPDPPKVRLANLMKVLTSDAVQDPTKVEAKVRKEVAMRAYKHEKDNQERKL
                     TAEERKEKEYSQMVARERNGIRGAVFKIKYLTNGRHKFKVRETAKADLLSGICIFHPS
                     FALVMVEGVEKSIKHFKRLMLSRIDWTEQARPMADGDGGEDAPGSDEDMDGRTNSKEG
                     EQDLADNKCELIWEGELPERVFKMFRARHVETDSKAKEWLTPRFEAMWDLAKRWQWAG
                     EDL"
     repeat_region   957478..957637
                     /rpt_type=tandem
                     /rpt_unit_seq="ccccg"
                     /satellite="microsatellite"
     STS             958938..959603
                     /standard_name="Xba11"
                     /db_xref="UniSTS:470765"
     gene            complement(<959436..>960071)
                     /locus_tag="CNC02990"
                     /db_xref="GeneID:3256285"
     mRNA            complement(join(<959436..959474,959540..959635,
                     959723..959847,959933..>960071))
                     /locus_tag="CNC02990"
                     /product="DNA-directed RNA polymerase i 13.7 kda
                     polypeptide, putative"
                     /transcript_id="XM_569944.1"
                     /db_xref="GI:58265575"
                     /db_xref="GeneID:3256285"
     CDS             complement(join(959436..959474,959540..959635,
                     959723..959847,959933..960071))
                     /locus_tag="CNC02990"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase i 13.7 kda
                     polypeptide, putative"
                     /protein_id="XP_569944.1"
                     /db_xref="GI:58265576"
                     /db_xref="GeneID:3256285"
                     /translation="MAPTRVSAHRIGSLLFCPACGTLLDLPKDDQNEIACSQCGRLEP
                     ASSYENLPTKTYSSPNAFPSSLRSKRALVQNKLDAGEAAKGRDPAQEKCQKCGHIGLS
                     YKEMQLRSADEGSTIFYKCLNCGDQTSTNN"
     gene            960504..961800
                     /locus_tag="CNC03000"
                     /db_xref="GeneID:3256679"
     mRNA            join(960504..960614,960689..960755,960812..960862,
                     960927..961222,961291..961320,961379..961441,
                     961503..961572,961637..961800)
                     /locus_tag="CNC03000"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531743|gb|CF677584.1,gi|41531751|gb|CF677592.1"
                     /transcript_id="XM_569596.1"
                     /db_xref="GI:58264879"
                     /db_xref="GeneID:3256679"
     CDS             join(960552..960614,960689..960755,960812..960862,
                     960927..961222,961291..961320,961379..961441,
                     961503..961572,961637..961740)
                     /locus_tag="CNC03000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569596.1"
                     /db_xref="GI:58264880"
                     /db_xref="GeneID:3256679"
                     /translation="MAPKGGNAKKESGRAKKAENEEKKKTAAEKSKEAKEADEWKSGS
                     KGASKTDAAAAKAAEAARKKAEREALLAAEEASLQSKSKAAPKAGAKKKPADKLVATG
                     TGVAGYSVSDPLNLRKAKGPDGEPEEVKELSAKGIDEMLEALELVNQKTDKATVGSKA
                     EIMVDPHPERRFKAAFEAYLDREMPILKQEHPGLRQNQMRDMLYKQFQKAPENPFNQA
                     KIAYNATKDEKVEAYKKIMESREAKFSRA"
     gene            complement(<961925..>962644)
                     /locus_tag="CNC03010"
                     /db_xref="GeneID:3256149"
     mRNA            complement(join(<961925..962195,962257..962393,
                     962450..>962644))
                     /locus_tag="CNC03010"
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /transcript_id="XM_569598.1"
                     /db_xref="GI:58264883"
                     /db_xref="GeneID:3256149"
     CDS             complement(join(961925..962195,962257..962393,
                     962450..962644))
                     /locus_tag="CNC03010"
                     /codon_start=1
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /protein_id="XP_569598.1"
                     /db_xref="GI:58264884"
                     /db_xref="GeneID:3256149"
                     /translation="MRIEKCYFCSANVYPGHGTMFVRNDAKCFRFCSSKCHKNFKMKR
                     NPRKVRWTKAFRRANGKEMVVDTTFEFEKRRNVPVRYDRELVATTLKAMERVAEIRQK
                     REKAFWKNRMSGNTAKNMRDSALEIERHIELVQPRSATAVSTSKASEALEQREKVREK
                     IKVRAAGRKAMALQQMGQGKKQKESRLIPAEGSGMGMSLD"
     gene            962961..964821
                     /locus_tag="CNC03020"
                     /db_xref="GeneID:3256248"
     mRNA            join(962961..962995,963049..963096,963143..963181,
                     963232..963239,963346..963373,963425..963554,
                     963603..963705,963760..963958,964010..964234,
                     964285..964554,964613..964649,964703..964821)
                     /locus_tag="CNC03020"
                     /product="mannose-1-phosphate guanylyltransferase,
                     putative"
                     /transcript_id="XM_569600.1"
                     /db_xref="GI:58264887"
                     /db_xref="GeneID:3256248"
     CDS             join(962990..962995,963049..963096,963143..963181,
                     963232..963239,963346..963373,963425..963554,
                     963603..963705,963760..963958,964010..964234,
                     964285..964554,964613..964649,964703..964704)
                     /locus_tag="CNC03020"
                     /codon_start=1
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="XP_569600.1"
                     /db_xref="GI:58264888"
                     /db_xref="GeneID:3256248"
                     /translation="MKALILVGGFGTRLRPLTLSWPKPLVEFCNKAMILHQIEALVKA
                     GVKDIVLAVNYRPEVMVSVLKKTEEEFGINIHFSVETEPLGTAGPLALAREILGKDDS
                     PFFVLNSDVTCVYPFEAFRDFHIAHKCEGSIMVTKVAEPSAYGVVVTKPNSTVIDRFV
                     EKPVEFVGNRINAGIYIFNPSVLDRIELRPTSIEKEIFPAIAADQQLHSFDLQGFWMD
                     VGQPKDFLAGTCLYLSHLTSQHSPLLTDPSQNKWVYGGNVMVDPSAEIDPTAVIGPNV
                     VIGPDAKIGPGVRLQRCVIMSNATVRDHSWIANSIVGWNSTVGRWTRVENITVLGDDV
                     TIKDELYVNGASVLPHKSISTSITEPRIVM"
     gene            964941..966834
                     /locus_tag="CNC03030"
                     /db_xref="GeneID:3256236"
     mRNA            join(964941..965306,965371..966834)
                     /locus_tag="CNC03030"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531984|gb|CF677825.1,gi|41544378|gb|CF690219.1,
                     gi|41552170|gb|CF698011.1,gi|41564258|gb|CF710099.1,
                     gi|41565261|gb|CF711102.1,gi|41569591|gb|CF715432.1,
                     gi|41575891|gb|CF721732.1"
                     /transcript_id="XM_569941.1"
                     /db_xref="GI:58265569"
                     /db_xref="GeneID:3256236"
     CDS             join(965052..965306,965371..966507)
                     /locus_tag="CNC03030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569941.1"
                     /db_xref="GI:58265570"
                     /db_xref="GeneID:3256236"
                     /translation="MAHPPRPTPAPNRHTLPLHKRQSYVTVSVVANDTDTSSTTPANS
                     SSGSSFPVAIAIPALVGGMAVAIAVFGFWWWWSKRSKRVKRERWEAAQRRKNKRHAAE
                     KDKPTTHPGQSQKSPTGEKAFNPILPPLSTAQPYYPPPQTNGYGYAPSQQGYAAWQTQ
                     PGIEQVQYGQQASPSPQQGYYSPPAYAQGSAPPLSRDYSSESTIPLTQNTTPPATSPT
                     SPTSSRSSSNSSSTGGGRKPSGNIPPPRRSSSDEKKSSTPSSPSPSSSPSKKSSKNSK
                     NSRATARMAVAESAAANASMNRMFRHKPSKPSPLAIKAQQEREALAATTDPLSRISAD
                     ETSNPFNTESEGLYPTAADSSRANAPSGEWGVALGSPDEEDTFADSQAAVLDSGLYHG
                     AKSSYSEDPYIEKKAQTKSGMYSQDPYALYHEQEEEKEEEVEDADRYHNAAESMGLGS
                     ASKNKKRDVGKWV"
     repeat_region   965779..965809
                     /rpt_type=tandem
                     /rpt_unit_seq="cag"
                     /satellite="microsatellite"
     repeat_region   966385..966419
                     /rpt_type=tandem
                     /rpt_unit_seq="gaa"
                     /satellite="microsatellite"
     gene            complement(<967105..970274)
                     /locus_tag="CNC03040"
                     /db_xref="GeneID:3256517"
     mRNA            complement(join(<967105..968445,968506..969396,
                     969451..970062,970102..970274))
                     /locus_tag="CNC03040"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532457|gb|CF678298.1,gi|41558352|gb|CF704193.1"
                     /transcript_id="XM_569602.1"
                     /db_xref="GI:58264891"
                     /db_xref="GeneID:3256517"
     CDS             complement(join(967105..968445,968506..969396,
                     969451..970062,970102..970266))
                     /locus_tag="CNC03040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569602.1"
                     /db_xref="GI:58264892"
                     /db_xref="GeneID:3256517"
                     /translation="MGLATPPPHLVALLANTRTPANYATDALEEWIAHRRAKGDSLFN
                     ISLALAHLEDITPPHTAHLFDRARYLTNVPQPQDLTPPVGPFPLARSASLATILNHLL
                     ATPPPSIQHSREVILEYVLARESKLKEKKPGRAGKGTMGREGFEDIAKRMSELEDSLR
                     ENSASSPPTSPSRDVYPSPRRSTRASQGQLLNENQQIGLTLILSLRMSLSYFALQELA
                     NQLMLVTLGDAERMLIQHIRRRVPGEGRWGVGKELEYVEGLTLSRRPALRPAFRSAKA
                     RTLLPPKPLYPIQLPAPSKSQCIKQIQALAKEIEAGGPAAGQEFLHAHEPSGISAPVF
                     NTPNSEKYFLGRRSANASPTVKAIFAREGSPQTPLSNLPPALGTPAGSPAQVSQPDPN
                     ILANFTMELISEFITREKREQMLKSKWAKTGRAQVSKDLGEIEAALCLVSKNNASSIA
                     PLLLPTFLLLRRTFALPPSPLPQAITEPYIDILPAPPDPDDVPFREPTVSSTTAALYV
                     NPRLNDDKAYDALEELAEFEKEKVDAAGGTRQQMIDWAFSQIEAVQKRFPDGSYKQVF
                     NRMKDNLLQQRRPEEHYQSISFAKSPSIHRRVKSNAFPSGLSDSEAGSPVAVDPLKAQ
                     HTRSLSMPDRKAPYDSDSDSEEDVSLVQRSTPADQPPLTPATSVPSSKPLPDVERSFP
                     QLPPLIVTPMNIGDRRSSAASASAAPSSGGGGGGGGWWDVVSAVAKEDSSSNTAPWDT
                     TPEKRSNEPTSHVSQLSTDSRRDGLALNINDPARNIAAPLPPGAEPAQALDFTRPMMS
                     LDLNSPVSQAKPPFSAPVSPQREAQYLPGQTVRLVETTGLGFAPSSPPYGYTQRQDED
                     GILPPPPPLRFDQSRGGHTLGSSTTPSAHSSSLTAEPTPTSTALNHSALSSGPSYPAP
                     SNASPTVAQGPAPHPAGPFVSSSTTTKSKLGSFGRSMSLVRRKSKKEKEKEKDGEKEG
                     KDKNKKERVLNDPGKWNRDLVANIMGPPAR"
     misc_feature    967176..967238
                     /note="CT-rich"
     repeat_region   967954..967984
                     /rpt_type=tandem
                     /rpt_unit_seq="cca"
                     /satellite="microsatellite"
     gene            complement(971274..973796)
                     /locus_tag="CNC03050"
                     /db_xref="GeneID:3256588"
     mRNA            complement(join(971274..971475,971535..971803,
                     971867..972843,972913..973103,973154..973375,
                     973437..973636,973688..973796))
                     /locus_tag="CNC03050"
                     /product="signal recognition particle binding protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537799|gb|CF683640.1,gi|41537808|gb|CF683649.1,
                     gi|41538896|gb|CF684737.1,gi|41538899|gb|CF684740.1,
                     gi|41543017|gb|CF688858.1,gi|41543023|gb|CF688864.1,
                     gi|41549350|gb|CF695191.1,gi|41549364|gb|CF695205.1,
                     gi|41559104|gb|CF704945.1,gi|41559117|gb|CF704958.1,
                     gi|41571094|gb|CF716935.1,gi|41571098|gb|CF716939.1"
                     /transcript_id="XM_569604.1"
                     /db_xref="GI:58264895"
                     /db_xref="GeneID:3256588"
     CDS             complement(join(971341..971475,971535..971803,
                     971867..972843,972913..973103,973154..973375,
                     973437..973636,973688..973718))
                     /locus_tag="CNC03050"
                     /codon_start=1
                     /product="signal recognition particle binding protein"
                     /protein_id="XP_569604.1"
                     /db_xref="GI:58264896"
                     /db_xref="GeneID:3256588"
                     /translation="MLDHISISHQSGLVLWSRAFTPAFETLANTPNSPINALVKSTFI
                     EGKAMTNGEEQGLEKDGYSVRWSVDNGLGLVFVVVFPALLPLTYVPALLERTKALFLA
                     LFQPYVTSLIESLSSGGASAGSALKQLKEKIVEERWDEVWDRCFRSCEGEKKSRSTLV
                     KQRVSDRTNPAISSADTSDVDVGSQSALSAEEIAKNVQSLKAKMKGGKRRGVRDGLSP
                     SPSPSPSRKPPSNATSKLMRRWGDTPVTAEDMAALDYSTPAPDSSANDTAHVDKESLI
                     SSEALGTRNDTGAYQVADWDFRRAPASSHESLPSEEEIIARGTSRLSLNRPTDDGSNQ
                     SSWTSMFSRLTGSKILTRNDLEPVLIEMEKHLMSKNVAKDIAEKLCNSVGAALVGKKL
                     GGLNSVKSEVQSVLSTSLTRVLTPKTSTDILLEIQRKRSSHLATLSTTSSPLDSGPDP
                     YTLTFVGVNGVGKSTNLSKVCFWLLQNGLRVLIAACDTFRSGAVEQLRVHVRNLGALG
                     EEMGQGQGKRIELFERGYGKDAAGIAKDAIAYAKEHAFDVVLIDTAGRMQDNEPLMRA
                     LAKLVTVNNPDKIVFVGEALVGNEAVDQLTKFDRALRDFSGAGVGGVARKRGIDGIIL
                     TKFDTIDDKVGAALSMTYITGQPILFVGCGQTYTDLRQLRVNHIVQALLS"
     gene            974078..975251
                     /locus_tag="CNC03060"
                     /db_xref="GeneID:3256444"
     mRNA            join(974078..974282,974331..974542,974591..974885,
                     974939..975082,975139..975251)
                     /locus_tag="CNC03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_569606.1"
                     /db_xref="GI:58264899"
                     /db_xref="GeneID:3256444"
     CDS             join(974126..974282,974331..974542,974591..974885,
                     974939..975082,975139..975209)
                     /locus_tag="CNC03060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569606.1"
                     /db_xref="GI:58264900"
                     /db_xref="GeneID:3256444"
                     /translation="MASLRISARPVLAALMPVPRIYRPAAVCARTFSTSFARWAVVKD
                     GPPVTQTNRAEQTLRRFWKTVNISATPSDGYLITLDHRALKTPFGAKLEIPKERGLLA
                     ALIANEWENQDEVLKQHALPVTSLASRAIDGLSEGPTRPAVIEALLQYLETDTILYPD
                     DAPPPLVRLQKKHWDPLYEWLKEDFGVELQLAQGFDAVKQSDDNMEKLKRVVETMDGW
                     ELAAFERAVYATKSFVIALALCRGRLTAHEAAQASHVEVSSQIERWGEVEDTHDVDYQ
                     DIRRALGSAACLLIKS"
     gene            complement(<975269..>976239)
                     /locus_tag="CNC03070"
                     /db_xref="GeneID:3256179"
     mRNA            complement(join(<975269..975314,975376..975956,
                     976008..976139,976189..>976239))
                     /locus_tag="CNC03070"
                     /product="ribosomal protein L1, putative"
                     /transcript_id="XM_569608.1"
                     /db_xref="GI:58264903"
                     /db_xref="GeneID:3256179"
     CDS             complement(join(975269..975314,975376..975956,
                     976008..976139,976189..976239))
                     /locus_tag="CNC03070"
                     /codon_start=1
                     /product="ribosomal protein L1"
                     /protein_id="XP_569608.1"
                     /db_xref="GI:58264904"
                     /db_xref="GeneID:3256179"
                     /translation="MISSSIRVSGRSLAQVIRPAVASASFSTTATAGARVQKKQSKKK
                     VASPDALSASEAARVLRALEVAHPTSTYSLTLHTKSHKSALPIRGSFTLPLDPRRTSE
                     TILVFAEPSSPSATLAKEAGAAYVGGDELFEPVLSGKIHPTRCLATPGMMPAVTRTLA
                     RFLGPKGLMPVAKRGGVAEGEELAERIRDAAGKMEYRADKQGTVKVNVARVDFGIPSV
                     ENNIKSFIQTVRDNQATANQTDDPLAAAGKSKKKKGTLIHHLCDLGINKWT"
     gene            976889..979581
                     /locus_tag="CNC03080"
                     /db_xref="GeneID:3256275"
     mRNA            join(976889..976984,977259..977355,977481..977562,
                     977609..977769,977817..977906,977962..978601,
                     978660..978893,978943..979066,979116..979206,
                     979261..979283,979338..979581)
                     /locus_tag="CNC03080"
                     /product="pyruvate kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530211|gb|CF676052.1,gi|41530400|gb|CF676241.1,
                     gi|41530842|gb|CF676683.1,gi|41532392|gb|CF678233.1,
                     gi|41532405|gb|CF678246.1,gi|41532727|gb|CF678568.1,
                     gi|41532731|gb|CF678572.1,gi|41533777|gb|CF679618.1,
                     gi|41533785|gb|CF679626.1,gi|41534858|gb|CF680699.1,
                     gi|41534862|gb|CF680703.1,gi|41537055|gb|CF682896.1,
                     gi|41537057|gb|CF682898.1,gi|41537938|gb|CF683779.1,
                     gi|41538790|gb|CF684631.1,gi|41538802|gb|CF684643.1,
                     gi|41541670|gb|CF687511.1,gi|41541684|gb|CF687525.1,
                     gi|41541933|gb|CF687774.1,gi|41542866|gb|CF688707.1,
                     gi|41542876|gb|CF688717.1,gi|41544656|gb|CF690497.1,
                     gi|41544665|gb|CF690506.1,gi|41546615|gb|CF692456.1,
                     gi|41547175|gb|CF693016.1,gi|41547183|gb|CF693024.1,
                     gi|41547960|gb|CF693801.1,gi|41549827|gb|CF695668.1,
                     gi|41551317|gb|CF697158.1,gi|41554360|gb|CF700201.1,
                     gi|41555988|gb|CF701829.1,gi|41556002|gb|CF701843.1,
                     gi|41557310|gb|CF703151.1,gi|41559689|gb|CF705530.1,
                     gi|41559695|gb|CF705536.1,gi|41566080|gb|CF711921.1,
                     gi|41569014|gb|CF714855.1,gi|41572279|gb|CF718120.1,
                     gi|415"
                     /transcript_id="XM_569611.1"
                     /db_xref="GI:58264909"
                     /db_xref="GeneID:3256275"
     mRNA            join(977116..977355,977481..977562,977609..977769,
                     977817..977906,977962..978601,978660..978893,
                     978943..979066,979116..979206,979261..979283,
                     979338..979581)
                     /locus_tag="CNC03080"
                     /product="pyruvate kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530406|gb|CF676247.1,gi|41530852|gb|CF676693.1,
                     gi|41537940|gb|CF683781.1,gi|41538797|gb|CF684638.1,
                     gi|41538809|gb|CF684650.1,gi|41541684|gb|CF687525.1,
                     gi|41541940|gb|CF687781.1,gi|41544665|gb|CF690506.1,
                     gi|41547960|gb|CF693801.1,gi|41549834|gb|CF695675.1,
                     gi|41551331|gb|CF697172.1,gi|41554367|gb|CF700208.1,
                     gi|41557316|gb|CF703157.1,gi|41566084|gb|CF711925.1,
                     gi|41570388|gb|CF716229.1,gi|41573570|gb|CF719411.1,
                     gi|41575383|gb|CF721224.1,gi|41575943|gb|CF721784.1"
                     /transcript_id="XM_569610.1"
                     /db_xref="GI:58264907"
                     /db_xref="GeneID:3256275"
     CDS             join(977134..977355,977481..977562,977609..977769,
                     977817..977906,977962..978601,978660..978893,
                     978943..979066,979116..979206,979261..979283,
                     979338..979389)
                     /locus_tag="CNC03080"
                     /codon_start=1
                     /product="pyruvate kinase"
                     /protein_id="XP_569610.1"
                     /db_xref="GI:58264908"
                     /db_xref="GeneID:3256275"
                     /translation="MVLGHFSPQTNTTVPPPPHPSAFVPLFQTNTSVVSGKPNAFSTM
                     AGTPSSQLAWLSGLSTNFNEMSADQKFLRKTSIIATIGPKTNNVETLVQLADAGMNIV
                     RMNFSHGSYEYHQSVIDNARAAAAKSPSGRPIAIALDTKGPEIRTGLMKDDTDVPISA
                     GHEFWVTTDKAYAEAGTAEHIYIDYTNIVKVTAPGKLIYVDDGILSLQVISIQGEKIR
                     VKSLNSGVLSSRKGVNLPKTAVDLPALSEKDKSDLAFGVKNGVDMIFASFIRSANDVK
                     EIRKVLGPEGADIKIIVKIENEQGVMNFDEILRETDGVMVARGDLGIEIPASQVFMAQ
                     KMMIAKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVIDGADCIMLSGETAKG
                     KYPIEAVKMMAETAFLAESSIAYPPLFDQLRALTPRPTETAETLALSAVAAAIEQDAG
                     AIIVLSTSGVSARLISKYRPACPIICVTRNEQTARQLHLSRGVYPVWFPEPRGIPAEK
                     WQIDVDNRIRYGLRMALGLGIIKPEATVMAVQGWKGGLGHTNTLRILSVPSDPADLDL
                     HSIERD"
     CDS             join(977263..977355,977481..977562,977609..977769,
                     977817..977906,977962..978601,978660..978893,
                     978943..979066,979116..979206,979261..979283,
                     979338..979389)
                     /locus_tag="CNC03080"
                     /codon_start=1
                     /product="pyruvate kinase"
                     /protein_id="XP_569611.1"
                     /db_xref="GI:58264910"
                     /db_xref="GeneID:3256275"
                     /translation="MAGTPSSQLAWLSGLSTNFNEMSADQKFLRKTSIIATIGPKTNN
                     VETLVQLADAGMNIVRMNFSHGSYEYHQSVIDNARAAAAKSPSGRPIAIALDTKGPEI
                     RTGLMKDDTDVPISAGHEFWVTTDKAYAEAGTAEHIYIDYTNIVKVTAPGKLIYVDDG
                     ILSLQVISIQGEKIRVKSLNSGVLSSRKGVNLPKTAVDLPALSEKDKSDLAFGVKNGV
                     DMIFASFIRSANDVKEIRKVLGPEGADIKIIVKIENEQGVMNFDEILRETDGVMVARG
                     DLGIEIPASQVFMAQKMMIAKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVI
                     DGADCIMLSGETAKGKYPIEAVKMMAETAFLAESSIAYPPLFDQLRALTPRPTETAET
                     LALSAVAAAIEQDAGAIIVLSTSGVSARLISKYRPACPIICVTRNEQTARQLHLSRGV
                     YPVWFPEPRGIPAEKWQIDVDNRIRYGLRMALGLGIIKPEATVMAVQGWKGGLGHTNT
                     LRILSVPSDPADLDLHSIERD"
     gene            980440..981659
                     /locus_tag="CNC03090"
                     /db_xref="GeneID:3256642"
     mRNA            join(980440..980659,980749..980875,980933..981071,
                     981134..981199,981334..981659)
                     /locus_tag="CNC03090"
                     /product="expressed protein"
                     /transcript_id="XM_569942.1"
                     /db_xref="GI:58265571"
                     /db_xref="GeneID:3256642"
     CDS             join(980537..980659,980749..980875,980933..981071,
                     981134..981199,981334..981559)
                     /locus_tag="CNC03090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569942.1"
                     /db_xref="GI:58265572"
                     /db_xref="GeneID:3256642"
                     /translation="MPSIAGKLVNKVLKDHISKQAPEDPLYTVTVNSKGKSKRQVRPL
                     PEGLSKRDRKALKKIRKRAHYLDKGMNICGFRVGWTFFIGIIPGLGDAVDAGLNYCLV
                     VKPAKKLDIPDSLVHKMLFNNAISAGLGLVPIAGDIFLAAWKANSRNAALLEAYLTIR
                     GQEYIAALRREPGVIDPAEAIAHGVPPEDLRDQFGPGAGMDHPVEDEESNRGFFGGRK
                     SKKEVTKK"
     gene            982616..983428
                     /locus_tag="CNC03100"
                     /db_xref="GeneID:3256550"
     mRNA            join(982616..982673,982730..982914,983000..983056,
                     983111..983428)
                     /locus_tag="CNC03100"
                     /product="expressed protein"
                     /transcript_id="XM_569943.1"
                     /db_xref="GI:58265573"
                     /db_xref="GeneID:3256550"
     CDS             join(982655..982673,982730..982914,983000..983056,
                     983111..983179)
                     /locus_tag="CNC03100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569943.1"
                     /db_xref="GI:58265574"
                     /db_xref="GeneID:3256550"
                     /translation="MTIIHVVAFKTATPSTIGPLTTSIKALKDNCINPRTGKPYILDL
                     RGGKQISTEGLDRGMQVVFVLEFENDDDLQYYIDEDPAHEQFKKSAKGEWEAIDVLAL
                     DFSNGKF"
     gene            complement(<984152..>985882)
                     /locus_tag="CNC03110"
                     /db_xref="GeneID:3256352"
     mRNA            complement(join(<984152..984243,984390..984480,
                     984610..984625,984676..984849,984911..985008,
                     985068..985163,985212..985236,985373..985432,
                     985515..985591,985823..>985882))
                     /locus_tag="CNC03110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569613.1"
                     /db_xref="GI:58264913"
                     /db_xref="GeneID:3256352"
     CDS             complement(join(984152..984243,984390..984480,
                     984610..984625,984676..984849,984911..985008,
                     985068..985163,985212..985236,985373..985432,
                     985515..985591,985823..985882))
                     /locus_tag="CNC03110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569613.1"
                     /db_xref="GI:58264914"
                     /db_xref="GeneID:3256352"
                     /translation="MPIELDLDSILQFAIKLALDLVTEVDKAVEKFIVERIREAYPSH
                     KFIGEESYEGQQITDEPTWIGDPIDGTTNFVHGFPMVATSIGLAHKGIPVVGVIYNPF
                     LDQLWSAAKGRGAYLNQKRKLPITGSSKPLASLGQALIGVEYGMSRSPPALPRKLAAF
                     EKLTAHTDVGGKMCHSLRSMGSAALNIVLVASGGLDIYWEVGAGICILEESGGRCFGA
                     KTADLSGEVDAKLMEIVLLQKETSLDQQKKFIKEFYDCVEDFDP"
     repeat_region   986595..986636
                     /rpt_type=tandem
                     /rpt_unit_seq="cag"
                     /satellite="microsatellite"
     misc_feature    987439..987459
                     /note="AT_rich"
     gene            <987901..993733
                     /locus_tag="CNC03120"
                     /db_xref="GeneID:3256328"
     mRNA            join(<987901..988059,988133..988259,988311..988414,
                     988467..988520,988573..988655,988713..988755,
                     988806..989032,989090..989193,989319..989355,
                     989425..989613,989667..991537,991590..991861,
                     991922..992039,992090..992163,992222..992280,
                     992336..992429,992479..992626,992678..993224,
                     993272..993333,993392..993733)
                     /locus_tag="CNC03120"
                     /product="transmembrane protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535866|gb|CF681707.1,gi|41538929|gb|CF684770.1,
                     gi|41562307|gb|CF708148.1,gi|41562308|gb|CF708149.1,
                     gi|41562520|gb|CF708361.1"
                     /transcript_id="XM_569615.1"
                     /db_xref="GI:58264917"
                     /db_xref="GeneID:3256328"
     CDS             join(987901..988059,988133..988259,988311..988414,
                     988467..988520,988573..988655,988713..988755,
                     988806..989032,989090..989193,989319..989355,
                     989425..989613,989667..991537,991590..991861,
                     991922..992039,992090..992163,992222..992280,
                     992336..992429,992479..992626,992678..993224,
                     993272..993333,993392..993657)
                     /locus_tag="CNC03120"
                     /codon_start=1
                     /product="transmembrane protein"
                     /protein_id="XP_569615.1"
                     /db_xref="GI:58264918"
                     /db_xref="GeneID:3256328"
                     /translation="MPFIKALDHAIPNGQTFNNLAKAPGAVAGGLTSAVGSVGNMVGV
                     EQVRGAAVHMFDPDASPAVKAAAAAKAKASLGLPSRDKVREGISGDGGGARAVIIDSS
                     TSANAPKPTVTLADIDKASQAEGQREGSDDMPGSIPSNTAPSIPTWVMAGWKQAAGLG
                     KTATAREEATVLQTYLTETMYGAWYHNAAVILFAILSTRLLTVLHLDWGWIIVVLAFC
                     SSYYSISISRTRQRVRDDIQRELVKTRLVTETESADWINSFLERFWLIYEPVLSQTII
                     ASTDAALAGVAPPGVDSIRMTTFTPPRIDYVRTFPKTPEDVVIMDWALSFTPNDLEDI
                     TPRQAAKQVNPKVVLSIRVGKGALSKALPVLLEDMSFSGKMRIKLKLMTNFPHVQTVD
                     ISFIEKPTFDYVLKPIGGETLGFDINSIPGLAPFIRDQVHSNLGPMMYDPNVFTIDLQ
                     QLLSGTPLDAAIGVLRVTVLDARNLKATKFGGGDPDPYVSFSIGAKPAIAQTKTIRSS
                     SNPSFHETQFLLINSLADVLNLNVFDFNDHRPDSLLGTVSHELGTLADDAEQEGIVGQ
                     ILGGGKDRGTLRYDLSYFPVLKPEKNADGTLEPLPDTQTGIVRLTIHQAKDLDVSHAL
                     LGGGALSPFASVFLGSGKNEVHRTKVLKHANQPIWEDACEFLVPEKHNSVVTVAITDS
                     KDFAVDPSLGMVTIRLADLLEAKERHQDWFPLKGSRQGKVRMTAEWKAVAMTGSIGGA
                     NSYIPPIGILRVWLKRAVDVKNVEAALGGKSDPYVRIMGNNRIMARTEVINNNLNPEW
                     DQIIYVPVHSIREHFMLEVMDYQNIGKDRSLGHVDLAARDYIDESGEQKYPYISKGSQ
                     DRRDRIKLDKANHFKGELHYEVDFKPAVSLRGGVSFDAQKNELEIAAEAAEAQSAAEG
                     ASSSVTATVTPEANGSIKAASVPSGIVGVDDVTAGDANGHANQSVVDASIAAAALTAE
                     EEDAQPETAAEDPREGVIMSTEEILSCQSGVIVFQVISGKLARRGSLEVMFDDGYWPA
                     FTSGKARSNHPTWDQVGEGFIRELDFSRVWLRINAADENSKEDVVAEFKCDTKDFLER
                     SINAPYDFVLTEPDGSNRSIVQIAARFVPVDIVLQPRESINNMGILRVDVIDAKALHG
                     ADRSGKSDPYVVFSLNDMKVFKSETKKKTLHPVWNESFETMVPSRVAAKFAFEIFDWD
                     RVGTATSLGGNIIDLAVLEPFEATEVSLPVITEKRGEKGTFTFRLLFTPEIIARVRHN
                     TSSFVSAGRAITQIGGVPLGVGKGVIHGGGAVAGGVAHGLGSVGGFAGRRIGLIKKKD
                     KLTGKEVVIDPVTGTSVPVAPGTEITPAIGESSDVAAGQTSAPVGANLDGAVPGHHAT
                     TLPVGESASPQQPGTLGVTVISAKDLKSNREGSVKPYVQIKAGGKTVKTEHVKGSAPE
                     WNESFSFNLTPNIKSFSVTVCDHHTLGKDPELGEAEVDIWRHIRPAVPDADVWVELSN
                     GTGLLRLKLDWNTGFANPTPMRLGSRIRTPSVSSKSLPDSPGRFSMKKSKE"
     gene            complement(995341..998091)
                     /locus_tag="CNC03130"
                     /db_xref="GeneID:3256272"
     mRNA            complement(join(995341..995488,995549..995793,
                     995849..996224,996279..996318,996370..996473,
                     996530..996615,996678..996822,996881..997120,
                     997182..997657,997714..998091))
                     /locus_tag="CNC03130"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532279|gb|CF678120.1,gi|41532286|gb|CF678127.1,
                     gi|41543837|gb|CF689678.1,gi|41543848|gb|CF689689.1,
                     gi|41547866|gb|CF693707.1,gi|41547871|gb|CF693712.1,
                     gi|41559436|gb|CF705277.1,gi|41559444|gb|CF705285.1"
                     /transcript_id="XM_569617.1"
                     /db_xref="GI:58264921"
                     /db_xref="GeneID:3256272"
     CDS             complement(join(995417..995488,995549..995793,
                     995849..996224,996279..996318,996370..996473,
                     996530..996615,996678..996822,996881..997120,
                     997182..997657,997714..997864))
                     /locus_tag="CNC03130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569617.1"
                     /db_xref="GI:58264922"
                     /db_xref="GeneID:3256272"
                     /translation="MTGESSAIRKYDVDFKKTPGTLSITSTHIIWVPKVKDAMDRQSQ
                     AMNRAINMLASKPENERVSLKIIFKENVPPGGLHFVFTNANTRGDDRKAVQDILIPFV
                     AANKNPTASAPGTPGSSTTPNTPSAATSAVMSDVAKGKRKMNEVTPAGLSTVSTESSP
                     LPPAVRSQRRKYNTLRQRVLEKNDALRMLHRDLVLGRQITEEEFWEGREALIQAEEMA
                     YAQKPGRPSRLLDDRFDLDAGRRGKTTGGTGVGIKQADNGPVILKLSKELTREIFEEF
                     PVVQDAYAKYVPGISETEFWSRYFTSQLWERHRASVRKSANDEISRKKDDIFDQYLEE
                     PDWNLQPRQPMPDRDGVERYLDLAATEEDHGEATSIRDVTMQAGRERSALPLIRRFND
                     HSKKLLRAASAGQTVRNSAFGGDIGIYEEINLEDLHDPSATPAIILDVENAAALDEGD
                     DKLAPTGVLPGYSDSELLAMATESASILLDSMPDFSSVCLANPGPFIDDDESQRNPAY
                     EAFAKQRDSQAAALATVKDMWSRANAENAVLPVFPEMLFEQIRSCHNSATEFLRQYWS
                     AILPSVPGALGGQTPSAKDAKAAKMASYLKNTSNKIEAIVQTAQITGFDPERVRKALA
                     PTLGAVEVALERERKRVKGK"
     gene            complement(<998579..>999627)
                     /locus_tag="CNC03140"
                     /db_xref="GeneID:3256622"
     mRNA            complement(join(<998579..998586,998766..998888,
                     998991..999046,999097..999282,999341..999384,
                     999589..>999627))
                     /locus_tag="CNC03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_569631.1"
                     /db_xref="GI:58264949"
                     /db_xref="GeneID:3256622"
     CDS             complement(join(998579..998586,998766..998888,
                     998991..999046,999097..999282,999341..999384,
                     999589..999627))
                     /locus_tag="CNC03140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569631.1"
                     /db_xref="GI:58264950"
                     /db_xref="GeneID:3256622"
                     /translation="MVGRWADLACANEILEDIAHISNNQFGHFAITKLVSYPNFYKQT
                     CEAIINSYPPVATTHHGVNLAKIALTEGGRASFIKYVEAICRQDDGRTPGIVTIATSS
                     IGKAHLKSFLTGSYSSLLRSMFEFVRPAVRIAPVFETAKAVTIFFGHYT"
     STS             1001019..1001689
                     /standard_name="Xba25"
                     /db_xref="UniSTS:470763"
     gene            1001784..1003811
                     /locus_tag="CNC03150"
                     /db_xref="GeneID:3256647"
     mRNA            join(1001784..1001810,1001859..1002063,1002114..1002440,
                     1002492..1002591,1002637..1002701,1002754..1003015,
                     1003073..1003231,1003281..1003811)
                     /locus_tag="CNC03150"
                     /product="transcriptional activator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532898|gb|CF678739.1,gi|41532906|gb|CF678747.1,
                     gi|41544145|gb|CF689986.1,gi|41544154|gb|CF689995.1,
                     gi|41559998|gb|CF705839.1,gi|41560000|gb|CF705841.1"
                     /transcript_id="XM_569633.1"
                     /db_xref="GI:58264953"
                     /db_xref="GeneID:3256647"
     CDS             join(1001795..1001810,1001859..1002063,1002114..1002440,
                     1002492..1002591,1002637..1002701,1002754..1003015,
                     1003073..1003231,1003281..1003646)
                     /locus_tag="CNC03150"
                     /codon_start=1
                     /product="transcriptional activator"
                     /protein_id="XP_569633.1"
                     /db_xref="GI:58264954"
                     /db_xref="GeneID:3256647"
                     /translation="MQQLLNPFAQKYPDAVDSTLFTQGVCLAFNRSGPFAGHYLAVGN
                     SHGTVEIWDVETRGVVRILEGHVKAVEGLSWSRNNRYLLSASSDGTAIVWDLSVLPHP
                     LLSPRTPLTGEPHAGPSSARLHTVRFDSPVISASFHPRNSRIILAVLSCGEAVIVDMR
                     KGGGKYRLEDVSDEDETAVNRKRISMTCGDFSPCGSRVYVGTSNGMLIVIDPMTRQIL
                     QRAKLANSGIRQLSFDTSGFHLLTSATDRALRLLHIDPLTLSLSPLHRFQDLINRTPW
                     NSIGFSGDAEYVMGGAAHKMAHNVFIWDRESGVLVKVLEGPKEPLIACTWHPTKPIIA
                     SITTSGDVHVWQTSSPDNWAAFAPGFEELEENVEYDEREDEFDIEDETELNRRKDLEE
                     DIIIDLLTPQEDAFPRRARPIISLPSNIIFANDDEQLEAMRFIESISNVAKWADREAA
                     VYEDALVSGDGEQEELGEAANGAADGDDWEGFYLSQDLLSDIRSDDAGT"
     gene            complement(1003682..1005821)
                     /locus_tag="CNC03160"
                     /db_xref="GeneID:3256805"
     mRNA            complement(join(1003682..1003763,1003827..1004034,
                     1004091..1004423,1004481..1004562,1004612..1004894,
                     1004946..1005135,1005200..1005229,1005285..1005498,
                     1005577..1005821))
                     /locus_tag="CNC03160"
                     /product="chaperone regulator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536933|gb|CF682774.1,gi|41569039|gb|CF714880.1,
                     gi|41569047|gb|CF714888.1,gi|41571906|gb|CF717747.1,
                     gi|41573519|gb|CF719360.1,gi|41573523|gb|CF719364.1,
                     gi|41573666|gb|CF719507.1"
                     /transcript_id="XM_569635.1"
                     /db_xref="GI:58264957"
                     /db_xref="GeneID:3256805"
     CDS             complement(join(1003735..1003763,1003827..1004034,
                     1004091..1004423,1004481..1004562,1004612..1004894,
                     1004946..1005135,1005200..1005229,1005285..1005498,
                     1005577..1005704))
                     /locus_tag="CNC03160"
                     /codon_start=1
                     /product="chaperone regulator"
                     /protein_id="XP_569635.1"
                     /db_xref="GI:58264958"
                     /db_xref="GeneID:3256805"
                     /translation="MSTIVDSRPRGTYIPADCPSCRSEQEYMIPPTFIGGLRVRCSAC
                     KQLFTHPQPKPSGSSSSSTSKAAPRTRSIGTDKDPLDLAYYDVLGLDSQCTTEEVKKA
                     YRRLAIKLHPDKNRDDPDAEEKFKEISVAYQVLSDPELRHKYNEFGQKNGGGMSEPAG
                     GFHDPEEVFGKMFGGDRFEVLIGNISIGKDMKEAFQQQHEEDPSDFTIGPNGKPILTP
                     AGAQKKWSREKKVAEEKARQRQARVDQLATHLINKLNIYTEAAKGPQDEMVGASFKEI
                     CRLEADDLKDENYGVELLHAIGKTYQAKSSQHLASSQFAPLGWFHGAKSSFNVVSDTV
                     STLRSAMELKAVFERLQRAEQSGMSADELRKLEEQAAEQGMRTMWKGVKLEVESVVRD
                     TCEKVLSDPTLPKEKLHSRAVALGLMGEAFLAIRKEGETHGEDFVRVETPASKQREAS
                     HTTTHAPPPVPPRPENTTSATQDAQLKEKEETLKAAYRAYESKRQGNP"
     gene            complement(<1006150..>1007227)
                     /locus_tag="CNC03170"
                     /db_xref="GeneID:3256460"
     mRNA            complement(join(<1006150..1006424,1006476..1006635,
                     1006700..1006770,1006898..1006976,1007046..1007104,
                     1007158..>1007227))
                     /locus_tag="CNC03170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570043.1"
                     /db_xref="GI:58265773"
                     /db_xref="GeneID:3256460"
     CDS             complement(join(1006150..1006424,1006476..1006635,
                     1006700..1006770,1006898..1006976,1007046..1007104,
                     1007158..1007227))
                     /locus_tag="CNC03170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570043.1"
                     /db_xref="GI:58265774"
                     /db_xref="GeneID:3256460"
                     /translation="MSPFYSEFWQTANGKFCRVSPWDGVRNHEAKKIMREKMKLGDKV
                     LFYHSNCKVPGVFAVAEISKEGYPDSHSRNRDHPYFDPKSKQDSPTWFMVDVRFKRRL
                     DYPPTLALIKHLATLSNLPKEVSYIGDRGLEAIKNMSLVNRGRLSVQPVDDAAYNAIV
                     ELGTKGGWDSFVSVSSQASKSRKAKASESSSELVKAKDNDTLEEKPHKGKKFLPGEDG
                     IFESGQGQRRSKRLKRSLP"
     gene            <1007718..1010257
                     /locus_tag="CNC03180"
                     /db_xref="GeneID:3256709"
     mRNA            join(<1007718..1007765,1007822..1008503,1008553..1008803,
                     1008857..1008927,1008975..1009284,1009335..1009765,
                     1009820..1010090,1010142..1010257)
                     /locus_tag="CNC03180"
                     /product="ATP-dependent RNA helicase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41555724|gb|CF701565.1,gi|41555735|gb|CF701576.1"
                     /transcript_id="XM_569637.1"
                     /db_xref="GI:58264961"
                     /db_xref="GeneID:3256709"
     CDS             join(1007718..1007765,1007822..1008503,1008553..1008803,
                     1008857..1008927,1008975..1009284,1009335..1009765,
                     1009820..1010090,1010142..1010183)
                     /locus_tag="CNC03180"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_569637.1"
                     /db_xref="GI:58264962"
                     /db_xref="GeneID:3256709"
                     /translation="MAAGIDVATPLKKKNKPESQKRRDKKKNKKKRKIQKAKRAAAPK
                     NKDWKPDPVLEALKQSTTFRKIDSVKGPKGDRTFEEYDTGTESGGQTTAQVPGDKEKK
                     QQEKREKREKRQRKEERRARREAAITKMGVDMGPGEGTMVVEGIPEPDQVEEQEKNKS
                     MPSLERSPTPPPLVAFPLPRLAPAPDASVLARQGLPKGLEDATFIDQSLRVEVEGLSV
                     EGRDEALSVNMRRRLNEIGIEDFFAVQAAMLPRLLPLQLIPSPYCPLPDYLISAPTGS
                     GKTLAYTIPILEILSQRTICRLRALIVLPTRDLVFQVRETMEALSKGTGLTIGTVTGQ
                     HSFAQERKQLVADLDTPLLGGSSKLDILIATPGRLMDHLASTPNFTLQHLRFLVIDEA
                     DRLLNQSFQDWLTQVLAYTRPPVEPIAPSFKRKPYDTVSSAFMEACGLVDKRGEWCDS
                     SPSICQKLLFSATLTRDPSKVAALSLHHPQYYIVQSSSVPALPTSVGEQFALPSSLSE
                     KMLILPPALKPLNLIHLIHHSEFNVDRALVFTKSVESAARLVKLLEFFEDAYVLGGGG
                     GKRLVVEQYSGETRAKDKKQLLAEFGEGKVNLIVCSDLIARGIDLPSVSHVVSYDIPL
                     DIRKYVHRVGRTARAGRQGTAWTLVEKQEALHFKGMLQNAGHLKAVKKVKVKEDDLSP
                     YRESYEIAMKRLKDYYHHD"
     misc_feature    1007832..1007873
                     /locus_tag="CNC03180"
                     /note="GA-rich"
     gene            complement(<1010392..>1011290)
                     /locus_tag="CNC03190"
                     /db_xref="GeneID:3256290"
     mRNA            complement(join(<1010392..1010534,1010598..1010829,
                     1010878..1010933,1010981..1011076,1011128..>1011290))
                     /locus_tag="CNC03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_570042.1"
                     /db_xref="GI:58265771"
                     /db_xref="GeneID:3256290"
     CDS             complement(join(1010392..1010534,1010598..1010829,
                     1010878..1010933,1010981..1011076,1011128..1011290))
                     /locus_tag="CNC03190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570042.1"
                     /db_xref="GI:58265772"
                     /db_xref="GeneID:3256290"
                     /translation="MAQTTDGQTPSPNSAKSTLEQRRARREQFRNFYGLKSDAAAKIE
                     GVNDSKLVDIDSPTFKPAAYYEDLIAKSTLSGLMRTTASLSSDIGRLQGTRHSLVYNH
                     HHQLFAAGDTISQLNARTPQLLSVVTNLQQSFSSISQLVDSINIPRIEEQIVVDPEEA
                     TTISRRKTQRQLERLRLMVQANESSDRINEFYKIHYEALHSLATEDDLAKKHLEDCEA
                     AIQLTSRIVPA"
     gene            <1011549..>1012669
                     /locus_tag="CNC03200"
                     /db_xref="GeneID:3256729"
     mRNA            join(<1011549..1011767,1011824..1012048,1012096..1012212,
                     1012270..1012385,1012447..>1012669)
                     /locus_tag="CNC03200"
                     /product="cap binding protein, putative"
                     /transcript_id="XM_569639.1"
                     /db_xref="GI:58264965"
                     /db_xref="GeneID:3256729"
     CDS             join(1011549..1011767,1011824..1012048,1012096..1012212,
                     1012270..1012385,1012447..1012669)
                     /locus_tag="CNC03200"
                     /codon_start=1
                     /product="cap binding protein"
                     /protein_id="XP_569639.1"
                     /db_xref="GI:58264966"
                     /db_xref="GeneID:3256729"
                     /translation="MTSTAIPPAAVAANNNTLNSALAAEQISSPASPVDKPVDEKKQL
                     EEGEIEENPSEGDSQTKTIFDDASKFNVKHPLFSTWTLYFDSPQSKSLPKTPQTTPAM
                     PQGSHGWMADIRKVVSFDSVEEFWGLYNNIIPPSQLPGKANYYLFKNGIIPAWEDPQN
                     KNGGKWSIQVPKNSESKSSIDRMWLYTMLAAIGETFETASTDSENAPSPTQSDLITGV
                     IVSPRPAFYRISIWTREASDVNVLDTDAIKARLLNIGKHFKTSVLGYELEQKLTEGGF
                     QTELTFDAHKDSEKKVNKNKFTV"
     gene            complement(1013286..1014658)
                     /locus_tag="CNC03210"
                     /db_xref="GeneID:3256778"
     mRNA            complement(join(1013286..1013410,1013469..1013578,
                     1013634..1013716,1013829..1013876,1013928..1014239,
                     1014299..1014658))
                     /locus_tag="CNC03210"
                     /product="expressed protein"
                     /transcript_id="XM_569641.1"
                     /db_xref="GI:58264969"
                     /db_xref="GeneID:3256778"
     mRNA            complement(join(1013286..1013716,1013829..1013876,
                     1013928..1014239,1014299..1014658))
                     /locus_tag="CNC03210"
                     /product="expressed protein"
                     /transcript_id="XM_569642.1"
                     /db_xref="GI:58264971"
                     /db_xref="GeneID:3256778"
     CDS             complement(join(1013677..1013716,1013829..1013876,
                     1013928..1014239,1014299..1014588))
                     /locus_tag="CNC03210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569641.1"
                     /db_xref="GI:58264970"
                     /db_xref="GeneID:3256778"
                     /translation="MEAELQTYRDQLAYVNLSLESDPSNDDLLKLKAELNELIDLTQQ
                     AMGHTAAAKGVDAGKEKAKAKGKEKEKEVTNWQDQGPYKAGMDCMAKYKDGKWYPARI
                     NAVVGSQESPLYAVTFKGYTSSTNLPLSSLKPHDPNAPIPQPQKRRADELTEKEKEKK
                     KKKGEKWMETQKQRAEEVKEKKNAWEKFGKKAQKKGIHISGLEGRSVFRTPDNPYGNR
                     GSRIWARRDGV"
     misc_feature    1013969..1014070
                     /note="CT-rich"
     misc_feature    1014374..1014417
                     /note="CT-rich"
     gene            complement(1015066..1018523)
                     /locus_tag="CNC03220"
                     /db_xref="GeneID:3256199"
     mRNA            complement(join(1015066..1015280,1015353..1015700,
                     1015752..1015860,1015915..1015926,1015980..1016046,
                     1016106..1016166,1016219..1016343,1016393..1016471,
                     1016522..1016536,1016590..1016607,1016654..1016666,
                     1016736..1016828,1016894..1017020,1017076..1017197,
                     1017251..1017310,1017365..1017388,1017450..1017640,
                     1017695..1017726,1017774..1017804,1017848..1017855,
                     1017914..1017938,1017993..1018003,1018066..1018077,
                     1018131..1018523))
                     /locus_tag="CNC03220"
                     /product="receptor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537197|gb|CF683038.1,gi|41539169|gb|CF685010.1,
                     gi|41546742|gb|CF692583.1,gi|41555671|gb|CF701512.1,
                     gi|41562710|gb|CF708551.1"
                     /transcript_id="XM_569994.1"
                     /db_xref="GI:58265675"
                     /db_xref="GeneID:3256199"
     CDS             complement(join(1015363..1015700,1015752..1015860,
                     1015915..1015926,1015980..1016046,1016106..1016166,
                     1016219..1016343,1016393..1016471,1016522..1016536,
                     1016590..1016607,1016654..1016666,1016736..1016828,
                     1016894..1017020,1017076..1017197,1017251..1017310,
                     1017365..1017388,1017450..1017640,1017695..1017726,
                     1017774..1017804,1017848..1017855,1017914..1017938,
                     1017993..1018003,1018066..1018077,1018131..1018243))
                     /locus_tag="CNC03220"
                     /codon_start=1
                     /product="receptor"
                     /protein_id="XP_569994.1"
                     /db_xref="GI:58265676"
                     /db_xref="GeneID:3256199"
                     /translation="MPDPSIPVVGHKTQRKLVGHNLLYSVSVFLSIGVWLFGYDQGVM
                     SGIITGPYFKAYFNQPTSTQIGNMVAVLEIGAFITSLAAAHIADNYGRRMTLRTGAIV
                     FTIGGAIQTFCVGYNSMVLGRIVSGFGVGMLSMVVPIYQSEISPADHRGLLGSVEFTG
                     NIIGYASSVWIDYACSFFQSDWSWRLPLSVQCIGGSVLFIGSFVTPESPRYLVDTDQE
                     VEGLAVIADFQGKALDDISVQAEYKEIRDAVLADRAVGDRSYRALWRRYKGRVLIAMS
                     SQLFAQLNGINVISYYAPLVFEQAGWIGRDAILMTGINALFYVASSLPPWYLMDRAGR
                     RPILLSGAVAMAIALTATGWWIYIDQAITPNAVVICVVIYNSAFGMSWGPVPWLYPPE
                     IMPLSFRAKGVSLSTATNWISNWWVGVSTPLFQELIGWRLYPMHAFFCALSFILVYFL
                     YPETRGVPLEEMDKLFGDESDEDEVDSDFDEVEEAESEISSLVSNPRHRRRSASSSLG
                     PSLPTSRKPSPIPSREASSSRGLFGRITDSVNGLIGSTKQQSRSVGYTAVNEE"
     misc_feature    1018897..1018917
                     /note="AT_rich"
     gene            1019178..1021192
                     /locus_tag="CNC03230"
                     /db_xref="GeneID:3256311"
     mRNA            join(1019178..1019843,1019913..1020428,1020485..1020862,
                     1020915..1021046,1021109..1021192)
                     /locus_tag="CNC03230"
                     /product="long-chain acyl-CoA synthetase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41560192|gb|CF706033.1,gi|41560197|gb|CF706038.1,
                     gi|41564425|gb|CF710266.1,gi|41564437|gb|CF710278.1,
                     gi|41570389|gb|CF716230.1,gi|41573544|gb|CF719385.1,
                     gi|41573552|gb|CF719393.1"
                     /transcript_id="XM_569644.1"
                     /db_xref="GI:58264975"
                     /db_xref="GeneID:3256311"
     CDS             join(1019313..1019843,1019913..1020428,1020485..1020862,
                     1020915..1021046,1021109..1021162)
                     /locus_tag="CNC03230"
                     /codon_start=1
                     /product="long-chain acyl-CoA synthetase"
                     /protein_id="XP_569644.1"
                     /db_xref="GI:58264976"
                     /db_xref="GeneID:3256311"
                     /translation="MTSLNSFPLLERIIARAQSAPASEAIVDVPHSLTVTYSELCGDI
                     LSLGSILTSFLSVPETRVVVLCDKGYLVPLSMLSIWTAGGLSVPVLPSLPLPEQAYMA
                     TNSDASLVICDANNKPRADELKADMEKEGIKTTVLEISLNGVRKAAYDKSGVETLSKM
                     SELHSERRAMMLFTSGTTGRPKGVVTRHSALGAQVSAVVQFWRWTSTDNLLHILPLNH
                     LHGIVVALLPALWAGATVELWEKFDARGIWMRWINNEGKTPITMFFGVPTLYSRLIQS
                     HPMLPKELQPIASEASSKLRLQVSGSAPLPESIKKTWEKEGGIGGGQVLLERYGMTET
                     GIIASTGWENDKRVKGHVGYALPGTGIRLWNEDLNQSITAFDTQGEIQVRGPSITTEY
                     WRLPEATAKEFVDGWFKTGDIGVWSSDTAAQNQLKVLGRKSTDIIKSGGEKISAVEIE
                     RAILELPGMKDCAVMGVEDEEWGQIVSVCLVTSRPSVTVNEIRNELRSVLAPYKLPKL
                     LKLYEGEIPRNNMGKVNKKKLVLEAFPK"
     gene            complement(1021589..1024826)
                     /locus_tag="CNC03240"
                     /db_xref="GeneID:3256155"
     mRNA            complement(join(1021589..1021809,1021861..1022151,
                     1022195..1023125,1023176..1023321,1023366..1024170,
                     1024214..1024420,1024476..1024826))
                     /locus_tag="CNC03240"
                     /product="protein-Golgi retention-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531487|gb|CF677328.1,gi|41533831|gb|CF679672.1,
                     gi|41533836|gb|CF679677.1,gi|41534367|gb|CF680208.1,
                     gi|41534378|gb|CF680219.1,gi|41536252|gb|CF682093.1,
                     gi|41536270|gb|CF682111.1,gi|41550586|gb|CF696427.1,
                     gi|41550598|gb|CF696439.1,gi|41553340|gb|CF699181.1,
                     gi|41553351|gb|CF699192.1,gi|41554135|gb|CF699976.1,
                     gi|41556021|gb|CF701862.1,gi|41556026|gb|CF701867.1,
                     gi|41556847|gb|CF702688.1,gi|41556862|gb|CF702703.1,
                     gi|41562761|gb|CF708602.1,gi|41565114|gb|CF710955.1,
                     gi|41565125|gb|CF710966.1,gi|41568072|gb|CF713913.1,
                     gi|41568593|gb|CF714434.1,gi|41570923|gb|CF716764.1,
                     gi|41570934|gb|CF716775.1"
                     /transcript_id="XM_569646.1"
                     /db_xref="GI:58264979"
                     /db_xref="GeneID:3256155"
     CDS             complement(join(1021645..1021809,1021861..1022151,
                     1022195..1023125,1023176..1023321,1023366..1024170,
                     1024214..1024420,1024476..1024747))
                     /locus_tag="CNC03240"
                     /codon_start=1
                     /product="protein-Golgi retention-related protein"
                     /protein_id="XP_569646.1"
                     /db_xref="GI:58264980"
                     /db_xref="GeneID:3256155"
                     /translation="MDEAKLLSDALANVKVQTVQLKRCLDQDEIMEALKAASSMLAEL
                     RTSSLSPKQYYELYMSVFDSLRFLSNYLYEAHTEGKHHLADLYELVQYAGNIVPRLYL
                     MITVGSVYMSVPDAPVKEIMKDMLEMSRGVQHPTRGLFLRHYLSGQTRDFLPVGNSDG
                     PGGNLQDSIGFVLTNFIEMNKLWVRLQHQGHSREREKREMERRDLRILVGTNLVRLSQ
                     LDGVDLDMYRKIILPSVLEQVVNCRDVIAQEYLMEVVIQVFTDDFHLHTLTPFLGACA
                     QLHPRVNIKGIVIALIDRLAAYAVREAESEDPEEKRRDEEEAARRLAEKVKGARGKGK
                     NVEEGEKNAPSPVAKPAEADVWGATTDTTSTTPVTENLSGESSKSPVEGEKLGESPAP
                     TPAQMEKEETAKKFRGIPEDVKLFEVFWQQVVELIKARPDLSIMDITALCVSLTNLSL
                     SCYPDRLEYVDQVLSFTHGKVHDYSQNPDLHSSQTVSNLLALLLAPISSYVSILTLLA
                     IPSYLPLLSVQPYSTRLSIGQAVVSSVLKNNTHIETSDDVTGVLGLCAVLVKDQKDHT
                     IGGGAPQRRGQAIDWREMAEEQGWVARMVHLFRADDLGVQFELLQTARRHFTEGGERI
                     RFTFPPLIASSIQLARRFKTRESVEDEWETRVSALFKFIHQLISILYHKVEAPETCLR
                     LFLLAAQVADDCRLEELTYEFFVQAFVIYEESISESRAQLQAITGIISSLQTSRVFGT
                     DNYDTLITKAALHGSRLLKKSHQATTVLYASHMWWQGDVPGREKNDKPPFRDGKRVLE
                     CLQKSLRIASSCIDEITSVQLYVDALDRYVYYFEQGVEAVTPKYVNSLVELITSNIDS
                     VNSGGDVHPSSAGGGLVEGVSGGDMIIKHFRNTLLYIRGRQRQAQTDVVDQGDEREGG
                     EEKKKVDWESVDVAGGCLKMGLTH"
     gene            complement(1025553..>1026298)
                     /locus_tag="CNC03250"
                     /db_xref="GeneID:3256124"
     mRNA            complement(join(1025553..1025735,1025799..1025993,
                     1026044..>1026298))
                     /locus_tag="CNC03250"
                     /product="transcriptional elongation regulator, putative"
                     /transcript_id="XM_569648.1"
                     /db_xref="GI:58264983"
                     /db_xref="GeneID:3256124"
     CDS             complement(join(1025649..1025735,1025799..1025993,
                     1026044..1026298))
                     /locus_tag="CNC03250"
                     /codon_start=1
                     /product="transcriptional elongation regulator"
                     /protein_id="XP_569648.1"
                     /db_xref="GI:58264984"
                     /db_xref="GeneID:3256124"
                     /translation="MSSTGWEIRFSNSRQIPYFYNSERSISTWEPPSELSAEQIQQLP
                     GAAKYMNVQLAQPAGGKEGQVRASHILAKHAGSRRPASWRNDKITITSDEAQAIIEQH
                     IAYLQSLPPADLPKEFAKIASTESDCSSARKGGDLGWFGRGQMQKPFEDATFNTPVGQ
                     LSGIVKTDSGIHVILRTG"
     gene            1026871..1029068
                     /locus_tag="CNC03260"
                     /db_xref="GeneID:3256397"
     mRNA            join(1026871..1026954,1027150..1027210,1027261..1027467,
                     1027518..1027770,1027820..1028221,1028274..1028410,
                     1028467..1028629,1028682..1029068)
                     /locus_tag="CNC03260"
                     /product="beta1-tubulin, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530305|gb|CF676146.1,gi|41530644|gb|CF676485.1,
                     gi|41530649|gb|CF676490.1,gi|41532281|gb|CF678122.1,
                     gi|41532290|gb|CF678131.1,gi|41533063|gb|CF678904.1,
                     gi|41533450|gb|CF679291.1,gi|41533462|gb|CF679303.1,
                     gi|41533485|gb|CF679326.1,gi|41533492|gb|CF679333.1,
                     gi|41533872|gb|CF679713.1,gi|41533985|gb|CF679826.1,
                     gi|41535044|gb|CF680885.1,gi|41535046|gb|CF680887.1,
                     gi|41535370|gb|CF681211.1,gi|41535384|gb|CF681225.1,
                     gi|41535429|gb|CF681270.1,gi|41535433|gb|CF681274.1,
                     gi|41535533|gb|CF681374.1,gi|41535625|gb|CF681466.1,
                     gi|41535637|gb|CF681478.1,gi|41536048|gb|CF681889.1,
                     gi|41537051|gb|CF682892.1,gi|41537059|gb|CF682900.1,
                     gi|41537269|gb|CF683110.1,gi|41537379|gb|CF683220.1,
                     gi|41537492|gb|CF683333.1,gi|41537495|gb|CF683336.1,
                     gi|41537506|gb|CF683347.1,gi|41537511|gb|CF683352.1,
                     gi|41537985|gb|CF683826.1,gi|41538168|gb|CF684009.1,
                     gi|41538182|gb|CF684023.1,gi|41538763|gb|CF684604.1,
                     gi|41538814|gb|CF684655.1,gi|41538824|gb|CF684665.1,
                     gi|41538913|gb|CF684754.1,gi|41538920|gb|CF684761.1,
                     gi|415"
                     /transcript_id="XM_569650.1"
                     /db_xref="GI:58264987"
                     /db_xref="GeneID:3256397"
     CDS             join(1026954,1027150..1027210,1027261..1027467,
                     1027518..1027770,1027820..1028221,1028274..1028410,
                     1028467..1028629,1028682..1028801)
                     /locus_tag="CNC03260"
                     /codon_start=1
                     /product="beta1-tubulin"
                     /protein_id="XP_569650.1"
                     /db_xref="GI:58264988"
                     /db_xref="GeneID:3256397"
                     /translation="MREIVHLQTGQCGNQIGAKFWEVVSEEHGIQADGSYKGTTDTQL
                     ERINVYYNEAAAGKYVPRAVLIDLEPGTMDSIRGGPLGSLFRPDNFVFGQSGAGNNWA
                     KGHYTEGAELVDSVLDVVRREAEGCDCLQGFQITHSLGGGTGAGMGTLLISKIREEFP
                     DRMMCTFSVVPSPKVSDTVVEPYNATLSVHQLVENSDETFCIDNEALYDICLRTLKLS
                     TPTYGDLNHLVSVVMSGVTTCLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTAR
                     GSASYRAVTVPELTQQMFDAKNMMAASDPRHGRYLTVACYYRGKVSMKEVEDQIQSVQ
                     AKNSAYFVEWIPGNISAAQCDIPPRGLKMSSTFICNSTSIQSLFKRIGEQFSAMYRRK
                     AFVHWYTGEGMDELEFSEAESNLQDLVSEYMQYQEAGADDEIYGDEEIPIEEEEM"
     gene            complement(1031247..>1036239)
                     /locus_tag="CNC03270"
                     /db_xref="GeneID:3256609"
     mRNA            complement(join(1031247..1034046,1034118..1034741,
                     1034804..1035958,1036004..1036108,1036182..>1036239))
                     /locus_tag="CNC03270"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543527|gb|CF689368.1,gi|41543530|gb|CF689371.1,
                     gi|41549125|gb|CF694966.1,gi|41566999|gb|CF712840.1"
                     /transcript_id="XM_569652.1"
                     /db_xref="GI:58264991"
                     /db_xref="GeneID:3256609"
     CDS             complement(join(1031312..1034046,1034118..1034741,
                     1034804..1035958,1036004..1036108,1036182..1036239))
                     /locus_tag="CNC03270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569652.1"
                     /db_xref="GI:58264992"
                     /db_xref="GeneID:3256609"
                     /translation="MPQVTVHRAHSPIVWHGKLKWVARLAPRLQLDASPQQLRIAHVR
                     DGGREVDIWDDYDFDAFKSRAAAQSAPLVVKVYPPGASSEPGASPATAAPARKPRKKA
                     VPSDDQPAPGTPPSTKKDKGKSKASPQSQNLAAPVLQPQQPSTPTAAPKSKKRKRDST
                     SSAAEPLPTRALPVQPTPTGPGRQSTSPQQPKKRRKRGAKSDAALAPAPPPANPSAPA
                     IASPSRPFTFSLPLQGSAAFINRYKPAKPSPLGRIDGPPVLAGETASTSSSPAAKETL
                     QPLTESGKKSRKPRKRKEKKEEGVGGVPASPAASSVAPSPAPSSSKKQKSRPSVTEEI
                     MRKQREKMAAEEAKKQAENADKANAKGKDKEKATDKPTAMPAASTSIPLTPSKESTTQ
                     PSTPELSTQSPLTKTKKEKSPKTPKVNRASEIMRMFREKQAAEAAAKAAEQSIPPVVQ
                     TVQPEQPSVSSAQPSTEHLSSTPATPASALESKKPSSAKPKAAPRPSITLEIMRKQRE
                     KMAAAETQAAENVEQENAGEAMDVDQPREKAHIPLVEQSKQGQAEQNTLQLEPQSEIQ
                     TESGPVAPPLVSHGFATVPQTPTQSSVQPSNTSSTTKKTKSGRPSITSEIMRKQREAM
                     AQQAEKEKEQEEQIATRDDGDKEASKPKQPQCLICHGSSHPQKDCPVVKAGVPRLQQV
                     LLERKEEDESPEAAVAAIEMWIDRLGRVTSALMGTPVTKGKGRPSSAGLTTQAKQTPS
                     QAASAPAVETESSASESSKSPSPTLPKAASPVPTFPPIYHKALSRKAGSTSGLSVSDA
                     VIETGSSGSSASESSEDEGGSVGSGSGYGSESETESESSASIQGQNAMSRSGSTSTSS
                     SPPPSSSSPSPPPPDLSKLDPQAALRHFLTAPLSQKQRRAARDSAAHMQVVDTQDVEI
                     EEASEVESDEDGTNASFARIRMDDEESLVGEFEDDEKEEDEVEDVEEEPRDEQPPALP
                     QVQQSESDDEMQLDVEGSQPVLEQESALQPRAGQEEEEIRIDVTNTEAEPMDVDQRQT
                     PLKTTQSPPESSPLSFHEGSRQSFNDLAALASPSTQHRELPGDAAVREAIAEDEAPVR
                     DAMRQDDDVHPKQRIPNGVQEPVLTQQLMSPPSSVAEREDEIEPLPATQLVQRFEDEE
                     GQGEATPIAKSKAPVRRSTRQPSRQPSVARDDIPSPPRRRLRSASREPALVPEPPRTR
                     MTRSSSQQRVVPPSPHVPIRRSTRRTVSSQSDVSQLSSSQLEPSSPVQLHATLTPATL
                     RRSSRRQTTPLRSSQVDELDPSSPPPASQQPIEESPLFIPETQLQHSQPQSSQSQSLN
                     SQRFWRISGEEENPLFMSQGSQIPQTQAYNLYPNIDSSSDVGETPRGAKIGIEGSSPS
                     NDKQGEGKRANYLSVSSPILEEDEEEQNALVDTEKHEQTSESGVDEHDDQSVDASEAS
                     SDDEGSSISIPIPRSQPIYPSLPRSSLSFSQPVAASQPSTGFPTLSSLPREALRRMKS
                     TFGFSSSQPETSKEKTSRHMNGAGDESESETSGDSSDEEPASLRGRFAGTRARKVKSQ
                     GAVKGW"
     gene            <1036380..>1037492
                     /locus_tag="CNC03280"
                     /db_xref="GeneID:3256685"
     mRNA            <1036380..>1037492
                     /locus_tag="CNC03280"
                     /product="elongation factor ts (ef-ts), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534072|gb|CF679913.1,gi|41534871|gb|CF680712.1"
                     /transcript_id="XM_569654.1"
                     /db_xref="GI:58264995"
                     /db_xref="GeneID:3256685"
     CDS             1036380..1037492
                     /locus_tag="CNC03280"
                     /codon_start=1
                     /product="elongation factor ts (ef-ts)"
                     /protein_id="XP_569654.1"
                     /db_xref="GI:58264996"
                     /db_xref="GeneID:3256685"
                     /translation="MALLSAAPRALRLPRRLPLGAALPALRALATPAAAQKVPVSLIA
                     ALRKQHPVPLAQAREALERSGLDLAAALDYLRTSTSASAEKKAAKVSGRDTNEGLIAI
                     SLLGGKRVGMIHLACETDFVARNQVFLDTARGVAETTAFLDVPGDHEKPQIASSPYAF
                     DPILDFPTESLLSAPLISLPAADTADGSLSPLPTSEPTTIKQSLLSSLAQTGENLKLL
                     RAVSFAAPFPSTPDVRFVPGGYAHGGITDKEGKVGGIVVLSVTSADPEKPIASIIHGP
                     GGDDLEKAAESLARTVARQVVGFPTKVIDRGDRAVDDEEVLMEQPFMMFNGDSRSVKD
                     VLAEWGKERGVVLRVVGMRRWAVGDEIEIKEKETDA"
     misc_feature    1036393..1036428
                     /locus_tag="CNC03280"
                     /note="GC_rich"
     gene            complement(<1037564..>1039904)
                     /locus_tag="CNC03290"
                     /db_xref="GeneID:3256325"
     mRNA            complement(join(<1037564..1037871,1037913..1038441,
                     1038521..1038889,1038936..1039069,1039131..1039209,
                     1039261..1039371,1039426..1039516,1039567..>1039904))
                     /locus_tag="CNC03290"
                     /product="tetracycline efflux protein, putative"
                     /transcript_id="XM_569993.1"
                     /db_xref="GI:58265673"
                     /db_xref="GeneID:3256325"
     CDS             complement(join(1037564..1037871,1037913..1038441,
                     1038521..1038889,1038936..1039069,1039131..1039209,
                     1039261..1039371,1039426..1039516,1039567..1039904))
                     /locus_tag="CNC03290"
                     /codon_start=1
                     /product="tetracycline efflux protein"
                     /protein_id="XP_569993.1"
                     /db_xref="GI:58265674"
                     /db_xref="GeneID:3256325"
                     /translation="MTTHETGEFVEDQDGKAEDDGLHTHDEEHEHGHEEGDQEHLEQS
                     HKTLRSEKGKEDNREQGKDEEAEIEGKKSGQKKTFELQDQTNLLPTKQVIFVFVGLTC
                     ALFCSLLDQTIVTTALPTLGQVFGRADISPWVGTAYLLTSTATQPVYGRLSDIFGRKF
                     TLLGCLFIFLMGSLACALAQTMIQLIIFRAIQGLGGGGILTLAMIIISDVVSLKERGK
                     YQGITGCVVALANSCGPIVGGAFTENASWRWCFYINLPLTSISMIIIVFLLPLRRVRG
                     SMVAKIKKLDFYGSILTLAWAAPFLIALSWAGSQYAWDSAAVLVPLLVGLALLGLFIF
                     VEAKVVSLPLVPMHIFKNASVSACFFTTFMNGLSFYATLYYLPQYFQIVRGASAIRSG
                     VLTLPLMLVQTVTSFTSGIIQSKTGDYWWNLVVGYTIWTIGLGLISSITSTTSIAKLS
                     GYQIIVGIGAGQTFQTSLVAIQAGVERKDMATATGLRNFLRQLGGTIALAACNSIVNN
                     CVRRNLSGVLPGTAYKAILEDPTRATSLGLSASELSAVTDAYGNADREGGDLNVARGI
                     NEVFWFCAPCVGICIPITIFLIKKVTLNRSDDAVKKAEAKAWVESKKAKRAKKRKGSE
                     ETVVDSGASTMVSGEEKKRDGRRIGKEQ"
     gene            complement(1040571..1044619)
                     /locus_tag="CNC03300"
                     /db_xref="GeneID:3256744"
     mRNA            complement(join(1040571..1040812,1040867..1041127,
                     1041181..1041369,1041423..1041801,1041851..1042601,
                     1042654..1042786,1042833..1043098,1043145..1043705,
                     1043762..1044028,1044082..1044502,1044579..1044619))
                     /locus_tag="CNC03300"
                     /product="protein kinase C, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532170|gb|CF678011.1,gi|41532174|gb|CF678015.1,
                     gi|41536681|gb|CF682522.1,gi|41536687|gb|CF682528.1,
                     gi|41537035|gb|CF682876.1,gi|41537045|gb|CF682886.1,
                     gi|41542822|gb|CF688663.1,gi|41542828|gb|CF688669.1,
                     gi|41544251|gb|CF690092.1,gi|41544255|gb|CF690096.1,
                     gi|41545965|gb|CF691806.1,gi|41545974|gb|CF691815.1,
                     gi|41549612|gb|CF695453.1,gi|41549624|gb|CF695465.1,
                     gi|41551675|gb|CF697516.1,gi|41551685|gb|CF697526.1,
                     gi|41554975|gb|CF700816.1,gi|41554982|gb|CF700823.1,
                     gi|41554993|gb|CF700834.1,gi|41555004|gb|CF700845.1,
                     gi|41556121|gb|CF701962.1,gi|41556129|gb|CF701970.1,
                     gi|41563251|gb|CF709092.1,gi|41563260|gb|CF709101.1,
                     gi|41564156|gb|CF709997.1,gi|41564160|gb|CF710001.1,
                     gi|41565794|gb|CF711635.1,gi|41566143|gb|CF711984.1,
                     gi|41566151|gb|CF711992.1,gi|41567227|gb|CF713068.1,
                     gi|41568858|gb|CF714699.1,gi|41568864|gb|CF714705.1,
                     gi|41571167|gb|CF717008.1,gi|41571175|gb|CF717016.1"
                     /transcript_id="XM_569656.1"
                     /db_xref="GI:58264999"
                     /db_xref="GeneID:3256744"
     CDS             complement(join(1040783..1040812,1040867..1041127,
                     1041181..1041369,1041423..1041801,1041851..1042601,
                     1042654..1042786,1042833..1043098,1043145..1043705,
                     1043762..1044028,1044082..1044502,1044579..1044581))
                     /locus_tag="CNC03300"
                     /codon_start=1
                     /product="protein kinase C"
                     /protein_id="XP_569656.1"
                     /db_xref="GI:58265000"
                     /db_xref="GeneID:3256744"
                     /translation="MASNDPKAKVILQSIATEKRNIEGARAVIRAFEASSKNETVIQQ
                     AQNEIRTATMSIKFLEDELAKLQVGGSGGASGTPGRGEPSGGTGAGVPGKQGPQGVVA
                     SSPGGRGMAGDRERPLPPPPPGAEQDSAKKPETKNYSQLDLLRYDAPLTGAKITRMLN
                     QLQFKLQVEEQYKTGIEKMAQAYRAEGDKRLKSETDAKKSESEGKIQLLRKAKKRYES
                     LAKFGGAVEDDEDLMSDGKRKEALRKPISGKLVISLRSARDLNHRALPRRSSKTYSET
                     TVVIKVEGNERAVSHPSRNDKWHEDFHIPVEKANEVEITIYDTVAPGDSAPIGMLWLR
                     VSDLVEALRRQKVGIEGQGAGWVTAATAATMGPRSSGNAPDSVTLHSAGTLRGKPDAE
                     GKGPDGIDGWWSVEPAGAISLRMDFVKDTVAGARRPYEALGRQGAVRMRKGDVYEMNG
                     HKFVQRQFYQPIMCALCQEFLLTGEGYQCEDCRYACHKKCYPKVVTKCISKSNADGEG
                     DEEKINHRIPHRFTPYTNMSANWCCHCGYMLPFGRKNAVKCSECALTCHQTCSHLVPD
                     FCGMTMEMANLLLKNLRDIKTTQHRKPVPSTSTSSSVSTLPSYHSQESRSHPVQSAAP
                     QQPAPSSRPPAGALPSTDQRPIQPQVQNQQTGAYDNLRPAGGRAMPQLPPVAVPSNKI
                     SFEGDRLQEPHGQIPPVMPAAQPQPQTLPPSAQSVQSPVKPQYVPQPAVQQQVAQRLP
                     PQQPLMARKRKVGLDDFNFLAVLGKGNFGKVMLAEEKTSSNLYAIKVLKKEFIIENDE
                     VESTQSEKRVFLAAAQERHPFLLGLHSCFQTETRVYFVMEYISGGDLMLHIQKKQFTL
                     RQAKFYACEVLLALQYFHSKGIIYRDLKLDNILLTLDGHVKVADYGLCKEEMWFGKTT
                     STFCGTPEFMAPEILLEQRYGRAVDWWAFGVLTYEMLLGQSPFRGEDEDEIFDAILED
                     EPLYPITMPRDAVSLLQRLLTRDPTRRLGAGEGDAEEIKQHLFFRDVNFDDVYHKRIP
                     PPYFPVIGNATDTSNFDQEFTREQPTLTPVHTQLSEADQKEFAGFSWIAPWAAAQT"
     gene            1046969..1049654
                     /locus_tag="CNC03310"
                     /db_xref="GeneID:3256153"
     mRNA            join(1046969..1047232,1047288..1047345,1047405..1047431,
                     1047489..1047507,1047562..1047609,1047669..1047925,
                     1047976..1048034,1048091..1048193,1048256..1048603,
                     1048655..1048718,1048771..1049042,1049091..1049249,
                     1049311..1049654)
                     /locus_tag="CNC03310"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530610|gb|CF676451.1,gi|41530621|gb|CF676462.1,
                     gi|41533377|gb|CF679218.1,gi|41533380|gb|CF679221.1,
                     gi|41537479|gb|CF683320.1,gi|41537484|gb|CF683325.1,
                     gi|41553437|gb|CF699278.1"
                     /transcript_id="XM_569658.1"
                     /db_xref="GI:58265003"
                     /db_xref="GeneID:3256153"
     CDS             join(1047066..1047232,1047288..1047345,1047405..1047431,
                     1047489..1047507,1047562..1047609,1047669..1047925,
                     1047976..1048034,1048091..1048193,1048256..1048603,
                     1048655..1048718,1048771..1049042,1049091..1049249,
                     1049311..1049487)
                     /locus_tag="CNC03310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569658.1"
                     /db_xref="GI:58265004"
                     /db_xref="GeneID:3256153"
                     /translation="MFLSRLAARQTRVQSYLPRQIAYRSFSSTIAIGMSMNDDILTKA
                     VLPDNELKNGEKKAVDFGEGKVLLSKINGRVYATSAFCTHYGAPLEKGVLSHDGRLVC
                     PWHGACFNVCSGDVEDAPGLDSLWSFSANVKNGQIEVTASKKEVTSKVGRIVARKRTK
                     DQMQNQGQVSEETVVIVGGGSGGIHTLESLRMNGFGGKIVLISAENYAPIDRTKMSKS
                     LLDDVEKLQWRTPDELRDSFGVDFHPGTTVTKVDFEAQTVTDSSGVLYKYNHLVLSPG
                     GRPKKIPIPGADLKGVVTLRHVEDTKTITSSITKDSDVVLIGTSFISMEASVAVLKKG
                     PKSVTLVGMDDVPFQGLLGKEFGSALMESMKEQGIKFRMSAQIEKITASDSNPDHAGM
                     LHVKGSDPIPANLIIMGTGVSPATSFLEGSVKLEEDGGVLVDEYLHLKGYKNVYAIGD
                     IAHYIQYPDKFPRRVEHWNVASNHGREVGHNITHPDNPVIYTKVPIFWSSIGKGLRYL
                     GTGAGYDDMYVDGNFKELKFAAYQAKGGKVTAVATMQRDPIVSKASELMRLDLMPPLE
                     EIKKGKDILQIELINKGQK"
     gene            complement(1050076..1053110)
                     /locus_tag="CNC03320"
                     /db_xref="GeneID:3256789"
     mRNA            complement(join(1050076..1050541,1050613..1051010,
                     1051961..1052282,1052340..1052455,1052520..1052527,
                     1052587..1053110))
                     /locus_tag="CNC03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_570041.1"
                     /db_xref="GI:58265769"
                     /db_xref="GeneID:3256789"
     CDS             complement(join(1050297..1050541,1050613..1051010,
                     1051961..1052282,1052340..1052455,1052520..1052527,
                     1052587..1052730))
                     /locus_tag="CNC03320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570041.1"
                     /db_xref="GI:58265770"
                     /db_xref="GeneID:3256789"
                     /translation="MADTGLLEAYAEPMLGPEDELDREYRKSPRKKPRITLPRGHACV
                     ACRQRKLKCQEGIRPCITCVKANIDCRDEEIPRKKPRHVVLEERVAELEGLLGLQKGQ
                     PVPRKSNPSSTTFSGYSASPSPSEHFFSEYPQVSSSHTVNPYLDHPPLSVTGRPTASS
                     QIEIPPGSAIELSLIQFILPYTPYLLLPLHPQRFLASLFDLPKITHPTSLSNEGSFPF
                     FPHIPPIEDVESVEICLALFRQHIPLPFIFPPPVSTANGPAMASAPLDTEIYDGPSDP
                     WWILFHFNLYAAEMLMWREMAFHRPESSGAALQCARALVNLTRSIPDEKWANVDMMVA
                     FSISLAARLLVKEAARFQASGALTAAAHALADADILQNCLDGPFNRYMEVAGGMFSRI
                     VDNVREGRTEKNGEYERV"
     gene            complement(<1054441..1059301)
                     /locus_tag="CNC03330"
                     /db_xref="GeneID:3256643"
     mRNA            complement(join(<1054441..1054486,1054534..1054845,
                     1054895..1055537,1055592..1055682,1055736..1058500,
                     1058562..1058900,1058972..1059301))
                     /locus_tag="CNC03330"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41567426|gb|CF713267.1,gi|41572082|gb|CF717923.1"
                     /transcript_id="XM_569992.1"
                     /db_xref="GI:58265671"
                     /db_xref="GeneID:3256643"
     CDS             complement(join(1054441..1054486,1054534..1054845,
                     1054895..1055537,1055592..1055682,1055736..1058500,
                     1058562..1058900,1058972..1059185))
                     /locus_tag="CNC03330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569992.1"
                     /db_xref="GI:58265672"
                     /db_xref="GeneID:3256643"
                     /translation="MTQKQSFADFLASGSPYGGKNRGRGSSSRGRGGGGRGGFYGNAS
                     KKAYNADYSNVPFDYDRINSQHYKKLEPASVAPYGNRDINRFHNGPDKNVSSSSYHVP
                     RLAHTPGTATPNKIHGLGFQTSSQLSQSDSVHPSVEMTKNKTASESSRGLSGSRWGGG
                     LAPLFIKAGELFKDGEVDVITQEEDKGIDVGHYYKPEASETRMADTESQANTQLLQAE
                     DGDNTSDAVIDGKSEQLKVDSQSGSSLPPTAGDDSNIFQVVQYTGELSIGPSIGNSHQ
                     DPVEGGYSRNGGIMGIPVPNEHQFTGSNTFTKTCPDIMSSFDRHEHVDGLVSEADLQP
                     HQEDTLFFIDTNPDPDSTPSQTPQYNTVAAPPIGSSSPDSDEEDIVFVPRAYNQQKAI
                     GPHVSSLHQRHGMRCLGQGSSKYQSYIEIVDDLNAQPLLDSTRQIQNFVEDANPNPQP
                     PSVPASLRTEELPDSISGYINAPAASYTDEKMVKHQKKRANKNAKRLARRAAARGVPR
                     DDSDIEWGSDGPPNLAGGEQDQMSVDDLIGGGKGKESEAILRDYLEGVKLSQKADEDE
                     DKYEDDDDMAALSKWANRINVLGKEVDSDEDSDEESSPPSVQASASKIYHGPEDRRDE
                     LRQDEKDDDELRELETLHNFANRINALDEGQNLSEGEEITLVQPQAPKISLKLQEKRR
                     EQHEKLEHGDGDVMDEELMELEALQEFADRINGQGIENESSGDDMGEIQMQKIQSPPK
                     ARVKQVKFSSYNQEITHAQWEADEEKLALDKWALSINTFGGDDYGDDDDDENMGVLLP
                     TQQDNKLQPRFMECFEPDSEQDEEDAELDALDAWISRVNSHSQGQDLSDDELDTAYTS
                     SKPKLKKPALPKMRQRQSSPSSQPSLNQQSKHMSPEELSQPTELGDNEGWPISEAEAT
                     EDNPWAFDPKEAEKDNPWAAKDPKEEHNLRSGEVVYEEQNFTQSTSLHADISSDSPPE
                     QPDVVVFSTSEERLAEQRRESEGGDWSNGKIASKVFNEVYSEEEDLEAEGDDSSSSST
                     GKWKKYEAKQEEGMFNGVNHWSDDDESEDDSDEGRDEISGENDGDSDSHYESEEDEED
                     DMEVDDYDQTEWFINAMEDALGGKEINFNDPRAKMFNAIKEDSYEFSSAPAKKGKKNK
                     QLKGIPMELQVQWEKDRQTKAEKKRQRELARHAEEFDSTIISGSSRNGKNKRYSKKGG
                     QSKDSKQIYQASVAHLISGSAADVADMFSEEEGLSDSEHEEYFGHSDRYETIGNDPFN
                     LSLKPKNARFSMGFKKNKKRGLEKKTVAGPEWKTLDWVDDLIQAFLKDKKSESMSLPA
                     MDKEGRKKIHMLAECYGVGSTSRGSGKKKSISLYKTKRSGVDVKEEKRERLLTAAPFS
                     GSMFHKTLYTKSSHGGVKSKGRDWASGATAKPREGELVGYGADKIGIDNVGHKLLSKM
                     GWAEGNKIGIGSGSGIDAPIVAVVKNTKSGLGA"
     gene            complement(1059706..1065250)
                     /locus_tag="CNC03340"
                     /db_xref="GeneID:3256127"
     mRNA            complement(join(1059706..1060395,1060449..1060916,
                     1060968..1061692,1061748..1062157,1062210..1062424,
                     1062477..1062756,1062806..1062846,1062903..1063064,
                     1063102..1063194,1063247..1063444,1063502..1063561,
                     1063610..1063681,1063726..1064981,1065110..1065250))
                     /locus_tag="CNC03340"
                     /product="protein-histidine kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532734|gb|CF678575.1,gi|41556358|gb|CF702199.1,
                     gi|41569712|gb|CF715553.1"
                     /transcript_id="XM_569660.1"
                     /db_xref="GI:58265007"
                     /db_xref="GeneID:3256127"
     CDS             complement(join(1060108..1060395,1060449..1060916,
                     1060968..1061692,1061748..1062157,1062210..1062424,
                     1062477..1062756,1062806..1062846,1062903..1063064,
                     1063102..1063194,1063247..1063444,1063502..1063561,
                     1063610..1063681,1063726..1064886))
                     /locus_tag="CNC03340"
                     /codon_start=1
                     /product="protein-histidine kinase"
                     /protein_id="XP_569660.1"
                     /db_xref="GI:58265008"
                     /db_xref="GeneID:3256127"
                     /translation="MSLPDAYPPVIATEGSTAFQSHILSLLSVISQHPSPDYPFPSSG
                     DSTLQDNASVTAKKNATLSTFPGKKTPAEDAIERAIIALGDRVWTSERTQAHLVKDVK
                     RDVPAQPGSDLLTPDWTPPVPTLNDSSPDPVCPTCTRPVSSSETSSFTPQQIASFYHP
                     FTAALSTPPPPLPEQMFFPQSVLAAYVSATSDSESAGDSGMSAEKELELLKAQVQDIA
                     RVCKAVATGDLTQKIIVPVKGQTMTELKNIINAMVDRLQTFAVEVERVSLEVGTEGKL
                     GGQAVVPNVEGTWKVLTAVVNKLAANLTNQVRSIAKVTKAVAKGDLSETIDVEASGEI
                     AELKTTVNGMVMSLRTLADEVSRVSLEVGSQGKLGGQANVPDVEGVWKDLTVNVNRMC
                     ESLTTQVRSIGSVTTAVARGDLSKMIEIEAEGEMAVLKNTVNSMVRQLTVFAKEVTRV
                     ALEVGTHGQLGGQAVVPGVEGVWDDLTTNVNKMARNLTDQVREIAMVTKAVARGDLSK
                     TVNADVQGEILDLKCTVNEMLTNMPCKVAQLTVFAAEVTRVSLEVGTEGKLGGQAVVP
                     NVEGTWMVLTDNVNLMALNLTTQVRSVAEVTTAVAAGDLSKKINVAAFGEILELKNTV
                     NNMVDSLRSFSSEVTRVAREVGTDGRLGGQAKVPGVAGTWKDLTDCVNIMAANLTEQV
                     RTIAHATTAVARGDLTQKVVGVKVSGEILDLVNTINNMIDQLAIFAAEVTRVAREVGT
                     EGKLGVQAEVENIEGTWQEITSNVNTMASNLTSQVRAFAQISAAATDGDFTRFITVEA
                     SGEMDSLKTKINQMVYNLRESIEKNTKARQEAEMANRSKSEFLANMSHEIRTPMNGII
                     GMTVLTLESELTRQQRENLMIVSSLAGSLLTIIDDILDISKIEAGRMTMEQIPFSLRV
                     AVFSVLKTLCVKAAQNKLDLIFDVDPTMPDQLIGDPLRLRQVITNLIGNAVKFTTKGQ
                     VALSCRVKRYVTVADAVELEFCVADTGIGIKQDKLDVIFDTFAQADGSTTRKYGGTGL
                     GLTISKRLVNLMSGDLWVESEYGQGSRFYFTTVAEMTSVPRDQIIERLSPWSGRSVLF
                     IDTLGDQTGIVEMLQELGLKPIVIHSVNDVYLLQDQGLTVFDTMIVDSLKAAGELRGI
                     EYLRYIPIVLLAPSNKPSGPSNPSFISLPESRRRLLALPSASEQLLSPIPVKDCLEMG
                     INTYYTTPLSLQELSNAIVPALESHQIQPGDTVKDTILSVLLAEDNLVNQKLAVKLME
                     VAGHKIEVADNGEIALEKYKRRQLARTPFDVILMDVSMPVMGGMEATGLIREFEANEG
                     VPRTPIIALTAHAMIGDKERCLAAGMDEYVTKPLRRGDLLASIAKVLAPKQSASGLEM
                     PAVPIPANIYGR"
     gene            <1067238..>1067956
                     /locus_tag="CNC03350"
                     /db_xref="GeneID:3256530"
     mRNA            join(<1067238..1067500,1067557..>1067956)
                     /locus_tag="CNC03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_569662.1"
                     /db_xref="GI:58265011"
                     /db_xref="GeneID:3256530"
     CDS             join(1067238..1067500,1067557..1067956)
                     /locus_tag="CNC03350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569662.1"
                     /db_xref="GI:58265012"
                     /db_xref="GeneID:3256530"
                     /translation="MLPLACYWMIVVMVLWVLLTVLVPFGYRIRDLDSITRHLRFAIV
                     EACVLCVSLFGNVLCWLAFGLGRSAYLSVQNGGGDPKSGRAMETTAVAALLSLLSLGT
                     AIRGLDLRLRGAQTHWREEAVMVRRRSMALLASGAARPEDAATLGVTGDFWERKDSQR
                     WSTNSSDVPSYTANNGALQHRDNELKTGYRPDIERGEEEEIDVKLEEAKRNSVDQIRR
                     TS"
     gene            complement(1068296..1070039)
                     /locus_tag="CNC03360"
                     /db_xref="GeneID:3256570"
     mRNA            complement(join(1068296..1068752,1068798..1069007,
                     1069059..1069429,1069482..1069777,1069847..1070039))
                     /locus_tag="CNC03360"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530504|gb|CF676345.1,gi|41530514|gb|CF676355.1,
                     gi|41533059|gb|CF678900.1,gi|41533067|gb|CF678908.1,
                     gi|41533075|gb|CF678916.1,gi|41533078|gb|CF678919.1,
                     gi|41537776|gb|CF683617.1,gi|41537783|gb|CF683624.1,
                     gi|41543204|gb|CF689045.1,gi|41543214|gb|CF689055.1,
                     gi|41569342|gb|CF715183.1,gi|41569347|gb|CF715188.1"
                     /transcript_id="XM_569664.1"
                     /db_xref="GI:58265015"
                     /db_xref="GeneID:3256570"
     CDS             complement(join(1068401..1068752,1068798..1069007,
                     1069059..1069429,1069482..1069777,1069847..1069952))
                     /locus_tag="CNC03360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569664.1"
                     /db_xref="GI:58265016"
                     /db_xref="GeneID:3256570"
                     /translation="MFYATAGQQATQQPPTSRIAGYPRNGPPGFSVRSSDPNDFPALG
                     SHNQHNSSYIAQNQGGQSSANASHQNSQLQQQQHLYMQQQQQQQQQQLGVTPAPPPGI
                     SGPTASAPSQSNGGLTEEFPALGASSESKDGRMANFFRNPSSVHQPIPSSPSPLPNGT
                     SNASASQSADATPSTNPPHPQSGIGGPASTTDSWQRQSPRHTEPVVRPVQQILSSPVD
                     RWGLKALLFEIQMHMNKTDRGMMVFGEDLEELGVDINSEEALYPTFVTPWAEPNSLPP
                     PQIEESFHIPQCYYVHAPPVESKLQNFAEDTLFLAFYMSPQDVLQLRVAEELYARGWR
                     YHTELQTWLTSPTLASIDLSKADRSSGQPNWIRGPFAYLDTRTWVRQRTAEDFTIDAN
                     VLELTKLADDVIREEAARKEAQKSPGGVPVNGQNQAQSQGQQNQGQALSYQR"
     repeat_region   1069610..1069671
                     /rpt_type=tandem
                     /rpt_unit_seq="ttg"
                     /satellite="microsatellite"
     gene            <1070207..>1070684
                     /locus_tag="CNC03370"
                     /db_xref="GeneID:3256743"
     mRNA            join(<1070207..1070209,1070265..1070307,1070367..1070412,
                     1070461..1070584,1070637..>1070684)
                     /locus_tag="CNC03370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570039.1"
                     /db_xref="GI:58265765"
                     /db_xref="GeneID:3256743"
     CDS             join(1070207..1070209,1070265..1070307,1070367..1070412,
                     1070461..1070584,1070637..1070684)
                     /locus_tag="CNC03370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570039.1"
                     /db_xref="GI:58265766"
                     /db_xref="GeneID:3256743"
                     /translation="MSSELRYTANTQLEQLHARYTGTGHADTTKYEWLTHQHRDTLAS
                     IVGHPPLLAYLSVADGECQARERFEVTEKMLQPCGKPPGKTEE"
     STS             1070640..1071396
                     /standard_name="Pst3"
                     /db_xref="UniSTS:470764"
     gene            complement(1071353..1074984)
                     /locus_tag="CNC03380"
                     /db_xref="GeneID:3256635"
     mRNA            complement(join(1071353..1072264,1072327..1073537,
                     1073588..1073977,1074035..1074408,1074708..1074984))
                     /locus_tag="CNC03380"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532346|gb|CF678187.1,gi|41532352|gb|CF678193.1,
                     gi|41532757|gb|CF678598.1,gi|41532761|gb|CF678602.1,
                     gi|41533648|gb|CF679489.1,gi|41533657|gb|CF679498.1,
                     gi|41543317|gb|CF689158.1,gi|41543333|gb|CF689174.1,
                     gi|41544866|gb|CF690707.1,gi|41544869|gb|CF690710.1,
                     gi|41546735|gb|CF692576.1,gi|41546746|gb|CF692587.1,
                     gi|41546806|gb|CF692647.1,gi|41549381|gb|CF695222.1,
                     gi|41549382|gb|CF695223.1,gi|41549523|gb|CF695364.1,
                     gi|41549529|gb|CF695370.1,gi|41549957|gb|CF695798.1,
                     gi|41549961|gb|CF695802.1,gi|41551052|gb|CF696893.1,
                     gi|41551062|gb|CF696903.1,gi|41552493|gb|CF698334.1,
                     gi|41552501|gb|CF698342.1,gi|41552862|gb|CF698703.1,
                     gi|41552874|gb|CF698715.1,gi|41559509|gb|CF705350.1,
                     gi|41560624|gb|CF706465.1,gi|41561819|gb|CF707660.1,
                     gi|41561830|gb|CF707671.1,gi|41562057|gb|CF707898.1,
                     gi|41562069|gb|CF707910.1,gi|41565338|gb|CF711179.1,
                     gi|41565345|gb|CF711186.1,gi|41565801|gb|CF711642.1,
                     gi|41566233|gb|CF712074.1,gi|41566238|gb|CF712079.1,
                     gi|41572784|gb|CF718625.1,gi|41572793|gb|CF718634.1"
                     /transcript_id="XM_569666.1"
                     /db_xref="GI:58265019"
                     /db_xref="GeneID:3256635"
     CDS             complement(join(1071841..1072264,1072327..1073537,
                     1073588..1073977,1074035..1074408,1074708..1074840))
                     /locus_tag="CNC03380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569666.1"
                     /db_xref="GI:58265020"
                     /db_xref="GeneID:3256635"
                     /translation="MAHYQQAPYSDSAGYGNSYGGPTPNYGGYSDNPRGAAGGDYGNN
                     SYLMSSANPNAAAGSGGYAGSAGGFQPKKKRNKWLWIGLPVLLICIILAAVLGGVLGS
                     RASSDNNDSSTSSDDSSSATTGASNANTALPSGVSSANTAATNTGANGEQYLAVATDT
                     YMLPVYATGTATSGYSAPTVISDPASTDSWPDDPSPPSNSTEGMRAHPRLAPGYKWDA
                     LTHGGLIQNNPYLKYWNATIVQNASDTIGDDPTPYIPDGGLDGSGVLDVAREIKLKVK
                     NWAYAYKVTNETKYADRVWLELTTAAGNNSDVSFGADGTRWNPAHFLDLAEFCAAFAI
                     GYDWLYDFWTDDQRDALMWSMLNLGLSFGHAVLSGNTSASSYNWWAGTGVGSSEVNGN
                     WNCVCNGGLIQAAVAIVDRDPTGIAQQVIDLAVPDAWNNCFQGAYSDGTWAETANYWY
                     FGTTGAAELVNALQSSYGDDRGLPESNPGWNLTSLFHIYVQGMTSLFNYGDHGPNKYS
                     STANSLLLWANTFNEPRYALYQRDHYDASEPWSMFWYNPALSGTWWDGLPLDRYFDDE
                     NGRWATARSNWATNEGSYWAMKASKLTDHQTHGDLDIGDFVFDAMGQRWAGELGSGQY
                     LADGYFSSEEQNSERWLYYRKRTEGQNTLLINDQNQNVNATPTGNWGSSGTAQGAAPS
                     FQLESDDTAYFWTDMSTAYNYTVKRGIRYLNARQQVLIQDDVTDVPNLQWRMHTNATI
                     TTNNATATLTLSEQTLIASIVQGPSGASFSTAEPTRSSSDPALPTGTMDADQPNDGVT
                     VLVVDVPNGGTFSLQVLLTPQWGSNFTAIDSVNNVALDDWSLTSH"
     gene            <1075399..1076425
                     /locus_tag="CNC03390"
                     /db_xref="GeneID:3256680"
     mRNA            join(<1075399..1075578,1075635..1075969,1076023..1076078,
                     1076125..1076425)
                     /locus_tag="CNC03390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569668.1"
                     /db_xref="GI:58265023"
                     /db_xref="GeneID:3256680"
     CDS             join(1075399..1075578,1075635..1075969,1076023..1076078,
                     1076125..1076324)
                     /locus_tag="CNC03390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569668.1"
                     /db_xref="GI:58265024"
                     /db_xref="GeneID:3256680"
                     /translation="MSIALWVVVYSPQMWENYQLKSGEGLSVPFIILWLLGDITNLFG
                     GMMAHLLPTVIILAVYYTICDLVLLFQVYYYRRFPSPSAHQHITSDESTPLLPEPRQP
                     KPLLPPLIEYPVLLGFVLLAGAGAWFLTDRDEVHVPEDPEVTIEWKSQALGWASAVLY
                     LGSRIPQIVHNYKTRCAGLSLAMFFFAISGNITYVLSILLKSLNPRWILANAPWLAGS
                     GLTVFLDLFVLAQFAIFSWQDERRKKTSGEVDNEEEDG"
     gene            1076684..1079146
                     /locus_tag="CNC03400"
                     /db_xref="GeneID:3256728"
     mRNA            join(1076684..1078517,1078567..1079146)
                     /locus_tag="CNC03400"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537394|gb|CF683235.1,gi|41537402|gb|CF683243.1"
                     /transcript_id="XM_569670.1"
                     /db_xref="GI:58265027"
                     /db_xref="GeneID:3256728"
     CDS             join(1077270..1078517,1078567..1079133)
                     /locus_tag="CNC03400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569670.1"
                     /db_xref="GI:58265028"
                     /db_xref="GeneID:3256728"
                     /translation="MAGRTGLPSRPQSQSSPKSRARSGTMVSPNEVRKIYLDRPPVPI
                     TSPTSLSEISGLQLSPVASKSTSSGDGSPVIPPPSRIPIRASSKSRGGSDPYSFLRSD
                     GPRSMLGLSFSSTIPATAGRMSRSPQLQREVSIAHVKELAEGPSAKKSRGQFSGELKQ
                     RDFGEDSPTLDAAQITEGFIKNELPPFIMSPEEALRIAERGHNLESDDDAQMQDWQHL
                     ELDPYAASGPSQEIGLAEGKREKRKRATTMKTSGRNRHVAARSVNKDCQPDFGLPVFE
                     NPSLKASKSRIQTGSTPSATATSYPISQTSRSVSMKAFSSTPRTLHPYNTLPNSSSRL
                     GVAAHLIPPASTYTPPKGANWDEVVLPAVAKKLGIGEARTADKIDTGPDAEDLAVEWD
                     KNGTPIKWVKKKMEDRTSLDKQTDLETKSPNSKLMELPFNPILEPLPDSPFCQSNYGA
                     QHPDTIGLGPQREAPGLHIIPPPLSKTISQTSINLKPSFLRKTSMQDVTKPSSQRSLQ
                     AQRCDDEESEPFVGNDLVPGQSHWGVPPVQPSAPGTTHRITGAVYEKRMNKQRGVASV
                     QANLLGVGNVQSGKAVDSKPNKKAKQDGHSKGCGCAIM"
     STS             1078467..1079847
                     /standard_name="ha3373"
                     /db_xref="UniSTS:515697"
     gene            complement(<1079628..>1080359)
                     /locus_tag="CNC03410"
                     /db_xref="GeneID:3256319"
     mRNA            complement(<1079628..>1080359)
                     /locus_tag="CNC03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_569672.1"
                     /db_xref="GI:58265031"
                     /db_xref="GeneID:3256319"
     CDS             complement(1079628..1080359)
                     /locus_tag="CNC03410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569672.1"
                     /db_xref="GI:58265032"
                     /db_xref="GeneID:3256319"
                     /translation="MQAQFSGIDEPSEAADYTPAPEGHGEDEGEVLEEDDEGVQEIDD
                     EGEAEDGENKPLELERSSPQSRAGSDGRSKSQRKPTGSPEAQLTPQSVQLPPDSSHAS
                     PKHAEDIHEASEAPSESVLEHNVSQREESFAGPSATTDEVSHDAPIPPHHQIPVNAVE
                     VANIPPNENEVGKGSLGEAGRSGIEVRQAEHSDSAGTLMGEEKMDVDGPVAKEDEGLV
                     HGEMEPPVPELAVEGVDEPVEVEQE"
     gene            <1080956..1082025
                     /locus_tag="CNC03420"
                     /db_xref="GeneID:3256723"
     mRNA            join(<1080956..1081020,1081247..1081296,1081359..1081784,
                     1081839..1082025)
                     /locus_tag="CNC03420"
                     /product="elongation factor 1-beta (ef-1-beta), putative"
                     /transcript_id="XM_569674.1"
                     /db_xref="GI:58265035"
                     /db_xref="GeneID:3256723"
     CDS             join(1080956..1081020,1081247..1081296,1081359..1081784,
                     1081839..1081969)
                     /locus_tag="CNC03420"
                     /codon_start=1
                     /product="elongation factor 1-beta (ef-1-beta)"
                     /protein_id="XP_569674.1"
                     /db_xref="GI:58265036"
                     /db_xref="GeneID:3256723"
                     /translation="MASTIDLKQLEQHLATRSYIDGFKPTTADVEIYKSLGSAPEATF
                     PHCHRWYIHIASFADEFDSLPAGANPLSSTSAGAAAAAGEEEDDEVDLFGSDDEEADE
                     EAERIKAERIAKYNEAKEAKKQEKLAAGKTLEVAKSVVTLQVKPWDDETDMQALEDGV
                     RAIEKDGLVWGASKLVPVGYGIKMLQINLVIEDAKISLDELQEEIAELEDYVQSSDVA
                     AMQKL"
     gene            complement(1082052..1084136)
                     /locus_tag="CNC03430"
                     /db_xref="GeneID:3256667"
     mRNA            complement(join(1082052..1082714,1082763..1083148,
                     1083214..1083441,1083510..1083683,1083735..1083873,
                     1083924..1084136))
                     /locus_tag="CNC03430"
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532949|gb|CF678790.1,gi|41532954|gb|CF678795.1,
                     gi|41556297|gb|CF702138.1,gi|41556306|gb|CF702147.1,
                     gi|41573298|gb|CF719139.1,gi|41573309|gb|CF719150.1"
                     /transcript_id="XM_569991.1"
                     /db_xref="GI:58265669"
                     /db_xref="GeneID:3256667"
     CDS             complement(join(1082097..1082714,1082763..1083148,
                     1083214..1083441,1083510..1083683,1083735..1083873,
                     1083924..1084124))
                     /locus_tag="CNC03430"
                     /codon_start=1
                     /product="alpha-1,6-mannosyltransferase"
                     /protein_id="XP_569991.1"
                     /db_xref="GI:58265670"
                     /db_xref="GeneID:3256667"
                     /translation="MAQAPPMSPSLSPTRTRCLNIVLCLLPFLVTFAHVFLSPYTKVE
                     ESFTLHAVHDVLAYGFNPHNLQLWDHVTFPGAVPRSFIPPALLGILAYPFSVVSVASG
                     AIKTKFGVQILIRLVLASFFSYSFNKLACSLQKAFNVSVRVWFTLLSLSSFHIPYYAG
                     RTLPNFMALPGVLWSISHIMTAQIATSEADRIASLRKAVIALTALATIVRLELALFVI
                     PLALSLLINRQVGFGQVLKWGILGGVGSLSISSAVDYHLWLPTLSHPSFPFKSHFQLF
                     WPELSGLIYNAVEGHSAEWGVMPWHYYLSGSLPKLLAGNSLLVGIATGGWLLDKMGLD
                     MMAKKAGGWDRLTGVRGVNKVMKVWALSVVTVIGALSFLGHKEWRFILPVLPILHIIS
                     ALSASSLWSLRPSKLRNLMRLFVLVALGLNSLATIATTFLSVGNYPGGEVWKVMEDIP
                     GLQRQNASIYFPSYPLQTGATLFTFVHAHSVNGTGRGLGPWSAFPETKEPRWIYNKSE
                     DKMMENPIRVWESGIDFVVTGDYDQFLALPDKWVEVASVEGLDSVGRAPGTYRVQAKW
                     DRKLAVLQRRENIQR"
     gene            complement(1085605..1087439)
                     /locus_tag="CNC03440"
                     /db_xref="GeneID:3256645"
     mRNA            complement(join(1085605..1085972,1086039..1086249,
                     1086477..1086569,1086626..1087314,1087369..1087439))
                     /locus_tag="CNC03440"
                     /product="expressed protein"
                     /transcript_id="XM_570040.1"
                     /db_xref="GI:58265767"
                     /db_xref="GeneID:3256645"
     CDS             complement(join(1085700..1085972,1086039..1086249,
                     1086477..1086569,1086626..1087314,1087369..1087371))
                     /locus_tag="CNC03440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570040.1"
                     /db_xref="GI:58265768"
                     /db_xref="GeneID:3256645"
                     /translation="MTFNDLSSIASNIDPQTALPYTPMSVLQAAHWSAADLRARVTAH
                     ERDGNVSVESEDDKNEVGLTQTTSSIVEGLRKRRRPAPRSRVPSPASWGPSTTSLAAT
                     INSISSATEASFSPLLSHSNSVWYPVPSDETHRIGASGLLSAGSLSTANLSGVPDFGP
                     DLVDVLPQEGSKSQPPHGEKNFFGLVSGKATEEEIEEKWVNEGGAFAMSHLGLMGNGN
                     AKEDKWTKIEPFRFSVEFWDVDKLGEKERYYSATHFYAGSLFNWNPLMRTVTSLSTAP
                     APSTPAVHGQSLAPSPVIPGSPPSATTRFFPGGANQERGNALATDVPYHDTRAVTKAF
                     FSISCASALGTALIRFTSGPDTFAHSQSWGWKSSALKSEEYLSSPPAVERGENLDEGV
                     MGWTGEVDTEGIGKGNGRSTLRATVVVGIV"
     gene            <1089763..1091921
                     /locus_tag="CNC03450"
                     /pseudo
                     /db_xref="GeneID:3256406"
     gene            complement(1091781..1094247)
                     /locus_tag="CNC03460"
                     /db_xref="GeneID:3256200"
     mRNA            complement(join(1091781..1092274,1092324..1092334,
                     1092393..1092486,1092551..1092661,1092710..1092758,
                     1092820..1092877,1092938..1092989,1093039..1093317,
                     1093379..1093589,1093661..1093682,1093811..1093871,
                     1093991..1094247))
                     /locus_tag="CNC03460"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530581|gb|CF676422.1,gi|41530589|gb|CF676430.1,
                     gi|41531626|gb|CF677467.1,gi|41531632|gb|CF677473.1,
                     gi|41532691|gb|CF678532.1,gi|41532699|gb|CF678540.1,
                     gi|41541251|gb|CF687092.1,gi|41541263|gb|CF687104.1,
                     gi|41548854|gb|CF694695.1,gi|41548856|gb|CF694697.1,
                     gi|41549654|gb|CF695495.1,gi|41549665|gb|CF695506.1,
                     gi|41568866|gb|CF714707.1,gi|41568875|gb|CF714716.1"
                     /transcript_id="XM_569676.1"
                     /db_xref="GI:58265039"
                     /db_xref="GeneID:3256200"
     CDS             complement(join(1092016..1092274,1092324..1092334,
                     1092393..1092486,1092551..1092661,1092710..1092758,
                     1092820..1092877,1092938..1092989,1093039..1093317,
                     1093379..1093589,1093661..1093682,1093811..1093871,
                     1093991..1094127))
                     /locus_tag="CNC03460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569676.1"
                     /db_xref="GI:58265040"
                     /db_xref="GeneID:3256200"
                     /translation="MFPRTKTLFTGMGAKIPSRTQRITLLERSTARGALLRGSRSMSI
                     LSNDKAIQNGDDFHALMIGGGFAMFGTPEGPWNISSRLEKRLGPRLKVDAVIEINGPR
                     AETALTEKRKSFVHEAYADTMVLPDVEEFKRRVSTGEAQEPRAIFVATPPLFRGGLGP
                     QNNLEIKLNELFPNAAIFLEKPVATGVPAEQSVGEAKAVGAMFATQHNAPVAVGYVLR
                     YLNAVREMKKIIDDNNLTVMATNARYVTAYELAIKTDWWNKSIMQGPIIEQGTHICDL
                     SRYFGGDVNIETICAHALEAHEKPGRLSKLNFDESVIPDNLRIPRATSASWKYESGAV
                     GTMLHATALHGKDYAIELEVYADGFQLILSDPFGTPALHVRKPGSDVVEVYPTPGDDP
                     FQSEIDAFIDVVEGKPNAKILSGYEDAAKTYEMTWAIRNSAEEWTRRLSQRQGRT"
     gene            complement(<1095960..>1097359)
                     /locus_tag="CNC03470"
                     /pseudo
                     /db_xref="GeneID:3256689"
     gene            complement(1098786..1101085)
                     /locus_tag="CNC03480"
                     /db_xref="GeneID:3256324"
     mRNA            complement(join(1098786..1099203,1099255..1099500,
                     1099548..1099675,1099732..1100668,1100720..1100802,
                     1100862..1100972,1101031..1101085))
                     /locus_tag="CNC03480"
                     /product="GTP-binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535909|gb|CF681750.1,gi|41535913|gb|CF681754.1,
                     gi|41542399|gb|CF688240.1,gi|41542408|gb|CF688249.1,
                     gi|41548421|gb|CF694262.1,gi|41548432|gb|CF694273.1,
                     gi|41549247|gb|CF695088.1,gi|41549253|gb|CF695094.1,
                     gi|41554493|gb|CF700334.1,gi|41554508|gb|CF700349.1,
                     gi|41556643|gb|CF702484.1,gi|41556653|gb|CF702494.1"
                     /transcript_id="XM_569678.1"
                     /db_xref="GI:58265043"
                     /db_xref="GeneID:3256324"
     CDS             complement(join(1098799..1099203,1099255..1099500,
                     1099548..1099675,1099732..1100668,1100720..1100802,
                     1100862..1100972,1101031..1101049))
                     /locus_tag="CNC03480"
                     /codon_start=1
                     /product="GTP-binding protein"
                     /protein_id="XP_569678.1"
                     /db_xref="GI:58265044"
                     /db_xref="GeneID:3256324"
                     /translation="MPRIRKKTSNRQNTRDRAKITKKAAEQKRKDRKASKKDQTWKSK
                     KKADPGVPNSFPFKDQVLAEIAEEKRKSEEGKIARREAAKAQKSTGAEDEADTPGVSS
                     LGRTVLNRVPLTATSAAVVTPTEDSDIPELIDTALPTLQEALDRADVICEVVDARDVL
                     GGRSGYIERLVKEAEGRIILIINKIDLVPREVLQSWVSQLDIPTFLFKSALPVPPTPS
                     SSRNPGPSFFLEPSVILGREQLIAAAKKWSAEKKKSRKSDEPLVLALMGLPSVGKTSI
                     LNSLLPSTANKSRHVVAPLIPSGQSAKSLQPTTKSPVEVEIDVDGLKIKVIDTPGWEP
                     VEDEKDEDEDEEEDEQIPEKWDRLEAKLSGDLLRRNLGRVDRVKDVFPLVSYIVERSN
                     HQDLMLAYNIPFFEKGDLEAFLTGLARAQQRIRKHGEPDLEGAARVLLRDWAHNNFPY
                     YSLPSSTSASKMDVDASKAIDKYDMTAILEKCRGKKEMKKESSKGMIRFKGGEIDERE
                     IILDDDYTAMMTVTSDDEEQEEIDDEEDIDDEDEDEDEDGIELASASDDEPVIIGSDE
                     GEVLELSEGKEPSESESSPEPEPRLPSPSSSKPKKRRISEASVAPAKKAKRVSFARNV
                     PDGEERNIRGGKKGKGRK"
     misc_feature    1099832..1099876
                     /note="CT-rich"
     gene            1103790..1106557
                     /locus_tag="CNC03490"
                     /db_xref="GeneID:3256159"
     mRNA            join(1103790..1104503,1104559..1104910,1104999..1105126,
                     1105177..1105416,1105481..1106057,1106114..1106557)
                     /locus_tag="CNC03490"
                     /product="leucine repeat containing protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41563960|gb|CF709801.1"
                     /transcript_id="XM_569989.1"
                     /db_xref="GI:58265665"
                     /db_xref="GeneID:3256159"
     CDS             join(1103837..1104503,1104559..1104910,1104999..1105126,
                     1105177..1105416,1105481..1106057,1106114..1106447)
                     /locus_tag="CNC03490"
                     /codon_start=1
                     /product="leucine repeat containing protein"
                     /protein_id="XP_569989.1"
                     /db_xref="GI:58265666"
                     /db_xref="GeneID:3256159"
                     /translation="MPTTHRLDESLREHEQEIQENADDEQSGVERHDTRSSVSITSHK
                     DDNRVEDCPDLSSIEPEAEAISEPVRIEEFKKRSTSLSVTSASHEGTIHIMPSAPLLM
                     TPTPSAFARNPIRSALRNAATPGDKPKKRQGWSDETTPGLIARGTTPASSGKRSVSFS
                     DGKKTGKIIDLDVEMRTTRWQTSAKEECADIFKRESTDSDRSFLPSARTRRIQGLLDD
                     MGELTLNDETPCKPSSRQIEDTDRPFSRASLTSSPDSHSTIPTRSPHVCRSSTYPSRH
                     AGNATFLTECSFGIAHDKLVEIITDIEPFNPHWDQLKMIDLRGKKADSVARLKEFLPN
                     LDEINFGIPTTVRTLHVAGNLLTSLTAVNHLRNLQYLDISRNKLDSVAQLGCLIHLRE
                     LKVDDNAICDLEGIMEMDCLIKLSCVNNKLDMLDLSAAKWSKLESLNLSNNNISIIKD
                     LHRLSSVASINLEGNRLCTLTPQIPMPSVRILRFSDNHIASFDISLFPKIRTLYADNN
                     LLSHLGRSEHSSPSRLENLSLRNQRTAPLHLTYIDLENVRRLYISGNALTEDFFPSRP
                     LYSLVYLEAAACKMSQWPQDFAINAPHLKMLNLNYNYFTDLNGVKGMNNMRKLTLVGG
                     RLGGEEAGKGDGRDVMAGLRGLRNLEELDLRMNPFTLSYYFPLLLPSSSPSSVLDPST
                     PTRNNEDRNRMDQPLAVAPAAWSTYDTRFRKNLPDEWYSKRLVYRGLIMQNCIKMRKL
                     DGIVVEDGERKRANQLLEAALGIRK"
     gene            complement(1106584..1108325)
                     /locus_tag="CNC03500"
                     /db_xref="GeneID:3256382"
     mRNA            complement(join(1106584..1106751,1106810..1107177,
                     1107237..1107500,1107553..1108156,1108240..1108325))
                     /locus_tag="CNC03500"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41553821|gb|CF699662.1,gi|41553835|gb|CF699676.1"
                     /transcript_id="XM_569680.1"
                     /db_xref="GI:58265047"
                     /db_xref="GeneID:3256382"
     CDS             complement(join(1106677..1106751,1106810..1107177,
                     1107237..1107500,1107553..1107787))
                     /locus_tag="CNC03500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569680.1"
                     /db_xref="GI:58265048"
                     /db_xref="GeneID:3256382"
                     /translation="MTLTFKLSDGKDIPFLAWGSGTGGIGKELQLAIGAGIHALKSGI
                     RHIDTAQGYDTEEATGESFRASGLKREDVWITTKISDKIPTDKEAIRKNVLASIARLQ
                     TKPDLLLIHNPFIVQDGNISQFWTYLEDLVLDGTLEGVSLGVSNFRPQDLEAILRVAR
                     IKPVANQLEYHPYVLVHLEPVLKIAAEHGILIEAFGPLTPVLRHPDGGPLKPVLERIA
                     QRISKDNGQKLDSTTVLLLWTRQKGVVAVTTSKNEQRIKGLADVEHLPDLTAEEMEEI
                     EKIGRSHHYRYYIEHMTEDFPNPDLPSVPSTREKSDH"
     gene            1109761..1113090
                     /locus_tag="CNC03510"
                     /db_xref="GeneID:3256344"
     mRNA            join(1109761..1110214,1110286..1110564,1110629..1110942,
                     1111206..1111395,1111451..1111534,1111588..1111748,
                     1111815..1111907,1111962..1112135,1112190..1112336,
                     1112392..1112450,1112507..1112594,1112656..1112671,
                     1112731..1112857,1112952..1113090)
                     /locus_tag="CNC03510"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531138|gb|CF676979.1,gi|41532904|gb|CF678745.1,
                     gi|41532910|gb|CF678751.1,gi|41540720|gb|CF686561.1,
                     gi|41540734|gb|CF686575.1,gi|41547663|gb|CF693504.1,
                     gi|41547679|gb|CF693520.1,gi|41554917|gb|CF700758.1,
                     gi|41567112|gb|CF712953.1,gi|41567126|gb|CF712967.1"
                     /transcript_id="XM_569682.1"
                     /db_xref="GI:58265051"
                     /db_xref="GeneID:3256344"
     CDS             join(1109930..1110214,1110286..1110564,1110629..1110942,
                     1111206..1111395,1111451..1111534,1111588..1111748,
                     1111815..1111907,1111962..1112135,1112190..1112336,
                     1112392..1112450,1112507..1112594,1112656..1112671,
                     1112731..1112857,1112952..1112998)
                     /locus_tag="CNC03510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569682.1"
                     /db_xref="GI:58265052"
                     /db_xref="GeneID:3256344"
                     /translation="MPEHAPLSMSGQSDSIASSQQERSRAFEPSDLATANDEAPLRLN
                     PGFTQRTTVLEILNARQPPSCDACRTRKLGCSGRPSSIEITTEGLAASPCNHCREWNL
                     ECSYTYKRKRRGRKNKAVEQLAVQQKARKLSQATRPSATTQLDDQAGDARDHAESSSV
                     GYPIDHNLSTQYNSVSVVGPSSNIGTCHQRPPNLPSHVQARADRPIPWYSHPSVPSQS
                     AILGDIGLNRSTLTSDDRGTNSHIQQPAVHLSIDHHENIAEAHITPPDVGASPYHGVS
                     PSTTLSNVSLPISTNIELATWTDVIDCRQLPKSYFPIPAHKVRSLSDRCLKACCAVTK
                     SEMDNCDVDLICIKYFLFVVHNKHGNIGLEASTFGEAQYLAVTMGLHREDTYCDLDPI
                     NAERGRRVWFLIYNADKFEAVSRQKPVLLRVDEFMGPESTEFPAEVDDESITSEGILP
                     SRTPAPLIAGFNTLTRIVTVLGDILISERDLRRQQITDPENLLSALREMRKLGQRIRY
                     ISDTLPRPFQLEADQGNSLPEPGWEDAVRGELDMFFSDPLPPETAKDGYLVLKGNIHV
                     TLAMTRLRLILLRENLLNCSGQPGTSSRNAAELVAADIGENTVNWRQSVYQDLYNVVH
                     CLPIRALAANGPSLVTKIRVVAVTLLDTLQAQDEAIDPNIQGMTTYLLSFLDIMSSIE
                     SQFAD"
     gene            <1113397..1116129
                     /locus_tag="CNC03520"
                     /db_xref="GeneID:3256322"
     mRNA            join(<1113397..1113915,1113999..1114455,1114502..1114684,
                     1114751..1115633,1115684..1116129)
                     /locus_tag="CNC03520"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41551913|gb|CF697754.1,gi|41551919|gb|CF697760.1"
                     /transcript_id="XM_569990.1"
                     /db_xref="GI:58265667"
                     /db_xref="GeneID:3256322"
     CDS             join(1113397..1113915,1113999..1114455,1114502..1114684,
                     1114751..1115633,1115684..1115978)
                     /locus_tag="CNC03520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569990.1"
                     /db_xref="GI:58265668"
                     /db_xref="GeneID:3256322"
                     /translation="MDPLPIPPSYYDLERRHLEHTIDHDLHSLSLSSLHSSTSSSSSP
                     FHPHDYSNSFISSSSDLSLEYPRAQFSGISTQPTQDVGHGHSYGPSGTPRAARGTNPH
                     SNNFGGGHSTSAGISPVSTTGHHASAITLGTGAFKGRIPKTNSGDQGDGGFDPERSLG
                     RLVGELGRIIGDEKLPKIPNSPFRPRSRSPLPSAANQTIDPSYLAHCNKHLDSRGSGG
                     KTRPKSSNVLHEQAQESGEQSRKKPLGSSTSYNISRTPVTRKTIAKDKVDRLRMLQNE
                     GKKAANASVRKNPDASADVTGMTALMATPAKGLIFDSLENNDDVGGEPAVNIPHTLAT
                     LHARLRALEMESSVSRRRVKELEAEVEKANREVDAARRNGEKKTRKSENEKSALEDLV
                     GSLRADLARITLELEQHKALIVELRQANLSNLKNGDRSFSDPSMNHEIAALRREIERL
                     TEEVCRLGCIVAEGIEVRRRTRGESTMNMEKVEMERLAKKLIEENSDFQRVKADVEKR
                     KAAVDQLKKHEAPIHVPLDSANALFTSIPEPQEAKLVMAHNRSHTSPKTPSLSHAKQH
                     DHVQPSPLASKKSSTPSTPRRHKQEREESSRSRRSKPISSSKALDRSVHSPFPSIMGE
                     DLEREFFSPLPNGIEGMNQNAEIKQVTDEMEPGKLPPQTVLARVVAELEGDFQHYKMV
                     YSELADQYKLLDPASVSAKRHVLADHLREVIDLLELKAGQISDLYDLLAFKDKPIHAN
                     RRKIDGRKAKSVDDVMRMVKASLGHEVWERLYIDLKKG"
     gene            complement(1117850..1119296)
                     /locus_tag="CNC03530"
                     /db_xref="GeneID:3256595"
     mRNA            complement(join(1117850..1118188,1118237..1118371,
                     1118418..1118592,1118644..1118717,1118782..1118815,
                     1118862..1118920,1118995..1119128,1119180..1119296))
                     /locus_tag="CNC03530"
                     /product="proteasome subunit, beta type, 7, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537223|gb|CF683064.1,gi|41537233|gb|CF683074.1,
                     gi|41574815|gb|CF720656.1,gi|41574825|gb|CF720666.1"
                     /transcript_id="XM_569684.1"
                     /db_xref="GI:58265055"
                     /db_xref="GeneID:3256595"
     CDS             complement(join(1117985..1118188,1118237..1118371,
                     1118418..1118592,1118644..1118717,1118782..1118815,
                     1118862..1118920,1118995..1119128,1119180..1119276))
                     /locus_tag="CNC03530"
                     /codon_start=1
                     /product="proteasome subunit, beta type, 7"
                     /protein_id="XP_569684.1"
                     /db_xref="GI:58265056"
                     /db_xref="GeneID:3256595"
                     /translation="MAKLAETPSVGFDFSNYARNQFLGQRLQGIPKATSTGTTIVGVI
                     YGGGSSGEEPGVCLGADTRATGGPIVADKNCEKIHYLAPHIRCCGAGTAADTEFVTNL
                     ISSNLELHALSQGRQARIVTAMTMLKQYLFRYQGHVGAHLVLGGVDSTGPHLFTVHAH
                     GSTDKLPYVTMGSGSLAAMAVFESSFKEHMTRQEAIDLVARAIRSGVFNDLGSGSNVD
                     VAVITKNGTEMLRNYQTPNERGLKSRNYKFRRGTTAWTKESVRSLIVTEEVKSTTGAG
                     KAQGAAEAVPVAVGAGPGGAEGMDIDG"
     gene            1119456..1121067
                     /locus_tag="CNC03540"
                     /db_xref="GeneID:3256746"
     mRNA            join(1119456..1119582,1119634..1119672,1119734..1119833,
                     1119890..1119982,1120036..1120203,1120260..1120411,
                     1120471..1120509,1120560..1120641,1120702..1121067)
                     /locus_tag="CNC03540"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538724|gb|CF684565.1,gi|41538739|gb|CF684580.1,
                     gi|41549783|gb|CF695624.1,gi|41561715|gb|CF707556.1,
                     gi|41561731|gb|CF707572.1"
                     /transcript_id="XM_569686.1"
                     /db_xref="GI:58265059"
                     /db_xref="GeneID:3256746"
     CDS             join(1119482..1119582,1119634..1119672,1119734..1119833,
                     1119890..1119982,1120036..1120203,1120260..1120411,
                     1120471..1120509,1120560..1120641,1120702..1120851)
                     /locus_tag="CNC03540"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_569686.1"
                     /db_xref="GI:58265060"
                     /db_xref="GeneID:3256746"
                     /translation="MQAFRNFQAQIPALPSVDVTAVSKSFRQTVQATRERIGNVGPEG
                     ITELPAEYRQLEARVDALRDVHNKMLKITKVHERESYDYPSDVTEGISEVGHQAASAW
                     NTFANKNLKNTNLPIPIPSPTAPTPHQPKTLSHALSRAAKSGATELGAEDRLGVSLGI
                     YGAALEKIGDARISQDQVITERFVTPWQATLSTSIGLAMKARQNVKTSRLELDAARAA
                     LKSAAPAKQEQARLHVEEAEDKLVQNTETAIGLMKAVLENPEPLQNLSNLVKAQLIYY
                     STAAETLSGIQGQIEEAATVAEGDYRQSRGA"
     gene            <1123049..>1123946
                     /locus_tag="CNC03550"
                     /db_xref="GeneID:3256121"
     mRNA            join(<1123049..1123234,1123284..>1123946)
                     /locus_tag="CNC03550"
                     /product="peroxisomal membrane protein pex13 (peroxin-13),
                     putative"
                     /transcript_id="XM_569688.1"
                     /db_xref="GI:58265063"
                     /db_xref="GeneID:3256121"
     CDS             join(1123049..1123234,1123284..1123946)
                     /locus_tag="CNC03550"
                     /codon_start=1
                     /product="peroxisomal membrane protein pex13 (peroxin-13),
                     putative"
                     /protein_id="XP_569688.1"
                     /db_xref="GI:58265064"
                     /db_xref="GeneID:3256121"
                     /translation="MQPYSQRYNGSYGMSPYNNMSGYGSYGGYGAMGGMNRFGGGYGG
                     YNYGMGGYGVGGMGGPGEGYPTLASSLQASTAPAFAVVESLVTAFTSLAQLVESTYLA
                     THSSFFAMVGVADQLGSLKTYLGQVLGVFSILRLGRKILSWLKGKKVKTGPWGEEWDR
                     IGSSGLPPNGQGGRPSIKPLVIFLLSALGLPYLMSRLVKVLVAHQTNQKSILSPDGTI
                     DPTKLEFVRAKWEFTPTEEWELGLGRDEIVAVLEKRGEGMNSWWRGRTRDGRTGWFPA
                     NYVSNV"
     gene            complement(1126710..1129165)
                     /locus_tag="CNC03560"
                     /db_xref="GeneID:3256123"
     mRNA            complement(join(1126710..1127312,1127371..1127523,
                     1127582..1127989,1128042..1128461,1128511..1128780,
                     1128828..1129165))
                     /locus_tag="CNC03560"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535031|gb|CF680872.1,gi|41545253|gb|CF691094.1,
                     gi|41545265|gb|CF691106.1,gi|41556736|gb|CF702577.1,
                     gi|41557044|gb|CF702885.1,gi|41557049|gb|CF702890.1,
                     gi|41559212|gb|CF705053.1,gi|41559222|gb|CF705063.1,
                     gi|41561384|gb|CF707225.1,gi|41561392|gb|CF707233.1,
                     gi|41564942|gb|CF710783.1,gi|41568216|gb|CF714057.1,
                     gi|41568223|gb|CF714064.1,gi|41568228|gb|CF714069.1,
                     gi|41568233|gb|CF714074.1,gi|41572456|gb|CF718297.1,
                     gi|41572474|gb|CF718315.1,gi|41576577|gb|CF722418.1,
                     gi|41576581|gb|CF722422.1"
                     /transcript_id="XM_569690.1"
                     /db_xref="GI:58265067"
                     /db_xref="GeneID:3256123"
     CDS             complement(join(1126980..1127312,1127371..1127523,
                     1127582..1127989,1128042..1128461,1128511..1128780,
                     1128828..1129160))
                     /locus_tag="CNC03560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569690.1"
                     /db_xref="GI:58265068"
                     /db_xref="GeneID:3256123"
                     /translation="MDSDTSPNPFASSPPSSPSPRPSLPPPVPRKPSSLVSAASGSPP
                     PTHRASFPDPARHPKMGATVPGPKPKTGYCCSIDKDISAGEQVHIVDALKTTEGGTAS
                     YITYVIRLGTHTVRRRYSAFLSLHQSLTGLYPVLIIPPIPSKQSLTDYAVKGQSKARE
                     DATIIARRKRLLEDFLQRLIRHPILGGEHVLHRFLEEDVSWSEVLHSPPISLLSKNPL
                     HAPSHNPTFQPTTPTSPSEAPATTSYIAHHLLPTPSPSHPLRQPDQRFMDSEAFTEKF
                     QSHFSGTMEKVNRRVTKRWGERAHDMSELGGIWNGFSLVEQGKLGDAIEKVGRAVDAE
                     YLATAALLQSWEKTTTEPLHIYSQFATLIRARLSFRHQKHVQYELVQEALETQRDKLE
                     ILENAEREARRLEEALERGGSVLASPQLEPEAARDERERAQRRARASQGFGLLSAVKH
                     SLSGMIDMDPEATRRANIAKTRDNISQLEDSYQAAAQDLKYASMTLQADLDRFQRQKV
                     ADLREMAINLSQVHRDWCKQNLEAWKAAQAAVREIDPHPNRPAQTQTQVQSQQSHAGP
                     STLHAQTEDDVSKLGVDAMKNEIERVEIEIADKPLPKPSLAETGGDGVVPSPQPRQEN
                     DTEEQEGHGPLGPL"
     misc_feature    1129081..1129147
                     /note="G-rich"
     gene            1129391..>1133703
                     /locus_tag="CNC03570"
                     /db_xref="GeneID:3256214"
     mRNA            join(1129391..1130096,1130735..1130768,1130827..1131516,
                     1131579..1131687,1131742..1131855,1131930..1132053,
                     1132109..1132175,1132237..1132385,1132451..1132637,
                     1132694..1132755,1132806..1132907,1133121..1133382,
                     1133445..>1133703)
                     /locus_tag="CNC03570"
                     /product="AMP deaminase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545565|gb|CF691406.1,gi|41561954|gb|CF707795.1"
                     /transcript_id="XM_569691.1"
                     /db_xref="GI:58265069"
                     /db_xref="GeneID:3256214"
     CDS             join(1129412..1130096,1130735..1130768,1130827..1131516,
                     1131579..1131687,1131742..1131855,1131930..1132053,
                     1132109..1132175,1132237..1132385,1132451..1132637,
                     1132694..1132755,1132806..1132907,1133121..1133382,
                     1133445..1133703)
                     /locus_tag="CNC03570"
                     /codon_start=1
                     /product="AMP deaminase"
                     /protein_id="XP_569691.1"
                     /db_xref="GI:58265070"
                     /db_xref="GeneID:3256214"
                     /translation="MSHSPDDPYTSPSPSPFPSPLPIPAPTYEDHLNGAPHSHSSPSF
                     DYHEERRTHLKDEIWMSHHLPRLPPPSASEAGSSVRTDTGTSFKSRMAPGDYFDTSNP
                     TGPVRQLSPKASFNPSVLRANMSNVEKGGEAMTMREHEVDPDVNDLGTALRQATLRLD
                     KESTMLSPSGPDYGDLDPAPALVHRQEMDAQERLDLEEEKKEKELAMKAFTGENEGQT
                     KVQPQQPSGVQQGIGNELESLYASFSRCLELRDKYIELSNQRLGDNPRDHDGTFHGFN
                     PASAGDVMGLKPEYDPETVEIPAEAKDDIPTWNIYPPPPPPRWHWKTAQDGVHPEPAT
                     IEDNNKRSAPNQRDVEVFKVEDCEIPGKDEGRTFMVNDEGVFTVYVDRVNSPSVSNGQ
                     PPERQANAQISDDKQPLSRVPSLKEYFTDLDFLLGVCSDGPAKSFAFRRLKYLQSKWS
                     LYCLLNEYQELADMKAVPHRDFYNVRKVDTHIHHSASMNQKHLLRFIKSKLKKSPDEI
                     VIHRDDKDLTLKEVFESLNLTAYDLSIDMLDMHAHQEFHRFDRFNDRYNPTGSSRLRE
                     IFLKTDNLLKGKYLAELTHELITDLEQSKYQHSEWRLSIYGRNINEWDNLAKWVVNNK
                     LISHNVRWLIQVPRLYEVFKGQGLVDNFEDVVRNVFQPLFEVTQDPASHPELHIFLQR
                     VVGFDSVDDESKPERRLYRKFPTAKMWNTKQSPPYSYWIYYMYANMASLNAWRRSRSF
                     NTFVLRPHCGEAGDPDHLSSAFLTAHSISHGILLHDPLQFHFTASHLLEEYSCAAQIY
                     KLTPADMCELARNSVLQSGWEMQVKKHWLGQRWYWPGAAGNDIHKTNVPTIRLAYRQA
                     TLLEELALIRHGEHSPSATPTHLKPPTTIKPDKPGLATHSSDIAAAAMAKSSGIPAAH
                     LVGGASELDRRSLERKRAIGGTDKQAQMSDTAS"
     gene            complement(1133766..1136227)
                     /locus_tag="CNC03580"
                     /db_xref="GeneID:3256183"
     mRNA            complement(join(1133766..1134106,1134160..1134355,
                     1134411..1134732,1134793..1135203,1135272..1135495,
                     1135552..1135643,1135714..1135894,1135946..1136227))
                     /locus_tag="CNC03580"
                     /product="hexose transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530598|gb|CF676439.1,gi|41530608|gb|CF676449.1,
                     gi|41542094|gb|CF687935.1,gi|41542102|gb|CF687943.1,
                     gi|41565402|gb|CF711243.1,gi|41565412|gb|CF711253.1"
                     /transcript_id="XM_569692.1"
                     /db_xref="GI:58265071"
                     /db_xref="GeneID:3256183"
     CDS             complement(join(1133917..1134106,1134160..1134355,
                     1134411..1134732,1134793..1135203,1135272..1135495,
                     1135552..1135643,1135714..1135894,1135946..1136117))
                     /locus_tag="CNC03580"
                     /codon_start=1
                     /product="hexose transport-related protein"
                     /protein_id="XP_569692.1"
                     /db_xref="GI:58265072"
                     /db_xref="GeneID:3256183"
                     /translation="MFFSKYRGSTGRNKPEHAHAPDRDSIPSLDDLGIQLHPDTARYV
                     TDSQALADAIGGNGLRDMFGNGLVVAAAFSTCMGGLLFGFDQGILSIVLTMPQFLEQF
                     PDVNINVSSSAAFNKGIMTALLELGAFIGALQAGFVADKYSRKKAIALGSVWFVIGAI
                     IQTTSFSFAQLVVGRFIGGLGVGLLSAVAPMYISEVAPPNIRGALLAMEGATIVIGIV
                     VMFYITYGSRFIENDWSFRLPFLIQMAPCILLGFGLWKLPYSPRWLAGAGRDADCLNA
                     LMRLRRLPSTDPRLQAEWISIRAEAIQNREVIIKDHPSLQGRDFMSELKLEVVSWIDM
                     FRPKLIKRTIIGPMLMMFQQFQGVNALIYYSPTLFEQLGLDYEMQLDMSGVLNISQMV
                     ATIVAFFVLDRVGRKPPLIFGSICNTICHIIVAVIMAKYSHDWVKYHNEAWVAVAFIL
                     TFMFTFGVGWSPVPWAMPAEVHSSSRRAKGVAITTCACWLCNFIIGLITPPMLQNIKY
                     GTFLFFGVFALLSGIWVWFFCPEPMGKTLEQMDEIFRSNTAHEDNITKVEIQAAIMDA
                     SPIGSTTSVFRSGEKLGDKDIQQEWVETV"
     gene            1137268..1139731
                     /locus_tag="CNC03590"
                     /db_xref="GeneID:3256190"
     mRNA            join(1137268..1137328,1137410..1137742,1137793..1138207,
                     1138265..1138395,1138445..1138662,1138714..1139276,
                     1139330..1139731)
                     /locus_tag="CNC03590"
                     /product="monooxygenase protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538074|gb|CF683915.1,gi|41538080|gb|CF683921.1"
                     /transcript_id="XM_569693.1"
                     /db_xref="GI:58265073"
                     /db_xref="GeneID:3256190"
     CDS             join(1137436..1137742,1137793..1138207,1138265..1138395,
                     1138445..1138662,1138714..1139276,1139330..1139642)
                     /locus_tag="CNC03590"
                     /codon_start=1
                     /product="monooxygenase protein"
                     /protein_id="XP_569693.1"
                     /db_xref="GI:58265074"
                     /db_xref="GeneID:3256190"
                     /translation="MAPIAIQNPLEDAQVAPPPPLKSSKASMGSIKKELPKHPDAVPH
                     DYMYKFKYNHELPLHGKEGIEIPQNVNPKDVADEIASLLSQATSKGDPKAFSELFLEH
                     GVWRDRVALTWDYRTFNWRSAILKAATDLLPENPISKVTVIDPPPTVERPYEDLSFVQ
                     AHIGFQTNKVGATALCNIVLTKDGYKIWTFNSAIESLHGFREVPERDGHMTGPHSWTQ
                     QREIDISMEDSEPEVLIVGGGQNGLMLGARLKALGVNALIVERNKRIGDNWRGRYEAL
                     SLHLPHWADHFAYMPYPEQHWPTFCPAAKLGDWFEWYASAMELNTWTDSSVTGAKQDP
                     DGKWTVEVNRGGQGKRVFHPKQLVMATSLIGIPHVPKVPGDDIFKGTIRHSSQHDSSR
                     EWVGKKVLVVGTSSSGFDTAYDFARRGVDVTLLQRSPTYIMSLTHCIPRLLGVYKPDD
                     NGKRPDIDIADRIAHGMPVGPGEELGRRLGQELTELDHDLLQALEDKGFKTWRGQRNT
                     STQTLGYTKAGGFYFDAGACTQIIEGKIKVEQGYIDHFTEDKVVLNGDREKTYDLVVL
                     ATGFSNTIDSVRRTLGDDVADRCKPVWGMDEEGELNSAWRDTGVPNLWVMVGTLQAAR
                     YHSKKVALNIKARLEGICKEPYLE"
     gene            1140635..>1142236
                     /locus_tag="CNC03600"
                     /db_xref="GeneID:3256753"
     mRNA            join(1140635..1140791,1140909..1141041,1141107..1141186,
                     1141257..1141484,1141540..1141741,1141792..1142085,
                     1142223..>1142236)
                     /locus_tag="CNC03600"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41576405|gb|CF722246.1"
                     /transcript_id="XM_569580.1"
                     /db_xref="GI:58264847"
                     /db_xref="GeneID:3256753"
     CDS             join(1141023..1141041,1141107..1141186,1141257..1141484,
                     1141540..1141741,1141792..1142085,1142223..1142236)
                     /locus_tag="CNC03600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569580.1"
                     /db_xref="GI:58264848"
                     /db_xref="GeneID:3256753"
                     /translation="MKIEGKSFVITGGLGSIGGSTAKLIAEKGGYPIIFDILSPADGE
                     KKIKELPNSERYVYQQTDIADRAKMEQAIQAALKKVPKGSLAGGVHCAAINPGMPWGP
                     KMADKLDDFEKVMKVNAYGTFCVDAVVADAINSQYPPLDPFHERVEEERGCIVNISSI
                     VAFDPPARCLTYGPSKTTVLGITSAAADFLAPTGIRVNSIAPALVYSALMNSGGRGDY
                     FKDEMNAHSMFPRRMTNASEIGAAILFLIETSMMNAFHLKVDAGWRNVTSWACGRDHG
                     SI"
     gene            1143948..1146004
                     /locus_tag="CNC03610"
                     /db_xref="GeneID:3256446"
     mRNA            join(1143948..1144043,1144124..1144214,1144322..1144603,
                     1144659..1144919,1144973..1145121,1145177..1146004)
                     /locus_tag="CNC03610"
                     /product="t-complex protein 1, theta subunit
                     (tcp-1-theta), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530636|gb|CF676477.1,gi|41530638|gb|CF676479.1,
                     gi|41535385|gb|CF681226.1,gi|41535444|gb|CF681285.1,
                     gi|41535459|gb|CF681300.1,gi|41535984|gb|CF681825.1,
                     gi|41535991|gb|CF681832.1,gi|41541072|gb|CF686913.1,
                     gi|41541081|gb|CF686922.1,gi|41541221|gb|CF687062.1,
                     gi|41541234|gb|CF687075.1,gi|41541387|gb|CF687228.1,
                     gi|41541396|gb|CF687237.1,gi|41542373|gb|CF688214.1,
                     gi|41542384|gb|CF688225.1,gi|41544136|gb|CF689977.1,
                     gi|41544146|gb|CF689987.1,gi|41544168|gb|CF690009.1,
                     gi|41544767|gb|CF690608.1,gi|41545304|gb|CF691145.1,
                     gi|41545309|gb|CF691150.1,gi|41546567|gb|CF692408.1,
                     gi|41553353|gb|CF699194.1,gi|41553359|gb|CF699200.1,
                     gi|41554769|gb|CF700610.1,gi|41554777|gb|CF700618.1,
                     gi|41556318|gb|CF702159.1,gi|41556330|gb|CF702171.1,
                     gi|41559664|gb|CF705505.1,gi|41559668|gb|CF705509.1,
                     gi|41561776|gb|CF707617.1,gi|41561783|gb|CF707624.1,
                     gi|41563322|gb|CF709163.1,gi|41563329|gb|CF709170.1,
                     gi|41566347|gb|CF712188.1,gi|41566361|gb|CF712202.1,
                     gi|41567008|gb|CF712849.1,gi|41567015|gb|CF712856.1,
                     gi|415"
                     /transcript_id="XM_569582.1"
                     /db_xref="GI:58264851"
                     /db_xref="GeneID:3256446"
     CDS             join(1143987..1144043,1144124..1144214,1144322..1144603,
                     1144659..1144919,1144973..1145121,1145177..1145980)
                     /locus_tag="CNC03610"
                     /codon_start=1
                     /product="t-complex protein 1, theta subunit
                     (tcp-1-theta), putative"
                     /protein_id="XP_569582.1"
                     /db_xref="GI:58264852"
                     /db_xref="GeneID:3256446"
                     /translation="MSLKVPKASGPDLFKSGYKHLSGLEEAVLRNIAAVGELSEIVRT
                     SFGPNGRNKLIINHLGRLFVTSDAATIIREIEVAHPAAKLLVMASTAQEAEMGDATNL
                     VLIFAGELLKRSEHLLTMGLHPSDVIQGYEMALAKGREELETLVAAQITSSPLPSVDN
                     LAAAVSSSLASKQPGCEVLLSKLVAEAALAVMPKNPKDFNVDSVRVVKVLGGGLEASR
                     VVRGMVFGREPEGIVKNATRAKVAVYTCGLDISQTETKGTVLLKKAEDLLNFSRGEEK
                     QLEGYFKEIADSGVKLIIAGSGIGDLALHYLNRMGIAVIKVLSKFDLRRLCRVVGATP
                     LARLGAPTPEEAGMVDVFETIEIGGDRVTVLRQEEGEKTRTATIVLRGATANYLDDLE
                     RSLDDGINTIRILFRDGRLVPGAGASEIELARRISAYGGKTAGLAQHSIKRWAEACEV
                     VPRTLAENAGLNSEDVVSSLYKAHADGQVDAGVDIESEKEGVRSTKDMGVFDPYAAKD
                     WALKLATEAAISVLRVDSIIVAKQAGIAPPKQQGHWDDD"
     gene            complement(<1146067..>1146669)
                     /locus_tag="CNC03620"
                     /db_xref="GeneID:3256308"
     mRNA            complement(join(<1146067..1146280,1146461..1146513,
                     1146577..>1146669))
                     /locus_tag="CNC03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_569585.1"
                     /db_xref="GI:58264857"
                     /db_xref="GeneID:3256308"
     CDS             complement(join(1146067..1146280,1146461..1146513,
                     1146577..1146669))
                     /locus_tag="CNC03620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569585.1"
                     /db_xref="GI:58264858"
                     /db_xref="GeneID:3256308"
                     /translation="MSDRRKLAAPPGVGAGKPDHPFAVTVEDPVPNAIVPDGYGIKYH
                     AYHTIAPNVQCRRLSYDITAWNETAGWCYGACELQSATSSMLISRLGTEKIVMDKVAK
                     PGPPAAKVPPGPICSIQ"
     gene            complement(1146876..1148685)
                     /locus_tag="CNC03630"
                     /db_xref="GeneID:3256814"
     mRNA            complement(join(1146876..1147273,1147349..1147573,
                     1147633..1147803,1147851..1147979,1148043..1148194,
                     1148257..1148374,1148459..1148562,1148614..1148685))
                     /locus_tag="CNC03630"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530024|gb|CF675865.1,gi|41530031|gb|CF675872.1,
                     gi|41551740|gb|CF697581.1,gi|41561346|gb|CF707187.1,
                     gi|41561358|gb|CF707199.1,gi|41571525|gb|CF717366.1"
                     /transcript_id="XM_569587.1"
                     /db_xref="GI:58264861"
                     /db_xref="GeneID:3256814"
     CDS             complement(join(1147037..1147273,1147349..1147573,
                     1147633..1147803,1147851..1147979,1148043..1148194,
                     1148257..1148374,1148459..1148551))
                     /locus_tag="CNC03630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569587.1"
                     /db_xref="GI:58264862"
                     /db_xref="GeneID:3256814"
                     /translation="MASGFSSESPVNILLIGLGSIGSIYAYLLEKSGKARVTAVARSN
                     YTLYTTSGVTLDTERFGEINNWKPYRVFKTQQEALNDGTFYASCIVCTKCLPDVLPNV
                     KLLEDTLASDQIGSYHLMQNGLGIEEDLFTALEGREIPILSSCAWIGIMTSSDGQVVS
                     WSGQDMLVTGIYPPASPETGNQTRAFSLKEAEALNLWVDLLRAGEGIVHPTERIDSIR
                     FSKNVWNCAWASVQGLVRATALAFAPLSLEQAAVVKAYFREIVAVGFEAGLLWKGMIQ
                     YPSGEISAGLEDVVNYCWDKITGMAVARGVGHKYSLLIDVETGRPFELEVIVGSVLRL
                     AQKHNIETPRLEYTYVLLKVLQGEILREKRLRVKERAVVA"
     misc_feature    1150196..1150380
                     /note="CT-rich"
     gene            <1152859..1154078
                     /locus_tag="CNC03640"
                     /db_xref="GeneID:3256167"
     mRNA            join(<1152859..1153535,1153593..1153903,1153960..1154078)
                     /locus_tag="CNC03640"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542847|gb|CF688688.1,gi|41542853|gb|CF688694.1"
                     /transcript_id="XM_569589.1"
                     /db_xref="GI:58264865"
                     /db_xref="GeneID:3256167"
     CDS             join(1152859..1153535,1153593..1153866)
                     /locus_tag="CNC03640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569589.1"
                     /db_xref="GI:58264866"
                     /db_xref="GeneID:3256167"
                     /translation="MSFSPPQESPNLPSLAAALADTSGAAQGIQIAPELIGDGGAPPD
                     LPRREELQGQQPSDGVSQAFGSYQNSSTRDDGYRGWSNGPNPPPRAQNPWEEGYRDHS
                     SHPDPTINQQYSYSEQAGPSISTENIEEPQKPPRKRARQSKPRGHEKNGVNSDGLPEE
                     GILDFAHPSGDFKLGPVFVHPPKGVAQACVRCHKIKRKCDNARPRCAGCSRADVACVF
                     ELNPATASYVSSLKSDNVTLSAQMVSAAERISQLEAVLVNTGQEIPPPPQTLKNIDFT
                     AIAGDKFSAKDDDVSTEDAIKRLAESALTTSLHKRRRMSW"
     gene            1155629..1156093
                     /locus_tag="CNC03650"
                     /db_xref="GeneID:3256471"
     mRNA            join(1155629..1155670,1155747..1155826,1155904..1156093)
                     /locus_tag="CNC03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_569995.1"
                     /db_xref="GI:58265677"
                     /db_xref="GeneID:3256471"
     CDS             join(1155763..1155826,1155904..1156073)
                     /locus_tag="CNC03650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569995.1"
                     /db_xref="GI:58265678"
                     /db_xref="GeneID:3256471"
                     /translation="MPANLARETVDKTPKMVLLRAQARKTFKAIMTMPVLAPPLADAD
                     TSMEDASTVDVLNKRAADDGSKDAVVKRSRVGM"
     repeat_region   1156132..1156163
                     /rpt_type=tandem
                     /rpt_unit_seq="cat"
                     /satellite="microsatellite"
     gene            complement(<1156192..>1158598)
                     /locus_tag="CNC03660"
                     /db_xref="GeneID:3256482"
     mRNA            complement(join(<1156192..1156865,1156932..1158132,
                     1158188..>1158598))
                     /locus_tag="CNC03660"
                     /product="mitochondrial intermediate peptidase,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_569591.1"
                     /db_xref="GI:58264869"
                     /db_xref="GeneID:3256482"
     CDS             complement(join(1156192..1156865,1156932..1158132,
                     1158188..1158598))
                     /locus_tag="CNC03660"
                     /EC_number="3.4.24.59"
                     /codon_start=1
                     /product="mitochondrial intermediate peptidase,
                     mitochondrial precursor"
                     /protein_id="XP_569591.1"
                     /db_xref="GI:58264870"
                     /db_xref="GeneID:3256482"
                     /translation="MLRLPRITRRALSSGALAPHFDRPLPPPPPAPPAPLCALPPLTA
                     PDALAPLTRRTVRHADALVARIAAAPAHPDPAELRRVVKNLDRLSDVLCGVIDMCELV
                     RNVHPDPRWVAAAEKTYETLCSFMNQLNTSTGLYDALVATVSHTFPGNPLSPAELRVA
                     QTFLSDFERSGIQLPPGVRAKFVRHSDNILSLGRTFLSFAAAGPSADTPIEIPEPEVL
                     LAGLSSKFVASLPRKKRKGPALLAPGSWEAQMIGRYADNEEARRLVYIGSMREDKDRV
                     YVLETMLKERAELAHVLGKETWADVALSDKMAKTPQNVLQFLTSLATHHRPSAAADVA
                     ALQRLKALSTVSRTSSQLPTVHAWDRDHYAEQYAASLLPNGSLPSITPYFSVGTAMSG
                     LSHMLSRLYGISFKPVSVAHGEVWHPSVRRLDVMDEHGKRIGVIYCDLFSRPGKPSAG
                     AAHYTVRCSRRVDDDPSEGDGLPPGWDQHLGKGMEVQGEALHGKEGKYQLPIVVLTTD
                     FGTVEESGPALLGWNDLETLFHEMGHAIHSMIGQTEFHNVSGTRCATDFVELPSILME
                     HFISSPAVLSTFATHYTTNEPLPIPLIQAHLQLDQSLKALETHSQILMALLDQKYHSI
                     KHGEQLDSTRVWNELQSQVGVIPPVRGTAWQTQFGHLYGYGATYYSYLFDRAIAGKIW
                     SSLFARGRTGPAAANHDPAAAEDILSREGGEAFKEKVLKWGGGRDPWEMVGDVIGGAE
                     GEQVAKGDEKAMELVGRWMIK"
     repeat_region   1158381..1158533
                     /rpt_type=tandem
                     /rpt_unit_seq="cggg"
                     /satellite="microsatellite"
     misc_feature    1158439..1158628
                     /note="G-rich"
     gene            <1158687..1161932
                     /locus_tag="CNC03670"
                     /db_xref="GeneID:3256520"
     mRNA            join(<1158687..1160273,1160467..1160739,1160805..1160880,
                     1160938..1161002,1161070..1161087,1161139..1161327,
                     1161403..1161640,1161709..1161932)
                     /locus_tag="CNC03670"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534776|gb|CF680617.1,gi|41534784|gb|CF680625.1,
                     gi|41562502|gb|CF708343.1,gi|41562511|gb|CF708352.1,
                     gi|41566422|gb|CF712263.1"
                     /transcript_id="XM_569593.1"
                     /db_xref="GI:58264873"
                     /db_xref="GeneID:3256520"
     CDS             join(1158687..1160273,1160467..1160739,1160805..1160880,
                     1160938..1161002,1161070..1161087,1161139..1161327,
                     1161403..1161640,1161709..1161890)
                     /locus_tag="CNC03670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569593.1"
                     /db_xref="GI:58264874"
                     /db_xref="GeneID:3256520"
                     /translation="MSAPLFTSPSGAELSLQNAGGHLSRWHVAVGHTPAFRFHRSDAP
                     PATLCTVHLPGLGPVTSDPCANKARAKQSASFRAVQRLLASHELDDRFQPTPSQPRTR
                     ARDDIMATKSRCNYRWESRKLLIKDELPQGHGSGDYAYRTTPQFWKECPPFAPGERVH
                     AAVLLLSPTAEKTFGHPECRPMCLLTSRPLPLFETHDTVEVNLGVGEQPTHRGCVRMT
                     SAGSLEGGLDDVTLGQTLRFTERLMRAELQRLIKADLHRIKWLLLPLTYGYSSARQPG
                     PLAREDIAWEQVEAVANGPLTVPFTLKDEDDLAAQCFDAMASANSELTRRSYITAVRQ
                     DLNPDSPHPERPEKTILQVIQGENCLFPQLVHRKQPILQVETACLAKNGSYITTSATP
                     AEQRSTQFLIPEYENRHCIPASIFRALTPFPFFIHQLECMLIAYEMSTKLFGSLLHPE
                     LALQALTAPSSQNVTPWTYERLEILGDTLLKFFITIHVYLHGGGANSREDSLKVWQDR
                     HKLVSNRTLTANAIKLGLVEFLLADIVEAIIGASYGRDKNFDNVISTLIHLNVPLDLF
                     STWEEIKHVLPLSDDEHDTEEHGAADAETETDSFSACEILGYKFKRKRRYEDVISMSN
                     QPHARRIRENYKMLGNAVLDLHVIEFLLAKYPEEGPGSLSNMKTFRTTEGLRCALATE
                     LGLQDLLKDGDERAERELGRATYFMRDAKAQADAGLSDEEQGGIHYWDGVAVNHFTGS
                     IIEVIYGAIFQDSGFSLEHTQRIFDNHIVPFIEKYCKGPSASDLHPKGLLTRWMQAKG
                     CAYWKLDAVGPKLCEGVVTCHDQDVARCKAFTTHVAVRNVCEEAIKRLRDENRIKDIC
                     DCPSFKEIVPEDKTFGKWR"
     misc_feature    1161974..1161994
                     /note="AT_rich"
     gene            <1162131..>1164932
                     /locus_tag="CNC03680"
                     /db_xref="GeneID:3256335"
     mRNA            join(<1162131..1164008,1164071..1164337,1164392..1164467,
                     1164518..1164582,1164637..1164654,1164717..>1164932)
                     /locus_tag="CNC03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_569595.1"
                     /db_xref="GI:58264877"
                     /db_xref="GeneID:3256335"
     CDS             join(1162131..1164008,1164071..1164337,1164392..1164467,
                     1164518..1164582,1164637..1164654,1164717..1164932)
                     /locus_tag="CNC03680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569595.1"
                     /db_xref="GI:58264878"
                     /db_xref="GeneID:3256335"
                     /translation="MTEEPSSIIADNSTAIKSPTTFTSPNGTVLTFQSAGSHLSSWLQ
                     TIGHTPDYSMEDVLPEGYIPPPLSKKAAKKAALGDANVYAGPPPGSMRVCTVNLPFYG
                     PVRSTPWANKALAKQSASFEAVKELHKHGEVDDNFQATPLRPKKKGDTKGTKSRCHDT
                     WEIKKAVIKDQLPRPTGGVGHGQYDYQTTPEFWSTCPPFNPRSLHASILQLSPAGEGK
                     YDHPECRMMCMLTSRPLPVFRKSNQVEVRMAVGEQPPLCATMRVINGGKMDTFYSGKL
                     DQALVFTEKLMRAEVQKVFKTDLRKVKWLLLPLRREYVPPTKEQLVAGKSASLKLDDI
                     SWKEVDAVTDGALTLPFTFDDYDSLKREIVDSLATAPSEMSRRSYIIDVRQDLHPLSP
                     HPDIPEKTICDVLKEGNVTLPQLTDPSQPILEVETVNLAKTGSYISTAAMAAEERPRQ
                     YLVPEFEHRHCIPASVFRTCTVIPYFIFYLESMLIAEEMSAKEFNSILDPELALQAIT
                     AAEGLNVPRWTYERLEILGDTLLKFMTTLHFYLLGGGADSEDDMNKVWQDRHMLISNR
                     TLTANAVKQGLVKYVRNKKFKVKEWTPRDWELDLLPGQFAPKKTMPTSFDGPESRVLG
                     DKVIADIIEAIIGASYMPNKDLDSVIAILHHLMVPLNLFNTWDDVKHVLPPPKAEEPK
                     NPDVPAYINFFKKSSYEVLGYKFKDNKKFEDAFSLAPAQQTRRIRERYKMMGNALLDL
                     YVIELLMDSYPDEGPASLSIMKLSRTTEGLRCALAVELGMSDLIIDGDDHSRSELKRA
                     THFMQKAKAQADEDLNENKEGGVHYWEEVVISRVRSSLSRV"
     gene            complement(<1166426..>1167192)
                     /locus_tag="CNC03690"
                     /db_xref="GeneID:3256385"
     mRNA            complement(join(<1166426..1166429,1166466..1166494,
                     1166583..1166670,1166730..1166843,1166906..>1167192))
                     /locus_tag="CNC03690"
                     /product="chaperone protein DNAJ, putative"
                     /transcript_id="XM_569597.1"
                     /db_xref="GI:58264881"
                     /db_xref="GeneID:3256385"
     CDS             complement(join(1166426..1166429,1166466..1166494,
                     1166583..1166670,1166730..1166843,1166906..1167192))
                     /locus_tag="CNC03690"
                     /codon_start=1
                     /product="chaperone protein DNAJ"
                     /protein_id="XP_569597.1"
                     /db_xref="GI:58264882"
                     /db_xref="GeneID:3256385"
                     /translation="MSYILTSFLASFLPSQITTAILPYLSANLPAIFPPAPRGSPRYL
                     HNYRLAFTGVICIWQGYSFLKDGLGNGDDWYRLLNVQGNADEDALKSAFRTLARKHHP
                     DRAGKDNDDHFILARKAYETLSDPVKRYAYDRFGPKILQWKAASVREYILFGLQNSIG
                     FYISLGKVVQDHI"
     gene            complement(1167390..1169622)
                     /locus_tag="CNC03700"
                     /db_xref="GeneID:3256565"
     mRNA            complement(join(1167390..1167842,1167891..1167955,
                     1168008..1168159,1168206..1168480,1168539..1168780,
                     1168839..1169046,1169097..1169173,1169286..1169381,
                     1169487..1169622))
                     /locus_tag="CNC03700"
                     /product="UTP-glucose-1-phosphate uridylyltransferase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531662|gb|CF677503.1,gi|41531669|gb|CF677510.1,
                     gi|41532451|gb|CF678292.1,gi|41532461|gb|CF678302.1,
                     gi|41532782|gb|CF678623.1,gi|41532784|gb|CF678625.1,
                     gi|41533211|gb|CF679052.1,gi|41533216|gb|CF679057.1,
                     gi|41534019|gb|CF679860.1,gi|41534029|gb|CF679870.1,
                     gi|41534520|gb|CF680361.1,gi|41535982|gb|CF681823.1,
                     gi|41535994|gb|CF681835.1,gi|41536106|gb|CF681947.1,
                     gi|41536115|gb|CF681956.1,gi|41538238|gb|CF684079.1,
                     gi|41538731|gb|CF684572.1,gi|41538733|gb|CF684574.1,
                     gi|41539415|gb|CF685256.1,gi|41539429|gb|CF685270.1,
                     gi|41540077|gb|CF685918.1,gi|41540086|gb|CF685927.1,
                     gi|41540334|gb|CF686175.1,gi|41540337|gb|CF686178.1,
                     gi|41541156|gb|CF686997.1,gi|41541167|gb|CF687008.1,
                     gi|41541464|gb|CF687305.1,gi|41541472|gb|CF687313.1,
                     gi|41542718|gb|CF688559.1,gi|41542722|gb|CF688563.1,
                     gi|41542755|gb|CF688596.1,gi|41542760|gb|CF688601.1,
                     gi|41543029|gb|CF688870.1,gi|41543488|gb|CF689329.1,
                     gi|41543496|gb|CF689337.1,gi|41544424|gb|CF690265.1,
                     gi|41544429|gb|CF690270.1,gi|41545085|gb|CF690926.1,
                     gi|415"
                     /transcript_id="XM_569599.1"
                     /db_xref="GI:58264885"
                     /db_xref="GeneID:3256565"
     CDS             complement(join(1167512..1167842,1167891..1167955,
                     1168008..1168159,1168206..1168480,1168539..1168780,
                     1168839..1169046,1169097..1169173,1169286..1169381,
                     1169487..1169552))
                     /locus_tag="CNC03700"
                     /codon_start=1
                     /product="UTP-glucose-1-phosphate uridylyltransferase"
                     /protein_id="XP_569599.1"
                     /db_xref="GI:58264886"
                     /db_xref="GeneID:3256565"
                     /translation="MATLEPKQDPQASARQRGHSAMDFKSATTGVAAKTMRNELNRMV
                     ANEQDPAKKKMFEAEMQSFFILFNRFLTERAKGEKLDWDKINPPKPEQVRPYEVLPNV
                     DPSILNKLAVLKLNGGLGTTMGCVGPKSIIEVRDNMTFLDLSVRQIEHLNEKYNVNVP
                     FILMNSFNTDEDTARIIQKYQNHNINILTFNQSRYPRVDKESLLPCPRESSSDKSNWY
                     PPGHGDIFDALTNSGLLDKLIAAGKEYIFISNVDNLGAVVDLNIFQTMIDAQAEYVME
                     VTDKTKADVKGGTIIDYDGKPRLLEVAQVPKDHLDEFCSTRKFKIFNTNNIWCNLRAI
                     KRIMDEDALNLEIIVNNKVTDDGLAVIQLETAIGAAIKHFDSAIGINVPRSRFLPVKS
                     CSDLLLIKSKLYNLEHGVLTMDRSREFGGTPVVKLGGEFKKVANFEKRFKSIPNITEL
                     DHLTVSGDVWFGKSVRLAGTCIIVATEGNKIMIPDGTNLENKLITGNLSIIDH"
     gene            complement(1169901..1173922)
                     /locus_tag="CNC03710"
                     /db_xref="GeneID:3256423"
     mRNA            complement(join(1169901..1170037,1170096..1170488,
                     1170533..1171901,1171969..1172553,1172609..1172630,
                     1172687..1172753,1172913..1173357,1173416..1173481,
                     1173520..1173566,1173630..1173922))
                     /locus_tag="CNC03710"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532439|gb|CF678280.1,gi|41532453|gb|CF678294.1,
                     gi|41539011|gb|CF684852.1,gi|41546035|gb|CF691876.1,
                     gi|41546052|gb|CF691893.1,gi|41558152|gb|CF703993.1,
                     gi|41558159|gb|CF704000.1,gi|41564416|gb|CF710257.1"
                     /transcript_id="XM_569601.1"
                     /db_xref="GI:58264889"
                     /db_xref="GeneID:3256423"
     CDS             complement(join(1169951..1170037,1170096..1170488,
                     1170533..1171901,1171969..1172553,1172609..1172630,
                     1172687..1172753,1172913..1173357,1173416..1173481,
                     1173520..1173566,1173630..1173860))
                     /locus_tag="CNC03710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569601.1"
                     /db_xref="GI:58264890"
                     /db_xref="GeneID:3256423"
                     /translation="MSRSTMSRQSNGDSTPARDLLLPHPAEDLSADDDLLSWVLVDQL
                     GCMPNTRLGVHPQQVKFVGPPFKTDEVLNIVRETVTKGDLNGAMKRLQEFWLFQQHLQ
                     SKLTTNQKERFIQHLRRYLLCLQPTSRVEIHLTSRYSFATGHTELAVFATRPLARGLV
                     VQELQGSVVPLPEEWREEMDIGDDFAVEAAEESGSERDEEEEDVRSEAFTSTSGRRGK
                     SKAKEESRRQGQRRSDRTKRRDFSIVWSGLKRCYQLFLGPARFLNWVYITFEWKPKLT
                     ITASSGENYFGKGNVECLCLTCEKNHHGGFTPKPESSRRTSRHLSRDFTADPPCVRGR
                     SSVSRSRESISTGPTSLKHETAVKQEPFSDDEHEVSIGLSTAPSLSTEEECDTPIDNV
                     SNTPRVASPFGESLASDVDSVIMPPRRERYARKAAQNSKSWLLLKGRGPKTDIDEDLA
                     FVGGDEEFPPDFPRCATCAKPLSDQIWYNGRYFDHCQRCVRHALVFQLPWPAHKPQEV
                     QEYPPAYLIPPGYIPPKISTVPLPSLSKNRLPPRVNVIATSQTPPRAGNSMEDRAHRL
                     RKQIEIEEFIVNSLREAAWSVQEAKELAQEAKEEAKRKKKEEKMRLDALRIKGNGIWQ
                     RYEYVDEEELKRKQEAMWRVEPGTTRRGTVRKIPQVENSDGKRDKQTGKEAEGTVAVI
                     NDEARAKKNEEKKRKRAEEKLKREQKMREEERRKEEKRLKDRERKRRAKEMKKEEKER
                     AVLTAVSNYTSTSHRDNGYVQPSVDIDEGDNEDLEDEIMVAAAPELLAYYSPETSRTT
                     ELPSSAVISARPLARRISKSTSQSPLSSGFKILTSSPQTTISMSAISASNNYAVGVGV
                     PASTPPEAIMLHIPARDLSSKDSASSKLKRKRPPGTVKTMKDQITETAPAKSEEAKSE
                     KGGGGSSTLMGSSQRKEESVLPKEDKGKGKDLASHSPKSTISTMDFTKQTALISQELP
                     FGRSGGYFPPPFSPLRANDYPPVATRAAPDLAPTLSRLDTSPQDVAIASASSSSDASL
                     SLTTVAAVKDAMDGEPLQEKLQGLVQNFDPSTASKNHKKRLFEHGVEATSQLQLPPAK
                     KRTFFPSTFQHPMEM"
     misc_feature    1171144..1171300
                     /note="CT-rich"
     gene            1174113..1175644
                     /locus_tag="CNC03720"
                     /db_xref="GeneID:3256531"
     mRNA            join(1174113..1174246,1174307..1174421,1174482..1174643,
                     1174725..1175165,1175240..1175644)
                     /locus_tag="CNC03720"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41557216|gb|CF703057.1,gi|41557229|gb|CF703070.1"
                     /transcript_id="XM_569603.1"
                     /db_xref="GI:58264893"
                     /db_xref="GeneID:3256531"
     CDS             join(1174189..1174246,1174307..1174421,1174482..1174572)
                     /locus_tag="CNC03720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569603.1"
                     /db_xref="GI:58264894"
                     /db_xref="GeneID:3256531"
                     /translation="MRLSQVNKILLGSCIVVVPLSFYGGLAIKEYYLSKELEKVDDSR
                     PPPHERAMRARIVQLEQERQELLKEGQNLDIKIRDIRKRMTEV"
     gene            1176173..1177734
                     /locus_tag="CNC03730"
                     /db_xref="GeneID:3256796"
     mRNA            join(1176173..1176359,1176420..1176608,1176668..1176721,
                     1176770..1176869,1176924..1177106,1177157..1177256,
                     1177313..1177438,1177496..1177553,1177616..1177734)
                     /locus_tag="CNC03730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569605.1"
                     /db_xref="GI:58264897"
                     /db_xref="GeneID:3256796"
     CDS             join(1176263..1176359,1176420..1176608,1176668..1176721,
                     1176770..1176869,1176924..1177106,1177157..1177256,
                     1177313..1177438,1177496..1177553,1177616..1177620)
                     /locus_tag="CNC03730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569605.1"
                     /db_xref="GI:58264898"
                     /db_xref="GeneID:3256796"
                     /translation="MSDGEHALAKTVFGSDRLSASKLFNVDGWVVLVTGGGTGLGLIT
                     AGALAENGAKVYITGRRLEPLEEAAKTAAPKGGKGTIIPLQADMSKKEDIDKVKETII
                     SKEKWLNALINNHGVAITPPKIDEAEQTAEGLSKFMYDEEKFDNWLDAYRINTASYYF
                     TSFAFLPLLAAAKSVGNYSEPGNIINVASVSGVAVTSQGGQFSYNSSKGATIALTRML
                     ATELARRELGIRVNMICPGYFPSGMTGYTEDDTQPSKEFKDKMGTPLGRTGNAIDYAQ
                     TVFSLLSNQYITGRELVVDGGYLLNQI"
     gene            1178104..1179687
                     /locus_tag="CNC03740"
                     /db_xref="GeneID:3256298"
     mRNA            join(1178104..1178299,1178357..1178545,1178605..1178658,
                     1178706..1178805,1178865..1179047,1179108..1179207,
                     1179275..1179403,1179472..1179529,1179581..1179687)
                     /locus_tag="CNC03740"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41561386|gb|CF707227.1,gi|41561395|gb|CF707236.1"
                     /transcript_id="XM_569607.1"
                     /db_xref="GI:58264901"
                     /db_xref="GeneID:3256298"
     CDS             join(1178206..1178299,1178357..1178545,1178605..1178658,
                     1178706..1178805,1178865..1179047,1179108..1179207,
                     1179275..1179403,1179472..1179529,1179581..1179588)
                     /locus_tag="CNC03740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569607.1"
                     /db_xref="GI:58264902"
                     /db_xref="GeneID:3256298"
                     /translation="MSSSHSLARSVFGTDALTVNKLFDVSGWVAIVTGGGTGLGLITA
                     GALAQNGCKVYITGRRLEPLQEAAKTAAPSQGPGSIIPVQADMSTKEGIAKLKDVIES
                     NERWINILINNHGVSLPAPQINEAEQTPEGLSKKMFEDETFESWTDGYRINTASYYFT
                     SFAFLPLLSAAKTVGNFPEPGNIVNLSSISGITKTSQRGQFSYNANKAATISLSHQLA
                     TEFARRDIGVRVNVVCPGYFPSGMTPVDNKYHSAANAEFKQKWGTPLARPGNAVDYAQ
                     CIFGLVTNQYVTGAELIIDGGWLLAQPF"
     gene            complement(1179835..>1181176)
                     /locus_tag="CNC03750"
                     /db_xref="GeneID:3256819"
     mRNA            complement(join(1179835..1180283,1180338..1180544,
                     1180593..1180674,1180736..1180951,1180999..>1181176))
                     /locus_tag="CNC03750"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_569609.1"
                     /db_xref="GI:58264905"
                     /db_xref="GeneID:3256819"
     CDS             complement(join(1180016..1180283,1180338..1180544,
                     1180593..1180674,1180736..1180951,1180999..1181176))
                     /locus_tag="CNC03750"
                     /codon_start=1
                     /product="endoplasmic reticulum protein"
                     /protein_id="XP_569609.1"
                     /db_xref="GI:58264906"
                     /db_xref="GeneID:3256819"
                     /translation="MNQPCDVASSPHSSYTSLLLHFSIPYIHLLRRPHPSTAMPAIDP
                     HYLWALGHFTVLFSTAYIIFQTVLFRGTPVKTYRLAYSGALLSYFIVVYKSLGRPQLS
                     QPWLRRALVDENCQYALLALFWWISKPVNLTVLPFATFSLFHCLTFLRTNVIPKLVPP
                     PPKPAAGAAPGATASGASAPQPARPPALLDNVSRRIQVWVKTNYDTAMRFVAYAEIFI
                     TLRLFAGVLTFRTSFITALFMIHFVRFRYHASPFTRSAVQDITARIDAFVAGKGAGVQ
                     NAWATVKRFVVSWGGMPLLPNEGRNGAQGPAAQAQQAARG"
     gene            1181288..1182163
                     /locus_tag="CNC03760"
                     /db_xref="GeneID:3256734"
     mRNA            join(1181288..1181533,1181594..1181797,1181851..1181894,
                     1182091..1182163)
                     /locus_tag="CNC03760"
                     /product="40S ribosomal protein S12, putative"
                     /transcript_id="XM_569612.1"
                     /db_xref="GI:58264911"
                     /db_xref="GeneID:3256734"
     CDS             join(1181308..1181533,1181594..1181797,1181851..1181867)
                     /locus_tag="CNC03760"
                     /codon_start=1
                     /product="40S ribosomal protein S12"
                     /protein_id="XP_569612.1"
                     /db_xref="GI:58264912"
                     /db_xref="GeneID:3256734"
                     /translation="MSDAGSETASNHPEVEAQEVEVAAPSGPMSVEDALEQVIKTALV
                     HDGLARGLRECAKALDKKEAHLCVLVETVTEAEYLKLIEALCTEHGIQLIKVSDAKVL
                     GQWAGLAKIDREGKPRKVVGCSCVVITNYGEDSAALQVLLEYFKTR"
     gene            complement(<1182239..1184733)
                     /locus_tag="CNC03770"
                     /db_xref="GeneID:3256644"
     mRNA            complement(join(<1182239..1182552,1182611..1183120,
                     1183178..1183442,1183496..1183593,1183644..1183774,
                     1183826..1183989,1184039..1184733))
                     /locus_tag="CNC03770"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539831|gb|CF685672.1,gi|41539839|gb|CF685680.1,
                     gi|41540513|gb|CF686354.1,gi|41540520|gb|CF686361.1,
                     gi|41540639|gb|CF686480.1,gi|41540651|gb|CF686492.1"
                     /transcript_id="XM_569614.1"
                     /db_xref="GI:58264915"
                     /db_xref="GeneID:3256644"
     CDS             complement(join(1182239..1182552,1182611..1183120,
                     1183178..1183442,1183496..1183593,1183644..1183774,
                     1183826..1183989,1184039..1184350))
                     /locus_tag="CNC03770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569614.1"
                     /db_xref="GI:58264916"
                     /db_xref="GeneID:3256644"
                     /translation="MPHPHTSIAPYPQPGDSSPHKTQSQDSLALQTPSSSGSTSTNSL
                     QLLDNDLDDPDDELDLDLDDMDLDEEESDARVDEPLVRGRGGRRRGRRYKEEATERGL
                     LELIPSLILSHPLPLLPLLALLPYNFLPAGVVFFVPVICILALLSVCAHIVIVYLAWY
                     LKVPSFEDVFANVTGKYGKYGLWGGRVATLIAVLGMLVSWLGTLHPLVQPVIETYFPA
                     NAVFSSRVFWTLLLSLTLLPSLLPSRMTRSLHRSPFVLVLLLPIVAFLIIGRTVEIRK
                     ASEIAQPGGDHAGDGGADVASLATDVLVHLGKRRFGLAGGSSAGAGLTTLTIFFSPHV
                     NTLPIHSTLARTKRSSFFMPCLISGAVILILSLPLALVPYYLLPMDATAADTGKGVIS
                     NNTIPSGVFAHLPADDGWVNLARLLMVTLTLGSTNMWILRGRDVILKAMDVDGGNHYK
                     VGRWIGFGWWVVAVGAACLGGWLADKIELVGVLGVIAVGWFLPSLFFIITFHVRSPLS
                     IIFPSRQPPPNPDALASLSTSHNLNRRGHSREDSLNDPSTDVLLARKERQLQKRRLGR
                     RLWQDLIVYVGIMPMGCVTLAWTAGRLVGLW"
     gene            <1185041..>1185944
                     /locus_tag="CNC03780"
                     /db_xref="GeneID:3256270"
     mRNA            join(<1185041..1185065,1185140..1185252,1185300..1185348,
                     1185405..1185601,1185645..>1185944)
                     /locus_tag="CNC03780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569616.1"
                     /db_xref="GI:58264919"
                     /db_xref="GeneID:3256270"
     CDS             join(1185041..1185065,1185140..1185252,1185300..1185348,
                     1185405..1185601,1185645..1185944)
                     /locus_tag="CNC03780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569616.1"
                     /db_xref="GI:58264920"
                     /db_xref="GeneID:3256270"
                     /translation="MDRTCCSICFQSDARMAYIASVISHIIQDPSGINMPKLKDWIRT
                     CRTWEGGYASRPGGIEAQGGTTYCSLVALSLMSDFDKSPSPLNDRIFQTDTLRWLVSR
                     QLGGFQGRPGKLEDVCYSFWCGGALSLTPGKVLGRDDLIDHDANKSFLLSAQSPLGGF
                     GKEPDDYPDPYHSYLALAALSLSLNRFGEDKESNFRLKALNVRWNVSTETAEWLQTEV
                     TRVKEQERS"
     gene            complement(1186025..>1188078)
                     /locus_tag="CNC03790"
                     /db_xref="GeneID:3256274"
     mRNA            complement(join(1186025..1187087,1187211..>1188078))
                     /locus_tag="CNC03790"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41549289|gb|CF695130.1,gi|41561740|gb|CF707581.1,
                     gi|41561746|gb|CF707587.1"
                     /transcript_id="XM_569618.1"
                     /db_xref="GI:58264923"
                     /db_xref="GeneID:3256274"
     CDS             complement(join(1186030..1187087,1187211..1188078))
                     /locus_tag="CNC03790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569618.1"
                     /db_xref="GI:58264924"
                     /db_xref="GeneID:3256274"
                     /translation="MSSRKGKARAESPDERTLLLPEPFRPRSQPVPPAEQSPPRRARV
                     RSVLLTVSIVAASLFLSALLFIALLAASFKPSPSELSDLPQTAFKYTSPSSISVVNVT
                     DDGILVNISLSCGIDVDRALGIQNFYQESERQKAAERGDRGMGAVWWESLRRKSANWL
                     IGSLQRKQMSLDISKGVYIFPENDSSPPLGHIDLLGPLSIPLVTGVPPYSPDHPDLSW
                     LEPISFTAFVKPMASSGEIWNFIHQGWLHGGLNVAVGAESIQTGLGDGEERWWGRWVA
                     MKENDVSLQMELPIPQLPGLPRPGHPFDLSALVSLQNYSLSNADDRSLVINAMATIPN
                     FIRHLDFVQNGNFTVPFGLPFALSLPSSEDDVRMATVILQPVTVGQEKMIELRMSGTV
                     IADLDRTTGGNDTSPLSAFLQNYLHGRPSPIIVRGLSHYPNSSFFPVAPRWLLSTLPS
                     LSLDLSFPGPSPPPQIIRSVTIERMTIVEKEGKMKAGGIIVAEVEMPKDMRDVDVDVR
                     AVRPDVLIYDGPAPEDDVYHKGDGEKDEYPPKAFGHIHPAKWLPSTTTRSSDPFTPHR
                     FIVRAPLSDVDLDILPGRDSILSGFVTKIIFKGGALAGVEGVSDVQVQVKGVKGEVEV
                     GDLPVRGEFWVGKKKAL"
     gene            complement(<1188312..>1189925)
                     /locus_tag="CNC03800"
                     /db_xref="GeneID:3256512"
     mRNA            complement(join(<1188312..1188940,1188988..1189069,
                     1189182..1189639,1189688..1189793,1189848..>1189925))
                     /locus_tag="CNC03800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569999.1"
                     /db_xref="GI:58265685"
                     /db_xref="GeneID:3256512"
     CDS             complement(join(1188312..1188940,1188988..1189069,
                     1189182..1189639,1189688..1189793,1189848..1189925))
                     /locus_tag="CNC03800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569999.1"
                     /db_xref="GI:58265686"
                     /db_xref="GeneID:3256512"
                     /translation="MSDPISLITDSLTLPNGIRVPNRLVKAAMAEGIGLGGGPPQPNH
                     LRLYGRWAQGGWGMVISGNVQIDPKHLASPHDLTITPSTADRVAYRRLASVVASNLEP
                     PLLIMQISHPGLQSSSTVNFSRLPYQRAIGPCSARPDMDGGIMGWLWSHAVWPRKSKE
                     INDPEDWLRIVDKFVVGAVLAEEAGWDGVQVHAAHGYLLAEYLSPLASHHAANAGINR
                     KTSKSFIKAVKVNCSDFVQGGESGLDEIQASELIKTIVSWQLLDIIEISGGTYTQPAF
                     AYPETLSSPSKRQSLFSHFTTSLLPLLPPPPQGPAILLTGGLHNRELIAASLAERACD
                     MVGIGRPACLIPDLPRRIILNRAIADDEAFFGTYSIPHAKVVKFLLGGPSTAKGKGIP
                     LVGAGVSTLWHTWQMCRIGRGVEPDGEMSWFRGLLVEEIWKGMIVRGVTLMLSWKGNV
                     "
     misc_feature    1190007..1190028
                     /note="GC_rich"
     gene            1190444..1191409
                     /locus_tag="CNC03810"
                     /db_xref="GeneID:3256276"
     mRNA            join(1190444..1190539,1190606..1190667,1190784..1190876,
                     1190928..1191005,1191066..1191409)
                     /locus_tag="CNC03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_569619.1"
                     /db_xref="GI:58264925"
                     /db_xref="GeneID:3256276"
     CDS             join(1190453..1190539,1190606..1190667,1190784..1190876,
                     1190928..1191005,1191066..1191288)
                     /locus_tag="CNC03810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569619.1"
                     /db_xref="GI:58264926"
                     /db_xref="GeneID:3256276"
                     /translation="MSRFLFTFLFVLLSVQFCLAQRLATRIDEDGHTVVITGPNGYNG
                     VGTLPSSTATPMSTSMSASSRMTKSRLDDSTMSSTPFASALDSWHSAANAAWTESPSA
                     SDSSSSTPATTASSTEKSAAVNGAASAATDASATTSQTNTSAVMSHAESSATLSLPLN
                     LGPVIGITLTGVVSLWALIA"
     gene            1191885..1193891
                     /locus_tag="CNC03820"
                     /db_xref="GeneID:3256277"
     mRNA            join(1191885..1192333,1192399..1192822,1192881..1193084,
                     1193135..1193210,1193264..1193495,1193551..1193891)
                     /locus_tag="CNC03820"
                     /product="ER to Golgi transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41558416|gb|CF704257.1,gi|41558422|gb|CF704263.1,
                     gi|41563598|gb|CF709439.1,gi|41563605|gb|CF709446.1,
                     gi|41574635|gb|CF720476.1,gi|41574639|gb|CF720480.1,
                     gi|41575656|gb|CF721497.1,gi|41575664|gb|CF721505.1"
                     /transcript_id="XM_569620.1"
                     /db_xref="GI:58264927"
                     /db_xref="GeneID:3256277"
     CDS             join(1191917..1192333,1192399..1192822,1192881..1193084,
                     1193135..1193210,1193264..1193495,1193551..1193871)
                     /locus_tag="CNC03820"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein"
                     /protein_id="XP_569620.1"
                     /db_xref="GI:58264928"
                     /db_xref="GeneID:3256277"
                     /translation="MPSKKGKSKSNAKANAAANSNSTQRAPNLPNGAPTVPDEAAPQA
                     PPADETIEPKPLQEGEEQTQEQNHEHKDEEPSGPSRGEEQEEQDDVPVDERIRILEDD
                     LETMRQEKEALGNQYRSLLGKLTAMRTTLGDKLKEDAEELDRRETQINNLVTENSELH
                     ETVNTLKSELSSLSQESSHLSAQLAQLRSQSDSSSSDVLSLTREMRELRGEMERLRLE
                     REEWEVEAGRERERRETLEDDLRVFERREQDMCSALEKLAEERDKEKERGDNLQEVLS
                     EFQAAKDSEIQRATVELETQLRTAAESLSEFKLRAANAETRLSEVSSDASKSSALEKE
                     LKDKNQIIGKLRHDTVVSNEHLKEALRRLRKNQSDNNVDRRLVTNILLSFLMTSRGDP
                     KRFEMLSLLATILSWDDAEREKAGLQRQAAAGGGSKGKASASKGKETEKSAEEEAAMN
                     ESFSNLFVEFLLKEASQGQPSQTGTSDHQPHRTLSSLSLDSPPIFSPPRGPAAGSMTF
                     SPPASSPRQRPREMSSSSSVSEWPMMMGGRKGSYALKDVMEGQGQTYNP"
     gene            complement(1193918..1194937)
                     /locus_tag="CNC03830"
                     /db_xref="GeneID:3256279"
     mRNA            complement(join(1193918..1194309,1194361..1194384,
                     1194435..1194524,1194580..1194636,1194687..1194796,
                     1194845..1194937))
                     /locus_tag="CNC03830"
                     /product="inorganic phosphate transporter pho88, putative"
                     /transcript_id="XM_569621.1"
                     /db_xref="GI:58264929"
                     /db_xref="GeneID:3256279"
     CDS             complement(join(1194073..1194309,1194361..1194384,
                     1194435..1194524,1194580..1194636,1194687..1194796,
                     1194845..1194896))
                     /locus_tag="CNC03830"
                     /codon_start=1
                     /product="inorganic phosphate transporter pho88"
                     /protein_id="XP_569621.1"
                     /db_xref="GI:58264930"
                     /db_xref="GeneID:3256279"
                     /translation="MNNPAVSNLILSLGAMQVARKIPMEDPQVVNYLRIGYVSAQLIS
                     LAIYYFITLKIRKKNDLTVLKYVNPASPMNPDAKPELVQTTVKDYDLAETGKAIRSLL
                     ISVAIMTFLHGYMKYTQPLFIQSIMGLKGALESNPAKLHLWNKKAEGDLARPFKSSGG
                     MFESLTGKASGPQTDAASIKEAEKAGKAE"
     gene            1195113..1195769
                     /locus_tag="CNC03840"
                     /db_xref="GeneID:3256281"
     mRNA            join(1195113..1195305,1195357..1195556,1195629..1195769)
                     /locus_tag="CNC03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_569622.1"
                     /db_xref="GI:58264931"
                     /db_xref="GeneID:3256281"
     CDS             join(1195116..1195305,1195357..1195556,1195629..1195709)
                     /locus_tag="CNC03840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569622.1"
                     /db_xref="GI:58264932"
                     /db_xref="GeneID:3256281"
                     /translation="MRPQLFRPARTLGRRLNSSSSSPQANPNVQKAVENAQKAYAQTA
                     ATLKKAAGPVGEKIGGALGGYREPVVYNSKVFASICRQVWQAEKLSPPLDLATWARAY
                     SEIYAKASNGGYWKNVLKTGAWAGLGVAALEAYGIFKIGEIVGRRNLVGYSLKE"
     gene            1196171..1198725
                     /locus_tag="CNC03850"
                     /db_xref="GeneID:3256286"
     mRNA            join(1196171..1196247,1196301..1196355,1196406..1196461,
                     1196527..1196733,1196789..1197058,1197121..1197235,
                     1197284..1197353,1197401..1197460,1197506..1197911,
                     1197958..1198339,1198392..1198725)
                     /locus_tag="CNC03850"
                     /product="phenylalanyl-tRNA synthetase beta chain,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531450|gb|CF677291.1,gi|41546139|gb|CF691980.1,
                     gi|41546144|gb|CF691985.1,gi|41550934|gb|CF696775.1,
                     gi|41552614|gb|CF698455.1,gi|41552620|gb|CF698461.1,
                     gi|41555258|gb|CF701099.1,gi|41556222|gb|CF702063.1,
                     gi|41556227|gb|CF702068.1,gi|41560359|gb|CF706200.1,
                     gi|41560464|gb|CF706305.1,gi|41560479|gb|CF706320.1,
                     gi|41563282|gb|CF709123.1,gi|41563288|gb|CF709129.1,
                     gi|41565602|gb|CF711443.1,gi|41565609|gb|CF711450.1,
                     gi|41568417|gb|CF714258.1,gi|41568422|gb|CF714263.1,
                     gi|41568567|gb|CF714408.1,gi|41568572|gb|CF714413.1"
                     /transcript_id="XM_569623.1"
                     /db_xref="GI:58264933"
                     /db_xref="GeneID:3256286"
     CDS             join(1196245..1196247,1196301..1196355,1196406..1196461,
                     1196527..1196733,1196789..1197058,1197121..1197235,
                     1197284..1197353,1197401..1197460,1197506..1197911,
                     1197958..1198339,1198392..1198666)
                     /locus_tag="CNC03850"
                     /EC_number="6.1.1.20"
                     /codon_start=1
                     /product="phenylalanyl-tRNA synthetase beta chain"
                     /protein_id="XP_569623.1"
                     /db_xref="GI:58264934"
                     /db_xref="GeneID:3256286"
                     /translation="MPTITVDKAELYRRLEKEYSHEEFDELCFEFGIELDEDTTIQVE
                     EARKRGLPTPPPQLKIEIPANRYDLLCIEGLARALRIFLQKDIPPSYKLDIPEKLQEV
                     YVEASTAPLRPYFASAVLRLARPMNQLEYESFIDLQDKLHQNLCRMRKFVAIGTHDLD
                     TIEGPFRYMCKDPKQIKFAPLNRDTEHTAEELMTIYEADRHLAKHLHLIRDAPAYPII
                     YDSKDRVLSMPPIINSQRSKIVPGKTTNIFIDTTATDKTKLDIVINMVCAMFAEYCRV
                     PFYIEPVRVHMPDGTSHITPPLEPRATTASSSYINAATGLALSRQEICTLLTRMSLSA
                     TPSPSNEDLLDVLVPCTRPDILHECDIMEDAAIAYGFNKLPREMPTTNTVAKAFPVNK
                     LGDIIRKECAMAGWVEALPLILCSHDENFAWLNRPDPGHYAVHLANPKSLEYQVVRTS
                     LLPGMLKTARENKALPLPMKIFEVSDVAIQDSTEERQARNYRRLCAVYMDRKAGFEVA
                     HGLLDRVMQILGVPLLERKENEGNYGYYIASADDPTYLPGRAAHVFYRPKPTVQPSEP
                     TPSAPPSNPIQSFTSDLKAALHAEKGSSWERDIDIGSLGILHPSVLDNFELIRPCSAL
                     EIDVEPLL"
     gene            complement(1198826..1201744)
                     /locus_tag="CNC03860"
                     /db_xref="GeneID:3256288"
     mRNA            complement(join(1198826..1199097,1199147..1199219,
                     1199273..1199562,1199610..1199691,1199748..1199866,
                     1199929..1200055,1200105..1200175,1200224..1200514,
                     1200571..1200615,1200673..1200758,1200808..1201017,
                     1201068..1201211,1201273..1201453,1201507..1201744))
                     /locus_tag="CNC03860"
                     /product="adrenoleukodystrophy protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545813|gb|CF691654.1,gi|41545819|gb|CF691660.1"
                     /transcript_id="XM_569624.1"
                     /db_xref="GI:58264935"
                     /db_xref="GeneID:3256288"
     CDS             complement(join(1198853..1199097,1199147..1199219,
                     1199273..1199562,1199610..1199691,1199748..1199866,
                     1199929..1200055,1200105..1200175,1200224..1200514,
                     1200571..1200615,1200673..1200758,1200808..1201017,
                     1201068..1201211,1201273..1201453,1201507..1201720))
                     /locus_tag="CNC03860"
                     /codon_start=1
                     /product="adrenoleukodystrophy protein"
                     /protein_id="XP_569624.1"
                     /db_xref="GI:58264936"
                     /db_xref="GeneID:3256288"
                     /translation="MPSSHIVPLTKDTLRSRFKFILNSYLQHRPIFQRAFTAAFVIYC
                     LISTYGSLTGRGAKGAPGGKGNGKRDKGAKHGITGSIKDPLFHVRLKRLIRIVIPSLK
                     SKEAAMLALHSAFLVGRTGLSLYVADLDGRIVSSLVTANPHAFLMNIARWLLVAIPAT
                     YTNSMLEYLQSELGLAYRTRLTKYALTMYLDPPGVESGGDKDGEQLFYKLANLDDRIK
                     NADQYLAEDIQQLSSKLAEIYSNIAKPVLDVILYNYQLSRNVGAESLVLLTILVQTSA
                     TLLRAITPPFGAYTAHEAKLEGELRFTHSRLLESAEEVALYHGEEFEKNVIERGYFAL
                     VKHINRILKIRVGHGMAEEGVIKWLWGSLGLCICAIPVFGGSALGMKEGDLGSRTEGF
                     VTNRRLLLSSSDAFGRVMYSYKDMAELAGYTSRVSELFETMEHAKKGEYQKKLVSSVS
                     TENNAKILQGRGKIIESDEIEFDQVPLISPNGDVLVKSMSFHVKPGKHLLVIGPNGCG
                     KSSLFRILGGLWPVYGGTVYKPPSNQFTYIPQRPYLCTGTLRDQIIYPHSHADMLSHG
                     KSDEDLSKILEVVEMAGIIEREGGWDAVREWRDTLSGGDKQRIAMARLFYHKPKYAIL
                     DECTSAVTLEIEKTMYDHATSLGITLMTVSHRPSLWKFHTMVLEYDGQGGYTFTHLDA
                     EKRLALQEEKQELEHKLLSVPKLKDRLEELKMIKEQREFTSGI"
     STS             1200933..1201744
                     /standard_name="Hind3"
                     /db_xref="UniSTS:470762"
     gene            complement(<1202879..1204335)
                     /locus_tag="CNC03870"
                     /db_xref="GeneID:3256193"
     mRNA            complement(join(<1202879..1203338,1203392..1203928,
                     1203981..1204170,1204258..1204335))
                     /locus_tag="CNC03870"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41565284|gb|CF711125.1"
                     /transcript_id="XM_569998.1"
                     /db_xref="GI:58265683"
                     /db_xref="GeneID:3256193"
     CDS             complement(join(1202879..1203338,1203392..1203928,
                     1203981..1204170,1204258..1204315))
                     /locus_tag="CNC03870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569998.1"
                     /db_xref="GI:58265684"
                     /db_xref="GeneID:3256193"
                     /translation="MPTKLPRIHTTGWIGLGAMGHPMALNLFLKTHQFYQKVSPSVTP
                     TFLFCEHEDSRAESFIRELRNRGGQDLASRAERVGTGKEMVMGASKVFTMLPSTPQVQ
                     AVYLDQDNGILAGLAKLPMDTPPLSETLLLSDTSLLSNTVTQEEGVKKESPSMIDAST
                     PATQPIHVHTMLVDQTTLDPTVSLSISSLIHDSTSRAALMIDAPVSGGTVAAERGELT
                     IMFGSPAPIATRLAMPLLQMMAREGGVIECGGSGTGVGVKVCNNLVLASNQIALSEGL
                     ALGRSLNIDIALLQSVINTSSGSSWSSRVNPPISSIPGTPASRGYSGGFQTRLMLKDV
                     NLALQAANKHNLATPLTSASKSIYEAICSDGDGDWASKDFSWVKSMLEIDKTESFFSV
                     AYEWVQKKQQEAMDMAWKDGLP"
     gene            1204554..1206483
                     /locus_tag="CNC03880"
                     /db_xref="GeneID:3256227"
     mRNA            join(1204554..1206152,1206201..1206483)
                     /locus_tag="CNC03880"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41560477|gb|CF706318.1,gi|41560482|gb|CF706323.1,
                     gi|41563032|gb|CF708873.1,gi|41568902|gb|CF714743.1,
                     gi|41568911|gb|CF714752.1"
                     /transcript_id="XM_569625.1"
                     /db_xref="GI:58264937"
                     /db_xref="GeneID:3256227"
     CDS             join(1204578..1206152,1206201..1206392)
                     /locus_tag="CNC03880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569625.1"
                     /db_xref="GI:58264938"
                     /db_xref="GeneID:3256227"
                     /translation="MPRSPSPPPRLPRRPFIEDSPQRFRDRDPRDDYRYRGEPSRYRG
                     PAGFDRDRRDPRDRDWRDRDVERDYDRGSRFGGRQSWYARDRDAERMRERDDRDRIRS
                     PLPVRPGISLIDRDERPRDERPRESIEGSTKARSEGTPEEGQITSPVVAPPTISGLPP
                     RPRSPPRSPPRRRSRSPPPFRRFDRESWRDRERDRERDRFYRRRSPSPYSPIRRRRSP
                     SVSSASTPSRSSRFSPIKRGISPAERSRYTRSPMSEKPQRLTSPEPMSPIDHSRPLSR
                     TSVSGPTRPQTPTSLPPTLSTPQQPAPALAHTQPLSTPSVSTFPKRPPPTGPRSERLG
                     LVPPTGPRALAHLYGGRPAAPRVPYATPIAGLSSTNPTPTATVKNDFHASTTPETPTA
                     TFGAHAPPTGPSSGRLSWSERKNVLSQPHPISTSEQTSNFNPYAPLPSYNGQAANRRG
                     DSSSPAPAPHPSSSVSTTPLPRILTPAAEESPNVEESVVAEEELAERKAKEEQARILA
                     ELPPVLIGFGGSAWETELASHMHHYTSLVQNTLRLQAAQRLAAASLADAEAERVAVME
                     RSKICDEQLMSGTLGVGIIGGI"
     gene            complement(1206586..1208116)
                     /locus_tag="CNC03890"
                     /db_xref="GeneID:3256379"
     mRNA            complement(join(1206586..1206691,1206745..1206818,
                     1206870..1207891,1207941..1208116))
                     /locus_tag="CNC03890"
                     /product="transcription initiation factor TFIIE alpha
                     subunit, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41551574|gb|CF697415.1,gi|41560748|gb|CF706589.1,
                     gi|41560754|gb|CF706595.1,gi|41570469|gb|CF716310.1,
                     gi|41570474|gb|CF716315.1"
                     /transcript_id="XM_569626.1"
                     /db_xref="GI:58264939"
                     /db_xref="GeneID:3256379"
     CDS             complement(join(1206665..1206691,1206745..1206818,
                     1206870..1207891,1207941..1208068))
                     /locus_tag="CNC03890"
                     /codon_start=1
                     /product="transcription initiation factor TFIIE alpha
                     subunit, putative"
                     /protein_id="XP_569626.1"
                     /db_xref="GI:58264940"
                     /db_xref="GeneID:3256379"
                     /translation="MSNPQLSSDEIQKLCSDLVYQVAYSFYDVPYIIILKMLVQYNVM
                     TEIDLGQRVGLSPNEVRKYMGTLHLHRLVKRHVNREKQILPEWKKSQLSTQAMRQSYS
                     SNKPPIGDSRTRDVHYWYLDYREFANVTKYRLAMMRKGIDERIKSEVGQRGYQCPQDG
                     RVYDTLDVGHLFDPTTSTFRCEDCQAELIEHDPTIDQENNSSLQDMMQRFNIATAPIR
                     DALKAVEVLTLPSTNVIAWIAQNVKTGVVSVNGQEGGEDSKKFEVVIGGEDDEAKEKL
                     AQAQREQNALPEWYTHSTVTGDATTLGINDINQRAKVAERAKHVGDHETEVGDQALAA
                     HYELLDEEDDVEEVGVDINEGVQLDTVERRDEAEVEEVPAGESLGKTVFVNGQMKKIE
                     DVTEDDQELMTSEEYEAYAQAMYG"
     gene            complement(1209124..1210761)
                     /locus_tag="CNC03900"
                     /db_xref="GeneID:3256456"
     mRNA            complement(join(1209124..1209309,1209361..1210050,
                     1210104..1210761))
                     /locus_tag="CNC03900"
                     /product="cytochrome c oxidase biogenesis-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532080|gb|CF677921.1,gi|41532083|gb|CF677924.1,
                     gi|41535288|gb|CF681129.1,gi|41535297|gb|CF681138.1,
                     gi|41537534|gb|CF683375.1,gi|41537539|gb|CF683380.1,
                     gi|41554069|gb|CF699910.1,gi|41554079|gb|CF699920.1,
                     gi|41560608|gb|CF706449.1,gi|41560618|gb|CF706459.1"
                     /transcript_id="XM_569627.1"
                     /db_xref="GI:58264941"
                     /db_xref="GeneID:3256456"
     CDS             complement(join(1209190..1209309,1209361..1210050,
                     1210104..1210679))
                     /locus_tag="CNC03900"
                     /codon_start=1
                     /product="cytochrome c oxidase biogenesis-related protein,
                     putative"
                     /protein_id="XP_569627.1"
                     /db_xref="GI:58264942"
                     /db_xref="GeneID:3256456"
                     /translation="MFGLRIGTATLSASQAVRSANSMPTSRKLSTLISTFTPRSALVS
                     SIERPSLASSKAVRQNQLRLLSSATITQTAVDSQLASPVDLPLEPLHEPLLQPASTFL
                     DPLIHPLSEALLSIPHPLGYGTTLILLTVIVRTAFTLPVSLWQKKRAKKMQSVVAPEM
                     KVINEQLAETVAKECRKKGVGYAEYLIELRRQLRKAQKAVHKKHNIHPWVTTWAPLVA
                     HIPIFVTLSLTIRRALDLPGSPMASESFLWLDSLGQADGYGILPLVGMAVAFGNAEVV
                     GRRVKDVRDALEGKVSNEKKAGLSATPVPQSRRIPKPESPKGDINARPSPLFARSPPA
                     NTGPTSHNNQTRSLSTSNSLNVQRQARWKAPTNSLIKEKDDGFVEVGPNDKPPTFSLA
                     RQAEFRRSIFANILRFSAIGFAMIASQMPSGVVLYWFTSLCYSFIQNFFLTVLPQLRL
                     EKQRKEEAVSN"
     STS             1210978..1211796
                     /standard_name="Bgl2"
                     /db_xref="UniSTS:470759"
     gene            1211280..1211958
                     /locus_tag="CNC03910"
                     /db_xref="GeneID:3256294"
     mRNA            join(1211280..1211355,1211410..1211497,1211545..1211641,
                     1211695..1211958)
                     /locus_tag="CNC03910"
                     /product="transcription initiation factor tfIID, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41572923|gb|CF718764.1,gi|41572929|gb|CF718770.1"
                     /transcript_id="XM_569996.1"
                     /db_xref="GI:58265679"
                     /db_xref="GeneID:3256294"
     CDS             join(1211426..1211497,1211545..1211641,1211695..1211858)
                     /locus_tag="CNC03910"
                     /codon_start=1
                     /product="transcription initiation factor tfIID"
                     /protein_id="XP_569996.1"
                     /db_xref="GI:58265680"
                     /db_xref="GeneID:3256294"
                     /translation="MDEEQARRFDTFSTVAINKNAIKRLNRDLFDQHCPPQLSQVVAG
                     MAKVFVADVIEMAKDLQPHSAHPTGPLQPYHLKLARMCLEEQGMVGSRTQGSASGLRK
                     GKALFRRR"
     gene            1212199..1216735
                     /locus_tag="CNC03920"
                     /db_xref="GeneID:3256676"
     mRNA            join(1212199..1212567,1212615..1212640,1212715..1212787,
                     1212837..1212938,1212987..1213391,1213440..1213518,
                     1213570..1213687,1213738..1213768,1213835..1213903,
                     1213952..1213986,1214405..1214589,1214641..1214713,
                     1214760..1214879,1214922..1214956,1215011..1215399,
                     1215450..1215482,1215539..1215580,1215637..1215785,
                     1215847..1215912,1215961..1216130,1216196..1216216,
                     1216272..1216735)
                     /locus_tag="CNC03920"
                     /product="DNA supercoiling, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539472|gb|CF685313.1,gi|41539478|gb|CF685319.1,
                     gi|41572194|gb|CF718035.1,gi|41572202|gb|CF718043.1"
                     /transcript_id="XM_569997.1"
                     /db_xref="GI:58265681"
                     /db_xref="GeneID:3256676"
     CDS             join(1212230..1212567,1212615..1212640,1212715..1212787,
                     1212837..1212938,1212987..1213391,1213440..1213518,
                     1213570..1213687,1213738..1213768,1213835..1213903,
                     1213952..1213986,1214405..1214589,1214641..1214713,
                     1214760..1214879,1214922..1214956,1215011..1215399,
                     1215450..1215482,1215539..1215580,1215637..1215785,
                     1215847..1215912,1215961..1216130,1216196..1216216,
                     1216272..1216694)
                     /locus_tag="CNC03920"
                     /codon_start=1
                     /product="DNA supercoiling"
                     /protein_id="XP_569997.1"
                     /db_xref="GI:58265682"
                     /db_xref="GeneID:3256676"
                     /translation="MTIGTIKPRRSLGAIIDSIPSQQEYVPDSCSENSGSDSERDAPI
                     PTLKPIPLTPLPPRSARLISELGADPIKIGKKNEREEARAVPGDGKIDTKVHGAVDTL
                     LAPVLYFAVQWRKPQFKKHKTWDGDANIKVEGNRIVMLDEDGNQMAATNVGDKVIKPE
                     AEFKIGGYEIMVDHVLQQDQFKASTSILNRPKVIPTIKSTGYRPASFTKPFRPPIQKA
                     NLTPAKPSTMEIVNNEQHQSPISSSSKRSIPTPAAAQRAVAASSFYTRQSPKPFNERI
                     VLGEKSNKERLQWGGALFNPHAEGAVVMPRPGEKLAKLKGTTIVDVVLDPVLGNLLRD
                     HQKEGVKFMYSCVMGMTGAEGEGCILADEMGLGKTLQTIALIYTMLKQSPFANQTSII
                     GKAIIVCPVTLVDNWRKEFKKWVDRRVNVLVADVLSGTPVQNDLGEYWAMVNFACPGV
                     LGKYSAFAKHYEKPILKSRTPNCSAKDVELGRERANDLAKLSKEFVLRRTAAVLENYL
                     PPKYEYVIFIAPSLLQLSVLSNLLDPNIVGSFIRGYGAQSLALIDLMRKISNSPMLLK
                     RRDDELARANDDLGSATSAAISAIPSDANINDVTTSGKMLMLDKMLHSIYQCTEEKVV
                     VVSNWTSTLDLIQGLCKLKRYNYLRLDGSTPPKQRQELVDRFNKDKGRQESFVFLLSA
                     KAGGVGLNLIGGSRLILFDSDWNPSTDLQAMARIHRDGQKRPVYIYRFLTTNAIDEKI
                     YQRQITKTGLSDQMMDQTRTEKQTSKDSFSAAELRDIFTLNVRTDGCQTHDLLGCQCT
                     RKPVGETRDIAEGEHNSKDLPDNASEESDNDENDHPTFVSANKYDPEPTPKMRRKAIQ
                     EQKNKLAALKHWAHFDPFEPASFRGIQDSLLYNVLFDSWETDSAPLSQNIKTYGSLAF
                     ESPHERHEDDLDSDEEVLVPKKRKSGIVRSGVMLKKARAADEENTGFSQRRHNLRSIA
                     ESGGTGRVTFVFEKISKSTIA"
     STS             1212601..1213531
                     /locus_tag="CNC03920"
                     /standard_name="Stu1"
                     /db_xref="UniSTS:470760"
     STS             1218659..1219360
                     /standard_name="Pst25"
                     /db_xref="UniSTS:470758"
     gene            complement(1218789..1222036)
                     /locus_tag="CNC03930"
                     /db_xref="GeneID:3256310"
     mRNA            complement(join(1218789..1219052,1219104..1219244,
                     1219303..1219498,1219559..1219691,1219752..1219926,
                     1219981..1220078,1220128..1220279,1220335..1220431,
                     1220501..1220522,1220574..1221346,1221406..1221448,
                     1221506..1221594,1221653..1221668,1221759..1221770,
                     1221830..1222036))
                     /locus_tag="CNC03930"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537926|gb|CF683767.1,gi|41537932|gb|CF683773.1,
                     gi|41539742|gb|CF685583.1,gi|41539751|gb|CF685592.1,
                     gi|41548886|gb|CF694727.1,gi|41548889|gb|CF694730.1,
                     gi|41549433|gb|CF695274.1"
                     /transcript_id="XM_570008.1"
                     /db_xref="GI:58265703"
                     /db_xref="GeneID:3256310"
     CDS             complement(join(1218973..1219052,1219104..1219244,
                     1219303..1219498,1219559..1219691,1219752..1219926,
                     1219981..1220078,1220128..1220279,1220335..1220431,
                     1220501..1220522,1220574..1221346,1221406..1221448,
                     1221506..1221594,1221653..1221668,1221759..1221770,
                     1221830..1222019))
                     /locus_tag="CNC03930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570008.1"
                     /db_xref="GI:58265704"
                     /db_xref="GeneID:3256310"
                     /translation="MDFYPPQLAGQSSTTTSLEHLGSSTQANQQPVTPDTVTTENKRK
                     KRTGSSGKDGTKIKKTRQSQSCDACRARKVKCDRPPPGKETDGPIKNMCSHCAQLNLP
                     CTFDYVQRKRGPPNMYLKRIQEDQQVECNENGKSISSTVGSSKFSSEVPATIPRAPPP
                     LQAALRGTPPATSDNTSSEWQPTLGMTMSTTRAAHAGHYPIMSISASSSPSVQAATVP
                     LGLSPLRSRSYLPVSLDPSHSLATSQTPSAQSSPLHLPQHLAYINHTYDPRNPLDSVL
                     PRRLLYHIIDLYFDYIYCLIPCLHRPSFIHDLNTKREENPDQEEWVILVLAVVASTLV
                     QLPRSFVDLPRNEVKDLVLRCHNRIKDYLARDFDTITVTRTIIIYLSLYVYGITGHIV
                     VSHGLFGQNYVFMLALRAHEEGTYATLGNIERVLLRRMFWLMYGGDKTLAFTGAFPVL
                     FHEDDCASVALPDDIDDEYLTEEGYTKQPESYTSVLSGFRYISHLFRVSGEVLDKRRR
                     DKIRSPSGLMLQMRINEINELYNRTMSIMDFCPAPLKLDYRSASASVMSMSPDWDERI
                     KSDIHTIFSDPNEHDMDLVKDFYLVQQANIYVTQQLVRFIIIQYREELLEIQQDEAHH
                     GLDLAQREAMKRSIREQTQDEKDEVVVDMLSILQKIPIQVLAVNSFTIIEKVRSVASS
                     LLDFLDHGEDMGLLPLSSHETRAQKAQRNLWKFLNYLSEIESMYSWHDEKGTGKGF"
     STS             1220242..1220597
                     /standard_name="Tru1"
                     /db_xref="UniSTS:470761"
     gene            complement(1222782..1226491)
                     /locus_tag="CNC03940"
                     /db_xref="GeneID:3256693"
     mRNA            complement(join(1222782..1222914,1222973..1224192,
                     1224245..1224719,1224775..1224874,1224931..1226491))
                     /locus_tag="CNC03940"
                     /product="PM-scl autoantigen, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532073|gb|CF677914.1,gi|41556974|gb|CF702815.1,
                     gi|41556978|gb|CF702819.1,gi|41570496|gb|CF716337.1,
                     gi|41570499|gb|CF716340.1"
                     /transcript_id="XM_570007.1"
                     /db_xref="GI:58265701"
                     /db_xref="GeneID:3256693"
     CDS             complement(join(1222817..1222914,1222973..1224192,
                     1224245..1224719,1224775..1224874,1224931..1226088))
                     /locus_tag="CNC03940"
                     /codon_start=1
                     /product="PM-scl autoantigen"
                     /protein_id="XP_570007.1"
                     /db_xref="GI:58265702"
                     /db_xref="GeneID:3256693"
                     /translation="MSKATSGEASVPSPTQSFSEYLPFLTAALDRLTTNAASLPDKTD
                     LNFHRSLDRRFNKDVEKTSERLLGMTERILDLIERSQKEARQGRDKGKTAKVMIRRRK
                     LEDQDDIIDGYRGAVQGVIDGLLEDAVRRSLPLCPCCSNISKDINLDELRGGKGKTSV
                     TVKPALVAQAGKKVSESHYTLACYAHHIVQIPGPFTERLPANIIHASDLTKPQLLFHD
                     APDNARTSESWKPSLTTKPHAMVPLGFKAPLDYELTSEEEMDPSKAALRREKEIRART
                     HPYYYETKHLPYPTSLFIDSKPVPPQSFDETPFEFVDTPEKLHRMVEKLKQAKEIAVD
                     LEHHDMRSYAGFTCLIQISTRESDWVVDTLALRKEIQQDKFGDVFTDPTIVKVFHGAD
                     SDIIWLQRDFEIFVVNLFDTYSACVVLEMPQRSLSALLQHYCNFEADKRYQRADWRIR
                     PLPDGMLYYARSDTHFLLFIYDNLRNALLHKSSRPSSPANCGTIVLDSARPNPQEAMR
                     EVLGKSADTALKMYERDSYDIVTGRGSGGWLAAGKKWLPKGEIEQESGWVWRHLHDWR
                     DRVAREMDESPFYIMPNNMLRDVSTADNTANLSRIIRRDRAPIAAQYIPEITSIIVAA
                     KEKFKEITAERAANPQVQEMEKIGVKEIGANDVKKVPVAALAVPSVPLASTTSNIWDV
                     AAKPTSTRTNAKSGLFGSAIKFSQPKHASGYITASKSGQSALFGVTLDRASNQKSSSA
                     ALTLRERELSPGFLKVMESMRMDLHPKGMTSGSSEGDGKMGLNPETVPFIPSNQRKTT
                     ATSSLEVRGKRPLGLTSESAHPQSGQKASSSTAYAPTSGIPSTLIKEMSPQKSSKSGT
                     VDEGVVQVKKSKKQKKRERASTTDRAGDDSDSKKAKLGTDGDGEFGAATPPAQAVIPS
                     VELLNTVIVGEGGNANKSTASKNKKKKVKPEDIPAFDYASQPNLLDQPHSVIAQDDAK
                     KKKKKFKEARPSGAGIVEVPTFGARPARDLSQPKQGNKSGTFAR"
     misc_feature    1227076..1227129
                     /note="AT_rich"
     gene            1227662..1229773
                     /locus_tag="CNC03950"
                     /db_xref="GeneID:3256547"
     mRNA            join(1227662..1227795,1227859..1227955,1228011..1228243,
                     1228297..1228739,1228802..1228876,1228942..1229172,
                     1229224..1229249,1229304..1229479,1229528..1229773)
                     /locus_tag="CNC03950"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530368|gb|CF676209.1,gi|41530374|gb|CF676215.1,
                     gi|41566961|gb|CF712802.1,gi|41566967|gb|CF712808.1,
                     gi|41567277|gb|CF713118.1,gi|41567279|gb|CF713120.1,
                     gi|41571226|gb|CF717067.1,gi|41571238|gb|CF717079.1"
                     /transcript_id="XM_569628.1"
                     /db_xref="GI:58264943"
                     /db_xref="GeneID:3256547"
     CDS             join(1227718..1227795,1227859..1227955,1228011..1228243,
                     1228297..1228545)
                     /locus_tag="CNC03950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569628.1"
                     /db_xref="GI:58264944"
                     /db_xref="GeneID:3256547"
                     /translation="MFALKFILITSFIASTALAHFTLDFPESRGFVSDIEGQFCGGFS
                     TVGPRQPFPLGSGPVHINSHHSLATVVAFISTSSNPTSFDDFNTTSNGTIIPLASNIF
                     QVTQGEKCFNIDLESLNVGLTNGSEVTLQIQYDGGDGDLYQCSDLVLIQGYEVPSNET
                     CTDDASRTSNASSTSSGSATATSAAATSSSSGTSGAIKEVVGLGALSLALGIAGLIIL
                     "
     misc_feature    1228665..1228686
                     /locus_tag="CNC03950"
                     /note="AT_rich"
     gene            1232478..1234769
                     /locus_tag="CNC03960"
                     /db_xref="GeneID:3256556"
     mRNA            join(1232478..1232769,1232821..1233032,1233085..1233181,
                     1233233..1233349,1233401..1233805,1233859..1233995,
                     1234042..1234224,1234277..1234519,1234570..1234769)
                     /locus_tag="CNC03960"
                     /product="phosphate transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530149|gb|CF675990.1,gi|41533336|gb|CF679177.1,
                     gi|41533351|gb|CF679192.1,gi|41534370|gb|CF680211.1,
                     gi|41534372|gb|CF680213.1,gi|41535250|gb|CF681091.1,
                     gi|41535255|gb|CF681096.1,gi|41536654|gb|CF682495.1,
                     gi|41536663|gb|CF682504.1,gi|41536922|gb|CF682763.1,
                     gi|41536932|gb|CF682773.1,gi|41545785|gb|CF691626.1,
                     gi|41545794|gb|CF691635.1,gi|41545896|gb|CF691737.1,
                     gi|41545903|gb|CF691744.1,gi|41547820|gb|CF693661.1,
                     gi|41547826|gb|CF693667.1,gi|41547917|gb|CF693758.1,
                     gi|41547925|gb|CF693766.1,gi|41548417|gb|CF694258.1,
                     gi|41549907|gb|CF695748.1,gi|41550943|gb|CF696784.1,
                     gi|41550945|gb|CF696786.1,gi|41551538|gb|CF697379.1,
                     gi|41551547|gb|CF697388.1,gi|41552781|gb|CF698622.1,
                     gi|41552789|gb|CF698630.1,gi|41554167|gb|CF700008.1,
                     gi|41554175|gb|CF700016.1,gi|41555402|gb|CF701243.1,
                     gi|41555409|gb|CF701250.1,gi|41559272|gb|CF705113.1,
                     gi|41559281|gb|CF705122.1,gi|41562525|gb|CF708366.1,
                     gi|41562531|gb|CF708372.1,gi|41563320|gb|CF709161.1,
                     gi|41563327|gb|CF709168.1,gi|41564836|gb|CF710677.1,
                     gi|415"
                     /transcript_id="XM_569629.1"
                     /db_xref="GI:58264945"
                     /db_xref="GeneID:3256556"
     CDS             join(1232634..1232769,1232821..1233032,1233085..1233181,
                     1233233..1233349,1233401..1233805,1233859..1233995,
                     1234042..1234224,1234277..1234519,1234570..1234707)
                     /locus_tag="CNC03960"
                     /codon_start=1
                     /product="phosphate transporter"
                     /protein_id="XP_569629.1"
                     /db_xref="GI:58264946"
                     /db_xref="GeneID:3256556"
                     /translation="MSSQFEVEKAHANVPMSAGERRRAALAEIDEASFSWFHAKACIV
                     AGVGFFTDAYDIFSISIAATMIGYVYHNGGSNTSNQDLGIKVAHSIGTFFGQLLFGYL
                     ADHIGRKRMYGVELIIIIIGTLGQAVAGHAPGVNIYGVLIMWRFIMGIGIGGDYPVSS
                     VITSEFAARKIRGRMMAAVFSAQGWGNFTCAIVAVIVVAAYKDSIHSQPLDDLKSVDQ
                     AWRLIIGIGCVPAVIALYFRLTIPETPRYTMDVERNIKQASQDVDAYITTGQYIADPV
                     QINDRAEVPKASWSDFARHFGQWQNGKVLLGTSWSWFALDIAFYGLGLNSSTILSTIG
                     FGSSTDLPTKQENIYQTLYNVAVGNIILAVGGLIPGYYFSMAFIDSWGRKPIQLMGFV
                     LLTIIFVCMGFGYDKMLSTDPGKKAFVFLYCMANFFQNFGPNTTTFIVPGEVFPTRYR
                     STAHGISAASGKLGAIVAQVGFSRLINIGGTNQFLKHILEIFAFFMLTGVFSTLLLPE
                     TKNRSLEDLSQEDQESFVRNSGTATAVPMVQKTGTSSDDERVLAEAL"
     gene            complement(<1236580..>1237754)
                     /locus_tag="CNC03970"
                     /db_xref="GeneID:3256792"
     mRNA            complement(join(<1236580..1236668,1236723..1236983,
                     1237037..1237221,1237282..1237428,1237480..1237535,
                     1237587..>1237754))
                     /locus_tag="CNC03970"
                     /product="nicotinate-nucleotide diphosphorylase
                     (carboxylating), putative"
                     /transcript_id="XM_569630.1"
                     /db_xref="GI:58264947"
                     /db_xref="GeneID:3256792"
     CDS             complement(join(1236580..1236668,1236723..1236983,
                     1237037..1237221,1237282..1237428,1237480..1237535,
                     1237587..1237754))
                     /locus_tag="CNC03970"
                     /codon_start=1
                     /product="nicotinate-nucleotide diphosphorylase
                     (carboxylating), putative"
                     /protein_id="XP_569630.1"
                     /db_xref="GI:58264948"
                     /db_xref="GeneID:3256792"
                     /translation="MSETDLKPGQNLAHLLPPSWSAEVQRWFAEDTPSFDWAGFVVGE
                     EEQEAILWGKSGGVLAGVPFFEEVFKQVDCAVEWLMPEGSVVPPDTKTKVAIVRGKAR
                     QLLLGERVALNTLARCSGIATVSRRFRDLARAEGWKGVVAGTRKTTPGFRLVEKYGMM
                     VGGVDPHRHDLSSMVMLKDNHIWATGSITSAIQTVRRVAGFSLLVNVECQNFKEADEA
                     VTAGANIVMLDNMVGEDLHSAARRLKEKWQGQREFLIETSGGIIEGSLTGRVGPDIDI
                     LSTSAVHQSCPHVDFSLKIQPRKSS"
     STS             1236793..1237599
                     /standard_name="Pst4"
                     /db_xref="UniSTS:470719"
     gene            1237994..1239905
                     /locus_tag="CNC03980"
                     /db_xref="GeneID:3256628"
     mRNA            join(1237994..1238206,1238263..1238359,1238419..1238641,
                     1238691..1238840,1238895..1239079,1239128..1239199,
                     1239249..1239905)
                     /locus_tag="CNC03980"
                     /product="kynureninase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530418|gb|CF676259.1,gi|41530425|gb|CF676266.1,
                     gi|41534098|gb|CF679939.1,gi|41534110|gb|CF679951.1,
                     gi|41537108|gb|CF682949.1,gi|41540276|gb|CF686117.1,
                     gi|41548046|gb|CF693887.1,gi|41548053|gb|CF693894.1,
                     gi|41551844|gb|CF697685.1,gi|41551857|gb|CF697698.1,
                     gi|41557519|gb|CF703360.1,gi|41557524|gb|CF703365.1,
                     gi|41568831|gb|CF714672.1,gi|41568833|gb|CF714674.1,
                     gi|41573110|gb|CF718951.1,gi|41573121|gb|CF718962.1"
                     /transcript_id="XM_569632.1"
                     /db_xref="GI:58264951"
                     /db_xref="GeneID:3256628"
     CDS             join(1238089..1238206,1238263..1238359,1238419..1238641,
                     1238691..1238840,1238895..1239079,1239128..1239199,
                     1239249..1239765)
                     /locus_tag="CNC03980"
                     /codon_start=1
                     /product="kynureninase"
                     /protein_id="XP_569632.1"
                     /db_xref="GI:58264952"
                     /db_xref="GeneID:3256628"
                     /translation="MSNDLPTKKDLVKWDQEDALNWTRGEYEIPNSKACGGEADGKAI
                     YFCGNSLGLLNKKARQHIMEELDVWSTSSVTGHFNHPYQRPWKHVDEPLTPHLAKLVG
                     AREEEVAHTSTLTSNMHNLFTSFYQPTEKRWKIVIEKGSFPSDWYAVHSHPRLHDKVL
                     RPEQIDNAIIALVPREGEDTLRTEDILKVLDDNKDSIAIVWLPLVQYYTGQLFDISSI
                     SPKVHEIGALLGLDMAHGIGNVECKLNEWNVDFAVWCTYKYLNAGPAAIGGFYIRSGL
                     EDGGRRLAGWWGNDARTRFHMSPNFQPTPGAKGYQHSCTPVFSSIPLLATLQLIEAVG
                     FSNMVEKARRLTGTLEALLKASRYHVHPADPKGKIGFKIITPAAPYRGTQLSLVILPE
                     EEHVMPKVFDRMLRKGLVGDERKPSVIRLSPVVLYNTFEEVGRAVEIVEEALEEEEEE
                     RKR"
     gene            1240674..1242139
                     /locus_tag="CNC03990"
                     /db_xref="GeneID:3256675"
     mRNA            join(1240674..1240955,1241007..1241213,1241284..1241473,
                     1241528..1241748,1241798..1242139)
                     /locus_tag="CNC03990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569634.1"
                     /db_xref="GI:58264955"
                     /db_xref="GeneID:3256675"
     CDS             join(1240746..1240955,1241007..1241213,1241284..1241473,
                     1241528..1241748,1241798..1242049)
                     /locus_tag="CNC03990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569634.1"
                     /db_xref="GI:58264956"
                     /db_xref="GeneID:3256675"
                     /translation="MPAATISPKTLPPGVYCPTITFFEPTAEQNLDVETHVKHMEFLA
                     KSGLAGVVVQGSTAEAVTLDDEERKTLIRTAKEAFKRCGNHGPVIAGTVGAQSSRQAL
                     KLCQDAAEAGADFALVLPPSYYPAAMSADAIQSFFEELASASPIPIIIYSYPGVCSGI
                     NMDTDLICRLARHPNIAGVKHTDHDVGRIGRETAQSMGNAFGSPFTILGGASDYLLGT
                     VAVGGQGAITGMANVAPRVCVKAFELARAGRYEEALQYARVISTAEWGMGKGAILGTK
                     YMTAWANDYAPTAALARKPLPLCPESTKQHVRAVGTEIVALERSLEQQGWAGAAMRGE
                     TQSEKVLAPSKKINGIVNGAEEVAI"
     gene            complement(1242126..1243852)
                     /locus_tag="CNC04000"
                     /db_xref="GeneID:3256700"
     mRNA            complement(join(1242126..1242276,1242327..1242884,
                     1242930..1243084,1243148..1243354,1243401..1243654,
                     1243715..1243852))
                     /locus_tag="CNC04000"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544821|gb|CF690662.1,gi|41544824|gb|CF690665.1,
                     gi|41552972|gb|CF698813.1,gi|41552988|gb|CF698829.1,
                     gi|41576489|gb|CF722330.1,gi|41576494|gb|CF722335.1"
                     /transcript_id="XM_569636.1"
                     /db_xref="GI:58264959"
                     /db_xref="GeneID:3256700"
     CDS             complement(join(1242170..1242276,1242327..1242884,
                     1242930..1243084,1243148..1243354,1243401..1243654,
                     1243715..1243801))
                     /locus_tag="CNC04000"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_569636.1"
                     /db_xref="GI:58264960"
                     /db_xref="GeneID:3256700"
                     /translation="MPPHMTQATELIDWIVSNGGYFHPSAKLQVDESTGLSVFADNTI
                     KPEEKLVSCPFSLAVTSELATQAVCEIAGVEKGQLIWPKGHAKEGKPWNERMRIGAYL
                     GFHWIYQERPETEWPRSLVHKTYLASLPPASNLSTPLYFTESELQLLSGSNLLGAVED
                     RRKEWSAESAALRSVLKEDGLTWERYLATATYMSSRAFPSKLLDLPPDGEMTPQPTRI
                     DGVSKPALLPGVDIFNHARGQPILWLSSLVSIPNGSRGVPSISLVSSSVCESGSQLFN
                     NYGAKPNEELLLGYGFVLDSNPDDIVNLRLGIASLPEPINERLQSKGLDARERFELRR
                     NGEVDKRLLEIMRVLLGGGNVEDEVDDDDEHALHEKEEREMQLELDVLGMLGGMLEDK
                     LEKLRTGSQIKVVDAREEVRRMCAVYRQGQMDILNAAMDKLSDRIERIESLMDEGMGG
                     CPCCS"
     gene            <1244012..1244826
                     /locus_tag="CNC04010"
                     /db_xref="GeneID:3256726"
     mRNA            join(<1244012..1244142,1244352..1244449,1244499..1244718,
                     1244794..1244826)
                     /locus_tag="CNC04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_569638.1"
                     /db_xref="GI:58264963"
                     /db_xref="GeneID:3256726"
     CDS             join(1244012..1244142,1244352..1244449,1244499..1244718,
                     1244794..1244812)
                     /locus_tag="CNC04010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569638.1"
                     /db_xref="GI:58264964"
                     /db_xref="GeneID:3256726"
                     /translation="MTLLTRDLSATASNVHPRIIRPLQEKLAPKDLRQMQRTTFCAPR
                     AQGVTVVALLIYGSQELAAREKAGVVKRKDDRIVVYPQTSPSPAAPEPFVRSDEPSAL
                     PESLSSAVDAKSNAYPLRKEERMKVSEFAKRLKEAEALQKEEDVSRRRTDHRI"
     STS             1244345..1245182
                     /standard_name="D1S3695"
                     /db_xref="UniSTS:474273"
     gene            1245101..1247157
                     /locus_tag="CNC04020"
                     /db_xref="GeneID:3256759"
     mRNA            join(1245101..1245234,1245290..1245425,1245480..1245490,
                     1245542..1245622,1245679..1245752,1245800..1246032,
                     1246089..1246189,1246245..1246314,1246367..1246456,
                     1246516..1247157)
                     /locus_tag="CNC04020"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533743|gb|CF679584.1,gi|41533751|gb|CF679592.1,
                     gi|41545717|gb|CF691558.1,gi|41553192|gb|CF699033.1,
                     gi|41553204|gb|CF699045.1,gi|41554262|gb|CF700103.1,
                     gi|41554267|gb|CF700108.1,gi|41559935|gb|CF705776.1,
                     gi|41565079|gb|CF710920.1,gi|41565089|gb|CF710930.1"
                     /transcript_id="XM_569640.1"
                     /db_xref="GI:58264967"
                     /db_xref="GeneID:3256759"
     CDS             join(1245155..1245234,1245290..1245425,1245480..1245490,
                     1245542..1245622,1245679..1245752,1245800..1246032,
                     1246089..1246189,1246245..1246314,1246367..1246456,
                     1246516..1247088)
                     /locus_tag="CNC04020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569640.1"
                     /db_xref="GI:58264968"
                     /db_xref="GeneID:3256759"
                     /translation="MHQNNPYLKQKPDFARLASRYPKFAPFVSVSEDGYTSINFQDPT
                     ALRELTKCLLKEDWNLDVDLREDRLCPTIPNRLDYIYHVLDLEPHLPSSSLRPLRILD
                     IGTGATAIYPILLARLRPDSRIVATEIDESSYNHAKATLEKNNIPPSSITVLKSPTPD
                     PILFPLLECKGKSEDWDLTICNPPFFASSQEMLQGMELKDRQAHAAPTASDNELITRG
                     GELAFITSMIRESIDIGHKCTWYTTLVGKYSSLQPLIETLREFKIDNYFVINMKQSRT
                     SRWILGWSHTMTRLPDSITRPYAIMENTTFAQLLPSSNTVRFNAPPPVSLTTLKAKVL
                     DVLRTVALDPSKDSPDPSQYEGETQNSVLISPRINTWSRAARRMAARQESKAEPEGQG
                     EASKPLTLFRCRIKYVNSHTRPMDGSPSLEIDWLEGRREDREVWESFCNFLLSKLGLS
                     RKRQAEAESDGRPLKSSGRRFQGNYARGRMAM"
     gene            complement(1247147..1249758)
                     /locus_tag="CNC04030"
                     /db_xref="GeneID:3256496"
     mRNA            complement(join(1247147..1247618,1247667..1248866,
                     1248913..1248986,1249039..1249758))
                     /locus_tag="CNC04030"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41555785|gb|CF701626.1,gi|41555795|gb|CF701636.1"
                     /transcript_id="XM_570006.1"
                     /db_xref="GI:58265699"
                     /db_xref="GeneID:3256496"
     CDS             complement(join(1247180..1247618,1247667..1248866,
                     1248913..1248986,1249039..1249065))
                     /locus_tag="CNC04030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570006.1"
                     /db_xref="GI:58265700"
                     /db_xref="GeneID:3256496"
                     /translation="MFGGLKILDLSKNLLKGVPDALSDLLRLSSLDLSHNSLPSIPRS
                     VLLLPQLQVLDISHNSITTLSFDSPIGPSEEGLRYGSGFFTTAIQRQTALKSERPILP
                     VLRHLSLGSNTITQEGLKALASVNLKHMRVLNIENNNVSGVLDVQSLGISEKAMPELS
                     HLVLSGNINIRGLIGTIASAAKVDTIGCNLRQATPSFNHEDTSTVEDNQDKASSAVET
                     GPAANDEHTLPIPEPDLTIVYRTFPAATFDSEPLAVDFDLYLPSTPAGPSGHPLVIWF
                     HGGGLLQGNKENLPPHFRRLPSHAYTRGDGRPDESVAIISPNYRLAPQVSILDILSEV
                     TVLFDYIQTRLNDRLVKDGKGDHKIDVSRICLSGGSAGGYLALIAGLRVPDEVGDEEI
                     GAYRGLKNEAIKCLAPFYPITDLTDKFWATETNPVPWMNGNSISHAQAKPHIDTKAAP
                     VCSAVSGGPRSILYPYMLQHSLFPSLLFLTQRSVGQGLDAFRPSPLSLSIPHRLEIAS
                     KSSKAKYHVPIFFVYGTIDDKVQPMEKTIEALGRASGDLVIERVEGADHAFDEDPKVE
                     CQAFQEWLGKTLL"
     gene            complement(1249911..1252367)
                     /locus_tag="CNC04040"
                     /db_xref="GeneID:3256788"
     mRNA            complement(join(1249911..1250969,1251028..1251272,
                     1251324..1251731,1251795..1252367))
                     /locus_tag="CNC04040"
                     /product="folic acid and derivative biosynthesis-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530154|gb|CF675995.1,gi|41530165|gb|CF676006.1"
                     /transcript_id="XM_570005.1"
                     /db_xref="GI:58265697"
                     /db_xref="GeneID:3256788"
     CDS             complement(join(1249973..1250969,1251028..1251272,
                     1251324..1251731,1251795..1252352))
                     /locus_tag="CNC04040"
                     /codon_start=1
                     /product="folic acid and derivative biosynthesis-related
                     protein"
                     /protein_id="XP_570005.1"
                     /db_xref="GI:58265698"
                     /db_xref="GeneID:3256788"
                     /translation="MPPDTITISSLTLHLPHGLGPSAFHLTPSPPCPALLSLTIHLVP
                     NSVSATAAGDSMAGLGVNYSSVSKAVYALANDAEKVWSGPWELMRAVSAIPLGFDDVQ
                     SVDIRLGLPKALLHALEAVYKASYAKNGEETGRSCTIRDLKVVCIVGLHEHERKEKQR
                     LELDVKVRGGDWNVWGHKGFADEIYDFVSNSAYGTIESLNHELGQHLLKSRYLGDPTQ
                     SHLEITIRKPSAIPFATPSITIHRSQADYAPSLPSGTACNAPREALERVFVAVGSNIG
                     DRVANITRAVSLLEEAGCKLLGTSRLYESEPMYVEDQDRFINGVIELATPLEPLEVLR
                     LLKHIEKAVGRTKTFTNGPRVIDLDLVFYGHRVVKIGNETDEEDEHGIKWLECPHKRL
                     REREFVLRPLADIDPEFTHPALRRSVGQLLASLPTTFPPSLSPIIPLHSHSSPLRLSI
                     PASPYIMAIFNTTPDSFSDGDPARTNVEYALAACEKLLKGPEPPAILDIGGMSTRPGS
                     EPCSEEDELSRVIPLVKAIRSSSNPIVASIPISVDTYRPSVAKAAVEAGASIINDVRG
                     GQEPGMLRVMAEADVPVVLMHSRGDSKTMIAADVQDYDSHGGVIKGVIQEMRVLVEQA
                     LKSGVKRWNIILDPGLGFAKSSSQSLTLLKHLPDLVLPGTGLERLPMLVGASRKGFVG
                     QTIKRAVPKERSFGDAAVSGWCASSGVVDILRVHEPREMAEVVKMACAIRDAE"
     gene            1252557..1253675
                     /locus_tag="CNC04050"
                     /db_xref="GeneID:3256435"
     mRNA            join(1252557..1252575,1252634..1252663,1252725..1253097,
                     1253161..1253675)
                     /locus_tag="CNC04050"
                     /product="dephospho-CoA kinase, putative"
                     /transcript_id="XM_569643.1"
                     /db_xref="GI:58264973"
                     /db_xref="GeneID:3256435"
     CDS             join(1252569..1252575,1252634..1252663,1252725..1253097,
                     1253161..1253602)
                     /locus_tag="CNC04050"
                     /codon_start=1
                     /product="dephospho-CoA kinase"
                     /protein_id="XP_569643.1"
                     /db_xref="GI:58264974"
                     /db_xref="GeneID:3256435"
                     /translation="MLIVGLTGGIASGKSTVSKLLSERHHLPIIDADLIAREVIEPGT
                     SGYSLVVSHFGPDRILQEDGVSLDRGAIGDIIFHDPEERKWLNGVVHPRVKKEMVKRI
                     IRYWLNGEWCVIVDVPLLIEAGMWKWVGDTVVVYVNERLQLSRLLGRQSNPPLTQSQA
                     SSRIASQLPLSAKLSYATSVIDNSGSFSDLNDQVDRTVAKWKAQQGGDSGWWWRVCWL
                     VPPVGLAAGALSLLAVWRKGKKDRRRGRGEVSRRDNSEQASERIELMELKGGRRRTAS
                     GSVTDEE"
     gene            complement(1253735..1255299)
                     /locus_tag="CNC04060"
                     /db_xref="GeneID:3256171"
     mRNA            complement(join(1253735..1255074,1255125..1255299))
                     /locus_tag="CNC04060"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543294|gb|CF689135.1,gi|41543301|gb|CF689142.1,
                     gi|41549849|gb|CF695690.1,gi|41549857|gb|CF695698.1,
                     gi|41558228|gb|CF704069.1,gi|41558240|gb|CF704081.1,
                     gi|41561535|gb|CF707376.1,gi|41561543|gb|CF707384.1,
                     gi|41574027|gb|CF719868.1,gi|41574032|gb|CF719873.1"
                     /transcript_id="XM_569645.1"
                     /db_xref="GI:58264977"
                     /db_xref="GeneID:3256171"
     CDS             complement(join(1253902..1255074,1255125..1255172))
                     /locus_tag="CNC04060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569645.1"
                     /db_xref="GI:58264978"
                     /db_xref="GeneID:3256171"
                     /translation="MSEAGSASTPQSNATKDRHEPRGRKPNDQLPPSRAREVQRAFRL
                     RRAEHLASLEERILQLETENTQLRALLSLPAADRPKIGSGPTGRGKALKEGGVPMSER
                     VRARKEARERERRALGLPEADTTDMSEAERGNGRDSATLSPRATSGAGPSNATAAAHT
                     AQQQPNVPHLSNPQNVPALFNSPADVSPAPFNYQLPMPFNLPVSPDTQFADFTNNIDN
                     SLYKNNTTSATPNFGGMFSMFSSADHNGDSSANGSGVNKPSPISPPLTNPPHAPSPSQ
                     LDLLTRLKSCCHVSDSHVVNDPGLLVFATRLCQSFGCSFGGTHTEANPRSDAENLTLE
                     DAWHALKATLDPGGDADGENRINTGKMAAELVVRAAHSRGAGGWISCRYREGLSIRRN
                     MVQALVQGLGGKLD"
     gene            1255558..1257935
                     /locus_tag="CNC04070"
                     /db_xref="GeneID:3256626"
     mRNA            join(1255558..1255603,1255678..1255702,1255743..1256204,
                     1256258..1256411,1256468..1256660,1256712..1256742,
                     1256792..1257935)
                     /locus_tag="CNC04070"
                     /product="urea transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41550447|gb|CF696288.1,gi|41567389|gb|CF713230.1"
                     /transcript_id="XM_569647.1"
                     /db_xref="GI:58264981"
                     /db_xref="GeneID:3256626"
     CDS             join(1255587..1255603,1255678..1255702,1255743..1256204,
                     1256258..1256411,1256468..1256660,1256712..1256742,
                     1256792..1257799)
                     /locus_tag="CNC04070"
                     /codon_start=1
                     /product="urea transport-related protein"
                     /protein_id="XP_569647.1"
                     /db_xref="GI:58264982"
                     /db_xref="GeneID:3256626"
                     /translation="MGATGESFLPQVVGLFYATFDPSLGPVVRYQVPENLISDSTTEE
                     ARSPSNSRSRSRSRASRFVSPSPSPSPLPNRTLLNFGPISEYVIPKKSLHGRLVTLLT
                     TGTGCDEDEQAGYRVMGFPNVMTAPEGTYTRNEYMWNLCFVFHSSSSLEAFEPVVRKC
                     ARILRSAERDSAYLSKPSPDHTALPAVLEQLFEDLNSYSETSIPLDGFNSLELKLFPF
                     YPNPPDCDDWHVPVALVDLNAHKDDNWDITAARVCQFIDGVNHVKKIAELAKADEALT
                     RETLRHMLYYQVIMMARRIDIFQYSNMYTLKPIISRLSADETIISECACYVTRSGFPL
                     PDWPTLLQLYSRFQPGITVHDWIEAHEVLSMGIDPRRFVSFGIIKGFLRRVNRWPKLV
                     ERREPLIHVPEHRKRVGFDDSVRGNSSGFYRDRDRSQSQIHLYQQGHQHTSGFHPNDS
                     AASLSRGILGGESTFTLRSVGSNASLGVSPSSIPTRTPPSLHGRSPRRHPFAPSTAGT
                     GSTHTALPRSHVSAAESHPSTSSRRAIGGSITGTNTTGGLVPGGSGFNIRYGLNTRQR
                     EEAAAVKQAEELEEELIGFLDGSHHADEIQVRFGWSWGQLEKILGLDEMTGGMGRKGV
                     TVVYR"
     gene            complement(1258027..1259635)
                     /locus_tag="CNC04080"
                     /db_xref="GeneID:3256226"
     mRNA            complement(join(1258027..1258405,1258511..1258843,
                     1258916..1259297,1259379..1259635))
                     /locus_tag="CNC04080"
                     /product="galactinol synthase, putative"
                     /transcript_id="XM_569649.1"
                     /db_xref="GI:58264985"
                     /db_xref="GeneID:3256226"
     CDS             complement(join(1258090..1258405,1258511..1258843,
                     1258916..1259297,1259379..1259463))
                     /locus_tag="CNC04080"
                     /codon_start=1
                     /product="galactinol synthase"
                     /protein_id="XP_569649.1"
                     /db_xref="GI:58264986"
                     /db_xref="GeneID:3256226"
                     /translation="MVVSPPLTPGVQGSRAWVTLVTNPAYVAGLLTLHRTLSSLSAYP
                     LLVMTTPSLPATHSSLLRSLGLNLVPVSHLSPSSSQHPGFDPSFSRFNDAWTKLQVFG
                     LTEYDKVILIDCDMIFLKDMDELFDFELPGRDWIGASPACVCNPLKLGHYPKDWIPAN
                     CSLSMQQSPTSLTSPPIPSPSAPRTAHLLNSGLVILHPSSTVLASLIDFINTSPTIAH
                     VKFADQDVIAEAFKGRWRPLPWWCNALKTLRAVHKPLWRDEEVGIIHYILDKPWSARP
                     PSLPPHQHPSPALPPSPASLDGSDDGQASYHVKPQIRRRPLPSGLLDAVRNSPPQKSL
                     TDYSEVDAWWWIVYEDLLDDLKARGVDWEAVDKWVTR"
     gene            complement(<1260033..>1260182)
                     /locus_tag="CNC04090"
                     /db_xref="GeneID:3256581"
     mRNA            complement(<1260033..>1260182)
                     /locus_tag="CNC04090"
                     /product="cytochrome c oxidase chain I, putative"
                     /transcript_id="XM_569651.1"
                     /db_xref="GI:58264989"
                     /db_xref="GeneID:3256581"
     CDS             complement(1260033..1260182)
                     /locus_tag="CNC04090"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="cytochrome c oxidase chain I"
                     /protein_id="XP_569651.1"
                     /db_xref="GI:58264990"
                     /db_xref="GeneID:3256581"
                     /translation="MIKSMATRWLFSTNAKDIGTLYLIFAIFTGLLGTAFSVLIRLEL
                     SGAGN"
     gene            complement(<1261023..>1261653)
                     /locus_tag="CNC04100"
                     /db_xref="GeneID:3256602"
     mRNA            complement(join(<1261023..1261147,1261217..1261277,
                     1261356..1261454,1261516..>1261653))
                     /locus_tag="CNC04100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570045.1"
                     /db_xref="GI:58265777"
                     /db_xref="GeneID:3256602"
     CDS             complement(join(1261023..1261147,1261217..1261277,
                     1261356..1261454,1261516..1261653))
                     /locus_tag="CNC04100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570045.1"
                     /db_xref="GI:58265778"
                     /db_xref="GeneID:3256602"
                     /translation="MSQSKPPSPPLNIPSGNSQITPDPEPLKPDETLSGDKFHDFKAA
                     LRRIDPRQDLENIGKIPCARNSLLYGIAGGVGVGANPGWQPTGLLVASLQFLSFNARR
                     KELAQMRIIQERYPHRHVSKLQKNNQNSEAGQGEQQSS"
     gene            1261907..1263887
                     /locus_tag="CNC04110"
                     /db_xref="GeneID:3256614"
     mRNA            join(1261907..1262194,1262245..1262275,1262332..1262661,
                     1262722..1263034,1263084..1263321,1263372..1263887)
                     /locus_tag="CNC04110"
                     /product="AAA family ATPase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533198|gb|CF679039.1,gi|41533204|gb|CF679045.1,
                     gi|41560839|gb|CF706680.1,gi|41560846|gb|CF706687.1,
                     gi|41562688|gb|CF708529.1,gi|41562699|gb|CF708540.1,
                     gi|41575024|gb|CF720865.1,gi|41575033|gb|CF720874.1"
                     /transcript_id="XM_569653.1"
                     /db_xref="GI:58264993"
                     /db_xref="GeneID:3256614"
     CDS             join(1261998..1262194,1262245..1262275,1262332..1262661,
                     1262722..1263034,1263084..1263321,1263372..1263813)
                     /locus_tag="CNC04110"
                     /codon_start=1
                     /product="AAA family ATPase"
                     /protein_id="XP_569653.1"
                     /db_xref="GI:58264994"
                     /db_xref="GeneID:3256614"
                     /translation="MFRSSLPQRTSHNSASEAGPSIPTPIPTDGDAVTLENASNTTGE
                     ATLSSSGSSEGESLISKMMADNPYFSAGAGLMGIGVALTALRRSITLGATMAQRRMLV
                     TLEIPSKDRSYPWFLEWMAHQSAAQTRGNVKPPGLFGWGQGMRSHELAVETSYKQHEN
                     GASEAIFNLVPGPGTHYFKYGGAWFQVKRERDSKLMDLHSGTPWETLTLTTLSTSRDL
                     FSSLLEEARTLAEASTEGKTVVYTAWGVEWRPFGKPRRRREMGSVVLGKGIAEEIESD
                     LKGFLGRGKWYAERGIPYRRGYLLHGPPGSGKTSFIQALAGSLNYNICLMNLSERGLT
                     DDKLNHLLGLVPERSFVLLEDIDSAFNRRVQTSEDGYKSSVTFSGLLNALDGVASSEE
                     RIIFMTTNHYDRLDPALIRPGRVDIQQLLDDAAGEQAKRLFVKFYGNSVNEDGTKGRV
                     LREGELPLNDEEVESLGNSVQRIVDDERAHGKVVSMASLQGHFIRTGAKESLDGIREL
                     CRPREGQA"
     gene            1264077..1266187
                     /locus_tag="CNC04120"
                     /db_xref="GeneID:3256682"
     mRNA            join(1264077..1264301,1264367..1264569,1264621..1264901,
                     1264957..1265107,1265169..1265348,1265411..1265475,
                     1265542..1265739,1265818..1266187)
                     /locus_tag="CNC04120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569655.1"
                     /db_xref="GI:58264997"
                     /db_xref="GeneID:3256682"
     CDS             join(1264184..1264301,1264367..1264569,1264621..1264901,
                     1264957..1265107,1265169..1265348,1265411..1265475,
                     1265542..1265739,1265818..1266142)
                     /locus_tag="CNC04120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569655.1"
                     /db_xref="GI:58264998"
                     /db_xref="GeneID:3256682"
                     /translation="MSQSRARKVLIVGAGPVGALTALSLHRRGWEVEVWETRDDPRGQ
                     DAAPSNLRSINLAISSRGLEALRSVDPSIAENFLEEAIPMKGRMIHHTDGKQESQLYD
                     PIGGQSINSISRPILNQRLVQSLPEAVKLRFNTKLKHIDFKNRVAYASHKQETSLLPG
                     EESEKDKKQNTEDEDGTAFDLVIGCDGSWSKVRTAMMRAERIDFSQSFIPHAYIELHM
                     PSDPAFPGGYAMDKNHLHIWPRHAFMLIGLPNKDGSFTLTLFIPFSSLELLDTRESAA
                     AFFREHFPSAVDIVGEKVLLDDFEKNPRGNLVTINCTPSAWSSHAILLGDASHSMVPF
                     YGQGLNCGLEDVRVLSSILERHHISPTTTLALGETDPELELALKAYSDERQGDLKAIC
                     ELALQNYTEMRSHVLSPLHHLRRQVDKVFTTLFRSAPQATLSLMEPFPTKKVRGWTSL
                     YEMVTFRPDVGYSEALRKERWQKDVVGYAGWIGGVVGVGAAGVFAATMAKKWLERR"
     gene            complement(1266198..>1268165)
                     /locus_tag="CNC04130"
                     /db_xref="GeneID:3256307"
     mRNA            complement(join(1266198..1266986,1267034..1267616,
                     1267663..1267794,1267845..>1268165))
                     /locus_tag="CNC04130"
                     /product="Dihydroorotate dehydrogenase, mitochondrial
                     precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529917|gb|CF675758.1,gi|41529927|gb|CF675768.1,
                     gi|41529986|gb|CF675827.1,gi|41529994|gb|CF675835.1,
                     gi|41535078|gb|CF680919.1,gi|41536395|gb|CF682236.1,
                     gi|41536406|gb|CF682247.1,gi|41539267|gb|CF685108.1,
                     gi|41539277|gb|CF685118.1,gi|41541540|gb|CF687381.1,
                     gi|41541549|gb|CF687390.1,gi|41552318|gb|CF698159.1,
                     gi|41552330|gb|CF698171.1,gi|41555706|gb|CF701547.1,
                     gi|41555715|gb|CF701556.1,gi|41564118|gb|CF709959.1,
                     gi|41564125|gb|CF709966.1,gi|41567446|gb|CF713287.1,
                     gi|41567457|gb|CF713298.1"
                     /transcript_id="XM_569657.1"
                     /db_xref="GI:58265001"
                     /db_xref="GeneID:3256307"
     CDS             complement(join(1266247..1266986,1267034..1267616,
                     1267663..1267794,1267845..1268165))
                     /locus_tag="CNC04130"
                     /codon_start=1
                     /product="Dihydroorotate dehydrogenase, mitochondrial
                     precursor, putative"
                     /protein_id="XP_569657.1"
                     /db_xref="GI:58265002"
                     /db_xref="GeneID:3256307"
                     /translation="MPRPLPLPALRAALPRPHPLPLRRLASTAPPPRRHYLSTALLLG
                     GSVLLVAYYYDSRSLLHEHVAMPLMRLVADPEQGHKLAVRVLAWDKWARPRDMGVDGA
                     ELQAELFGMHLKNPVGIAAGFDKDAEAIDGLFDLGFGYVEVGSVTPEPQPGNPKPRFF
                     RLEEDDACINRYGFNSLGHGHALARLRLRLAKFAQDHPSLFPSPLPANLVPPAGLPRS
                     LRAGQLLAVNLGKNKASDPDSNDDYVRGVRTLGPFADVVVINVSSPNTPGLRALQGKQ
                     QLERLLNDVVEERNKIAQGTGLPKIAVKVASDLSEDELADVASAVRSSGVEGVIVSNT
                     TIRRKELNLVSGNQDQIGGLSGKPLFPYALNALKTLRPLLPPSIPIIGCGGISSGSDA
                     LTMANAGASIVQVYTSFGFRGVGTPRLIKDEITEHLKGESWKTHVGRDWASSGQPMGW
                     DENRLKQESQALVDEANGLAELLRQSNDKAETAKLIEDAERALGIVKEKDGAASAATV
                     VDETMPSLPPQAAVPSQGGGFGIEGVGAPSIGEALIAEPVPQVDLAPIVVLEEKKDNV
                     DDRREGGERDNEWKQAVKAGPKRLV"
     misc_feature    1268036..1268162
                     /note="G-rich"
     gene            <1268295..>1269236
                     /locus_tag="CNC04140"
                     /db_xref="GeneID:3256820"
     mRNA            <1268295..>1269236
                     /locus_tag="CNC04140"
                     /product="phosphoribosylglycinamide formyltransferase,
                     putative"
                     /transcript_id="XM_570000.1"
                     /db_xref="GI:58265687"
                     /db_xref="GeneID:3256820"
     CDS             1268295..1269236
                     /locus_tag="CNC04140"
                     /codon_start=1
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="XP_570000.1"
                     /db_xref="GI:58265688"
                     /db_xref="GeneID:3256820"
                     /translation="MMDVSQPLGKPLARCPAPAASQSSSQAQASPPPPLPHARSRPAG
                     TNLQALLDAAGTPRLPGAAITAVISSRSNAYGLTRARTHAPPIPAAVCALKTFLNRNP
                     GATREDYDAEVARQVLDTRPDIVVLAGWMHILSDRFLDILDGKKEPPPAPALPPPAPS
                     SLPTQTEPIPSHAPGAVSQNAQATSELPPPPPSQSFPVPIINLHPALPGAFDGAHAID
                     RALEAFQKGEVTRTGVMVHRVVAEVDRGEPLLVKEVEIKPEDRLEDLEERIHSASLHA
                     RGYVALHSADMLLQVEHEIIVDGARLIIEQLDRQGRP"
     gene            complement(1269226..1271650)
                     /locus_tag="CNC04150"
                     /db_xref="GeneID:3256563"
     mRNA            complement(join(1269226..1269467,1269522..1269621,
                     1269686..1269848,1269912..1270059,1270125..1270180,
                     1270240..1270590,1270654..1270893,1270947..1271200,
                     1271259..1271357,1271425..1271508,1271577..1271650))
                     /locus_tag="CNC04150"
                     /product="family II 2-keto-3-deoxy-D-arabino-heptulosonate
                     aldolase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532176|gb|CF678017.1,gi|41532186|gb|CF678027.1,
                     gi|41538130|gb|CF683971.1"
                     /transcript_id="XM_569659.1"
                     /db_xref="GI:58265005"
                     /db_xref="GeneID:3256563"
     CDS             complement(join(1269358..1269467,1269522..1269621,
                     1269686..1269848,1269912..1270059,1270125..1270180,
                     1270240..1270590,1270654..1270893,1270947..1271200,
                     1271259..1271357,1271425..1271508,1271577..1271636))
                     /locus_tag="CNC04150"
                     /codon_start=1
                     /product="family II 2-keto-3-deoxy-D-arabino-heptulosonate
                     aldolase"
                     /protein_id="XP_569659.1"
                     /db_xref="GI:58265006"
                     /db_xref="GeneID:3256563"
                     /translation="MAPAPAPWHPSSWREKPIAQDVVYEDKDQLETVLNKLRRLPPLV
                     SPVEIDRLRTQLADVAAGKAFLLQGGDCAELFDDCSQDPIEHKLSLILLMSLIILHGS
                     RLPVVRIARIAGQYAKPRSKPTEIVEFPTKDGKTEKKEVLSFRGDNVNGYDPTDRAPD
                     PQRLLGSYFHSTATLNYIRTLLSSGFANLHNPVDWSFSHVRSPELQQAFSSVIESLQD
                     SLEFMKVATGAVGGGERGGMETVDFYTSHEALLLEYEEAFTRSWDSTTLSPPATGDST
                     PILSRSASRIREASSSSSYPHSPARRPKSPKNLSDSINSLSMSVGDLGKGEAKKWYNT
                     SAHFIWIGDRTRQLDGAHVEYFRGIANPIGIKIGPSMEPEEIVRVLDIVNPDKIPGKV
                     TLIGRYGAAKVDQFLPKHIDAVLRTDHPVVWQCDAMHGNTKSSVHDPTLKTRHFVDVI
                     TEITRSMEIHKEKNTILGGVHLELTGEVNDDGYSVTECIGGSMELEDKDLSFNYRTHC
                     DPRLNYEQSLDVAFLLADYLKSKRRGERPHDILLASLRGRKNDVEK"
     gene            <1272802..>1273465
                     /locus_tag="CNC04160"
                     /db_xref="GeneID:3256499"
     mRNA            join(<1272802..1273196,1273261..>1273465)
                     /locus_tag="CNC04160"
                     /product="pria protein precursor, putative"
                     /transcript_id="XM_569661.1"
                     /db_xref="GI:58265009"
                     /db_xref="GeneID:3256499"
     CDS             join(1272802..1273196,1273261..1273465)
                     /locus_tag="CNC04160"
                     /codon_start=1
                     /product="pria protein precursor"
                     /protein_id="XP_569661.1"
                     /db_xref="GI:58265010"
                     /db_xref="GeneID:3256499"
                     /translation="MLPVPPSVHRLVILFLVAVPLLSIILPVTAAAAGVDAPSKLQPR
                     APQPSRRMGATKRSKKIEPLKKKDYSSFLCPGGSVACPIPGDEVSPSSVEALEKSLNS
                     LADWFKVGFECVELETELNSCGGCLALGSGQDCALIENARTTGCESGSCQVYSCFDGY
                     VVSPDRTSCVKKGSTIPATPVTAVNVEELVADDQLPLGQ"
     gene            <1273965..>1275213
                     /locus_tag="CNC04170"
                     /db_xref="GeneID:3256544"
     mRNA            join(<1273965..1274037,1274314..1274537,1274593..1274658,
                     1274715..1274955,1275005..1275135,1275193..>1275213)
                     /locus_tag="CNC04170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569663.1"
                     /db_xref="GI:58265013"
                     /db_xref="GeneID:3256544"
     CDS             join(1273965..1274037,1274314..1274537,1274593..1274658,
                     1274715..1274955,1275005..1275135,1275193..1275213)
                     /locus_tag="CNC04170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569663.1"
                     /db_xref="GI:58265014"
                     /db_xref="GeneID:3256544"
                     /translation="MTALLAQRVLPQIEYAIFDMDGLLNAILGRYGHTMTWDIKAGVM
                     GKPQRIAAEYILSHFPDILEKLTVEEFIAEGVQRREELFKRVEPMRGAAELVKGLHAA
                     GIPIALATGSTMPNFIHKTTHLPHIFSLFPPTSILTADSPEVKRGKPNPDIFLAAAHS
                     LGRDVGTADECTEEQKAERSRGLVFEDARPGVLAGIAAGMNVIWVPDAELLALNPGET
                     YGATEVLTHLEEWDPTRWGLPPLPGFNHIPAQP"
     gene            complement(1275239..1277799)
                     /locus_tag="CNC04180"
                     /db_xref="GeneID:3256526"
     mRNA            complement(join(1275239..1275540,1275596..1275714,
                     1275763..1276018,1276067..1276345,1276397..1276610,
                     1276671..1276724,1276773..1276914,1276968..1277313,
                     1277364..1277462,1277538..1277594,1277660..1277799))
                     /locus_tag="CNC04180"
                     /product="dihydroxyacetone kinase 1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534315|gb|CF680156.1,gi|41534318|gb|CF680159.1,
                     gi|41536720|gb|CF682561.1,gi|41536727|gb|CF682568.1,
                     gi|41536937|gb|CF682778.1,gi|41536945|gb|CF682786.1,
                     gi|41540373|gb|CF686214.1,gi|41541104|gb|CF686945.1,
                     gi|41541108|gb|CF686949.1,gi|41543398|gb|CF689239.1,
                     gi|41543406|gb|CF689247.1,gi|41545599|gb|CF691440.1,
                     gi|41545606|gb|CF691447.1,gi|41552021|gb|CF697862.1,
                     gi|41552032|gb|CF697873.1,gi|41555317|gb|CF701158.1,
                     gi|41555326|gb|CF701167.1,gi|41555558|gb|CF701399.1,
                     gi|41557448|gb|CF703289.1,gi|41558955|gb|CF704796.1,
                     gi|41558962|gb|CF704803.1,gi|41560252|gb|CF706093.1,
                     gi|41560260|gb|CF706101.1,gi|41561471|gb|CF707312.1,
                     gi|41562087|gb|CF707928.1,gi|41562095|gb|CF707936.1,
                     gi|41563730|gb|CF709571.1,gi|41563737|gb|CF709578.1,
                     gi|41565953|gb|CF711794.1,gi|41565963|gb|CF711804.1,
                     gi|41567559|gb|CF713400.1,gi|41567561|gb|CF713402.1,
                     gi|41573166|gb|CF719007.1,gi|41573175|gb|CF719016.1,
                     gi|41574524|gb|CF720365.1,gi|41574531|gb|CF720372.1,
                     gi|41576047|gb|CF721888.1"
                     /transcript_id="XM_570003.1"
                     /db_xref="GI:58265693"
                     /db_xref="GeneID:3256526"
     mRNA            complement(join(1275239..1275540,1275596..1275714,
                     1275763..1276018,1276067..1276345,1276397..1276610,
                     1276671..1276724,1276773..1276914,1276968..1277313,
                     1277364..1277462,1277538..1277638))
                     /locus_tag="CNC04180"
                     /product="dihydroxyacetone kinase 1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534315|gb|CF680156.1,gi|41534318|gb|CF680159.1,
                     gi|41536720|gb|CF682561.1,gi|41536727|gb|CF682568.1,
                     gi|41536937|gb|CF682778.1,gi|41536945|gb|CF682786.1,
                     gi|41540373|gb|CF686214.1,gi|41540380|gb|CF686221.1,
                     gi|41541104|gb|CF686945.1,gi|41541108|gb|CF686949.1,
                     gi|41543398|gb|CF689239.1,gi|41543406|gb|CF689247.1,
                     gi|41545599|gb|CF691440.1,gi|41545606|gb|CF691447.1,
                     gi|41552021|gb|CF697862.1,gi|41552032|gb|CF697873.1,
                     gi|41554860|gb|CF700701.1,gi|41555317|gb|CF701158.1,
                     gi|41555326|gb|CF701167.1,gi|41555558|gb|CF701399.1,
                     gi|41555563|gb|CF701404.1,gi|41557448|gb|CF703289.1,
                     gi|41557452|gb|CF703293.1,gi|41558955|gb|CF704796.1,
                     gi|41558962|gb|CF704803.1,gi|41560252|gb|CF706093.1,
                     gi|41560260|gb|CF706101.1,gi|41561471|gb|CF707312.1,
                     gi|41561479|gb|CF707320.1,gi|41562087|gb|CF707928.1,
                     gi|41562095|gb|CF707936.1,gi|41563730|gb|CF709571.1,
                     gi|41563737|gb|CF709578.1,gi|41565953|gb|CF711794.1,
                     gi|41565963|gb|CF711804.1,gi|41567559|gb|CF713400.1,
                     gi|41567561|gb|CF713402.1,gi|41573166|gb|CF719007.1,
                     gi|415"
                     /transcript_id="XM_570004.1"
                     /db_xref="GI:58265695"
                     /db_xref="GeneID:3256526"
     CDS             complement(join(1275287..1275540,1275596..1275714,
                     1275763..1276018,1276067..1276345,1276397..1276610,
                     1276671..1276724,1276773..1276914,1276968..1277313,
                     1277364..1277462,1277538..1277550))
                     /locus_tag="CNC04180"
                     /codon_start=1
                     /product="dihydroxyacetone kinase 1"
                     /protein_id="XP_570003.1"
                     /db_xref="GI:58265694"
                     /db_xref="GeneID:3256526"
                     /translation="MAPAQKHLLNTPQTLVVDSLKGLATLNPNVKLDEAQRVIYTPPT
                     EPKVALLSGGGSGHEPAHAAFVGPGLLSAAICGNIFASPNVAQIRRGLELVTREKGGL
                     VVVMNYTGDALHFGLAAEQHRSAGKVGDVRVLMVGDDVAVGREQGSIVGRRGLAGTIL
                     VYKVAAALSDKGADLDSVENIAKYVASRLGTLGVGLEHCHVPGTRAGTSHLGANEVEV
                     GMGIHNEAGTYKLEMTTASELVGRMLTQITDTTDKDKSFVPFKGDGSDEVVLLVNDLG
                     AISELEMGGLTNEAVKWLQSRKIKVRRVLAGTYMTSLNMPGFSLTLLLLPSASEKAPY
                     SANEILEYLDTPASAPGWKWHAGREPGTLDVKAEEAPIPVQKDNAVLPSTDAKGFLAA
                     IARACKALIAAEPELTEQDQIAGDGDAGLTLEAGAKGVLKAIEEGRLKGENVVQDVKV
                     IAEIVEDDMGGTSGALYSIFFAGLGKSLRDAATNGAKSTSPEVWSKAAAEALATLYKY
                     TRARPPSRTLVDPLDAFVASLPSKGLSSAAEDALAAADKTKELVAKAGRGAYVNQEDL
                     KKREVPDPGAWGIWRILDGLRGFEA"
     gene            complement(1277910..1280268)
                     /locus_tag="CNC04190"
                     /db_xref="GeneID:3256804"
     mRNA            complement(join(1277910..1280031,1280095..1280268))
                     /locus_tag="CNC04190"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532050|gb|CF677891.1,gi|41532057|gb|CF677898.1,
                     gi|41537559|gb|CF683400.1,gi|41543769|gb|CF689610.1,
                     gi|41545984|gb|CF691825.1,gi|41547562|gb|CF693403.1,
                     gi|41551227|gb|CF697068.1,gi|41551237|gb|CF697078.1,
                     gi|41551286|gb|CF697127.1,gi|41551298|gb|CF697139.1,
                     gi|41552081|gb|CF697922.1,gi|41552094|gb|CF697935.1,
                     gi|41556230|gb|CF702071.1,gi|41556239|gb|CF702080.1,
                     gi|41561814|gb|CF707655.1,gi|41563142|gb|CF708983.1,
                     gi|41563148|gb|CF708989.1,gi|41566510|gb|CF712351.1"
                     /transcript_id="XM_569665.1"
                     /db_xref="GI:58265017"
                     /db_xref="GeneID:3256804"
     CDS             complement(join(1278125..1280031,1280095..1280158))
                     /locus_tag="CNC04190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569665.1"
                     /db_xref="GI:58265018"
                     /db_xref="GeneID:3256804"
                     /translation="MLDLSVTPKHGNAGGRYFPHTGHLGVSPVVVQGKVATKLPPVCD
                     PLLVKSISLRIKCTEYRTGGAFEGDLQNTLWEQSQLLLAPPDGEKYLNVGDWDQQFKM
                     AIPIEAATQGRSTMCIREYKVVWRMEVVIEHKPIHYVGTSITKAFALNLQNHQAPPLR
                     PLSPSPSLCIGSDAYVSEACLNVPHGVFGPGDSFHVALLIKPENPTTMVKKVTVVLER
                     LIELVDSKSASRRDSFNDRSPSKRRHVHSSRSYSPTQTSRLTSILRRSLSPRPPFHRL
                     QSDPHTSVGPSVQHEGQVIRDKITESSTTDMTSGGAGFRCSLPMSLPRRTGKWALGET
                     HQTGLVSMSYQLRASITLKGVRRSSPSKTFILPTAPITLISTSTTERLDAVAAAEHKR
                     KKLGSLGKGLYLHGENSSIVDSRDPVHPEEPPALSTVIGVATNIKPILLPPDKSQHPP
                     SQSISFSFPSPSQRSPTVRSLPIQSLLNPETSKSSSNHQLPSPPPTRQGPSSLDVVAD
                     PESGSLLRLFHVQGSGRRISTTTSEEEEVQPSRSRQKLRAEPPTTIAEFEWPSLPSLD
                     TLGLGLPHVPEDHRPRSRPRTAPIHSTFAMSKNGVPPPLSGAFGGPMSGDQLGQRPMT
                     SAGASRGWREEEDAATFAFALPEDKGHIDMRR"
     gene            1281698..1282472
                     /locus_tag="CNC04200"
                     /db_xref="GeneID:3256797"
     mRNA            join(1281698..1281719,1281900..1281973,1282030..1282170,
                     1282228..1282332,1282390..1282472)
                     /locus_tag="CNC04200"
                     /product="thioredoxin (allergen cop c 2), putative"
                     /transcript_id="XM_569667.1"
                     /db_xref="GI:58265021"
                     /db_xref="GeneID:3256797"
     CDS             join(1281932..1281973,1282030..1282170,1282228..1282332,
                     1282390..1282416)
                     /locus_tag="CNC04200"
                     /codon_start=1
                     /product="thioredoxin (allergen cop c 2)"
                     /protein_id="XP_569667.1"
                     /db_xref="GI:58265022"
                     /db_xref="GeneID:3256797"
                     /translation="MVKAIESYDEWKTLTSGSDVVVVDYWATWCGPCKMISPHFAKLE
                     GKFPNVKFAKVDVEEQEDIAKEAQIKAMPTFVAYKDGKVIETVTGAVPAKINALLDKV
                     AA"
     gene            complement(<1282550..>1283738)
                     /locus_tag="CNC04210"
                     /db_xref="GeneID:3256419"
     mRNA            complement(join(<1282550..1283065,1283127..1283300,
                     1283361..1283603,1283655..>1283738))
                     /locus_tag="CNC04210"
                     /product="inositol/phosphatidylinositol kinase, putative"
                     /transcript_id="XM_570044.1"
                     /db_xref="GI:58265775"
                     /db_xref="GeneID:3256419"
     CDS             complement(join(1282550..1283065,1283127..1283300,
                     1283361..1283603,1283655..1283738))
                     /locus_tag="CNC04210"
                     /codon_start=1
                     /product="inositol/phosphatidylinositol kinase"
                     /protein_id="XP_570044.1"
                     /db_xref="GI:58265776"
                     /db_xref="GeneID:3256419"
                     /translation="MSPVSICKPQATMAQLTRLWITGTCTKFPTTQEEIQFYENINDF
                     DFLIEHPGLVKIKPFIPTYKGCVDRSSYIRSDDSIQTEDAEEVPVYGEGGEVIGYKEN
                     IAKKHTQSIVLSNLLYGLLNPIVADFKLGKRWWGSRSGRAKRLRHDKSCAATTSGTTG
                     IMFAGAHTWVPGKETCVSTTKSYGYSLRDDNLSDSMACVFPSVTDWHLFSKKPHLTLR
                     TDPSSRLQRKPSSDCMADMLSRTLKTIESVTDIRTAMKESGWSYPGSSLLIAHGVSEF
                     TGKTEVRCALIDFAHAHEHNDELPPDGVDDGLETLSKLLKDRANYLQSYRSTTTRCDD
                     TAEL"
     gene            complement(<1285855..>1287127)
                     /locus_tag="CNC04220"
                     /db_xref="GeneID:3256720"
     mRNA            complement(join(<1285855..1286563,1286622..1286950,
                     1287032..>1287127))
                     /locus_tag="CNC04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_569669.1"
                     /db_xref="GI:58265025"
                     /db_xref="GeneID:3256720"
     CDS             complement(join(1285855..1286563,1286622..1286950,
                     1287032..1287127))
                     /locus_tag="CNC04220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569669.1"
                     /db_xref="GI:58265026"
                     /db_xref="GeneID:3256720"
                     /translation="MSLYPIMSSLPQKPTENTFQSSSAAGPSKICASRDSCSGIRDPA
                     KFVPLNQYGQGVWSSDYTLLEEGRRQIAGWGKGIKIEEVNGGVVSSRGRGRGSRAPKG
                     QRRSKTDGLRRELERYGCRAEFMPEGMGRKKTNQSSWNPKTEQLHLTVHLIIPSNLIL
                     PSPDSTIITSTSFKTITHPRVLFHAREAESLPTISSLLPSLTIPLSEIRFCQPFHSTP
                     FRPAPSHQPNQKIFYPPLDANKPLKDVLKGSAWVEFPEIQLMARENWEEMVDKGEAII
                     TEIEAISQVSGRERDSGWGAKRRLNEVAEGKVQHNGTKRLKSESNQGLLALGEYDSEE
                     GSDAENGAEEADDVSAEEAQDQDPSPEILAAVGRALMADLEEA"
     gene            <1287882..>1289053
                     /locus_tag="CNC04230"
                     /db_xref="GeneID:3256732"
     mRNA            join(<1287882..1287914,1287972..1288031,1288089..1288140,
                     1288269..1288347,1288445..1288529,1288589..1288921,
                     1288976..>1289053)
                     /locus_tag="CNC04230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569671.1"
                     /db_xref="GI:58265029"
                     /db_xref="GeneID:3256732"
     CDS             join(1287882..1287914,1287972..1288031,1288089..1288140,
                     1288269..1288347,1288445..1288529,1288589..1288921,
                     1288976..1289053)
                     /locus_tag="CNC04230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569671.1"
                     /db_xref="GI:58265030"
                     /db_xref="GeneID:3256732"
                     /translation="MSHSSLDYPEMKELFNRNLKWSENVWARDPSFFPHHFPGQRPEI
                     LWIGCSDARVPETTILGCQPGDIFVHRNIANLYSPQDDSLNAVLMIALFNFNVKHIVV
                     TGHTNCVGCLTALNVSRLPATPPTTPLQRYVKPLATLARTLYTPDGPPTLDLLVEENV
                     VQQVKNLVESDIIKGVSGVYIQLKRKNADISLQNWKKRGADGVVIHGWVYHLEDGTIR
                     DLNVSVGPSGHIPGKKVKSLF"
     misc_feature    1289449..1289489
                     /note="A-rich"
     gene            complement(1290355..1292455)
                     /locus_tag="CNC04240"
                     /db_xref="GeneID:3256267"
     mRNA            complement(join(1290355..1290612,1290668..1291006,
                     1291059..1291740,1291816..1292081,1292148..1292212,
                     1292266..1292455))
                     /locus_tag="CNC04240"
                     /product="di-, tri-valent inorganic cation transporter,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530480|gb|CF676321.1,gi|41530489|gb|CF676330.1,
                     gi|41551620|gb|CF697461.1,gi|41551624|gb|CF697465.1,
                     gi|41559645|gb|CF705486.1,gi|41563977|gb|CF709818.1,
                     gi|41563982|gb|CF709823.1,gi|41576046|gb|CF721887.1,
                     gi|41576055|gb|CF721896.1"
                     /transcript_id="XM_569673.1"
                     /db_xref="GI:58265033"
                     /db_xref="GeneID:3256267"
     CDS             complement(join(1290459..1290612,1290668..1291006,
                     1291059..1291740,1291816..1292081,1292148..1292212,
                     1292266..1292331))
                     /locus_tag="CNC04240"
                     /codon_start=1
                     /product="di-, tri-valent inorganic cation transporter"
                     /protein_id="XP_569673.1"
                     /db_xref="GI:58265034"
                     /db_xref="GeneID:3256267"
                     /translation="MGLSRQARIITLLVIDSVFFLIELITGYAVGSLALVADSFHMLN
                     DVLSLIVALYTIRLATSPSSSANSYGWQRAEILGALINGVFLVALCVSIGLEAVGRIF
                     SPPEISNAQLIVVVGSLGLLSNIVGLFLFHDHGHSHGGHTHGAVALPNDEDETSSLIS
                     RDDSVSELYQHPAQTRAQVIETAQEFGYGGTQLSSSLDSRAGHLAKSPNAGGHGRTGS
                     ASRRTKRGSFSRAGGHSRLGSANIVPPVPGQNDVLPPVGGDGNSTSSSTVIDNGKKKA
                     SKKDDHDQDHGREREQGSDSGKKLAGNASDAESGHTHGSPAEHGRHGGHGHSHGAMNM
                     RGVFLHVVGDALGNVGVISAGLVIWFCQGRWTLYFDPGVSLVITCIIFSSALPLVKSA
                     SYILMQGVPSHVSLDAVRQCIYEVPGVDSVHELHIWQLSESTVVASVHVMIEAGRDYM
                     VVASGIRERMHSHGIHSVTIQPEFYCEETDPQDTEACLIRCPPGQCSGDTCCPPGVKI
                     TGPEGDEGNGHDHEH"
     gene            <1292835..>1293890
                     /locus_tag="CNC04250"
                     /db_xref="GeneID:3256265"
     mRNA            <1292835..>1293890
                     /locus_tag="CNC04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_569675.1"
                     /db_xref="GI:58265037"
                     /db_xref="GeneID:3256265"
     CDS             1292835..1293890
                     /locus_tag="CNC04250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569675.1"
                     /db_xref="GI:58265038"
                     /db_xref="GeneID:3256265"
                     /translation="MYPIHTAPVYYSYSRPPSPSNGPAAPPFEFSGVTIPPRLKSIGR
                     QLSQLGNDFLTTQPDQEPKSQPRGDGKAPDIPGMGDDPILCPYCDKPLPPSLFAQVAE
                     HSHRHQTLGPSRPSSVPSSAVSAKLGPTPGHKSADKTTSDALSATVRNGDAANHSAVV
                     NTISPADIARWSSLAGISITMPEPSGPSQGIHKAKDADAKPFPMIPPPPPPNKLTRPP
                     PASRHNSADSGSRFGFFRRDSKREDDSDGEGEDRGSGYAKLGAGGSDDEEEVTSGKKE
                     QHDGVNEGDDDAKVEDNASLDLGDQDKNGQVEDEGRPESTAKDPGEVSSVDSNSDLKN
                     VMQEILTKVNQMVSRPH"
     gene            <1294340..1295298
                     /locus_tag="CNC04260"
                     /db_xref="GeneID:3256351"
     mRNA            <1294340..1295298
                     /locus_tag="CNC04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_569677.1"
                     /db_xref="GI:58265041"
                     /db_xref="GeneID:3256351"
     CDS             1294340..1295242
                     /locus_tag="CNC04260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569677.1"
                     /db_xref="GI:58265042"
                     /db_xref="GeneID:3256351"
                     /translation="MAVPYGGALPEGRPMPARSATHSGQLATGVSKSLGADSILSKQS
                     STRPSTPTQTPGPVPVSNAELASLRTAYSSALSKLSSLTAELTDLKRTNSAMEAELES
                     LSQALFEEANKMVADERKRRAEMEENLKEVREEREALKETVKVLGGKVSPPNEDADAK
                     PPKKNEPEEVEEENIIPRDLDKHYAALRKSIHNVASPPISPPADASRLPATFELPESG
                     LASRASPEEVGRPLSVSLPDESNPWASSANSAAAAAAAAPVGLGLGVDEEGSVPTEFR
                     LSVVTPSPRKEKTGEGLESGAGLS"
     STS             1295041..1295218
                     /locus_tag="CNC04260"
                     /standard_name="AGC17"
                     /db_xref="UniSTS:470821"
     repeat_region   1295090..1295110
                     /rpt_type=tandem
                     /rpt_unit_seq="cag"
                     /satellite="microsatellite"
     misc_feature    1295391..1295411
                     /note="T-rich"
     gene            1295481..1297931
                     /locus_tag="CNC04270"
                     /db_xref="GeneID:3256283"
     mRNA            join(1295481..1295883,1295940..1296557,1296614..1296668,
                     1296725..1296810,1296866..1297931)
                     /locus_tag="CNC04270"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542926|gb|CF688767.1,gi|41542935|gb|CF688776.1,
                     gi|41572109|gb|CF717950.1,gi|41572116|gb|CF717957.1"
                     /transcript_id="XM_569679.1"
                     /db_xref="GI:58265045"
                     /db_xref="GeneID:3256283"
     CDS             join(1295562..1295883,1295940..1296557,1296614..1296668,
                     1296725..1296810,1296866..1297728)
                     /locus_tag="CNC04270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569679.1"
                     /db_xref="GI:58265046"
                     /db_xref="GeneID:3256283"
                     /translation="MHKNETTSHPPPETTSSTIHQALPPDSLQDHPDTHPVNPLGLFI
                     RPHPTRGNGLFSPRPIPAGTVVEESPVLVLTKEQWEQGQMDGTILGEYGFCWSAGGMA
                     IGLGLASLFNHSSRPNVNFIRSPSTKTIRFVTAKHISPGEELCICYTADESKLWFTPA
                     RGEEEDEVLGGESEGEGDGLPDDVDGLVEDVQQAKLNSSEPTLQAPRPVHISSLPSYP
                     SSSSSSPAPQHTIPPSSLPAPLHSSGHKASGQRHLSKHRQPATLVDDLAWQEDEWKDE
                     KGRDHVGEGKKAGEDWGEVIRVKGPAERENDGNDRELMQVWILEFSDAKLTKTALNFS
                     KEIWPNDVNERLRHLKRVCRRNEDGKEICRIALCPLDEHSADSLSSLMTAFSPLLSSL
                     TPKSWSVPSSGARTQEQLKWKHHIWPVSFSPAPIIPADSSSWPISRKAWVAAGIKRVL
                     KLAVNAKQKSELPVATFCTSAPPCFWPTMDGFIPPTLNLRASSCDTRISESHPLRHAT
                     LNCVASIAHLRTVPPFTDVPPTRNGADYLLTSLSLFISHEPCVMCAMALLHSRVREVF
                     YVFPRKKGGGFEYNEGNEYGEGSPVHQHDEGAGTREDISGQGGFGIHARRDLNHRFEV
                     WKWNGHVDEDVRKELEIDENLQL"
     STS             1296428..1297122
                     /locus_tag="CNC04270"
                     /standard_name="Eco4"
                     /db_xref="UniSTS:470757"
     gene            complement(<1298469..>1301616)
                     /locus_tag="CNC04280"
                     /db_xref="GeneID:3256258"
     mRNA            complement(join(<1298469..1299282,1299334..1299644,
                     1299694..1300308,1300355..1300890,1300944..1301361,
                     1301411..1301440,1301494..>1301616))
                     /locus_tag="CNC04280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570002.1"
                     /db_xref="GI:58265691"
                     /db_xref="GeneID:3256258"
     CDS             complement(join(1298469..1299282,1299334..1299644,
                     1299694..1300308,1300355..1300890,1300944..1301361,
                     1301411..1301440,1301494..1301616))
                     /locus_tag="CNC04280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570002.1"
                     /db_xref="GI:58265692"
                     /db_xref="GeneID:3256258"
                     /translation="MTTDISTRPDFKADDLVSAMGEVTLNGSGRNGHEALDLAETAEV
                     SNQAVQERLEQKRLEHERARLAQRAKFEQQMRELEANQLAEERQLMSATSPLPAGEAA
                     SAPTTPPGHASLGSSVHDLHKEAPAPIGSLVPGPREGLNGAKSMPGSRRTSTYGGTFG
                     MEKMSLSVMTDGSRREWRQEDDDVDAEGAQSSVKYLGMNDDDPFPGIPKQESKHLSAA
                     SAALDLAPLSQTPPRAFGSRPFETSLKTSEWPQFSAVPGASSGPARGVTSPLQASGMM
                     SDELREPTLLGSRKTSPTAGMADSIASLPAMPSKSVPGTPFGFGGAGGGGAGVGKRVD
                     SGEGLSHGQRGFSNPDLARAFGKVGGGFSVGENARQPYNDLYNSFSPVNASLPPSAAV
                     AAAFTPQVAYDPYGFDEDGYGSGSLYPGGSVGLKNKRADQDREFNRFAGVRIEDLKGE
                     LLSLCKDQHGCRYLQKKLEDGDPKHRDMIFNETYGHFPELMTDPFGNYLCQKLLEYST
                     EEQRSAIIDSVANDLVGISLNMHGTRAVQKMVDFLAQPRQPKQIRTLILALSMNVVAL
                     IKDLNGNHVIQKCLNKLIPEDNQFIYNAIAANLIEVATHRHGCCVLQRSIDHASPAQR
                     MQLVTEIIFNSLYLVQDPFGNYVIQYILDLNDARFSEPLIRTFIGNVCSLSVQKFSSN
                     VVEKCIRVADPEIRKVLVGEVLNRSRLEKLLRDSYGNYVIQTILDYCEIGQRMVLVEC
                     IRPILPSIRNTPYGKRIQSKLAREDASFQPYNGYNNNGNNSNRGRGGGGGGNYHSSRG
                     HIGRPQLQHVNALTDIYGGGGPFMQYGHAPAGHMHPAHAGWTPGREPPHMGGPTHTGL
                     SYHAPGPDGQPWLHLRGPGGGPAPNWHLSQDGSHGGVLPGGMNPQMTGASAQAGGAVG
                     AGEEEGLQVGAGAGAWQDPQSGGFYNGPSHVPMM"
     gene            complement(1302191..1303274)
                     /locus_tag="CNC04290"
                     /db_xref="GeneID:3256416"
     mRNA            complement(join(1302191..1302276,1302371..1302394,
                     1302445..1302481,1302607..1302672,1302982..1303008,
                     1303059..1303104,1303238..1303274))
                     /locus_tag="CNC04290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570001.1"
                     /db_xref="GI:58265689"
                     /db_xref="GeneID:3256416"
     CDS             complement(join(1302268..1302276,1302371..1302394,
                     1302445..1302481,1302607..1302672,1302982..1303008,
                     1303059..1303060))
                     /locus_tag="CNC04290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570001.1"
                     /db_xref="GI:58265690"
                     /db_xref="GeneID:3256416"
                     /translation="MAHSNVWFSRPRNYGKGSRQCRLCAHQAGLIRGLDLCRQCFREK
                     SKVIGFDKYN"
     misc_feature    1303415..1303437
                     /note="AT_rich"
     gene            complement(<1304383..1305549)
                     /locus_tag="CNC04300"
                     /db_xref="GeneID:3256472"
     mRNA            complement(join(<1304383..1304704,1304758..1305549))
                     /locus_tag="CNC04300"
                     /product="ornithine carbamoyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530921|gb|CF676762.1,gi|41530935|gb|CF676776.1"
                     /transcript_id="XM_569681.1"
                     /db_xref="GI:58265049"
                     /db_xref="GeneID:3256472"
     CDS             complement(join(1304383..1304704,1304758..1305548))
                     /locus_tag="CNC04300"
                     /codon_start=1
                     /product="ornithine carbamoyltransferase"
                     /protein_id="XP_569681.1"
                     /db_xref="GI:58265050"
                     /db_xref="GeneID:3256472"
                     /translation="MPSATVIRYAIQGARKPTPNVIIPFKPTNIAKSRQLPPPHLLTL
                     ADLSPEQISSLIANAAALKFVSKNVHTTAIPKRLDRRTVALIFNKRSTRTRVASETSV
                     EALGGHPMFLGKDDIQLGVNETLEDTAKVVGSMTDGIMARVAGHEEIETLAQYSPVPV
                     INALSDLYHPTQILADLLTLCEIYAPVPPPTEIVSGQAYSSILSYYQSALNPTKILQG
                     KKVAWVGDTNNITNELLVTLPRFGMHFSVAAPKGYDKFDERVWSRLAESKTESLVTLT
                     NSPAEALRDADVVVTDTWISMGQETEKAARLEAFKGYQITNKMVSEAGAKEDWKFMHC
                     LPRKKEEVDDEVFYGPRSVVFPEAENRKWTIMAVFE"
     gene            complement(1306711..1309937)
                     /locus_tag="CNC04310"
                     /db_xref="GeneID:3256502"
     mRNA            complement(join(1306711..1307122,1307177..1307332,
                     1307415..1307689,1307749..1307978,1308031..1308389,
                     1308440..1308547,1308597..1308975,1309027..1309108,
                     1309170..1309937))
                     /locus_tag="CNC04310"
                     /product="glycerol-3-phosphate dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534528|gb|CF680369.1,gi|41534541|gb|CF680382.1,
                     gi|41535971|gb|CF681812.1,gi|41535985|gb|CF681826.1,
                     gi|41546916|gb|CF692757.1,gi|41546923|gb|CF692764.1,
                     gi|41547617|gb|CF693458.1,gi|41547630|gb|CF693471.1,
                     gi|41548901|gb|CF694742.1,gi|41548907|gb|CF694748.1,
                     gi|41551275|gb|CF697116.1,gi|41551287|gb|CF697128.1,
                     gi|41557261|gb|CF703102.1,gi|41560867|gb|CF706708.1,
                     gi|41560873|gb|CF706714.1,gi|41561663|gb|CF707504.1,
                     gi|41561670|gb|CF707511.1,gi|41564946|gb|CF710787.1,
                     gi|41564952|gb|CF710793.1,gi|41566646|gb|CF712487.1,
                     gi|41566649|gb|CF712490.1,gi|41567337|gb|CF713178.1,
                     gi|41567340|gb|CF713181.1,gi|41567350|gb|CF713191.1,
                     gi|41569879|gb|CF715720.1,gi|41570371|gb|CF716212.1,
                     gi|41570379|gb|CF716220.1,gi|41573154|gb|CF718995.1,
                     gi|41573161|gb|CF719002.1"
                     /transcript_id="XM_569683.1"
                     /db_xref="GI:58265053"
                     /db_xref="GeneID:3256502"
     CDS             complement(join(1306799..1307122,1307177..1307332,
                     1307415..1307689,1307749..1307978,1308031..1308389,
                     1308440..1308547,1308597..1308975,1309027..1309108,
                     1309170..1309653))
                     /locus_tag="CNC04310"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="XP_569683.1"
                     /db_xref="GI:58265054"
                     /db_xref="GeneID:3256502"
                     /translation="MFRGRSYMPGRRALVFTTATTVAVGSAYYALRPTPLHLDSQHVP
                     LTKRRPGPLWAPPSREQMLEHLRTSGIYIHRTEEGGPEPGAVLRKDEAESEGDDVFDL
                     LIVGGGATGAGTALDAASRGLKVACVEREDFSSGTSSKSTKLVHGGVRYLQKAIFELD
                     YEQWKLVKEALRERRIFLETAPHLSHMLPILLPIYTWWQLPYYYAGCKLYDFLAGKEN
                     MESAYWMGKGKALEAFPMLKKDGLVGGVVYYDGQHNDSRMNISLVMTAVQHGAVVANY
                     VEVTELHKKPDPSRGGQERICAATLKDRRTGETWKVRTRGVINATGPFSDGLRKLDEP
                     TTQDIVAPSAGVHITLPNYYGPKTMGLLDPATSDGRVIFFLPWQGNVIAGTTDSPTKV
                     SQNPIPDEKEIQWILDEVRNYLSPDVKVRRGDILSAWSGIRPLVKDPNSKNTESLVRN
                     HMINTSKGGLLTIAGGKWTTYRAMAEETVDVAVKEFNLKPNGPSQTNHIKLVGGHAWS
                     KTMYIKLIQQFGLETEVANHLSESYGDRAWTVASMAKPTGESWPFHGVRLSKLYPYIE
                     AECRYACRCEYAQTAVDFIARRTRLSFLNVQATVETLPRVLEIMGEELGWDMKRKEQE
                     FDDAMEFLKSMGLPQHTKLKLSDVEKSHGHIGPLGLAQKEEVALYQRAQFTPDEVSHL
                     RTQFERFDFDHDQRITRADLIHAMTGMGYDASVELADSILREVDFGRKGEIDFQDYLD
                     IAAGLKELQLENAFTHLTQLDSSRKEAGARDIGDHAHESSERREKRRKIPVERSGGGA
                     "
     gene            1310301..1312929
                     /locus_tag="CNC04320"
                     /db_xref="GeneID:3256810"
     mRNA            join(1310301..1310945,1311005..1311086,1311138..1311322,
                     1311371..1311564,1311611..1311718,1311771..1312129,
                     1312186..1312684,1312739..1312929)
                     /locus_tag="CNC04320"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539039|gb|CF684880.1,gi|41539048|gb|CF684889.1,
                     gi|41546521|gb|CF692362.1,gi|41546522|gb|CF692363.1,
                     gi|41559948|gb|CF705789.1,gi|41559949|gb|CF705790.1"
                     /transcript_id="XM_569685.1"
                     /db_xref="GI:58265057"
                     /db_xref="GeneID:3256810"
     CDS             join(1310462..1310945,1311005..1311086,1311138..1311322,
                     1311371..1311564,1311611..1311718,1311771..1312129,
                     1312186..1312684,1312739..1312834)
                     /locus_tag="CNC04320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569685.1"
                     /db_xref="GI:58265058"
                     /db_xref="GeneID:3256810"
                     /translation="MFRGRSYMPGRRAFAVTTTTTLAVGSAYLYFRPQPVRLEDASSV
                     YDVKRPANLSWKPPTRDQMLSHLATSGIYVNRTQESGPEIGEIKGEKKEEDDDDVFDL
                     LIVGGGATGAGTALDAVSRGLKVACVERDDFSSGTSSKSTKLVHGGVRYLQKAIFELD
                     YEQWKLVKEALRERRIFLDTAPHLSHMLPILLPIYTWWQLPYYYAGCKLYDVLAGKEN
                     MESAYWVGKGKALEAFPTLKKEGLVGGVVYYDGQHNDSRMNISIMMTAVQHGAVVANY
                     TEVTELHKKADPLRNGQERIYAATVKDNLTGKTMKVRCRGVINATGPFSDGIRQLDEP
                     SVQNIVAPSAGVHISLPNYFGSKTMGLLDPATSDGRVIFFLPWQGVIIAGTTDSPTSL
                     SQNPIPDEKEIQWILDEVDHYLSPDVKARREDILAAWSGIRPLVKDPNSKNTESLVRN
                     HIINTSKGGLMTIAGGKWTTYRAMAEETVDAAVKEFDLKPNGPTRTHHLKLIGGHAWS
                     KVMYIKLLQEYGLETEVAKHLSESYGDRAWTVASFANPTGESWPKHGVRFYRRYPYIE
                     AECRYACRCEYAQTAVDFLARRIRLSFLDIHATVVALPRVIDIMSDELGWDAKRRAEE
                     LESTIKFLQSMGLGSKSDRDYAHELSERRGERRQIPIERSAGGA"
     gene            complement(1312943..1316260)
                     /locus_tag="CNC04330"
                     /db_xref="GeneID:3256375"
     mRNA            complement(join(1312943..1313322,1313372..1314063,
                     1314114..1314231,1314281..1314929,1314992..1315104,
                     1315276..1315656,1315712..1315958,1316011..1316260))
                     /locus_tag="CNC04330"
                     /product="nucleoporin-interacting protein NIC96, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532077|gb|CF677918.1,gi|41532085|gb|CF677926.1,
                     gi|41536863|gb|CF682704.1,gi|41536873|gb|CF682714.1,
                     gi|41542513|gb|CF688354.1,gi|41542526|gb|CF688367.1,
                     gi|41546118|gb|CF691959.1,gi|41546123|gb|CF691964.1,
                     gi|41554397|gb|CF700238.1,gi|41554409|gb|CF700250.1,
                     gi|41555527|gb|CF701368.1,gi|41555530|gb|CF701371.1,
                     gi|41566917|gb|CF712758.1,gi|41566928|gb|CF712769.1"
                     /transcript_id="XM_569687.1"
                     /db_xref="GI:58265061"
                     /db_xref="GeneID:3256375"
     CDS             complement(join(1313008..1313322,1313372..1314063,
                     1314114..1314231,1314281..1314929,1314992..1315104,
                     1315276..1315656,1315712..1315958,1316011..1316231))
                     /locus_tag="CNC04330"
                     /codon_start=1
                     /product="nucleoporin-interacting protein NIC96"
                     /protein_id="XP_569687.1"
                     /db_xref="GI:58265062"
                     /db_xref="GeneID:3256375"
                     /translation="MSTNSPYRPHNHGPAARPPAASALSSLLAQANSLNEVDYDSELP
                     QIRFGIDDIERMSEAVAGRGKRAKSEKGEAFNLLSNLGVNTSQLTHSISQLPSEPAAP
                     RPRRRRAAQIQAQTADQVPELGRGFVAAEGDIGTWGRNWHEMVILSGIEMQRQRTVNS
                     FQKQFQQRILQNWQLEKARVLQDELGVTDDELAGIVDAARLAASTSGNSTLGRSALGA
                     STRRFPMGQSTLGKSTTAESREGGLVMHTKMVRYERVIGELNQKRLRKEPYEFCQALS
                     ESTKNDSPVNERQYSAAYLGDQKAHQAALLRGRLVTGGLKYLERDFERHVDETIARNP
                     KEAALGGVPGIRNKVRAFVDVTLRTKEAREAYKPESVNGTLLWAQTYYLVRCGYIDDA
                     LNLVAENQQHISRDDWSFPGCFKSAMQSPERRLSKTQRDQLYNDFNAHIRNNPLIDQF
                     KAALYKLVGRFELNRKTAKVATTTEDWMWLQLNLVRENRDGDAPQEQYDLADLGRLLE
                     KYGSDKFDAGGTKPLAWFNLLLFTAQFEKAVAYLYSKPQMKTDAVHFAIALSYYGLLR
                     VPTKGDEAELLAVTDSGDVSFLNFARIIKQYIAPFFKLEPQTALQYAYLVMLNSDAPA
                     PSGPKQRQLCLELVRDIVLSSRSWSRLLGSVRSDGSKETGVIERDLKLLKLEDEQDYL
                     RQVVLAAADQSSLDSSLTDSIELYHLAGSYDKVVETVNRALGHSLSQTAGTAPLPSDA
                     AQVGLTGAFGGAPDLYSLAQKVHAVYERDFGKRTRVSSLHWETLETLLQLKLALAQFA
                     ADRPDLALETFKATNLLPLDNDPSSITRYAQKFRDMLDQPVVSNLDDVIVTTMKCLHL
                     LSQQLKQSPYGDQGRAAQLSVYKHQAQCLIQFASTLRLRLGPDVYRQLSSMSAFF"
     gene            1316449..1318043
                     /locus_tag="CNC04340"
                     /db_xref="GeneID:3256613"
     mRNA            join(1316449..1316500,1316619..1316650,1316777..1316848,
                     1316929..1316987,1317050..1317062,1317135..1317230,
                     1317306..1317513,1317579..1318043)
                     /locus_tag="CNC04340"
                     /product="Rab/GTPase, putative"
                     /transcript_id="XM_569689.1"
                     /db_xref="GI:58265065"
                     /db_xref="GeneID:3256613"
     CDS             join(1316469..1316500,1316619..1316650,1316777..1316848,
                     1316929..1316987,1317050..1317062,1317135..1317230,
                     1317306..1317513,1317579..1317702)
                     /locus_tag="CNC04340"
                     /codon_star