GenomeNet

Database: RefSeq
Entry: NC_006685
LinkDB: NC_006685
Original site: NC_006685 
LOCUS       NC_006685            2105742 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 3
            sequence.
ACCESSION   NC_006685
VERSION     NC_006685.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 2105742)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 2105742)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2105742)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 2105742)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017343.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2105742
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="3"
                     /note="MAT-alpha"
     gene            1815..3872
                     /locus_tag="CNC00010"
                     /db_xref="GeneID:3256733"
     mRNA            join(1815..2196,2252..3449,3508..3872)
                     /locus_tag="CNC00010"
                     /product="hypothetical protein"
                     /transcript_id="XM_569349.2"
                     /db_xref="GeneID:3256733"
     CDS             join(1984..2196,2252..3449,3508..3809)
                     /locus_tag="CNC00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569349.1"
                     /db_xref="GeneID:3256733"
                     /translation="MIGDEQTFDDRIFRRYLDRFIQENCNYMAMATEFSHQANLKTVF
                     YDRYDKEWAKLDLVDMYRRRTGKILGAPSQSQGTSKSKKDVATTPDASLIGSVNDPSS
                     PSGRKRMLYAVIELKWMNLAALLTGEAKSQTDEKALSYLCQEGVFQTMWYVILGYAIS
                     RCIFGLSIVNEYFYRIVYLYQDSASDSPVLALEASKEFLENAGRHFGYPRDGYSVEEL
                     AELQDFWSSPPNCLISDRANATLNKETRYHLDATILLFLAHAAALPTQRFLNDLPLPF
                     AHHVPVDATAHSATDMRLKGLEVGRRRHSLRSTKRNKRTLADLYDEEKGEEDKPGDQE
                     DKSGDRKPPGKDNRNNDPRNDGSQGGNSGSGGDNSRGGGSGPGGDNLHDGGSGSGRGH
                     EGSDSRDVGGYEGSESRDDGRDPVRDGAGGPSTHRAEAADIRTPTTRQEFLRGLQKLS
                     TPGNMLDMKSSIIASLISNPHTSTSVAPSSPGVNSTTSSEDVLFPDLSLDSNGRTLVH
                     CDLSTDPLPKVHKSTPLDLDLEDIDPETGELTLAAYRDRLAMLGVRVKLVTREEMDVL
                     LARG"
     gene            complement(4524..6191)
                     /locus_tag="CNC00020"
                     /db_xref="GeneID:3256284"
     mRNA            complement(join(4524..4932,5018..5326,5385..5503,
                     5586..5755,5823..6191))
                     /locus_tag="CNC00020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569351.2"
                     /db_xref="GeneID:3256284"
     CDS             complement(join(4655..4932,5018..5326,5385..5503,
                     5586..5755,5823..6098))
                     /locus_tag="CNC00020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569351.1"
                     /db_xref="GeneID:3256284"
                     /translation="MASFTLSWGIISTGGIATTFAHDLLVDPASRNTKDVKHRIAAVG
                     SRSLQSAQSFINKLKESSEGKSWAWGVKNGVLDGVKARGTYEEVYNDPDVTAVYVGTP
                     HVFHHRNAKDALLAGKHVLLEKPACLEVEELDELIKIAKEKNLFFMEAVWTRFQPIAY
                     AVEEVIKSGILGKPRRFSADFSMDWNLDASPDSSRMVNPALGGGSLLDMSAYPSVWAM
                     LLVHRNPFNTDKDPKVLFTNQTIYPRSGVDINSRWLVEWKGLCQGMLMTDLDNAGQKD
                     STAVLQCEEGDLVVAYPPYKPETFYIHPRPSRFPGTITSSTTHHHPLHDGNNGMSYEA
                     DEVARCIRDGKIESERMPWEESRVVQGWVDKVRKEGPTETAKLVGTAGQ"
     gene            complement(7477..9961)
                     /locus_tag="CNC00030"
                     /db_xref="GeneID:3256326"
     mRNA            complement(join(7477..7762,7811..8565,8613..8876,
                     8925..9638,9716..9961))
                     /locus_tag="CNC00030"
                     /product="expressed protein"
                     /transcript_id="XM_024656640.1"
                     /db_xref="GeneID:3256326"
     CDS             complement(join(7675..7762,7811..8565,8613..8876,
                     8925..9638,9716..9901))
                     /locus_tag="CNC00030"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512334.1"
                     /db_xref="GeneID:3256326"
                     /translation="MSIHSISDTYYTGPINSTLRGFSNVVRLFGTGKAAHSDGKDVDE
                     ENSDDADIDEEGLLWDAQTALIANEPEIATRLYVQAALPPYCSPSACLALGNLLIRSS
                     VYMESPSAPISSSNELTSGRSGTSLWSKLFGTISTPQSPSSAHSSSPTRKRIDLVACG
                     WQMPKVGKRAVRDVEGMGVAGAWFVLGLGWVVRVEMEREKRLRGKVVIKPSKETFEDS
                     EEEAIFTKKKGKGNGRLHSSTIYIAPPQRADDPFPIVAGNPKTALSESTKTEESSLIG
                     TPAMGDVESLEDEDESEMESLSIMYDLLSPLLHLYRYGHIQSQDPVALPPVSLQQLPP
                     ALRPKNEADKGRNVWWLGRVVAQQLIKLDILKAAKGKGQKEQLRKAVGVSVNYIIATT
                     SPDLQAEMYFRSIASTPSIGLEYADDLVTNAKKRLQIITSTPRDEKMLRFFPFPSMLD
                     KASPPNPQKTSISSPRSILTPPKVMVQSAKSTVSLAALAGEEEVASLVAPGPKKLGAL
                     DTLKRVHEKAVMQDEEVGREEVHDEPGVSYSEVRPTIRRVSTSPHLQTHLHPPPSSSR
                     TRRRLPFELPSSEPIAPVDPVLAAAEMSSALTKHVVCNVCGMKGVNFPECRKCGLRFC
                     SRECRVGEDRAGNGKRHICGLSESRRNHGGLSHGIEYGVVGDVH"
     gene            11088..14777
                     /locus_tag="CNC00040"
                     /db_xref="GeneID:3256521"
     mRNA            join(11088..11286,11336..11405,11461..11936,11996..12132,
                     12182..12324,12382..12516,12568..12676,12745..12983,
                     13052..13167,13226..13254,13308..13386,13447..13572,
                     13626..13745,13794..13856,13901..14363,14447..14656,
                     14698..14777)
                     /locus_tag="CNC00040"
                     /product="expressed protein"
                     /transcript_id="XM_024656641.1"
                     /db_xref="GeneID:3256521"
     CDS             join(11155..11286,11336..11405,11461..11936,11996..12132,
                     12182..12324,12382..12516,12568..12676,12745..12983,
                     13052..13167,13226..13254,13308..13386,13447..13572,
                     13626..13745,13794..13856,13901..14344)
                     /locus_tag="CNC00040"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512336.1"
                     /db_xref="GeneID:3256521"
                     /translation="MSIHDSTFSALKDMGIDPMLAREAASRFHSVEPAVNWCFGDGAN
                     WQPTTVAESMYGGFNPRHREGTSVEHREVIEVFDSPSGSPKPRHSHIPLGSNNPFLPT
                     QPRSPHPASHPLPQPPLPPRSPSVRLGTQGLPVEVDDGNDSEGEELRKAIALSQNVEH
                     SVSEAAPLQDAMDVDGKRDSRERSERASGAPPPSPKSDMPGTIGVTFGPSTKDDVDGK
                     LALVPTSQNNNTTSNEDADLDKAIQESLMTASFHSASAEANKERPQPTKRGDGVPLVF
                     YSPSGRYTYVAQILQAFAAVPRIQTAFQENVDSASSGDDILTERTQALSDSFGRMIDE
                     PFSFYEIDDTAKIITEGSERNQLPPLLPTMDFQLIFIDLFERAAIPRLQGMAKDEDEL
                     NRLREECRRVFETKVTGHTPDSITSASYVTFVRQPTGNDVYTQLADVFWGPEAQTTSI
                     KKLGDVLTVYLDWKPSSAREVWKLDEEITLDRFLQSNAAWAANRRGLQAVSAGNARRI
                     KEKIESLTLHDGNNYLDSFAALIENLRTKPKNVDITRAVSREGMKGKIETILTALKTK
                     VADLEEELKEQEKAASAEAFETDDPQYNQHVFNLRAILFHDGAMVGQKHLYMYVRGKD
                     DRWWKIQEHEATEVEWEAIIGDRTGIWMEGGPYMLLYARQGDRPSSPESSPTRPSDVD
                     VPPHSNSIILESNNTLTPTLPPDYSESTSTSASNGSKSQSSDTNEKNGEGLLLMDMET
                     PEAETEWVEDAGSEANKDLMDIVMGEGGSPKKEEEIKATVHEKADEENKEVEARSTNK
                     DEDTVML"
     gene            complement(14758..15741)
                     /locus_tag="CNC00043"
                     /db_xref="GeneID:36392764"
     mRNA            complement(join(14758..14955,15026..15330,15416..15741))
                     /locus_tag="CNC00043"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658912.1"
                     /db_xref="GeneID:36392764"
     CDS             complement(join(14863..14955,15026..15330,15416..15632))
                     /locus_tag="CNC00043"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514252.1"
                     /db_xref="GeneID:36392764"
                     /translation="MGIFTPSAPAVLSPVHPPLGIHPAYTSHPQPVTLVLKERVFSFS
                     GDDFGVKDTNGQVVVRCQGKALSFKDRKVITDPNGQFLFGIRNKLIAIHKTFIGEDAH
                     GNEIFRIKKKLSFGSHLVATFHNPATNSPTTLVLKGDFWGGSADISIEGGPVVGQISR
                     KLFNAREFWGDKQTYFLTVAPGVDLALMAAVCICFDEAKNEENN"
     gene            15926..18970
                     /locus_tag="CNC00045"
                     /db_xref="GeneID:36392765"
     mRNA            join(15926..15984,16047..16505,16578..16759,16917..17402,
                     17462..17780,17887..17955,18019..18970)
                     /locus_tag="CNC00045"
                     /product="chitin synthase, putative"
                     /transcript_id="XM_024658913.1"
                     /db_xref="GeneID:36392765"
     gene            complement(16733..23643)
                     /locus_tag="CNC00050"
                     /db_xref="GeneID:3256313"
     mRNA            complement(join(16733..17608,17671..17757,17813..17935,
                     17996..18554,18606..19104,19159..19271,19329..19348,
                     19410..19466,19513..19562,19623..19850,19909..19939,
                     19996..20050,20111..20275,20333..20403,20468..20595,
                     20646..20701,20761..20807,20856..20924,20983..21109,
                     21174..21199,21256..21372,21432..21515,21571..21750,
                     21804..21847,21906..21982,22032..22185,22249..22356,
                     22407..22620,22667..23643))
                     /locus_tag="CNC00050"
                     /product="chitin synthase, putative"
                     /transcript_id="XM_024656642.1"
                     /db_xref="GeneID:3256313"
     CDS             join(17147..17402,17462..17780,17887..17955,18019..18817)
                     /locus_tag="CNC00045"
                     /codon_start=1
                     /product="chitin synthase, putative"
                     /protein_id="XP_024514253.1"
                     /db_xref="GeneID:36392765"
                     /translation="MPFKKPPLQPLSLSEMASLSSKLFSSNLFPRSLTREPRPPQLAG
                     SKLPPPAAEIDERPTARVRRFKLWNEQVGDLRVTLLDPKRRGCLAKYRMFVVPSPPRP
                     EFGRLSPSHRPFHIDPQPFRHSILPPPSLMLSSEVMINSKNDKISKKERERTHERLLE
                     HKWVLDQEHERRFRRGMAAIMEDVLEFQRSNTMPAESGIGYKWKEGVDLNCVMAFREF
                     FCAVRKDSTAIYSYLDPIDIAPVANRDEVHKMVKKVERRRKKRERKKADKKMKRETES
                     RLNEESERLKAEWEAEATRNPMDELRETTNESQITPNSEASITPFPPPAETCTQEQDD
                     EIARLITHLLYLREEKIVLGDIEDRDTRRVRKAVAAHPPEAVEMASELNWEGRGEVAA
                     MPVGDEARSTSLSLSQDSLLDAAVTYRPIFRPSSHRSYSRSSSPSFHVRSGSLNIDDD
                     TDFPPTLTPSVIPSSFFFPCPDSEHSPDTE"
     CDS             complement(join(19213..19271,19329..19348,19410..19466,
                     19513..19562,19623..19850,19909..19939,19996..20050,
                     20111..20275,20333..20403,20468..20595,20646..20701,
                     20761..20807,20856..20924,20983..21109,21174..21199,
                     21256..21372,21432..21515,21571..21750,21804..21847,
                     21906..21982,22032..22185,22249..22356,22407..22620,
                     22667..23574))
                     /locus_tag="CNC00050"
                     /codon_start=1
                     /product="chitin synthase, putative"
                     /protein_id="XP_024512337.1"
                     /db_xref="GeneID:3256313"
                     /translation="MNPGDIYQPPGGYSPARQNQRPPQPQPFPQQPYPPPPAVQYGDP
                     FSAPPQRPPAASLQNMSPAWHEPPHASHPLQPTSPTGPPAPRYSLPTQSLSPFNGSPA
                     SAPAPAPYTMGSPPNSHPPMHASPPQHIRFHANPSHLPPQQQPAPSYSYPNGIDDRLT
                     SPPPLLPHHSSQSSMSAMPAPVPDNINYGPPSYPPQGYGNAADDDMNDSRPLLAHAAP
                     DSRFGIPQSTSAMSMTAPAVRYQLSDAGAGDMGVTMYTGNGDAEGQNGFGTGDGVGAG
                     GEDEVNMHYGPVPARIVRRNRTQKRVQLFQGHLVLDIEVPTMLLEQCPIRQGNEFTKL
                     RYTAVTCDPNDFVEDMYTLRQRLYDPPRQTELFIVITMYNEDDILFCRTMRGVMQNIA
                     HLCTRSKSKTWGVNGWKKVVVCIVADGRKKINPRTRSVLAALGVYQEGVGKNMVNGKP
                     VTAHVYEYTTQLSINSSGKIGPAGSNTVPIQMLFCLKEKNQKKINSHRWFFNAFGACL
                     RPNVCVLLDVGTQPGPDSIYHLWKAFDINSSVGGACGEIVALKGMFWKNLLNPLVAAQ
                     NFEYKMSNILDKPLESVFGYITVLPGAFSAYRYIALLNDEKGNGPLKQYFVGETMHGS
                     GAGIFSSNMYLAEDRILCWELVSKRQCKWKLHYVKSAYAITDVPDTVAELVSQRRRWL
                     NGSFFAAIHSIVHFGYLYRSSHSFTRKFFLHIELVYQTLNMVFAWFALGNYFIAFFVL
                     TESLNSLGTAWKYVNTPLHYIYIALLLWCFLLSLGNRPAGSKIGYTSSMVGFALITIY
                     MLFAAIYLTVKGVEDIQAAGEVTASTVLGNKIFRNIVISLLATYGLYIISSLMALEPW
                     HMITSFFQYLLLAPSYINVLNVYAFCNVHDVSWGTKGSDKVSDDLGAVKSSDDNKDEV
                     TVDVPIEQKDINAVYAAELQILGNKAPKEVRVVNDDQKQEDYYKNVRTNVLLAWTMTN
                     GALVAAILQVSGGDSAVATTYMGVLLYTVAGLAFFRFLGSSAYLLVRLFVGE"
     gene            complement(24167..26835)
                     /locus_tag="CNC00060"
                     /db_xref="GeneID:3256561"
     mRNA            complement(join(24167..24433,24505..24590,24660..24850,
                     24917..25053,25108..25196,25251..25390,25456..25790,
                     25856..25915,25979..26035,26086..26178,26237..26360,
                     26425..26835))
                     /locus_tag="CNC00060"
                     /product="sugar transporter, putative"
                     /transcript_id="XM_569359.1"
                     /db_xref="GeneID:3256561"
     CDS             complement(join(24247..24433,24505..24590,24660..24850,
                     24917..25053,25108..25196,25251..25390,25456..25790,
                     25856..25915,25979..26035,26086..26178,26237..26360,
                     26425..26593))
                     /locus_tag="CNC00060"
                     /codon_start=1
                     /product="sugar transporter, putative"
                     /protein_id="XP_569359.1"
                     /db_xref="GeneID:3256561"
                     /translation="MVAAVANEGGGLESWADWFKKDYRRPIFFCALISIAPVAYGYDG
                     TYFTSLLETPVFVEQFGDNTGNGTYALSSSDQSLWVSIIQVGEVVGSLGAGPIGDYSG
                     RKGGIFSAIVLLAIGVVLQMIIVGSSALLTVGRLIAGMGIGIISNAAPLYLSEIPPME
                     IRGACVSSWQLMLAIGQVIGAGVGLGTHTMSSTASWRIPVALNLVWVVLLFVVLFIVP
                     ESPRWLLYKGKEAKAERALNKIHGGSEYRDVLVSEQLAILNKSREEEAEASSGESKWS
                     DLWKNPVERRKFFATVGILVSQQISGVQFIFSYTTTFFALVGISDTFIITIIVDCIEV
                     LGVIASFFVVERWGRRPLLIYTGIFMFITLLIVGAMGAVSGQGDRFEPYLADHPSLGK
                     AVAAMICLYVFAFNLSWGPLAWVVAAEMSTGRNRQKHLSIGTAMFWVSAWVVTFTLPY
                     LFQPDEAGLGPMIGFIYAFGGFLSVAFVYFFIPETQGRTLEEINFMMEARIPTRQWKG
                     YDLATVVARDEKKITRGEAEHLEKVDELERPQNKRFMSLFAADSESS"
     gene            27638..29360
                     /locus_tag="CNC00070"
                     /pseudo
                     /db_xref="GeneID:3256424"
     gene            complement(28211..30497)
                     /locus_tag="CNC00080"
                     /db_xref="GeneID:3256619"
     mRNA            complement(join(28211..28816,28943..29082,29291..29349,
                     29439..29565,29631..29660,29735..29749,29806..29883,
                     29947..30018,30081..30497))
                     /locus_tag="CNC00080"
                     /product="expressed protein"
                     /transcript_id="XM_569363.2"
                     /db_xref="GeneID:3256619"
     mRNA            complement(join(28211..28816,28943..29104,29163..29175,
                     29247..29349,29439..29565,29631..29660,29735..29749,
                     29806..29883,29947..30018,30081..30497))
                     /locus_tag="CNC00080"
                     /product="expressed protein"
                     /transcript_id="XM_569362.2"
                     /db_xref="GeneID:3256619"
     mRNA            complement(join(28211..28816,28943..29104,29163..29175,
                     29247..29349,29439..29565,29631..29660,29735..29749,
                     29806..29883,29947..30024,30081..30497))
                     /locus_tag="CNC00080"
                     /product="expressed protein"
                     /transcript_id="XM_569361.2"
                     /db_xref="GeneID:3256619"
     CDS             complement(join(28761..28816,28943..29104,29163..29175,
                     29247..29349,29439..29565,29631..29660,29735..29749,
                     29806..29883,29947..30018,30081..30402))
                     /locus_tag="CNC00080"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569362.1"
                     /db_xref="GeneID:3256619"
                     /translation="MWTLHQLTENKATRSTTGSPSRSPSPSVARKRARLSSSSPKMAP
                     SLVKKEVEEVSSGKPDSSKLEEGGDEPKPDVEREWEGFSKDVLEKWPALKKRNFWCIQ
                     RHSATALHYDLRMHLDGVTVSWAIPKGLLGISKSGEARRMAVETTLHPLWYTIHEGSD
                     GRTFGQGRQGGTLLWDIGEYTIDLPSGYIPDLDTDEEEEAENRRRFKKRRKDSESDGR
                     EEEDKFRNALHRHIGFGKSRSMHFTLKGGKKMTNHSFILVLSSNPYKYNTVSLEGKEK
                     KTWFISLPRGVDSYPWDQGGEDGDFYGRSIKSGMTFQQVCQGLADDSSQ"
     CDS             complement(join(28761..28816,28943..29104,29163..29175,
                     29247..29349,29439..29565,29631..29660,29735..29749,
                     29806..29883,29947..30024,30081..30402))
                     /locus_tag="CNC00080"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569361.1"
                     /db_xref="GeneID:3256619"
                     /translation="MWTLHQLTENKATRSTTGSPSRSPSPSVARKRARLSSSSPKMAP
                     SLVKKEVEEVSSGKPDSSKLEEGGDEPKPDVEREWEGFSKDVLEKWPALKKRNFWCIQ
                     RHSATVVALHYDLRMHLDGVTVSWAIPKGLLGISKSGEARRMAVETTLHPLWYTIHEG
                     SDGRTFGQGRQGGTLLWDIGEYTIDLPSGYIPDLDTDEEEEAENRRRFKKRRKDSESD
                     GREEEDKFRNALHRHIGFGKSRSMHFTLKGGKKMTNHSFILVLSSNPYKYNTVSLEGK
                     EKKTWFISLPRGVDSYPWDQGGEDGDFYGRSIKSGMTFQQVCQGLADDSSQ"
     CDS             complement(join(28946..29082,29291..29349,29439..29565,
                     29631..29660,29735..29749,29806..29883,29947..30018,
                     30081..30402))
                     /locus_tag="CNC00080"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569363.1"
                     /db_xref="GeneID:3256619"
                     /translation="MWTLHQLTENKATRSTTGSPSRSPSPSVARKRARLSSSSPKMAP
                     SLVKKEVEEVSSGKPDSSKLEEGGDEPKPDVEREWEGFSKDVLEKWPALKKRNFWCIQ
                     RHSATALHYDLRMHLDGVTVSWAIPKGLLGISKSGEARRMAVETTLHPLWYTIHEGSD
                     GRTFGQGRQGGTLLWDIGEYTIDLPSGYIPDLDTDEEEEAENRRRFKKRRKDSESDGR
                     EEEDKFRNALHRHIGFAIPTSTIPLAWKEKKKRRGSLVFPEEWIAIRGTRAGKMAISM
                     EGA"
     gene            30689..32652
                     /locus_tag="CNC00090"
                     /db_xref="GeneID:3256787"
     mRNA            join(30689..31333,31400..32652)
                     /locus_tag="CNC00090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656643.1"
                     /db_xref="GeneID:3256787"
     CDS             join(30765..31333,31400..31421)
                     /locus_tag="CNC00090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512340.1"
                     /db_xref="GeneID:3256787"
                     /translation="MSPLTPNPLSTLRVTKKQIPSYQNFPNTALHRHPLIIYHSAYPS
                     SLTADQVEKHLSSVGVVKPAWRFPMYRQHHYHSNTHELLVVVSGAGTLCFGGPRDEEN
                     KSRTEIDVEKGDAMLVPSGVAHAMIEDKGGFSMVGSYPIGAKNWDMCTGQDGEKNDAW
                     ETVKGVKWFDKDPIYGDEGPAINTREGDANSKHGMP"
     gene            complement(30896..33898)
                     /locus_tag="CNC00100"
                     /db_xref="GeneID:3256178"
     mRNA            complement(join(30896..31527,31588..32636,32687..33898))
                     /locus_tag="CNC00100"
                     /product="RNA helicase, putative"
                     /transcript_id="XM_024656644.1"
                     /db_xref="GeneID:3256178"
     CDS             complement(join(31726..32636,32687..33851))
                     /locus_tag="CNC00100"
                     /codon_start=1
                     /product="RNA helicase, putative"
                     /protein_id="XP_024512342.1"
                     /db_xref="GeneID:3256178"
                     /translation="MLIGQVSRLSAIPPLALQHTLRPLHSSSVLAAGGKRPKQSPSHS
                     RNSPRQKPDWEKRGSNRGRSEQPRASRFGLKSSGTTSFRSEPPRARRVISDSSSGSSA
                     SITPKGQHVPTSSRRLLPFSSSDTIPKPSHRFKLEPATMPPNLTPRSFNRDDGVTEEY
                     INGLPAYPTPPTTLANEEQARPRTFDDFGLEEGLVKSLKGLYGEDGKTTPIETLSFHH
                     FTQPDIASAPIGSQRVLLGAETGSGKTVSYLIPLFHHLKRTDPGPSVTSSFFADSENT
                     LHPRSIILSPTHELTRQSTQFAKILTHNTKLSVHGMSSTVSGGVGEKRGSVDVLLGTV
                     GSLRRMFGMTRSEEEQEKEDYIRGKRIWQDEQEKGMVEGDKVEWVVIDEADVLLGREF
                     YLDTISVLSQVKQANLILCTATLPPFLINLLTTNPFFTKKEPFIHLLSPGLHKLPPKL
                     LTRFIRPSTTGNKHGDVAHQVRLTLAEDAKAAKAEGREGEEPSKIVIFCNSDKQVEQV
                     SGILGTKKIDCLAWTGAGEERLRGRNGSLNDFLQRPHLPGHEPPAPLPSLEPRETKPI
                     FQDKNGTTPNVSQVTRRRVLVTTSLLSRGLDFHPSVSSVFLVQPPRDVLDFVHRAGRA
                     GRAGRPGRVVVFGIDEGGTLGEGAKNNKGGKGQGPLKKDGKTALGDRLKDVLGKREVV
                     GAMGKRVRT"
     gene            34883..36965
                     /locus_tag="CNC00110"
                     /db_xref="GeneID:3256192"
     mRNA            join(34883..35155,35246..35344,35402..35465,35543..35633,
                     35683..35843,35898..35967,36212..36329,36385..36466,
                     36525..36965)
                     /locus_tag="CNC00110"
                     /product="fatty acid elongase, putative"
                     /transcript_id="XM_569369.2"
                     /db_xref="GeneID:3256192"
     CDS             join(34950..35155,35246..35344,35402..35465,35543..35633,
                     35683..35843,35898..35967,36212..36329,36385..36466,
                     36525..36527)
                     /locus_tag="CNC00110"
                     /codon_start=1
                     /product="fatty acid elongase, putative"
                     /protein_id="XP_569369.1"
                     /db_xref="GeneID:3256192"
                     /translation="MFPFDAWTPGPGPVYTAITSVWDALDLPHPALGYRTWIPGESPL
                     STQKAVVAAVGTYLLIIFGGREMMKNRQPFKLKIPFQIHNVYLTLGSGLLLALMLEEI
                     IPLFLKHGFFWSICNTSAFTPRLVTYYMINYYFKYVELIDTVFLVLKKKPLAFLHVFH
                     HAATAVLCYTQLNGETSVQWVVITLNLTVHVIMYYYYYATAGGAKIWWKKYLTTLQIT
                     QFIIDLFIVFFATYSHFAFKYGVPAVGDCAGSEGAALFGCGLLGSYLVLFIAFYKATY
                     KKGVAKGKGKATEIRGSSKSK"
     gene            complement(36983..38669)
                     /locus_tag="CNC00120"
                     /db_xref="GeneID:3256434"
     mRNA            complement(join(36983..38090,38130..38339,38384..38669))
                     /locus_tag="CNC00120"
                     /product="manganese ion homeostasis-related protein,
                     putative"
                     /transcript_id="XM_569373.2"
                     /db_xref="GeneID:3256434"
     CDS             complement(join(37321..38090,38130..38339,38384..38648))
                     /locus_tag="CNC00120"
                     /codon_start=1
                     /product="manganese ion homeostasis-related protein,
                     putative"
                     /protein_id="XP_569373.1"
                     /db_xref="GeneID:3256434"
                     /translation="MPISFSRLAIALGIASIILLPFAYASSGDRNPTFQHCLRGCAAT
                     YCDPSQPPIAFYLRLFGWTCAENCAYHCSHSFTDKIGPGSRYHQFYGKWAFYRLGPFQ
                     EPFSIIMSLGNLLVNLQGVSAVRRRIRSENKLRKWLVSLGFVQVNTWIWSAVFHARDK
                     PWTERLDYFSATLTIAFTLLYSIIRILHFQTPLYTSRFLLPACVAVALLVLSHFKYIL
                     SFPLGQFPYGYHTMFNLCLGLIHNLLWVLWSFSFRFPYPTLRFGRFLSLSFPYPYPPH
                     NPYKNPSPKESSTPAVLVGLTTLAMSLELWDFAPLFRVIDAHSLWHTATIPLTMGWWH
                     FLMADALELEGSLMGQGGMGVGLLEEPIGRRRGGGPLERDADMPMTPTFQELDSGRVK
                     LTSSSPSPGTRMRISPKSSEFK"
     gene            38862..41834
                     /locus_tag="CNC00130"
                     /db_xref="GeneID:3256252"
     mRNA            join(38862..39229,39276..39781,39824..39881,39934..40180,
                     40230..40316,40369..40574,40632..40689,40773..40883,
                     40999..41125,41197..41834)
                     /locus_tag="CNC00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_569375.2"
                     /db_xref="GeneID:3256252"
     CDS             join(38990..39229,39276..39781,39824..39881,39934..40180,
                     40230..40316,40369..40574,40632..40689,40773..40883,
                     40999..41108)
                     /locus_tag="CNC00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569375.1"
                     /db_xref="GeneID:3256252"
                     /translation="MPSIRESRAPIEPDDVWEHSNSDPEGNHDFNNVLHIDYIEGEAL
                     ENMSENAMLLGETSAPMEYDHRLRRGRGWVTISGFSLPKPLLYLLAVPPLLILVNLVA
                     STYNSARPHAHYRHPTLTNGTHPFHPTILLLSLDGFRSSYLSTHAHLLPNLLFLSSSK
                     WGLRAESMQPVFPTLTFPNHWSLMTGLYPSSHGIVANDFWDPLFDEKENKGAQFVYTE
                     ESKSWDSRWWWGEPIWEVVEKVGRKAAVIMWPGPPVTRAGASPSYFVPYRNLPPSSKL
                     SQIFAYLDHPLPTRPEFIASYFPEIDQSAHRHGPDAPQVEEKLRMMDEMVGGLLRGLE
                     ERNLTGVVDLLIVSDHGMTGTSNERIIYLDDILGEDGIEAIEHKDGWPSVGLRFSPTS
                     NHSLYLSRLLSAAEASNGTFAVYTPDTMPQRWHFTGGRRIAPIYVVPDIGWAVTDRHE
                     HEVLFQGDYQPRGNHGYDNKYADMQAIFFAHGPFARTLKDMGKGFISHDPPVLHSFKN
                     LEIFSLVTRLLSLRDVEPGHNGTIGFWEGLLD"
     gene            complement(41214..42618)
                     /locus_tag="CNC00133"
                     /db_xref="GeneID:36392766"
     mRNA            complement(join(41214..41508,41579..42618))
                     /locus_tag="CNC00133"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658914.1"
                     /db_xref="GeneID:36392766"
     CDS             complement(join(41237..41508,41579..42479))
                     /locus_tag="CNC00133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514254.1"
                     /db_xref="GeneID:36392766"
                     /translation="MSFLFTRRSSVPLSSAGIPFPPGPRATGSSFSSFSRPQHISLNS
                     PVWNNPSNSSGNPTNFSIPQQQPFNGYGAGQSFYSSQPSAAPTYFGTRIGAPPNFRVV
                     QVPAPWVPGTKPSNLMNNQSDTTNDHNQKTSPKESTFWDSPTQQRSCTPGNSRSVKDM
                     YKDWLSGQAEDARSIVNECISKVKQSRYEVGGSTRRTDAVMGEAKRISAFISTHVAQL
                     SDASLETDVATLSSLVDEISRDLEAERVSRRTLNDNLTKTTNAVNRAHRLAEERTKAD
                     SDPDLARSRNLWQTYKEFVPRSEKSQALRSDWEVFMDSRKDETTESILSHADQKAFFP
                     HHASMNSTFTGSGTLPYTYCSGQSEPFSQRFASSSVRGPPPSYRQPRTFQSSMFGR"
     gene            42425..43719
                     /locus_tag="CNC00135"
                     /db_xref="GeneID:36392767"
     mRNA            join(42425..42482,42546..42686,42733..42924,42991..43077,
                     43133..43719)
                     /locus_tag="CNC00135"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658915.1"
                     /db_xref="GeneID:36392767"
     CDS             join(42673..42686,42733..42924,42991..43077,43133..43136)
                     /locus_tag="CNC00135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514255.1"
                     /db_xref="GeneID:36392767"
                     /translation="MVIVVFISPPTVLPLILSSSSCIQSPNVRLCTTSNLLNRSFIYS
                     AALYLLHTVVKHLFSLIETFSVVSIAQAKAQPQRSKQAMPSSWINANWDSRQKG"
     gene            complement(43185..47447)
                     /locus_tag="CNC00140"
                     /db_xref="GeneID:3256766"
     mRNA            complement(join(43185..43742,43793..45692,45754..46141,
                     46207..46473,46530..46600,46662..47092,47142..47197,
                     47263..47447))
                     /locus_tag="CNC00140"
                     /product="expressed protein"
                     /transcript_id="XM_024656645.1"
                     /db_xref="GeneID:3256766"
     CDS             complement(join(45448..45692,45754..46141,46207..46473,
                     46530..46600,46662..47092,47142..47197,47263..47334))
                     /locus_tag="CNC00140"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512343.1"
                     /db_xref="GeneID:3256766"
                     /translation="MITPEEQKQVTRKLTHWIESESKIVTYRTVSREIGCHVNVAKNI
                     LLRHFEANPSLAATYLLTGPLLSNSVLTQTTIQSGTTSKDGKSLRDLGDGMVKIVDMD
                     QNSDAGDSDVEGLESQSQGQSKAQRIGLMGTDDEDERMDGVGNDRGAQVGDGGIGGGK
                     RLGELGFKRERVKRWGVVLATAEALEEKKTLFDESELNIHIYALSPAPVKDPAQFLIA
                     SLELHDNANMYNSSIYGSITGHAFKPSAKPNPLAPAKPPIKEAAAPSIFARGPKEKMV
                     KEQTKKEVKKQGSTKDVKDEPLQSRSSTSATTAPAKNKAQPLNKSNSKKRVINSDTEE
                     DEPGPAKAKASTPTSKGGSSKTALEPTSSMVAREDKAALEAMAGMDVDFSDNEEPLAA
                     RPKAKEEARPLRKSATGRKVRRVKKTKREKDDKGYFVSKDYWTDESYSGESEPEQVET
                     QPRAQPASKRGGSKPPMKARESASSVGSGSGAGAGGNMKKSAGKPTGGQSTLMGFFKK
                     K"
     gene            48001..50650
                     /locus_tag="CNC00150"
                     /pseudo
                     /db_xref="GeneID:3256242"
     gene            complement(50637..52806)
                     /locus_tag="CNC00160"
                     /db_xref="GeneID:3256354"
     mRNA            complement(join(50637..50947,51005..51153,51206..51489,
                     51545..51955,52012..52208,52262..52393,52610..52625,
                     52720..52806))
                     /locus_tag="CNC00160"
                     /product="phosphopyruvate hydratase, putative"
                     /transcript_id="XM_569379.2"
                     /db_xref="GeneID:3256354"
     CDS             complement(join(50835..50947,51005..51153,51206..51489,
                     51545..51955,52012..52208,52262..52393,52610..52625,
                     52720..52752))
                     /locus_tag="CNC00160"
                     /codon_start=1
                     /product="phosphopyruvate hydratase, putative"
                     /protein_id="XP_569379.1"
                     /db_xref="GeneID:3256354"
                     /translation="MSVVTKVHARQIFDSRGNPTVEVDLYTEKGLFRAEVPSGASTGA
                     HEAVELRDKGSDYMGKGVLKAVENVNKVIAPALIDSKLPVTSQKEIDDLLIKLDGTEN
                     KGKLGANAILGVSMAVSEAAAADKGVPLYGYLAQLAGVSEPYVLPVPAFNVINGGSHA
                     GNALAFQEFMLLPTGASSFTEAMKMGSETYHTLKKVITKKYGIDAANVGDEGGFAPNV
                     SGAEESLDLLTEAIKQAGYTGKVQIGLDVASSEFFKEGKYDLDFKNPNSDSSKWLSGK
                     ELADLYHGYCEKYDICSIEDPFHEDDFDAWAAYNQTAKIQIVGDDLLVTNPRRIKMAI
                     EKKACNALLLKINQIGTISESIQAVQLAQSNGWGVMTSHRSGETESTYIADLAVALRT
                     GEIKTGAPCRSERMAKYNQLLRIEEQLEGKSIFAGGKGLSKGTTAPELHSSK"
     gene            complement(53465..55500)
                     /locus_tag="CNC00170"
                     /db_xref="GeneID:3256132"
     mRNA            complement(join(53465..53508,53553..53886,53948..54044,
                     54134..54264,54357..54481,54538..54542,54592..54708,
                     54772..55037,55091..55099,55146..55250,55308..55500))
                     /locus_tag="CNC00170"
                     /product="expressed protein"
                     /transcript_id="XM_024656646.1"
                     /db_xref="GeneID:3256132"
     CDS             complement(join(53564..53886,53948..54044,54134..54264,
                     54357..54481,54538..54542,54592..54708,54772..55037,
                     55091..55099,55146..55250,55308..55443))
                     /locus_tag="CNC00170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512344.1"
                     /db_xref="GeneID:3256132"
                     /translation="MRFTAPRPNNFALALLPAALTLLLLLYLWTVSHRPPVPEKAKIE
                     NPHRWGFPEWYGKGPTPYDPESGLSVEKQKSVLLFIDLPYDSLSIPKALSTLQILRND
                     PSIRLSVISPFSSTWDHQSTPQENLESAGCENVDRLWRIGEYSGEVEGCEGVVWISEG
                     MDRRARVDGRANVILAQQPFDILRDEVSYDRLKESLGEDWELGLLSYIPPAADPSIFY
                     PEETPSYKSVTYFPLSSTPERKHPRMPWTGKWSKYTPSRKPPPPTKAGQDPLSPDSAY
                     IKHWRKEDKRRAKAMRKAGICLFEGWQDGQLDERMVEAMMAGCVVATVPPQTDYDMLK
                     PLILPLSPPSSSASPLSLPVKQISTLLASPRASQRLTYKALHAFLAARHHFTVQTRFE
                     RVWNVVKGWEEGKRGYDFDEGLMGFRWDCGTVMDGDAGRPAWCKD"
     gene            complement(55540..57294)
                     /locus_tag="CNC00180"
                     /db_xref="GeneID:3256576"
     mRNA            complement(join(55540..55751,55801..56340,56393..56783,
                     56850..57022,57102..57294))
                     /locus_tag="CNC00180"
                     /product="histone lysine N-methyltransferase, putative"
                     /transcript_id="XM_569384.2"
                     /db_xref="GeneID:3256576"
     CDS             complement(join(55695..55751,55801..56340,56393..56783,
                     56850..57022,57102..57215))
                     /locus_tag="CNC00180"
                     /codon_start=1
                     /product="histone lysine N-methyltransferase, putative"
                     /protein_id="XP_569384.1"
                     /db_xref="GeneID:3256576"
                     /translation="MDTPGAGPSRQSSSAPAANNKLDPNVKPGTVLLTSDLLSSFQPA
                     KRFKDAVLEPTSTPSGPKTHSVTTLTFDDTGDRLISAGDDNQFILWDARKGKKIKSFY
                     SKKYGIDHVRSTHKTGTILHASTQGGDHAVRYHSTHDNAYLAYFKGHTARVRSIDMSP
                     ADDSFVTAGDDGTVRLWDLRANACKGLVNDVGGSAIAAMDNTGVVFAVACSDTQTIMM
                     YATKTADVHPFIHQGLIDIALEDISTPPPKPIFTSLHFSNNGQYLLVGTSSDVHYVLD
                     AIYLTPLRRLVGHVGLERDAQGNKGVEPRRGISGEELCWTADSNWVISGSANGEVVAW
                     DLRPEPGQSQLTRSDVAGGNWHTANPPDWTTLRIPDLKPKVVLHGDGAGSGPTRAVKF
                     NPRYNLMAVGGYDLTLWMPIKDEEARLAAEGW"
     gene            complement(57431..59058)
                     /locus_tag="CNC00190"
                     /db_xref="GeneID:3256261"
     mRNA            complement(join(57431..58142,58204..58214,58285..58390,
                     58470..58496,58560..58642,58697..58782,58863..58875,
                     58943..59058))
                     /locus_tag="CNC00190"
                     /product="hydrolase, putative"
                     /transcript_id="XM_569386.2"
                     /db_xref="GeneID:3256261"
     CDS             complement(join(58089..58142,58204..58214,58285..58390,
                     58470..58496,58560..58642,58697..58782,58863..58875,
                     58943..58985))
                     /locus_tag="CNC00190"
                     /codon_start=1
                     /product="hydrolase, putative"
                     /protein_id="XP_569386.1"
                     /db_xref="GeneID:3256261"
                     /translation="MASLASCIFCKIIKGEIPSMKLLETESVFAFMDVGPIARGHCLV
                     IPKQHAATFTELPDEAMVDILPTCKKLAAATGAENYNILQNNGRPAHQVVDHVHFHVI
                     PKPAEAGDKEGLVIGWPTQKDLSKDEISKIFEQMKSRL"
     gene            59302..60425
                     /locus_tag="CNC00200"
                     /db_xref="GeneID:3256144"
     mRNA            join(59302..59632,59693..59895,59975..60077,60125..60425)
                     /locus_tag="CNC00200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656647.1"
                     /db_xref="GeneID:3256144"
     CDS             join(59405..59632,59693..59895,59975..60077,60125..60418)
                     /locus_tag="CNC00200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512346.1"
                     /db_xref="GeneID:3256144"
                     /translation="MSHSPNLTSHDPNAYRTHASFVFSAANSAPVLGLLDPKPGEKII
                     DLGCGTGEITIAIKEVVGQQGTVIGVDANQSMLDSAASSGPSTIRWIQADIQAAQSFS
                     KAHPEYEAAFDAVFTSATLHWCKDSPEGVVQLIRWLLKPGGRCGVRAALHHAIRAKGI
                     DPVPLDPWYFPTAKQYEKVLQSGGLIPSNVHLVPRPTPLPTTLEGWLVTFARNSFLSS
                     FSDDEAKAIMKEVVGICRVDNYWSDENPGTGVKGSGEGGESGWEVLYVRLRGVGKKP"
     gene            complement(60412..62363)
                     /locus_tag="CNC00210"
                     /db_xref="GeneID:3256234"
     mRNA            complement(join(60412..60812,60868..60873,60930..61229,
                     61288..61581,61637..62363))
                     /locus_tag="CNC00210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569390.2"
                     /db_xref="GeneID:3256234"
     CDS             complement(join(60480..60812,60868..60873,60930..61229,
                     61288..61581,61637..62293))
                     /locus_tag="CNC00210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569390.1"
                     /db_xref="GeneID:3256234"
                     /translation="MPYYAPRPAFRNGLRSATSLLPWNTPAKVHFNSLRISFYSSALM
                     PYSSEKNYPSFVSRPFTFSHRLSSDCSTQVGGGGDSVGMSRLPSPLFAPIPLRHFRSK
                     GLRNFLPRKRLFSSTPTTASLLPPSPAASDAEMMSDSEESEAVRQGKRISKELMTTSS
                     AGGGRYVRIVDVSPRDGLQNLKGKPVPTEVKRELVERLLEAGVRNIEVGSFVRSDWVP
                     QMADTPQLLPLLPPFTGKTLSPPSPVSRSESPFSGRPSSPSIGPLIGEHLPPHAEDVH
                     YPVLVPNMRGLDNLIKLQEEWSSKGLPALTDEIAVFVSATEAFSQANNHAPISKVLDS
                     LPSVINKAKSHRFRVRGYVSCVITCPYSGPTDPNQAVDVAERLLQMGCYEVSMGDTTG
                     EGDPDSWKILWDRMKDRGLDMDKIAAHCHDTFSLALSSILSLVPYGLKTIDSSLAGLG
                     GCPYSPGATGNVPTEDVVYALHKMGYETSIDLDRLVESGNWLAKTLGVRNESRVGRAI
                     WARRQRREEIEGKGAETEDGM"
     gene            complement(62618..65352)
                     /locus_tag="CNC00220"
                     /db_xref="GeneID:3256812"
     mRNA            complement(join(62618..63062,63127..63587,63643..63731,
                     63781..63913,63970..64418,64470..64604,64669..64913,
                     65072..65094,65152..65352))
                     /locus_tag="CNC00220"
                     /product="CTP synthase, putative"
                     /transcript_id="XM_569392.1"
                     /db_xref="GeneID:3256812"
     CDS             complement(join(62758..63062,63127..63587,63643..63731,
                     63781..63913,63970..64418,64470..64604,64669..64913,
                     65072..65094,65152..65189))
                     /locus_tag="CNC00220"
                     /codon_start=1
                     /product="CTP synthase, putative"
                     /protein_id="XP_569392.1"
                     /db_xref="GeneID:3256812"
                     /translation="MVKYILVCGGVISGIGKGVIASSTGLILKTAGLKVTSIKIDPYM
                     NIDAGTMAPTEHGEVYVLNDGGETDLDLGNYERYLDVSLNKDNNVTTGKVYQHVIDRE
                     RRGDYLGKTVQIVPHLTNAIQDWVERVSKVPVDETGEEPDVCIIELGGTVGDIESMPF
                     IEAMRQFQFRVGHENFALVYVSLIPVVGGEQKTKPTQAGVRDLRGLGLLPDLIACRCT
                     EKLLTATMEKVSMFCHVSPRQVLGVHNVSSTYHVPLLLQEQGMLKFLWERLSLSSINM
                     RPELKARGEKIMEKWQVLTTGLERCFETVEIVLVGKYITLEDSYMSVVKSLEHAAMRC
                     GRKLILHWVDSSDLELTMQTENPIKFHNAWQAVCSARGIIVPGGFGLRGTEGMIAAAK
                     WAREQNIPYLGICLGFQVAVIEWARHVCGLEKANSAELVPDSPHPVICFMPEISKTHM
                     GGTMRLGLRPTIFEPNTEKSKLRRLYGSRNIAWERHRHRYEVEPKYVEQLEAPGGMRF
                     IGKDERGERMQMLELDDHPYFVGLQAHPEFCSRPLNPSPPFVGLIAAACGLDVLEEQL
                     ANNEKNYVDPHPESDKVIPESEAATQAGKGKSQSVEGVRVKHEDVVDALGKKLDEVAE
                     I"
     gene            complement(65585..66969)
                     /locus_tag="CNC00230"
                     /db_xref="GeneID:3256666"
     mRNA            complement(join(65585..65977,66042..66164,66251..66363,
                     66422..66462,66568..66595,66669..66730,66867..66969))
                     /locus_tag="CNC00230"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_024656648.1"
                     /db_xref="GeneID:3256666"
     CDS             complement(join(65944..65977,66042..66164,66251..66363,
                     66422..66462,66568..66595,66669..66730,66867..66879))
                     /locus_tag="CNC00230"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_024512348.1"
                     /db_xref="GeneID:3256666"
                     /translation="MGGEGWLFLFAVLMAAVLLFTMVFFIIMFSDLECDYINPIDLCN
                     KLNQFVLPEMIAHAFLTLCFLLSGQWLAFLLNAPLVAYNVNKIMSKNHMYDATEIFRT
                     LSGHKKESFIKLGFYLISFFYYLYRMILALISESD"
     gene            67122..68124
                     /locus_tag="CNC00240"
                     /db_xref="GeneID:3256640"
     mRNA            join(67122..67324,67391..67659,67728..68124)
                     /locus_tag="CNC00240"
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /transcript_id="XM_569396.2"
                     /db_xref="GeneID:3256640"
     CDS             join(67161..67324,67391..67659,67728..67936)
                     /locus_tag="CNC00240"
                     /codon_start=1
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /protein_id="XP_569396.1"
                     /db_xref="GeneID:3256640"
                     /translation="MANPRQRNKAKSSRTQKPSLNAKRRMHQKLRKAPPLKGPEVLQE
                     KWDKKKTVFQNYAALGLLPSIPVSKGASTSRSQRVKLPEVPAEAEAQNVKVGFGRIIR
                     DEEGNVIDIIIDEDEEKQEEEQIEVDEEKELEPVEAKTEVVKRLEELAASAAPVKRHS
                     SMSERTWLQQLVDKYGDDTERMARDRKLNVWQKTEGEIKRMIKKAGGVQMLRK"
     gene            complement(68102..74878)
                     /locus_tag="CNC00250"
                     /db_xref="GeneID:3256448"
     mRNA            complement(join(68102..68465,68534..69096,69167..70172,
                     70228..71265,71313..71836,71893..73884,73938..74878))
                     /locus_tag="CNC00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656649.1"
                     /db_xref="GeneID:3256448"
     CDS             complement(join(68334..68465,68534..69096,69167..70172,
                     70228..71265,71313..71836,71893..73884,73938..74322))
                     /locus_tag="CNC00250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512351.1"
                     /db_xref="GeneID:3256448"
                     /translation="MPNISESIDSVMEGVKGLVNMAEGYLAPASDEGEASVPPPRPQS
                     QPLHIPSTHRNTTSKFALPQQSQLVQTIDVPSGWIHLQAAYLDGDGGQRQVRPFGLRN
                     LTEEEVEVEVESDLKQLLFWASDDEKSIPSSASSTSSLSTNAGLPSLQITIPASSTVT
                     LFIAFQPTVSLPPFPLNPLPPTGTIDDGGYTPRVKPILSRTNSFELSPVGLSVSDSTE
                     SGQSLQSVAGNIRETHVAKRPEPIHRAFSVHGSVSIQAITATSHQSIALPFFATVCRS
                     VFTAGPIEPVSGLVTGSQQSSGDLVVDFGSENVMGKKYHRDILLVNRSEIELVWTTHV
                     VSAPHKDSVWFELRDLDSENVFGVDHSSQPVPLPALSSRHLRLSLRSKAPVNDFEFSF
                     LLSNSNQAGNIVTCKAIGSILPTTADDSLKILSGPTLDFGEITDKVWARQTISVRNVG
                     DRTLDVRFGKSEGVEVVFRLAGVAGEDVDEDLPIERSMGISSAKEKGLGLSRTSTREV
                     AYPADHPHVHSTSLEQGKDEGGNENTEKWKEREMSQSGGSRPLSRITSRTSSSHQGPY
                     HLEGFESESEDVEAPFFGGGGGGGGTGSGGQDGQLSLLGSHPRVMASPTIPAPTEQQV
                     IPNQIEEITMRPGTEYRISVLHRPASLGPSAAPEIAGTLRKSSFKIYLDSIPSSLRSS
                     HATHTSTRRTISATVSSCTSLIRLVSGNVVDFGQVTVGASKSTTIKIENLSELSTKVE
                     IAAMSKVLSVNKSVIVIPPKEVVEEKMEFFPRRINEKYEKQIFIRNLLNRANDQLVEI
                     KSRNVDVYNLTLHSHLYRILTPSGSNFLDFGSVVINSPTVRIINIENLSRAPLVLDLS
                     ASQPEDIELFVKAEDSSAAKALASGKYAEEAQSSSHGGERPGGTGELKERFMEELNEK
                     SSNGGSIKSKKGREKNGGRAKEENGEEIGGKKGSIAASVATALKKGSRGKPVQLYGNS
                     VVFKDRSLLEPHEYLDLASGPPVAAHRSSPHSKRTQLLESIELEDKSKLSGQHPKVPK
                     LDFAAGAKATGAVGKEGKKRRQAQEHSHHHTQHHSHPSQARTAPGTGQHTPKTPDKTK
                     PHLGSFALINRLLPQVTDGGLKSPALTAKRIEPPLDNPPAAPTDPSKMTPDQLLLAIE
                     QHDAKKSSMTHTTLEEEEAFVRRTIALRKELQNLIANNRLIPAQTLRVAPGASRSLIV
                     IMTPNSSIRPHISTRAKRADSRIFIKLLEFDKSLLNSARSGPGITPGPGSRKQLGGDQ
                     DMEVLEGVELPIRDLIIRSSCVRSVLEVQQSSINFGACDKGEVKSKTIVIHNKSDCIG
                     LFRLRTSGSIASGDLKLGLGRYGVISAFGRKQFDNFSFTPSLVGNYQENITIENVLDS
                     WNDQPLAVKATVRKVPTFKVDPLSLDFGVVEKSTRKPETKGFVITNVSKHERTFVISV
                     QDLVPNSFAEIHLIQDEKDAGTALSRVEEEELEALLQKLKIARRKGKAEKIAKYETRL
                     LELGVPKPQLNAGAEGEVGKDGQEEESSASVAGKVIAEIASSVLTTLKDTKADLPKEC
                     ITKLNLTLAPKQKSNILVDLIPRNPSSSADDGQKDESSIDVSASITIHDRKNTDETVS
                     VNVMASRMAKPVRSRTMDTSNSSGQEDMDGHVTPSATSNPTDLALIRHCLQLTLNCEV
                     SPTAFCVGSTLFLPSSSSYYPPLKSHFDAFPQSVVGEPKGLILADGWSRQIPGNTHAE
                     ANALTNFKTKYADILSDDDGDDEGQREGEGFIEGRGYEQREGSSGVEDKVEGEESGST
                     VSSKEVIQLPPIDMVLKDAICFATMEPCSYRTSGGPSCALELVRAGVKAVYLGVEEPP
                     DFVECEGVRILQDGGVRVVRVVGLEEDCLKAARRGRT"
     gene            75347..79257
                     /locus_tag="CNC00260"
                     /db_xref="GeneID:3256134"
     mRNA            join(75347..75752,75809..75903,75990..76107,76158..76250,
                     76308..77390,77436..78092,78147..78269,78327..79257)
                     /locus_tag="CNC00260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569400.2"
                     /db_xref="GeneID:3256134"
     CDS             join(75579..75752,75809..75903,75990..76107,76158..76250,
                     76308..77390,77436..78092,78147..78269,78327..79085)
                     /locus_tag="CNC00260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569400.1"
                     /db_xref="GeneID:3256134"
                     /translation="MPRKALPPVAVAPVDALRPPPPPSPIVQTLRKDWRWAAISQFIA
                     TFSDAFGLLDWDIEVLEKDFDGDETALIPTLVAKLLFALTYNRQINSENAFEQLRKQY
                     LKRAPETTLLGTVEEPVEWAALGLSQKVGILHQLCEWQMDDPARFRGLLKTEDDAVSW
                     RIEPVGWDKSGNIYWLFDDNRLWIQRTPPLPPAPPKKSSLKAKRALKRARNNINNTSK
                     SNSKFKAKPAPKPKPKTKPSTSTPRPKGPPVKREPTPPPEEISGSRRRAPVAFYGNPT
                     PTALALKRGAVFPPASGGTPTNGRATRSSARISGVNGNSTDQSTAIGATPSKTAKKTQ
                     LPLGTRVSRRLRNVDDEWQQVPDEWLDGAKEDHADTEDASDGEKEEEGDDDESELSDL
                     TDEEEHAAEVEAVKARESQENGQPKKNRRKAVKEEVEEKVEEVADADSPLSELPEPDP
                     EPIVEQDDEEDEYNPDEDVEQDDAMDVDETEPKQEEEEDDAEEDGEEEEDIIKAAIKE
                     ANNLPEGFIEWETVCVTLYDWRTFPEQFAKSKHPDEKALYKLLHDQVGPTIIEQLTEK
                     EKERLKQEAFLNRKRSSRIATKELEKEEAVRREQAQREMEERMERTRKEEMRKAKEEA
                     EALAREKAREDRLKEREERAQAREEAALRKAEEEQKAKEKEERRREKRKRRREGEIVS
                     DDSEDESSQAPSRRSRTMTPSHMGETTNQKSKVGAGKAVAGNRWELGCEVCGMHGWNI
                     DGDKDLVSCDECGKWQHVECLDRLDRSQGRVRRNWSKVDFTCKECQQRAANKRLRIES
                     LTHANSRPIPVIPSPLAPRPTPPHPYPHPRPHSAHQQQQSPPYPILPGSAPGPQPLLN
                     PSRPPPPPLQAGQYYLPYPPESRSPAQPAGYAVYYPPGDPRHDTTAPQPHHQHQPHQE
                     RRISGQGNNRRASAEGYAPSPTGVTPGYASPHVQAHAYPTAPQYSSLAPSPSSGAAYP
                     PTAYSHPQIQTQAPRPIQVHQAHLMPSHLPTTARYPHQPQMQAGAVGHVPPDPRLQDT
                     RQQ"
     gene            complement(79456..81863)
                     /locus_tag="CNC00270"
                     /db_xref="GeneID:3256761"
     mRNA            complement(join(79456..80521,80568..81240,81294..81334,
                     81393..81863))
                     /locus_tag="CNC00270"
                     /product="multiple drug resistance protein, putative"
                     /transcript_id="XM_569402.2"
                     /db_xref="GeneID:3256761"
     CDS             complement(join(79556..80521,80568..81240,81294..81334,
                     81393..81641))
                     /locus_tag="CNC00270"
                     /codon_start=1
                     /product="multiple drug resistance protein, putative"
                     /protein_id="XP_569402.1"
                     /db_xref="GeneID:3256761"
                     /translation="MSIVSDVTQVDGRTRSKFTADDKPLSSYTLKKYPWRPYVTPFEE
                     IIGKKYPGSGTNEDPYIVDWLSNDKEDPQSWPGTYKWFTIFIVSSMTLAVALSSSAYS
                     GGIESLIKELGASRELLIAGISLFVVGFAFGPLFWAPLSEVFGRRYIYIASYALLTLW
                     SGAAAGAPNVGALLVFRFLAGFFGSSPLANAGGTISDVLDANQRGLGMAFFSAAPFLG
                     PSLGPITGGFLGLTSGWRWVEGFLTIFCGVLFIIGIVFCGETYAPVILRARAKRLSQV
                     TGDVYRFRADAKKPLNVTSMFRMSLIRPWKFLFLEPIVTILSLYTALIYGILYLFFAA
                     YPIIFQSGHGWNTGVGGLAFLGVLVGTVLSVLLSIFISNPQYIKVAKKKGGRADPEDR
                     LPPAMWGGVLIVIGLAGTAATDGPDIHWIAPIIFGVPFGCGIIVVFLSILGYLVDSYT
                     IYAASVLAANSVLRSLFGAAFPLFTVQMFDKMGVHWGVALPGFLSLACIPATWVFYKY
                     GAAIRAKCKYSADAERQMAMIMAARMAQSKQEDEEARAEGKEVIYPVGSRPESEVQDV
                     QPAEQEGGLGKVVSRAGEYTGPHSNGGAPLARVPTHLHHEWTIYEALADRDENDLQDD
                     ERIKLQDMHTKFDNKLRK"
     gene            82368..84806
                     /locus_tag="CNC00280"
                     /pseudo
                     /db_xref="GeneID:3256768"
     gene            complement(84656..87264)
                     /locus_tag="CNC00290"
                     /db_xref="GeneID:3256600"
     mRNA            complement(join(84656..85882,85930..86488,86535..86689,
                     86740..87264))
                     /locus_tag="CNC00290"
                     /product="multiple drug resistance protein, putative"
                     /transcript_id="XM_569405.2"
                     /db_xref="GeneID:3256600"
     CDS             complement(join(84908..85882,85930..86488,86535..86689,
                     86740..86982))
                     /locus_tag="CNC00290"
                     /codon_start=1
                     /product="multiple drug resistance protein, putative"
                     /protein_id="XP_569405.2"
                     /db_xref="GeneID:3256600"
                     /translation="MHSYLTRMYTTSDSTQASDGKPLSSYTLRRYPWRPYVVPFDDIV
                     GKKYPGSGTNEDPYIVDWLPNDKEDPQQWPGTYKWFTIFIASMMTLAVALSSSAYSGG
                     VISIMEDFGSSRELLIAGISLFVLGFAFGPLLWAPLSELYGRRWIYIISYALLTLWSG
                     AAAGAPNVGALLVFRFFAGFFGSSPLANAGGTISDVLDANQRGLGMALFAAAPFLGPA
                     LGPITGGFLGLTSGWRWIEGFLTILSGVLFLVGIGFASETYAPTILRRRAKRLSRVTG
                     DVYRFRADAKKPLDAMALFKASLIRPWKFLFLEPIVTILSIYVALLYGILYLFFAAYP
                     IIFQEGRGWNTGVGGLAFLGVLVGTIISVAVSILVVNPQYVKVANKKGGRAAPEDRLP
                     PALWGGILIVIGLAGTAATDGPNVHWIAPIIFGAPFGCGIIIVFLSIMGYLVDSYTIY
                     AASVLAANSVLRSLFGAAFPLFTTQMFDKLGLHWGVALPGFLSLACVPFTWIFYKYGA
                     AIRAKCKYSADAERQMEMIMAARMAQSKQEDEEARAEGKEVIYRAASRPEGDESQDVQ
                     PSEQTGGLGRSQSKRSQHSASAGQSGNGAPLDRVSTHLHHEWTVYEALANRDENDLDD
                     DERIRLEGLRRTFGDRSEK"
     gene            complement(88106..92300)
                     /locus_tag="CNC00300"
                     /db_xref="GeneID:3256822"
     mRNA            complement(join(88106..88449,88519..88577,88631..89114,
                     89170..89330,89387..89616,89672..89739,89791..89862,
                     89915..89960,90011..90111,90169..90450,90502..91016,
                     91068..91370,91423..91489,91538..91709,91759..92300))
                     /locus_tag="CNC00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656650.1"
                     /db_xref="GeneID:3256822"
     CDS             complement(join(88353..88449,88519..88577,88631..89114,
                     89170..89330,89387..89616,89672..89739,89791..89862,
                     89915..89960,90011..90111,90169..90450,90502..91016,
                     91068..91370,91423..91489,91538..91709,91759..92107))
                     /locus_tag="CNC00300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512354.1"
                     /db_xref="GeneID:3256822"
                     /translation="MDPYSVDYTRHSQYQQYNPVRIAPGLEASSSRTASTSDIYGRGN
                     SAYSSSWTGASPVDERPARKLDRPWEHENDIKGLSQPQASAQQPPQQQQSLQPSVFPS
                     SGPTAKRGSRACMACRRGKNRCEWDPAGKETSCRRCLMNGTQCVFEKPAEKNGTRART
                     NSSAVADHPNEAENRITSLEKMVETLSSGQTQMQTTLQQILTLLPQTQSLLTPTGHPS
                     FLSHNTPSTGVPPSTIFASVSPPQTFHDGAGMSSVRDHAQSDRPRSPQNTASGRGISN
                     STMNRVKSVKEFPPLPGFAPPNHRFGTYGIIPLPSAPPSPSRSRHSSRSSSSSRSRDE
                     YSSALPHETLTAPIQALQALANAADQAAALVDKDDEGEKGKSTSQEVRSDGSDEDSRR
                     GEGEAKGGAERQWKLNGEDDEDRGRSRKRKRVTIDGQNIHLRVRKKTRPDPTPRNPFP
                     DVVTKGLVSEKEARELWDIFFSGCHYFVPLWDKSYDTFETYIERTPFSTNGLLAVAAK
                     IRAGNGPVDETFHRCLEEAQGIARSTLFGPIVRKEAVMAMLILSLWSQNGWLPCGHAL
                     RMGLDINIHRALDKLANKEDGRTEAEERDLVVSARIWLNCYMHEHLVSLGTGKPILLR
                     DDSSVRKARELLDHPMASDTDVRLIAGVELVNIRITILEHLTPLHGSTDAPTISFVKS
                     KLAELQAWHQEWYCIHKRRYDDESVVVKLLETERVYAELWTVCMALRGCSWDKLSHEQ
                     KELAFHAKDCAWRCLEIFLRSDNFRKHLKYATHDQLVSVAFAAVFLLKVAILYPTSLS
                     IPLLVSQVSELAHCLSAECFAERYALTLRLMLSNFRRTTGAMSTIPGTPRTAASAAAG
                     AVHGLSGLSMTALNVNGQLNDVEGSFQNFLSLPQMENHNMEVGGEGENASNGMGATGF
                     TGTEGDGGLWGMMGLEGFDWPTELSPSSLPVWLQDGNATDLGLPVDGSDSLFLPVELA
                     NMFMPSNSQTSGLYQFTLPDSGDVGTEAW"
     gene            92607..93473
                     /locus_tag="CNC00310"
                     /db_xref="GeneID:3256239"
     mRNA            join(92607..92771,92831..93003,93065..93189,93251..93473)
                     /locus_tag="CNC00310"
                     /product="Hmp1 protein, putative"
                     /transcript_id="XM_569409.2"
                     /db_xref="GeneID:3256239"
     CDS             join(92733..92771,92831..93003,93065..93189,93251..93258)
                     /locus_tag="CNC00310"
                     /codon_start=1
                     /product="Hmp1 protein, putative"
                     /protein_id="XP_569409.1"
                     /db_xref="GeneID:3256239"
                     /translation="MSNPNEPSKTNGQLNSLIGTGKTLVGNAIETAYSTVGGSTESSS
                     WTTAGQKQHDKGEAEISAAKTQGYVEGVGDRLEGKKDSVVGAITGDKTQQASGNVQHD
                     KGETQMDINKSS"
     gene            complement(93444..96540)
                     /locus_tag="CNC00320"
                     /db_xref="GeneID:3256256"
     mRNA            complement(join(93444..95171,95222..95475,95536..95932,
                     96026..96540))
                     /locus_tag="CNC00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656651.1"
                     /db_xref="GeneID:3256256"
     CDS             complement(join(93645..95171,95222..95475,95536..95932,
                     96026..96100))
                     /locus_tag="CNC00320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512496.1"
                     /db_xref="GeneID:3256256"
                     /translation="MANTRPYTREELKSLRRADLQTLYKLHNLKGANGTNATLIDTLV
                     EYFTSPAYREAFPQPTGSQLSQAATKTTTAPKPERLYRPLPAKTATSRQTAGVKRKAP
                     DVGTRTGTRIGSGTAGGARTASTEHIKPAGRSRREEREVEAPSSVQEEVAVDERQELS
                     SLTHRPPIPTPQSSLTPQPQQQIPQPPTISIAEVQALISENDTKWHTRLENVEKLLGD
                     EVERLRKEVTEVRLKCEELERAERIRTPRPFPQLPGPSSGPRMPGAAGLSQSHHRSVS
                     LPFSSLGKRRLPFEYRSESEDAEVKRVRHSGRGEPSTSASVTGRVSNETSGQPRAPSS
                     RKAPSSFPPDFFAPPPAAGSSSTSASRPVSILPRTPSPSRQGVIPDNSQTPRLPLEWR
                     APEFGSRTGTPLRTPFINERTPEFATTPEPPIMSMSPSLEGTALGSRLTPGRTLLSLH
                     GSTPDRSDEDIQAEASTSTPTSGQAPSRTGEGISLSAVTELERIDEGEELAPSPPVQH
                     MSPAGQLRFPVVKPHPGLGVGVTGSPSSGSPKLVRRSISQPNQSTTPSLLGQHSLLAP
                     PALISRGSRAGSERPAVPSRAFTQSPPPRPRSASAMYRSSYGRSVSASSSRHASPLPS
                     TIIPTEVAPQVRSASADYMRIAMFGLEGASLDSIDYADDPLQTDTLPDVTEDPAAEER
                     EAGPSAGTGTSAGVTAERRRWRKVDEVVTPGHRTLLGTERYNDTRFGDIPVGMWAQPK
                     IDFGTPGGPF"
     gene            complement(96593..98829)
                     /locus_tag="CNC00325"
                     /db_xref="GeneID:36392768"
     mRNA            complement(join(96593..96709,96800..97291,97510..97712,
                     97771..98829))
                     /locus_tag="CNC00325"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658916.1"
                     /db_xref="GeneID:36392768"
     CDS             complement(join(97130..97291,97510..97665))
                     /locus_tag="CNC00325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514256.1"
                     /db_xref="GeneID:36392768"
                     /translation="MQRTKLRTMPSLDSGYFEHSPPSSSSPPPTDEEKMSVPTLAGEA
                     LDLLASQDMMALGDFIAELREDYDLRTAVVDEVLEHMTTHGWVQLWKRKGTEEAWISV
                     TED"
     gene            complement(99186..99985)
                     /locus_tag="CNC00330"
                     /db_xref="GeneID:3256141"
     mRNA            complement(join(99186..99505,99562..99635,99690..99843,
                     99904..99985))
                     /locus_tag="CNC00330"
                     /product="bud site selection-related protein, putative"
                     /transcript_id="XM_569411.2"
                     /db_xref="GeneID:3256141"
     CDS             complement(join(99334..99505,99562..99635,99690..99843,
                     99904..99926))
                     /locus_tag="CNC00330"
                     /codon_start=1
                     /product="bud site selection-related protein, putative"
                     /protein_id="XP_569411.1"
                     /db_xref="GeneID:3256141"
                     /translation="MGRLRRSRTHHARRDVHRAARTRARVKDLDQIETDLRPQNRNRL
                     EKQPIDEDKPGLGQHYCVECSKYCETAVALQSHLKSKVHKRRLKELKEGAYTVDESER
                     AAGLGTDNKQRGVEDVIKRFDGINSSAAGPSIVAQPQA"
     gene            100238..101905
                     /locus_tag="CNC00340"
                     /db_xref="GeneID:3256605"
     mRNA            join(100238..100508,100565..100675,100740..100982,
                     101043..101483,101552..101905)
                     /locus_tag="CNC00340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569413.2"
                     /db_xref="GeneID:3256605"
     CDS             join(100632..100675,100740..100982,101043..101483,
                     101552..101819)
                     /locus_tag="CNC00340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569413.1"
                     /db_xref="GeneID:3256605"
                     /translation="MCVTFFTLSQPGYKLILAFNRDEFLDRPTLPAHWHDFNSPSPLT
                     PTLYKFNNFTDPCSRENKESDDGGRVLSGLDRGKAEGGTWLGISKDLKVALLTNIARI
                     RPAPGVQPLSPPPSRGKLLREFLSPSPLTSSQLETQSYISSHFPTAGDYEGFNLLLFS
                     LSPERNIGYLTNRPSPSSLDLTSSLCGGEDGQRRCVGLSNSPLDEKWPKVQQGEKNME
                     KSLREWEEKREGEDRLVERMFRVLSPSRPITCDDDLTLSTTIPPIKLGEDLFLNTDPQ
                     NTRARWKGTRTATVIIVKDSGETTYVERDIWMIDEDGEPKKGEDERRFKFVGEEK"
     gene            complement(101916..103978)
                     /locus_tag="CNC00350"
                     /db_xref="GeneID:3256686"
     mRNA            complement(join(101916..102048,102105..102174,
                     102231..102582,102856..102898,102954..103386,
                     103449..103604,103672..103746,103856..103978))
                     /locus_tag="CNC00350"
                     /product="ribosomal protein, putative"
                     /transcript_id="XM_024656652.1"
                     /db_xref="GeneID:3256686"
     CDS             complement(join(102034..102048,102105..102174,
                     102231..102582,102856..102883))
                     /locus_tag="CNC00350"
                     /codon_start=1
                     /product="ribosomal protein, putative"
                     /protein_id="XP_024512356.1"
                     /db_xref="GeneID:3256686"
                     /translation="MAPSKTAGKAAAKPQDVKAKAAKKAALKGTQSTSVRKVRTSVTF
                     HRPSTLRLPRAPKYPRKSVHHLPRMDQFRTIQHPLNTESAMKKIEEHNTLVFIVDIKA
                     NKRNIKDAVKKLYDVEAAKVNTLIRPDGRKKAYVRLTADFDALEVANKIGFI"
     gene            104702..107686
                     /locus_tag="CNC00360"
                     /db_xref="GeneID:3256782"
     mRNA            join(104702..104930,105132..105153,105490..105807,
                     105858..106000,106051..106576,106633..107686)
                     /locus_tag="CNC00360"
                     /product="protein phosphatase type 2C, putative"
                     /transcript_id="XM_569418.2"
                     /db_xref="GeneID:3256782"
     CDS             join(104928..104930,105132..105153,105490..105807,
                     105858..106000,106051..106576,106633..107279)
                     /locus_tag="CNC00360"
                     /codon_start=1
                     /product="protein phosphatase type 2C, putative"
                     /protein_id="XP_569418.1"
                     /db_xref="GeneID:3256782"
                     /translation="MGQTLSEPMTEKHTTDVVRGKQFWVGLSDMQGWRISMEDAHSVH
                     LYLPPSSDDSKPHSPASDVPAQPEGSTVTNHNEPEVANAMFGVFDGHGGQTVAKFAGT
                     TLHSRLSALDAYKSGDYITALTQAFIKTDEDLRADPSFLNDPSGCTAVVGLITTDGRI
                     IVANSGDSRSVLGYQGQAKALSNDHKPTNEEETARITAAGGFVEFGRVNGNLALSRAM
                     GDFEFKQNFSLAPEKQIVTVVPEIITHELDGEEEFLVLACDGIWDCLTSQQVIDFTRR
                     AIANGDPLGKICENMMVKCLAKDSSTGGIGCDNMTVVIVALLNGRTPEEWQAWVKERV
                     EQKVGHDTPESIPDVFPQNSGPSNSGFAGSGFRVAGGAGGLANIASILGASGITFRPA
                     YDSDDDDDGIQLMGDGPVSPDKLSSPGLIDNEAVEGGTKPKDVTGQLEKEEEETMFGG
                     EGKKGSVRLLDEDGDSSMDSDDSDSTTTGNDPAPQPIPSSSHQATHSPIPPNFSSIGS
                     PTVPTPQELQGLQASNRSEPQGDAYSDAVKVEGLMDKSESPLNL"
     gene            complement(107982..110530)
                     /locus_tag="CNC00370"
                     /db_xref="GeneID:3256539"
     mRNA            complement(join(107982..108282,108351..108372,
                     108442..108538,108621..108878,108932..109251,
                     109323..109438,109498..109553,109612..109676,
                     109753..109844,109898..109913,109964..110065,
                     110120..110530))
                     /locus_tag="CNC00370"
                     /product="polyamine transporter, putative"
                     /transcript_id="XM_024656653.1"
                     /db_xref="GeneID:3256539"
     CDS             complement(join(108119..108282,108351..108372,
                     108442..108538,108621..108878,108932..109251,
                     109323..109438,109498..109553,109612..109676,
                     109753..109844,109898..109913,109964..110065,
                     110120..110389))
                     /locus_tag="CNC00370"
                     /codon_start=1
                     /product="polyamine transporter, putative"
                     /protein_id="XP_024512357.1"
                     /db_xref="GeneID:3256539"
                     /translation="MTEKNERQTAKPQDVEHFDESQHHNMAFEDFGLTKEQNQLLIDN
                     YAYMWKKDDSGNLLIRSAKGDPTNPRSWPNWKRYAIVGLASLLNNLVCLCVSGYSTGI
                     AQMEEEMGFSSEVGTVGLSLYVLGFAIGPMLLAPLSEYWGRRPVYLVSWTIFTIFQIP
                     LALAQNVATILVCRFIQGLAGSTPLANTGGVVHDVFAVKEAGYAVAIYALSSADGPPL
                     GNVISGFLAQNAGFRWLFWAYLIIFGFFLIVIFFCLPETRSTIILSRKSSKLREATDL
                     PFYGEHELAKKAPGHLWKVTIFRPFKFLFTERITYLCAGINGFVYGMIFLSNEAFPLV
                     FGPGNNGHGWTHSGVVNLTFGAYVVGSFLGFCLTPLQEAWYRKASKAKGRGDPEARWW
                     SALWATPFMPLGLMVAAWTSYPDLPWIAPIIGFTMFGFGFYIILAAILNYVVDGYAHY
                     SASALGGVVFVRNIIGAVFPLFSSQMFKGMGNQWALFLLSMVSFLMIPIPVYLYYRGK
                     VVRDRSPYCAMHYNDEE"
     gene            111128..113620
                     /locus_tag="CNC00380"
                     /db_xref="GeneID:3256706"
     mRNA            join(111128..111408,111505..111598,111672..111764,
                     111822..112028,112094..112227,112309..112583,
                     112642..112877,112963..113151,113280..113620)
                     /locus_tag="CNC00380"
                     /product="expressed protein"
                     /transcript_id="XM_024656654.1"
                     /db_xref="GeneID:3256706"
     CDS             join(111914..112028,112094..112227,112309..112583,
                     112642..112877,112963..113151,113280..113506)
                     /locus_tag="CNC00380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512322.1"
                     /db_xref="GeneID:3256706"
                     /translation="MDGALDVLDLERRVLIEVAETVEKEMWEVDFWIGKKVEVRISEE
                     KAKKMDEWYNKWLKARAAGKYKHLKPEWKWIGDAKEAQKVTRINGATGYSIGPAGSLH
                     PHKLATAYLRSALATGEAELYSSSPVQKLTRTEDGELWQVDCGKRGTVKSRNVIVCTN
                     AHTPHLFKGSDIDDFLTPFQGQAANVTPPPSFSGENYLDTTYTMEEGPYLIATTHAGI
                     VLGLSHEVAVKKGILEKKDVFGNVDDSYVQPAAKRWLSEYCKNSFTNWGEEAPGEGAM
                     RFWSGIMCATKDTLPLVGQVPSEQVPEGKNEGLYIAAGYHGHGMARIALTTKYVVKLA
                     TTGEWDEGMPESFKISQNRLERGRTAPPYITAVDKIGGATSKILNAVGIGGVQSVCR"
     gene            complement(113832..115415)
                     /locus_tag="CNC00390"
                     /db_xref="GeneID:3256150"
     mRNA            complement(join(113832..114006,114104..114195,
                     114365..114408,114664..114755,115191..115273,
                     115359..115415))
                     /locus_tag="CNC00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_569329.2"
                     /db_xref="GeneID:3256150"
     CDS             complement(join(113990..114006,114104..114195,
                     114365..114408,114664..114755,115191..115251))
                     /locus_tag="CNC00390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569329.1"
                     /db_xref="GeneID:3256150"
                     /translation="MSERGSNPPEEKPKAEEPAADPNTLNIKITNTNNEEVFFKIKRT
                     TKLNKLKSAYADRVGTDVASIRLLFDGHRILDHQTANDLDLEDGDAIEVQLEQVGGY"
     gene            115945..117741
                     /locus_tag="CNC00400"
                     /db_xref="GeneID:3256209"
     mRNA            join(115945..116124,116182..116195,116260..116593,
                     116680..116992,117087..117741)
                     /locus_tag="CNC00400"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024656655.1"
                     /db_xref="GeneID:3256209"
     CDS             join(116053..116124,116182..116195,116260..116593,
                     116680..116952)
                     /locus_tag="CNC00400"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024512323.1"
                     /db_xref="GeneID:3256209"
                     /translation="MSSKPQQELAVPTHLPDPVLIIVMGPASCGKSTVGQDVADHFHI
                     PFIDGDSLHPKSNIAKMSSGTPLTDEDRLPWLALIRSTAEKMCKEQSDEIAGKTRSEE
                     DGGLGRAGVVIACSALKKWYRDILRGVVKADPPPAEDLNDALPDDAQVPATASLKTYF
                     VYCYGTPELLKQRIASRKGHFFGQQMLDSQLAVLEDPSEEEGVTVANIDGTKEEVGER
                     AVNGMKKLLGIN"
     gene            117781..120483
                     /locus_tag="CNC00410"
                     /db_xref="GeneID:3256162"
     mRNA            join(117781..118076,118273..118299,118370..118401,
                     118485..118515,118567..118667,118745..118933,
                     119003..119138,119209..119398,119474..119630,
                     119693..119875,119948..120483)
                     /locus_tag="CNC00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_569331.2"
                     /db_xref="GeneID:3256162"
     CDS             join(118050..118076,118273..118299,118370..118401,
                     118485..118515,118567..118667,118745..118933,
                     119003..119138,119209..119398,119474..119630,
                     119693..119875,119948..120275)
                     /locus_tag="CNC00410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569331.1"
                     /db_xref="GeneID:3256162"
                     /translation="MSCPSDNSTAVDDEFWSSDGIHWDAHRIGWAVAGGCAILTVLIT
                     LFTLTMHATRYKHPPAQRQVMRVLLMPPVYAVVSFFSYRYYKSYEYYILAETAYEAIT
                     LSAFLMLLMELVSMGTIDLQIKSVLAEKDKMKFPFPFGFWRFRASKPYFWHALSFSVM
                     QYVVLRPLISIIGIICEYYGVLCPEEYSIHFAEVYLDAVDFVSISVALYGLIVFYVLC
                     KDELKGKKPLNKFLAIKLIVFFTFYQSFLFSILQSHGVIKGTAMWTATNVSDGLSALC
                     TCVEMVFFSVYMGWAYNWTDYTDPEKNPYQRDTNFRTYLQAIWDTINLSDFCSEIYLA
                     CKFFVDYARGKPGTRSGATKLQKTFMPHTIPEESQEMGMIASYNAGGGYDNEYEQDKH
                     KLQNNTKGGTIFSSSKPSGLLEDNDSGDDTYAPIRSPEGTAYSRVREGHGRDESAFEP
                     WPQERPTGQEAHRHQF"
     gene            121426..123774
                     /locus_tag="CNC00420"
                     /db_xref="GeneID:3256535"
     mRNA            join(121426..121771,121861..121921,121987..122430,
                     122481..122653,122700..123774)
                     /locus_tag="CNC00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_569332.2"
                     /db_xref="GeneID:3256535"
     CDS             join(121623..121771,121861..121921,121987..122430,
                     122481..122653,122700..123306)
                     /locus_tag="CNC00420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569332.1"
                     /db_xref="GeneID:3256535"
                     /translation="MPPPGVFTFDQSSDESPELLPRDALPETEHIPEVSMVEESTVTG
                     VTFTPELWMQRRQWALQTLRKEGVRSVLDLGCGPGALLETLVMPASTICEPPIREKPS
                     ETRHAEDEEEDFDHEDELFIGRLAGIDANPEVMNPALSVLSPHSETSTFPPPRPRWEP
                     ITTELWLGGLEKYNARLEGYEAITALEVIEHLDPNVLSRFGVVTLGTYRPRIMLISTP
                     NFDFNAKFPQANGDCFAKKGFVDPTGRTDRVFRHSDHKIEMTGAEFRNWAETAAADWG
                     YDVEVSGVGSSSIPSFYPSDDITKPPRPIYASQTAIFRIATGMPLRSPRSVRTMQLPF
                     TPSSKESSHPHKLAGRFTLPATAPGIGQRSSPEEVRVKVREFFTGSSVNEVSLEELWG
                     VLDIAGACGGSKRWLVGSLGGYGDCPALDANDEDELEFEVKKVKGVGLSVQWREWTPR
                     AEEKPRSWGTPVQNESEHTSPAAAQGW"
     gene            124051..125718
                     /locus_tag="CNC00430"
                     /db_xref="GeneID:3256212"
     mRNA            join(124051..125028,125085..125266,125323..125366,
                     125427..125718)
                     /locus_tag="CNC00430"
                     /product="expressed protein"
                     /transcript_id="XM_569333.2"
                     /db_xref="GeneID:3256212"
     CDS             join(124260..125028,125085..125266,125323..125366,
                     125427..125454)
                     /locus_tag="CNC00430"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569333.1"
                     /db_xref="GeneID:3256212"
                     /translation="MPPSLVLFTTSQTPLAVRYPHPRKPILTVPPLLHRSLHNALDRD
                     QPSAAFVVNAGDAGGVAQGTLYIPNLEELAKPSPLPVANGHAAPELVHDNIELTVKVH
                     LIVSPTSTSPASARAEWVSEALQVFRKAKRLPLPDNLLIGFKGIDYRGIKTATGAEAS
                     VTPNTEIVPAELEEEVLKVWERVFAERGKLVKENGKLGSLYAPQGLLKKLTEREGEGR
                     VKVNALDTPDCHHLPKDYTGYARKNGVELWAGGGGEGSDPLPSTHLQNVLQEFLPAIR
                     KIIPEQQAKEFNKLDNPIPLRQDGLKFEDVETGVQVRWVLSYTVLSTTRNVVEDKGYI
                     VAADLV"
     gene            complement(125573..126653)
                     /locus_tag="CNC00440"
                     /db_xref="GeneID:3256224"
     mRNA            complement(join(125573..125682,125745..126142,
                     126210..126212,126283..126387,126450..126478,
                     126538..126653))
                     /locus_tag="CNC00440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656656.1"
                     /db_xref="GeneID:3256224"
     CDS             complement(join(125632..125682,125745..126142,
                     126210..126212,126283..126387,126450..126478,
                     126538..126605))
                     /locus_tag="CNC00440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512324.1"
                     /db_xref="GeneID:3256224"
                     /translation="MTTSAYSDLIGRAEKLVKAHMAKYDPSHDWAHVDRVRKMAMTIA
                     RSMMDNGPDLLIVELAALFHDLSDYKYAKPGSPTLPDLLFPILQLQIPDETIDRILSI
                     IPAVSYTAETALLAAGKWTWQKDCLELHAVQDADRLDAIGAVGILRCAAYSGATKRVL
                     VEDEDTGGKSAEAHFEEKLLKVKDRMKTAFGKEEAERRHQTMVHFLASLQAEKDCLI"
     gene            complement(127003..129293)
                     /locus_tag="CNC00450"
                     /db_xref="GeneID:3256312"
     mRNA            complement(join(127003..129001,129072..129293))
                     /locus_tag="CNC00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656657.1"
                     /db_xref="GeneID:3256312"
     CDS             complement(128144..129001)
                     /locus_tag="CNC00450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512325.1"
                     /db_xref="GeneID:3256312"
                     /translation="MKPKFVDKSNSKQYDLPAVLQKLVCHFRTHRRPESQAIIFCKSK
                     DQPETISQILKRAGQRATWYNSEAGDRDQVRKFFGPGHAQGESQIDFLCSTSGLGAGV
                     NMPNIDVVYFLGDPWDLFEVIQGGGRGGRLGHLFKVCVFSGSFNTAVFYTPNGNRLLK
                     EWMQHNVCRRLTIGSYMDGTEATCLTLNAGQCDLCVQSVPFKRGHQPTYSPLPRDPPL
                     TSRLIQNSWFLLLDQAHPLFHQTVSAPCHEQDHLVAKNQVVIWENFIIRFNAQVVIPV
                     TVVPTCPRD"
     gene            130457..132424
                     /locus_tag="CNC00460"
                     /db_xref="GeneID:3256457"
     mRNA            join(130457..130602,130736..130860,130965..131079,
                     131150..131266,131333..131437,131490..131589,
                     131641..132191,132244..132424)
                     /locus_tag="CNC00460"
                     /product="SNARE binding protein, putative"
                     /transcript_id="XM_569336.2"
                     /db_xref="GeneID:3256457"
     CDS             join(130507..130602,130736..130860,130965..131079,
                     131150..131266,131333..131437,131490..131589,
                     131641..132191,132244..132339)
                     /locus_tag="CNC00460"
                     /codon_start=1
                     /product="SNARE binding protein, putative"
                     /protein_id="XP_569336.1"
                     /db_xref="GeneID:3256457"
                     /translation="MRLTIIAPDSVHEHEVSPSLLIQDIINIVEATADLPPAVIVLTS
                     DAGTPLTDPTRTLESYGLNGETATIFLTPTGPPVASSSSIPFPDADADIERMRLQALG
                     NPSLMNDLRERDPETFAAIQGGTQSFKKALQLAQSRQRDAEFEKQRQIEALNADPYDI
                     EAQKKIEEAIRMEAVLENMQHAMEYSPESFGNVTMLYINVEVNGHPVKAFVDSGAQTT
                     IISPECAEQCGIMRLLDTRFAGMAEGVGTARILGRIHSAQIKLGSLYLPCAFSVLEGR
                     SVDLLFGLDMLKRHQCCIDLSTNTLRINNTEVPFLSEHELPDKARRRGEAQVAGEMGD
                     AAGQGVKAGVASPKIGKKTFPGEGHALGAGSSTGPGTATGSASATGARTGGTASVPSP
                     SNRWKEDDIQTLVNLGAPRAQAIQLLEASGGNVDVAASMLFG"
     gene            complement(132520..133930)
                     /locus_tag="CNC00470"
                     /db_xref="GeneID:3256342"
     mRNA            complement(join(132520..133134,133336..133531,
                     133709..133822,133878..133930))
                     /locus_tag="CNC00470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569337.2"
                     /db_xref="GeneID:3256342"
     CDS             complement(join(132622..133134,133336..133531,
                     133709..133779))
                     /locus_tag="CNC00470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569337.1"
                     /db_xref="GeneID:3256342"
                     /translation="MFGQKQYDQALFNDLLSRVEISKHDLNALVLDYLLIEGFSDAAV
                     EFARETGLPADVDHAQVAERMEIRQAVEDGRVEEAVRRVNELDPEILDGNASLLFHLH
                     LLRLIELIRTEDLDTALAFATEELAPRGAQNPEFLADLEKTMALLAFPDLAKFADDSP
                     AADKPTLAPETLTLFEEPAFEPIIALMKRSQRVKVAKELNAAILENQGYGMETKLSGL
                     VRLMAWGEEKLVEGSDIVIPEEEQRKGRTWADAVLSGEVDC"
     gene            134106..>136254
                     /locus_tag="CNC00480"
                     /db_xref="GeneID:3256719"
     mRNA            join(134106..134633,134681..134753,134804..134910,
                     134960..135046,135095..135334,135391..135451,
                     135501..135911,135965..>136254)
                     /locus_tag="CNC00480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569338.1"
                     /db_xref="GeneID:3256719"
     CDS             join(134208..134633,134681..134753,134804..134910,
                     134960..135046,135095..135334,135391..135451,
                     135501..135911,135965..136254)
                     /locus_tag="CNC00480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569338.1"
                     /db_xref="GeneID:3256719"
                     /translation="MSGGYDFSHLFPANTLAFSPGTTFLAVAHQNRIIVRSTSTLQVV
                     RTWECTLPSESTIFRSKEPCVASSATEATSEAFIIDTLQWSGDSTYLLVHSKEAKMAW
                     VYGVAQEGEAAHVGGMGVEGLSKVEWGKGNREVLAWTEIDSRLYIYSLSSGETRLIQN
                     VKPTADGYTYSPDSRYLAVTEKHLGKDYIGVYDILDGYNLLRHFPLLTVDVQGVSWSP
                     CGKYIAAWDLPLSYSLHIHSAIGPHLTHLNPSSPAFSLAPNETPGLGLRTLAWAPGGR
                     WIAVGGWDGKVRIVESDGWRCVCVITCGTRANKTAAVWREPNDWLRDTRGRGIVQFDR
                     QPHPVTFPALRPDITKPYPRMGISQLTFDREATLLLIRLDSQPNVVHIYSFLPTPTSE
                     QPTIAHIVSSIFSREIKKAKWSPVKSKLSVVTRGGGVYFWDRESGWIEEESGGSFECD
                     REIDVATGGMMEGVGIPTRAEFSALDIHWSPDGRSLAIRDRYHFCLLYDEDTGNLDDD
                     EQEGERSALMWNEQGEGLTDVLEEEGHISLSEGLPSREQFIWEKKRYATVKAAVYS"
     gene            complement(136281..140331)
                     /locus_tag="CNC00490"
                     /db_xref="GeneID:3256395"
     mRNA            complement(join(136281..136472,136551..136690,
                     136752..136937,137008..137121,137184..137268,
                     137321..137365,137424..137448,137506..137680,
                     137727..137792,137848..138036,138096..138268,
                     138321..139512,139570..139593,139648..139771,
                     139827..140331))
                     /locus_tag="CNC00490"
                     /product="potassium ion transporter, putative"
                     /transcript_id="XM_024656658.1"
                     /db_xref="GeneID:3256395"
     CDS             complement(join(136453..136472,136551..136690,
                     136752..136937,137008..137121,137184..137268,
                     137321..137365,137424..137448,137506..137680,
                     137727..137792,137848..138036,138096..138268,
                     138321..139512,139570..139593,139648..139771,
                     139827..139971))
                     /locus_tag="CNC00490"
                     /codon_start=1
                     /product="potassium ion transporter, putative"
                     /protein_id="XP_024512326.1"
                     /db_xref="GeneID:3256395"
                     /translation="MKRPRFRVRKAFRKPKMPTVAEARDTWQKLKCHFNFFRIHLLVF
                     TFIPIIAACIFYAANGSASGNANSGLTGRQKVTFIDSLFLCFSAMTTTGLCTVNLSAL
                     HPFQQVILFFLFIVGDYSFVSLIMVLVRKHYFRTHCEQLLINDLFRRIPTISYDTGAQ
                     GGLNYSSKSFKSTIKKLRGKNIAISGPIDGHKMDNFAEDGLVTAGDQEQHMMTDSPVD
                     MTFEERGRRERAEASEIPADNQTPGPRVPSTLGKSTAALLNPANAAPPPATSSAQAED
                     HRSPFVDPLFQARQRLRTQTRAKSISAAQHGRSTSDHRPTPPHVTSDVPNHMGGGAIP
                     PKRKNNVHIKDYSHHDQSQHPHLHTAAQIVTHHTIDPTRGLPIPFGHKNTGYGGFPSL
                     LHIFHHFLPERAKQRLYRPVRRVGIVMHPTYAHEFENGHAGHEESWSEAIRGSVAKWM
                     PEGLQGLVIGRNSRFWTEELDDEELEQIGGVEYRALKLLSSIVSSYIFLYQMIPFAIL
                     SIYFAKVDYWNSALLETAGEQAGTVNKTWFSLFLSASAYTGCGMVLTDEGLVPFQTCY
                     LMIYVLIVALLVGNHALPIMLRFIIWIGTKITRKGVKHESLHFLLDHPRRCFLYLFPS
                     HQTWYLLFILLAFTVVELFSFLVLNIGLPVVDSLGGWERFSDGLLQSLSVRASGFGII
                     TISDMAPSVLFLYIIFMYVAIYPIAMSVRSTNVYEERALGLYEHDDPDTSGQDEPQFK
                     GHRREVFSKYLMWHMRRQLAFDVWPLALAVLTISMLERGKLLDPQNSWFTIFRIIFEC
                     TSGYGTIGLTLGTPNNNYAFSGEFGTASKLVMIVIMLRGRHRGLPVAIDRAILLPREY
                     SRIVKPSEGLQPTLSHSDPFTRASNEDDRSRPIEMELEEADRQG"
     gene            complement(143485..145723)
                     /locus_tag="CNC00500"
                     /db_xref="GeneID:3256758"
     mRNA            complement(join(143485..143750,143815..143947,
                     143997..144107,144164..144289,144344..144440,
                     144489..145217,145276..145723))
                     /locus_tag="CNC00500"
                     /product="3'-5' exonuclease, putative"
                     /transcript_id="XM_569340.1"
                     /db_xref="GeneID:3256758"
     CDS             complement(join(143821..143947,143997..144107,
                     144164..144289,144344..144440,144489..145217,
                     145276..145684))
                     /locus_tag="CNC00500"
                     /codon_start=1
                     /product="3'-5' exonuclease, putative"
                     /protein_id="XP_569340.1"
                     /db_xref="GeneID:3256758"
                     /translation="MLSNLGLFAAERCPDTNCTRPRCFFSHDPTISGPSQSQVPIGIR
                     EPANRKPPTAVKRKVGESSGAPIVREMKKQNVTRNPKPVAPSSTTPVRSAPAPTKTVV
                     SGGANSSSTDYSRPPMLPYGIKLSPQPRTDRQKALGTLHTQFVKLYSQILHFSPSLAH
                     DSSLAQEAEISSSSTSLRAYKTAIHHAAVAISRRPPPTSIPHPSIGTVKESRVAMEKA
                     EKEKASKLTRNRVERYCMKKEDFEKWGYPDPSGEGLTGRGVETKPDGEGETHDCDRCK
                     VSFIVSSKNLERRFGECRYHYGRTAPERVEGRRKWIYSCCGKERGEQGCEEGVHVFKD
                     GEDDKELAKRVAYKTVRMCLEEAKASGKNVVGEGYGVVAMDCEMIFTTAGLSLGRVTV
                     VDENGYTLLDELVRQKVPILDINTRFSGISPGQLDNAIMDLDGVRAAVCMFIGPETII
                     VGHGLENDLRALRLLHDQVIDTAIVFPHDKGAPYRRALRDIVKEKLGYFIQDRTSDKG
                     HNSVEDAKATLDVLKWKVREDNED"
     gene            145841..147601
                     /locus_tag="CNC00510"
                     /db_xref="GeneID:3256391"
     mRNA            join(145841..146067,146118..146369,146419..146581,
                     146636..146762,146817..147063,147138..147243,
                     147307..147601)
                     /locus_tag="CNC00510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569341.2"
                     /db_xref="GeneID:3256391"
     CDS             join(145876..146067,146118..146369,146419..146581,
                     146636..146762,146817..147063,147138..147243,
                     147307..147569)
                     /locus_tag="CNC00510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569341.1"
                     /db_xref="GeneID:3256391"
                     /translation="MFISRPVAPSLRLFAKNSLQSITQNSPVRSTALFRCQSNSAVSS
                     SSKPAAKPNELAKVIRDSIKSTGPISASRYMQFCLSHPVHGYYSKGDVFGQKGDFITS
                     PEISQIFGELVAIWFLTRWMEVDSPTRVRIIELGPGRGTLMDDVLRTLFNFPGIAASI
                     NSVHLVENSEAMREVQSQTLTPRIKGKDVKLNWYTSIEEIPETKDEFTLFVAHEFFDA
                     MPINVFEKTDMGWREVLIDRDPSYTPNLPTSSTPSGLRFTLSPSPTTLSTILPSTSPR
                     FAKLPSGSRIEVSQDSYKIMHRLGQVVNQGLGGCGLVVDYGADKAFASSFRAFRKHEI
                     VDVFEDPGNCDLTANVDFAYLRESLTGTATPLGPISQAQFLISLGLQPRLRKLLDTAP
                     PERREAIEKGAKRLIDVLGMGSQYQVMGVVSGEPEMKEGIYPFPVKKETVESKVLRP"
     gene            complement(147111..149225)
                     /locus_tag="CNC00520"
                     /db_xref="GeneID:3256231"
     mRNA            complement(join(147111..148164,148235..148761,
                     148815..148938,148996..149052,149108..149225))
                     /locus_tag="CNC00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_569342.2"
                     /db_xref="GeneID:3256231"
     CDS             complement(join(147625..148164,148235..148761,
                     148815..148938,148996..149052,149108..149146))
                     /locus_tag="CNC00520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569342.1"
                     /db_xref="GeneID:3256231"
                     /translation="MQMATKYRGLPDIDTAPDIFETTDEPEIVLKPSDVRSGDEDSVL
                     KPVSEDIDAGGLPSRRKAERVFARGTRKPELSTLSFRPRLPPLSRYASSSSDTDEEPP
                     LPRETPAARLRRLKAELAEIEAEVGSSSPSKTQSISHEGSGAGKRRSVLPPRQPVDVV
                     SELANVRERLERVEIDGLDVGQVVAVGMGPSSEWRERLDKLVTAENRSGKGKVAQSTA
                     VGQQDSSLSDIDKRLAALEQVVGPTTDGLDQTLSPLVPTLNKHDHLLTLLTQPRHLDA
                     ISRRVKLLLVDLDRAAAASRRTGAGGAAIPQQSSEKAVTNLSLTQGEYTQLQSLFSVL
                     PRLDPLLPILTPLLARLRSLSALHSEASEIAVSLRELQSRDKKNAEEINELDEVVKSV
                     QTGLGDAIAAIKKNWEGLEKRMMGLEQRLKDMERQI"
     gene            149356..151913
                     /locus_tag="CNC00530"
                     /pseudo
                     /db_xref="GeneID:3256737"
     gene            complement(151898..153455)
                     /locus_tag="CNC00540"
                     /db_xref="GeneID:3256806"
     mRNA            complement(join(151898..152330,152389..152910,
                     153028..153455))
                     /locus_tag="CNC00540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569343.2"
                     /db_xref="GeneID:3256806"
     CDS             complement(join(151938..152330,152389..152910,
                     153028..153402))
                     /locus_tag="CNC00540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569343.1"
                     /db_xref="GeneID:3256806"
                     /translation="MPRRSAKYKATARARELYRMATILNHKQLKTSLSIPYHALRTSR
                     YLNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLRVNHTEFRKLLCLIKDHPVSSLM
                     VQESRRTPFYSLQLRSIDWDIADGTSAIWTTRVIKAILSLERNNVYWPDENERKAIDR
                     HFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVDSLSYKGRYGFNILGICDHLKRIRY
                     FQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVHSEMISQGEYLLADSAF
                     PAGDWCVPLFKRRRGQNDLDAPEAKFNKKCSSARVKIEHAYGILKNRWQSLRNLRVKI
                     RNVRDEGVATCWIRACVVLHNLLIDTGDWYNQLDGDADEPDDYIDIERMQERMERVLE
                     RHREEEEDEARDARDASNLTRKRVMERMQEIERRDLL"
     gene            154243..155928
                     /locus_tag="CNC00550"
                     /db_xref="GeneID:3256701"
     mRNA            join(154243..154649,154728..155779,155852..155928)
                     /locus_tag="CNC00550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656659.1"
                     /db_xref="GeneID:3256701"
     CDS             join(154350..154649,154728..155387)
                     /locus_tag="CNC00550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512327.1"
                     /db_xref="GeneID:3256701"
                     /translation="MSWKPSPAGIFASGPPMSSSSNPVINRIKPNASGLSAFQREALV
                     SSYGPSSSAQPKVRTEWDVLKENHRFIRDDEDAKDVSWEERLARAYESKLFKEFALID
                     LKHYKSKKLALRWRTAPEVVNGIGEETCASLRCKYHEPLRAPSPVSDHAVGFISPHSR
                     AESTDRNYGWEYLGHDEKERRRRKEKKTKTTPELKTFELPFVYMEAGERKEALVKVRV
                     CPRCTAKLLWKPGQDDVEEDLMGQMRSGERENEKEKEDEKRSRKDRDRRTEDRGKSAE
                     DKERRRKRKVQECERGRSRSQSPKRHSRHHFEEKGKSHRHRWD"
     gene            complement(155391..157672)
                     /locus_tag="CNC00560"
                     /db_xref="GeneID:3256740"
     mRNA            complement(join(155391..155839,155893..156060,
                     156113..157084,157148..157270,157334..157415,
                     157467..157548,157597..157672))
                     /locus_tag="CNC00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656660.1"
                     /db_xref="GeneID:3256740"
     CDS             complement(join(155537..155839,155893..156060,
                     156113..157084,157148..157270,157334..157415,
                     157467..157548,157597..157612))
                     /locus_tag="CNC00560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512328.1"
                     /db_xref="GeneID:3256740"
                     /translation="MTSLELPLARLSISNPRLAPAGASPKSLNWDSYSNCIIKTNVTS
                     DPASLRLQIVHDTSTLIVRDLPASDLINASITRRITHIGQQAAFRYDWPLNAGVGAKT
                     QECFQVIFQNATDLTSLLDHLKPFFNIQTSTTKPITVTASQPTQVQAKENSSTKKRSP
                     SKSGQKKQVANPAPIRASPKGRLAGDTRAVNKPRPTSQPSLASNPRAPKVNTLGSSPT
                     AKSLGTDGTVPSTLSSDGPRAVTKDIGRQSPLPVHGPLAFSMNDPTMAGLKRKLLAGF
                     DPGTTASVTMHPSQTARITGSPSHSEPQTHEATPSRSVTHKSDPESTTNESAPFNSHF
                     PPIVPVQKPAPTFQPTSVDLITFSSPIMSSNSLPPPPGPARIVLGGSSDIEIGSECDW
                     PVMLTEEKQREETLKRLVEEDLDVEMNPDDGSAHYSSNQQCWTVPPTSYGTLPTALSL
                     AVNGPASYELSDQKLFELICQIFREPKFVNLYGKVSHILGQVSIAQHNNPYPTPSESY
                     ASLPLFTPRGESVYSQEYTERGCHSYSSQDRSNYKRPAYSLEYHDNQTIWKRMRVGEE
                     EIYLYDDLEEEDRMC"
     gene            complement(157829..158964)
                     /locus_tag="CNC00565"
                     /db_xref="GeneID:36392769"
     mRNA            complement(join(157829..157949,158013..158157,
                     158231..158455,158514..158641,158716..158964))
                     /locus_tag="CNC00565"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658917.1"
                     /db_xref="GeneID:36392769"
     CDS             complement(join(158341..158455,158514..158641,
                     158716..158892))
                     /locus_tag="CNC00565"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514257.1"
                     /db_xref="GeneID:36392769"
                     /translation="MAQEQVLPLSNSNSQDPLRPGRYQSLLPLIDEILSILHAQTVSS
                     EKLSPAQASEQVAPKAKQLAQVLENMKLSAMSLPGAHLSIEEINNLTDILEKEGEKRR
                     QILRTFELLDLPIVDDFSLPGAETRAMGTHAFPSPNK"
     gene            159125..162929
                     /locus_tag="CNC00570"
                     /db_xref="GeneID:3256477"
     mRNA            join(159125..159192,159239..159639,159686..159937,
                     159984..160583,160639..161364,161426..161572,
                     161638..162130,162204..162929)
                     /locus_tag="CNC00570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656661.1"
                     /db_xref="GeneID:3256477"
     CDS             join(159177..159192,159239..159639,159686..159937,
                     159984..160583,160639..161364,161426..161572,
                     161638..161745)
                     /locus_tag="CNC00570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512329.1"
                     /db_xref="GeneID:3256477"
                     /translation="MYNGQPPFPGNGLPPFPPQMVPNGTMPAGFPPFAPPFPPPFPGM
                     RPPSGPGIPSPATPGMMPSPAPMSGMQTPGMAFRPPPMGYAPRPAHPGLGSTPHGLPQ
                     PPHMPPSTPKPDVKTTKVFVGGIAPGITDETLESLLNACGPLHELKRVIGASGKPQAF
                     GFAMFENPEVVLRCIRCLNGVELPDMTPEGRRDRKPAKKLIVKADEKTQAFLEEFEST
                     LGRSDSDEEADASSRKSIQHIIALLTDPNAQHPDGPSAGNNGGQSPVQVVVPAHLQDL
                     QEGDLPEEQRVAVLGQIAVFRENAAKREREKKLMEEEKERYKAMQSQGGGQRQAPSGY
                     GYGNRGLAKQQQQAERQWGSQSASPVPWKGAGPSRYGPGERDPQAYDKPVSFVKAETT
                     EGKAESGRTDEEEEELRRRKIQMDKDIALRDAERRVEARERTRLDALSREMNYRQTQK
                     DLVARSRARQEELYARYDDDEYIERSERERDRRDRPDRERDVRELFYVDRPQWRARRQ
                     KFRQNEYQADLRDRQHEEDERQALERESEEFLKKQMAELAALEQSQRAQGLLTEDAAP
                     IKLAINPSALPPPPPKEEKKHVVAPRPGVQFEGEDDDEESGRKKKGTFVRLDEEEEGD
                     GLNEAEKRARRNARLLDVKKGVPNDRRSIWKFPVEWAAVGETLIQNKIKPFVHEKIRN
                     FLGELDEDLADFVLEHLRDRKGADDLVDGLEPILAEDAEPFVLQLWRQLIFESLAFRE
                     GIDTGSMMI"
     gene            complement(161844..163319)
                     /locus_tag="CNC00580"
                     /db_xref="GeneID:3256662"
     mRNA            complement(join(161844..162661,162731..162821,
                     162870..162969,163019..163319))
                     /locus_tag="CNC00580"
                     /product="N-acetylglucosaminylphosphatidylinositol
                     deacetylase, putative"
                     /transcript_id="XM_569842.2"
                     /db_xref="GeneID:3256662"
     CDS             complement(join(162245..162661,162731..162821,
                     162870..162969,163019..163298))
                     /locus_tag="CNC00580"
                     /codon_start=1
                     /product="N-acetylglucosaminylphosphatidylinositol
                     deacetylase, putative"
                     /protein_id="XP_569842.1"
                     /db_xref="GeneID:3256662"
                     /translation="MPPAQGPGQPRPLAFPFVFAVIFPLFRLLFSLTPITQPQDFNLL
                     TPKSIDTLGDKPSALIVTAHPDDEVMFFSPTILGLIGAGWDVKGLCLSTGNSEGLGQK
                     RKEEFIKSYEALGIPAENLEITDHPDLPDGLTTKWNTTLVSTIIQDSLFSHPVDIIVT
                     FDPKGITSHPNHVTLPSSLALIPAERRPRVLALQSPDILPKFTGPLYIIYLHIRTLFF
                     SPQFQRAFQFLFPSFNTFFGTENAKGTQTHVMINDLRGWAIGLKAMMAHNSQLVWYRY
                     LYLAFSRLMWVNELVEVTY"
     gene            163484..164973
                     /locus_tag="CNC00590"
                     /db_xref="GeneID:3256674"
     mRNA            join(163484..163570,163617..163746,163801..163996,
                     164062..164165,164227..164556,164616..164973)
                     /locus_tag="CNC00590"
                     /product="vacuolar ATP synthase subunit d, putative"
                     /transcript_id="XM_024656662.1"
                     /db_xref="GeneID:3256674"
     CDS             join(163539..163570,163617..163746,163801..163996,
                     164062..164165,164227..164556)
                     /locus_tag="CNC00590"
                     /codon_start=1
                     /product="vacuolar ATP synthase subunit d, putative"
                     /protein_id="XP_024512330.1"
                     /db_xref="GeneID:3256674"
                     /translation="MSGTGPREAIFPTRMNLTLTKGRLKGAQTGHSLLAKKRDALTTR
                     FRQILRKVDEAKRLMGRVLQLASFSLAEVTYAAGDIGYQVQESVRKANYTVQARQENV
                     SGVVLPAFEGVRSNDASDFNLTGLSRGGQQIQKSRDTYIKAVGTLVELASLQTAFTIL
                     DEVIRATNRRVNAIEHVVIPRLENTIKYINSELDEMDREEFFRLKKVQGKKKRDAANA
                     EQTREGENKAFEATGGELHRDEGIGGGVAGGADMLDEGKDEDVIF"
     gene            165912..175730
                     /locus_tag="CNC00600"
                     /db_xref="GeneID:3256637"
     mRNA            join(165912..166029,166091..167284,167340..168414,
                     168469..170341,170395..171138,171187..171337,
                     171394..173298,173347..174904,174966..175056,
                     175113..175214,175271..175730)
                     /locus_tag="CNC00600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656663.1"
                     /db_xref="GeneID:3256637"
     CDS             join(166332..167284,167340..168414,168469..170341,
                     170395..171138,171187..171337,171394..173298,
                     173347..174904,174966..175056,175113..175214,
                     175271..175455)
                     /locus_tag="CNC00600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512331.1"
                     /db_xref="GeneID:3256637"
                     /translation="MSNGVFFLDEERERDAVSNPSPTLSPSNPAEDAKSTQPLPSLQI
                     PQTTLAAPIPTHGGQPLPQHRKHPASFAATPSFPSPLARAVTVPSHSDESSSSTHSSP
                     TQSDEEWEGRRNSGQRSPSEMSGSGTPRRWAEGVHGAYQRSPSLSRAGSPTSRPPSPT
                     AAGTNTRPQPLTPGALLMRSRRSGSTSRHSPPRIAKKEPATGQKMPRFVDTFSRMQPG
                     DTGSVYSQNGSNGYGHDQSSPSKTESVSGDRAVAIPSAQDTSKEANSLGFGWGAWELS
                     GSGSSFGNGAGSLRDKGKPRGDLRDIGPPSPRRERDRMSTISVSPTKQRRPSDFLNPV
                     LEARKMPTSNGRPSFGGPAVAHLSTSASMVSPLNPLPSPWTTASDTSVSTFSPSTSST
                     SESALTSGSSNTGGAIKLNRVPTSVRMAADLLRNANTASPAPISGNTPPEHQLPGREG
                     LTKEQIDQAIMPPPQPPAPSGQYMEDVRPGPTPMTTATPAPSTESHIPLAAGRSPAIP
                     FKTSMVPLLPRPRPSLPLESPALSSNGNVQIPTESVKVHKYRTSLYEPVKSSNLLSES
                     PSESTSGGENGSPAKSDSASVATSPSRFGLGLSIPSGTTTAPFLSPVPQSTATEKPGV
                     AQLARLKGAAGEKHGMAGDLAGISGMGDAASHATMIMQSRQAKIQRWGVGSNQRGFAP
                     PIFGRSASAGSPAMLAARRADRQSEWGQLDVSGGTAASSPGEDIPATGSLDAFSCAIS
                     GTLGPSASMPSTQTPNPSLLGLSSHGAEDNEMREEAGSCTKHQFNAGAAGVGDIEWVD
                     WMDCYKGYKEMKIKAEAEAMKAETSKAGDSPAFETKQLGYEHATRPSLQEERRPAERA
                     HGRRFSDQEVTISSRKSGEKIPVTLTLTPTVSRDSQGGSLHGSMKRQSLSFKNLIAVE
                     PRMSPTQRRSSFFERQRQSSGSSTKTDHSSVFGSGSGSGSGLMKKKNLVSKMEGWWNA
                     VKSNFVPEHPPGRPGGHSNQGRVNHSPKRRGSIPSITQLKSAYLAPEPAALRGSPNLP
                     LRQVISHNELRQRPQGDNHYESASVLDSTPADIARLSRNSSSETAMPIPQHMLVPPPP
                     PVRHASTVTEVTEEPTNPPSRQEPPIHTSLEARRRQPNLRLELEPHTLAQPSPHSSNS
                     SGSQPRMVPLGMPLRLSESSLRSSVYGQSRGPGLTPGAPRWDQTPWPVHTFSQHQVED
                     REDKPVAPGAELTVGSVRNHIRRRLNGAKEACDASLRRTINSITKFVEQERQDVGRQE
                     EIPVDYFETLNLNDSAVVDGEDTGSEAAYENEGPSSRAVSISWSRGPSRRPSVSLHAI
                     SPKARTSALATSPSRIVSRRRPSAVLPRTFGPTGRNVSIPKDRTQSGASSRSTSRSHS
                     PMPGRQLPLQVDSTDEDRHFLQALQDLIVQATEVVDSSVHTLKSGPDSCATIIQRIQK
                     IGAKWDEHPDWPGREWYVEILLAVANLGRVLDWWEAEKGFWNFDAETENDQLLFVLKP
                     REEQRFDQEFRATFSEPRYSPLSTAVSVAGDLPPALGLDATSPIVSSPQTAKSEEPGK
                     GLSPKAQAIDDLKFLAEHAKSVNIVMELSLQGEIVEYVNDAVLEVLGQVPEEVIDHPI
                     TDLLAPGDASVFSEATHQLIEDDNNTVQCRFRFEVHDLAQDEDDERQPGPVYIELEGV
                     GMLMRENNEPSHTMWVMKPVAATQVEAITAAVFPRDGHISTEGILCRICEREIVAWFF
                     EKHNETCDALHRLEAEIAECDDCLHELRQTVVDLESEVDAAAPNNPAQYQGVLFFTLP
                     ESVAASDAKAATQYLQGIEVRKVAREHLQDVLHILSTARQIETPYVREEEADLPSNIQ
                     NYLSEESEDRLLKIMRWQRPQTNEFALNLLFTHVEEQLKRKHKAVARMQSTIRYSEKT
                     RHEWEDKVNEMLAEQEDGSGTESESGSGGSEIDKSPSEVHAALSVENPESSPPGPRKI
                     APLARLPITQAHPHRQPSVLEELSAPTSIAPTPAAPQTITTDPAPPALTSASSLPTVP
                     ILAPKVRNAPFQFGSKVHSPDMPPPAPSRRVTPSKTGSTEPESMTSSPLLMPYGADRH
                     HRRRISGSQGMRDAPLSPRIPSAALRSSVAQTTIDDFKILKPISRGAFGSVYLAKKVA
                     TGDYFAIKALKKSDMISKNQITNVKAERTILMNQASSPYVAKLFFSFQSKDYLYLVME
                     YLNGGDCASLVKTLGGLSEDWARNYTAEVVLGLEYLHKRNIVHRDIKPDNLLIDARGH
                     LKLTDFGLSRIGLLNRQVGGPRPAYLRGISLRGSGQHRLSMTRTTSNSSLIDSNMLSP
                     EISSGQSLPNVSQSYFSQMRPSGPEDESSGSESAGIIPKHVRQMATKLSSELGTPSVN
                     GKEPPKFVGTPDYLAPESILGIGQDDAAVDWWALGVVLYEFLYGFPPFHAETPEKVFD
                     NVVSRRINWHEDEVGISPEARDLINRLLCSDPQMRLGANGAEEVKSHPYFASINWDTI
                     ATSEASFVPDVADPESTDYFDSRGATVGFHDGGGVPQVSKQTATDPNAKANPGAASMS
                     PKASGEMEAIANDMAEQSDFGAFNYKNLPVLKQANDDVIRKLRTDSMAPLSQALECAP
                     SLSKGKQRRLSVQVQSKSTRRISDPNQAPYTPSPSTSTSSAVSTPSRSNMQPPSSSTS
                     HHPRRLSELGALDRVKSTDEADEPREAQSQTRLRGDSGSSIGSNSTELTKQRRHASLQ
                     LDFATSEPFGGLAENKHFVGSNVHSRGLDVLVAEDNPISQKILETLLTRVGCRCICVD
                     DGPSALAAIMGSIRFDVIICDIHMPVVNGEQVARMIRSTNNHNQLTPIIAATSYEQYI
                     NEEGTLFSGVLAKPVTKADLIRCLAKLGFVISAGASDVASVPTTAPAVQS"
     gene            complement(173298..174819)
                     /locus_tag="CNC00610"
                     /pseudo
                     /db_xref="GeneID:3256735"
     gene            complement(175621..180483)
                     /locus_tag="CNC00620"
                     /db_xref="GeneID:3256413"
     mRNA            complement(join(175621..176068,176129..176332,
                     176395..176591,176642..177426,177484..177680,
                     177737..179157,179204..179261,179318..180296,
                     180346..180483))
                     /locus_tag="CNC00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656664.1"
                     /db_xref="GeneID:3256413"
     CDS             complement(join(175769..176068,176129..176332,
                     176395..176591,176642..177426,177484..177680,
                     177737..179157,179204..179261,179318..180295))
                     /locus_tag="CNC00620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512332.1"
                     /db_xref="GeneID:3256413"
                     /translation="MLSSSLTALPPTSEAPTLPSEPSPPRPAPKRTYGRAKHVSPPPD
                     KVEFSSITNTSEFGEPSSARDNTLVNRWTDLSSNWRSQLAEIDAPRDGAGLAEDPEEL
                     AREMARLRGELRGKNGSTSTLVTEEQDHTRKLTAKATGGLTVSVNGSSQASPFSMPPS
                     SPPKRHSSQASSALSEPQSLLQVSEASETTEEESYVLNRLLKGKSRSVIASDEEEEEE
                     EETPKRRARSESSQSASPPLFSSQEELTEQNPTEKDADSDKEKDDGEDQDIGALLAQQ
                     NEEVETHGQREQERAKEGQFSQAREDPLAELNDLFSDDKDSDEHEKSNNKGLNKRNKE
                     TMYREIDAAKRQRPVHLPKPNAKLAPLGDWLNKWKAVKDSSPPPHQLVIKEASPAPQP
                     LIIPSSENDPITLFTPSSTAHVHVPSTQIKTSTISSSPTPNSILRPSRDYSKSRISQS
                     SRVLGTSEPNEQEEEDENQDFGAFMEKEEKKDTAAEKQAEKMRNLKEIKAKLAREAAL
                     RNKPKSKADDDDDLDIVQGSRDFLLEGRGRAGGSVKPNTKTLDIIRAAASRRSTTPFE
                     KGGPKPQSMSQEATETYVLHAAHTPNHASSKFLNGGVRPAGQKKGRDGAISQAKLNAY
                     ILDKHRQQANMTKGKKEEQWGRGRILPERVTQDVDELVTQAEQAGEEEDEDGDEDEDD
                     GEYAPDDESEEQELVYSGEEEEDEKSEELPMKDEPIADTSGDKGNQSQSEEEEEEDSA
                     LILKRKSKKPRASARVLESDDEDESVPPKAPTPREPLAETAISNLAPLAADIDIDLAG
                     FGEGGMSQLFDATQIDNAGDGEDAFAELRNRKPVGLLPTQLELPPLQISESQALRDDQ
                     LVIAAIEDAAMERARELEEPAKRYLNTQGLFTQTKPTTPDEDYDPSYALGGGSPTPLT
                     QRDTQYANSMGQTFPRRNGDMVSSDQFSPTQKLTRLKRRVSGSPRSPDRLRESSPEAS
                     ADELEPTQVSEEQQNAFDVLRAGARLAANPLDIPIIEAERKKKGKNKSAFLEAEAEES
                     DEGDGGWMKTTGGEDENSGDEGDDRFLEELVDDAAVSAEEKARQDELAAQMRKQIEDE
                     DDARRLEEARKITEGEHRKRRKGQDFYDDDSDDEGVRLKKLSRKERKRRELGRAEGLL
                     DGEINVFEQEYHRDLDSDQSDVGEEEYHPSVLGGVERLSPEPEPVERLSYGDRRVRLQ
                     KVAKMNAQRDMETMDQEMDAELGLGVKHHISGRSRATAIHLGIDEDVIMKDSNFNIKR
                     NVRYTKKMEQVPAEDDDLVTYSSHKRDGDRLQQFEAYLRNESTYNRGVNSRGGGGGNF
                     SVIRRNGGNSNSGIGENMGNSVGGDVFGRGRPGPMPQRSSTMSSSSSGLVGLSKGDKF
                     A"
     gene            180648..182322
                     /locus_tag="CNC00630"
                     /db_xref="GeneID:3256671"
     mRNA            join(180648..180799,180859..180960,181018..181126,
                     181182..181577,181631..181986,182053..182322)
                     /locus_tag="CNC00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656665.1"
                     /db_xref="GeneID:3256671"
     CDS             join(180708..180799,180859..180960,181018..181126,
                     181182..181577,181631..181986,182053..182170)
                     /locus_tag="CNC00630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512333.1"
                     /db_xref="GeneID:3256671"
                     /translation="MPRSNSNTEDLPKHQEDDTLRQKILVLGWRKAGKTSCIKTVFQQ
                     VPAVEVPHFGVTQKIEQINYNSIVPLQIWDTPSNFEIDQLEVPLSTFSTIVYVLDMQQ
                     DDSYHDSIRKFVHIMVRAYLSNPDIRFHMFIHKAEMLSEDYRGENYAEIQRTTAEEIE
                     DFRYGDLQAYAPNNLDLDDPSTIGMIINQLIPEVVYSMTSAHDVSLRAAWSKVIQGSM
                     EMLSAVEALLLDFSSHSSTDNTFLFDMNSRVILATDNRHRTDELTEQVTEYLSSFLQF
                     QSLYKAISQRPSADEEDEDDGEEERGQDGEDDEDDEEEEDDAPRGWWDDEDPDAPWMT
                     QSTRLLPSTTLAMWQFTPYLALVVLLRTETWQARRGTIEYNLTFLRQGVREILSVV"
     gene            complement(182468..184492)
                     /locus_tag="CNC00640"
                     /db_xref="GeneID:3256762"
     mRNA            complement(join(182468..183121,183180..184117,
                     184168..184309,184368..184492))
                     /locus_tag="CNC00640"
                     /product="expressed protein"
                     /transcript_id="XM_024656666.1"
                     /db_xref="GeneID:3256762"
     CDS             complement(join(182515..183121,183180..183640))
                     /locus_tag="CNC00640"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512335.1"
                     /db_xref="GeneID:3256762"
                     /translation="MTIVPNLQEATTSDSDSERTLYDRPNRTSRTDRAESGHDSSEIF
                     FPYTAPFSSIVPALTSFTKQPQVTSFQPLKETKWQRPPFLPTLNSHPRLVYPIVVLTL
                     LSAGLITGLVVFVIHQNHILVGEESSPDNEGKDDGQELSPLILFIDAVFIIFIIGTIS
                     ILLLLIYRFSTKFRHPPLPSSTTRIANPLDFLPGWCRTTLPSLPTYGEAVIGASGTID
                     HQLEMTLPVYEDNRNSRMLMRSQSRQNVEDRGGSSVSVVMTDDEGNERQVRSPTQEQR
                     LTSYWMSELVLPTAKRQSQIHIQSEPRSSSLLDVIVEDESVMINMEDIKERGRIGVEE
                     GGVNGDEGEVKEDEIEVWLEV"
     gene            184631..186245
                     /locus_tag="CNC00650"
                     /db_xref="GeneID:3256738"
     mRNA            join(184631..184741,184826..184931,185095..185242,
                     185332..185504,185573..185635,185692..185912,
                     185963..186245)
                     /locus_tag="CNC00650"
                     /product="expressed protein"
                     /transcript_id="XM_024656667.1"
                     /db_xref="GeneID:3256738"
     CDS             join(184671..184741,184826..184931,185095..185242,
                     185332..185504,185573..185611)
                     /locus_tag="CNC00650"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512497.1"
                     /db_xref="GeneID:3256738"
                     /translation="MASITPSTIPPSSQIGIPTTVPPAAQSWGPLAIDAAAHGAIAFC
                     QIYYEAYDEPSRRAEEIPILYLPSSKIIWNGNPVSSEPAAFAEFLRSMPLSRHDLQTL
                     DCHPVASEEGSAPSLIINVTGSVLHGPAVLQSSNDKPQERDMPRKFHEMFMLKVIGQE
                     EGMQPRYAVHSSNFRFIG"
     gene            186949..190469
                     /locus_tag="CNC00660"
                     /db_xref="GeneID:3256367"
     mRNA            join(186949..187064,187117..187150,187209..187223,
                     187310..187378,187437..187839,187892..188187,
                     188276..188405,188487..188627,188707..188851,
                     188950..189063,189143..189157,189218..189240,
                     189303..189390,189447..189481,189557..189730,
                     189787..190059,190154..190469)
                     /locus_tag="CNC00660"
                     /product="long-chain-fatty-acid-CoA ligase, putative"
                     /transcript_id="XM_569356.2"
                     /db_xref="GeneID:3256367"
     CDS             join(187014..187064,187117..187150,187209..187223,
                     187310..187378,187437..187839,187892..188187,
                     188276..188405,188487..188627,188707..188851,
                     188950..189063,189143..189157,189218..189240,
                     189303..189390,189447..189481,189557..189730,
                     189787..190059,190154..190331)
                     /locus_tag="CNC00660"
                     /codon_start=1
                     /product="long-chain-fatty-acid-CoA ligase, putative"
                     /protein_id="XP_569356.1"
                     /db_xref="GeneID:3256367"
                     /translation="MPLEPLPPNVDLNRQNHEIPGTRKDGQSGVFTNSFYNRSILTAP
                     GEPHTLFQLFEDSVKKNPGHPLFVRRALHPSSTPLEPVWTDTLIPTSYATVQTRRNNF
                     GSALLALEREGRLRDPTSADISPPEIKHPGVPFYGDENRRKGGARRGWAVGVWSGNRE
                     EWQIMDLACHAFGLVGVSLYETLGPDVAKYITNHCPLPIIVTSQNHLPSLLKIAPLCP
                     SLRVIVSMDPLPASERVLLNQWAASVNIEFFTMDELEAKGAQAPCKPGPEEGEEELDL
                     KRICTISYTSGTTGDPKGVVLTTENVLSATISNGKGVNPGLINESWMFLSFLPLSHIY
                     ERFAEIVVMYGCGTIGFTRGDPTKLLEDAQLIKPHFMVGVPRMWNRIHAAVKEQMNSG
                     GLKGALLTKAVNTKLAKWRETGEVTHPIYDALVFRKIRALLGGRLVFIGSGAAPLRKD
                     VHEMLKVVLSCEVVQGFGMTETVGTCSVGIPWDVGGPGTCGRLQPCNDVKLVDVPDMG
                     YTARDLPNPRGEVCLKGLNISPGYLHNPKATKESIDEDGWFHTGDIGEIDSAGRLKIV
                     DRLKNVVKLSQGEYVALEKLEGLYALDPLFASFLVHGDSTRSSLIAIAILDPQQTSNL
                     VSKVLGKNVPSENLRGLEEAAKSKEIRKAVFKILGKTARQNKLNGFEMIKGLYLTLKP
                     FPEDIVTPTFKVKRNLAAKIYAKEIEEAYERGEEEAVEALREARL"
     gene            complement(190457..194196)
                     /locus_tag="CNC00670"
                     /db_xref="GeneID:3256475"
     mRNA            complement(join(190457..190838,190900..192013,
                     192069..192305,192355..192509,192558..192990,
                     193045..193468,193517..193680,193750..193839,
                     193914..193949,194060..194196))
                     /locus_tag="CNC00670"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_024656668.1"
                     /db_xref="GeneID:3256475"
     CDS             complement(join(191006..192013,192069..192305,
                     192355..192509,192558..192990,193045..193468,
                     193517..193680,193750..193839,193914..193949,
                     194060..194122))
                     /locus_tag="CNC00670"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_024512338.1"
                     /db_xref="GeneID:3256475"
                     /translation="MSNDESKTNQQQAPLKRRRITRACDRCHRGGIRCAASSNPSVCA
                     PCADFGSECTYNRPMKRRGPPPSKARESYGSASGIALTRWTLPLPSDNWTYREIASHA
                     HIESLVEAFYAIVYPIYPMFHWPTFTANIRRRVYTTYPAFHALTMSVCAITSARLRDG
                     AVPSPNSSTPTSDPQPPTSETFYQAAVASYPRDITTASDFDYKRAKPLLATLAIQYGQ
                     IPAVHAHIGDYMTLCAIDGFHNESRWPNDLNEIEVQERRRLFWLAYQLDVYAATTWGG
                     IIRHRESQSTVLYPAEVYSDEEITPTGIVKSVNPAHPVSFWRGWNFVVDLYRILEHAV
                     TRLRARNHTFDAGNQIAALFSEGRVGSGTELKPGDLLVLVERLYRALPPELRATSEMT
                     GDVEKDRYGFQAANILVTMQTMKMVVAGMAEWSVEQRCSIAGELLDAFATVPRAYIQA
                     ISTPLLHHLAGVGHLLASIIHSPLSPAAYLHVRTVLLSMADLLSSLESHLTSTGGIAP
                     KLREHVERIDRYMTSATESNGKLATFASPIHDVQTRQHLATPHHAKDTTPTTTFSLRN
                     VSAVPGTASSVTGTGSLGMSTGTNSSNVRTTSRPSTSANADVYNPSPLGNVNAKFQFK
                     PNSTSSSSSLPLPHLPRPPASQIQNTILPSSSSSVPPPMHLPFGGIGAGVSDTGAGES
                     LQRREPPVITPSSSHSSHSTPSQFSPKFVNTSLVSHPVPPPSIGQPQGNLAGLPLPLQ
                     PSHSQNQSQSRTQHNQPQQPIENPFHLTISNFPPETQEPAYQLPDDLFVDWPFLFNEF
                     GFQGDAFDFLSSGIGGAGGGPGGESASTGVFDGVQAGAGGSTAPVGNFNGVNMTGIGG
                     GRIPPALEGANLQ"
     gene            complement(194570..197522)
                     /locus_tag="CNC00680"
                     /db_xref="GeneID:3256297"
     mRNA            complement(join(194570..195924,195984..196295,
                     196353..196598,196660..197522))
                     /locus_tag="CNC00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_569360.2"
                     /db_xref="GeneID:3256297"
     CDS             complement(join(195007..195924,195984..196295,
                     196353..196598,196660..197490))
                     /locus_tag="CNC00680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569360.1"
                     /db_xref="GeneID:3256297"
                     /translation="MSDATLFLRKNKDKQRRRNVSGASRIASTSNSSLASRPGASKGQ
                     PVAGPSSSGAPSSAAPSPSSVSIKPEPDSSNNPNITEIKIFSTGSNSALRYNLMRLNS
                     VKDVDPTQITAPVLMNRKKPGPKDPPTFALDENGKIVGRYVYDEEGKPILDEEGQPVV
                     ERKEVVDMSLVGQAPGGGRKKRVKRGTKEVFHQDIEIMRLRREEALPWVLESGNPQDK
                     PAQPEQWVGRMLEQGQLSTVLLSNDGTRDGFEMMPLGRSYKFEPARPFKPLDSDAANK
                     LFELQAKNKIHDRWAFRPADNQSGEASSASTPIQVKAEPNELEQRASRMETRIKMHKG
                     VTVDRKAKVERYEDDYQREGHRVERGMEGGVDEELDFDEAEEFQDDDDNNTFYRDAQE
                     EEEARELEERLKKEFRVANANVGDRPQIDAEDDEDDLFGDKSLDDEGKKLRKIMRRRM
                     RENGEDYDIDDDSDSDSDDESTTSTQNKEKEKEKDKEKEKAKEKDSSRNPSQPPSRPS
                     SRPPTARTSSPSGSNPRYPSPKKGKASTAPPPVSGASLIAQRATSRGASPRPSTHGGH
                     VAGRASSPLGRVPSPAEGRGPGVTGQSQPASRATSPAVRESSPASGGAAATGGASPAS
                     GGPSTRDVSPAPPAGRPSPRKENAAVSTSSSSAKRKSSPSVSTPSADAPPRPKKHKKT
                     GSLTPAPAPEDIPPFSGMITKQDVLGWFQRNKKKAVPMNEAIGAFRKRIVDAGPNRDA
                     NQKLFLGWIRMVADQENGNLSLKPEFRQ"
     gene            <197700..199556
                     /locus_tag="CNC00690"
                     /db_xref="GeneID:3256549"
     mRNA            join(197700..197823,197892..197923,198003..198120,
                     198190..198293,198351..198485,198546..198649,
                     198842..199198,199291..199427,199483..199556)
                     /locus_tag="CNC00690"
                     /product="chaperone regulator, putative"
                     /transcript_id="XM_024656669.1"
                     /db_xref="GeneID:3256549"
     mRNA            join(<197758..197823,197892..197923,198003..198120,
                     198190..198293,198351..198485,198546..198649,
                     198744..199198,199291..199427,199483..199556)
                     /locus_tag="CNC00690"
                     /product="chaperone regulator, putative"
                     /transcript_id="XM_024658918.1"
                     /db_xref="GeneID:3256549"
     CDS             join(197758..197823,197892..197923,198003..198120,
                     198190..198293,198351..198485,198546..198649,
                     198744..199102)
                     /locus_tag="CNC00690"
                     /codon_start=1
                     /product="chaperone regulator, putative"
                     /protein_id="XP_024514258.1"
                     /db_xref="GeneID:3256549"
                     /translation="MASTELDYAIKKSANDLAKELEVERIMSAFKLNPYDILDLPLSA
                     TETDVKKQYRKKSLLIHPDKFKHEKGLEAFDFLKKAHDHLADPAKRKDIDMIMTHART
                     QVLKSILGDGYSTSVTDDDPRLTNLSPPFEQQIRAKGREILVEDELARRRKQKLAYSN
                     EGAEKARAEAEVAARKRKVEEQAKWEGCNTITMPHIIFYFLITRIEYVADTCFPFFSS
                     QNDEMTVSKTGETSRRKRRRRERRTICMCWDKKWGARDLWQVSILRRIHSFFSFCFVK
                     SFSIVVLITIVVNIPRQEMMHHTLITVLA"
     CDS             join(197758..197823,197892..197923,198003..198120,
                     198190..198293,198351..198485,198546..198649,
                     198842..198933)
                     /locus_tag="CNC00690"
                     /codon_start=1
                     /product="chaperone regulator, putative"
                     /protein_id="XP_024512339.1"
                     /db_xref="GeneID:3256549"
                     /translation="MASTELDYAIKKSANDLAKELEVERIMSAFKLNPYDILDLPLSA
                     TETDVKKQYRKKSLLIHPDKFKHEKGLEAFDFLKKAHDHLADPAKRKDIDMIMTHART
                     QVLKSILGDGYSTSVTDDDPRLTNLSPPFEQQIRAKGREILVEDELARRRKQKLAYSN
                     EGAEKARAEAEVAARKRKVEEQAKWEERRDDRIKDWRDFSQKKEKKRKKNNLHVLG"
     gene            complement(198851..200447)
                     /locus_tag="CNC00700"
                     /db_xref="GeneID:3256811"
     mRNA            complement(join(198851..199356,199418..199856,
                     199915..199993,200126..200199,200260..200273,
                     200367..200372,200428..200447))
                     /locus_tag="CNC00700"
                     /product="PRCDNA38, putative"
                     /transcript_id="XM_024656670.1"
                     /db_xref="GeneID:3256811"
     CDS             complement(join(199757..199856,199915..199993,
                     200126..200199,200260..200273,200367..200372,
                     200428..200430))
                     /locus_tag="CNC00700"
                     /codon_start=1
                     /product="PRCDNA38, putative"
                     /protein_id="XP_024512341.1"
                     /db_xref="GeneID:3256811"
                     /translation="MGKGTPSFGKRHSKSHTLCRRCGNRSFHKQKLTCAQCGYPAAKL
                     RSFNWGLKAKRRKTTGTGRMAHLKNVNRRFKNGFREGGAAAKKAKAE"
     gene            200706..201490
                     /locus_tag="CNC00705"
                     /db_xref="GeneID:36392770"
     mRNA            join(200706..200960,201059..201175,201244..201490)
                     /locus_tag="CNC00705"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658919.1"
                     /db_xref="GeneID:36392770"
     CDS             join(200787..200960,201059..201175,201244..201426)
                     /locus_tag="CNC00705"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514259.1"
                     /db_xref="GeneID:36392770"
                     /translation="MPKFLSCFPSQRSAAAQYDPLLPTSNDITNDADNHKKTIASCIF
                     CDVSRDKDFNIVYEDQELIAFHDRTPRAVTHLLIIPRSHVASSVRQLTHEHLPLIQWP
                     LYLAHLCPPNRHRSWVSIYLLSPLYRISIYTSSLGHTRLLANSNIPSPLMQQGKV"
     gene            complement(201474..202461)
                     /locus_tag="CNC00710"
                     /db_xref="GeneID:3256125"
     mRNA            complement(join(201474..201873,201924..202461))
                     /locus_tag="CNC00710"
                     /product="pyrophosphatase, putative"
                     /transcript_id="XM_569368.2"
                     /db_xref="GeneID:3256125"
     CDS             complement(join(201585..201873,201924..202396))
                     /locus_tag="CNC00710"
                     /codon_start=1
                     /product="pyrophosphatase, putative"
                     /protein_id="XP_569368.1"
                     /db_xref="GeneID:3256125"
                     /translation="MSLQLPESSLPPLKSFSLTHILYDPAHPLSIPLTLLSLSPIFLF
                     VSYFTLLIFTRRISIALLASGQLANEVLSWVLKRIFKGERPYIGHGEVGAGYGMPSSH
                     SQAAGFLVAWGIGYVLTHADRNEQVRSVRAEMVRKWRTRVYVFGLLLWSVGVSYSRFH
                     LHYHSPAQIVAGYLAGLAFGALYFTITEYYPLRHPFSSLARLRIAVEYIWGGIGGVGG
                     WELGDAGGGWGEGWAFVGEEQPAEEKREDKKKKKK"
     gene            205111..209779
                     /locus_tag="CNC00720"
                     /db_xref="GeneID:3256244"
     mRNA            join(205111..205846,205917..207000,207047..207161,
                     207211..207668,207720..207961,208016..208558,
                     208607..208863,208919..209192,209247..209370,
                     209425..209779)
                     /locus_tag="CNC00720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656671.1"
                     /db_xref="GeneID:3256244"
     CDS             join(205926..207000,207047..207161,207211..207668,
                     207720..207961,208016..208558,208607..208863,
                     208919..209192,209247..209370,209425..209504)
                     /locus_tag="CNC00720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512542.1"
                     /db_xref="GeneID:3256244"
                     /translation="MPHTTNVSLSPRPTTPSGSLPRTDRSRRPLPPDTAASGINDLPR
                     REFFSEGSDGEDYDDEEDEEEEDDVFAFNRPATAAQPNGASSSGYGTAPTSGRPTTAG
                     ISWTQTTAEERGPAHVGTSTGPGTLSYDGPTPLRDQPQSVNSNNKDAVPTPTGVIDVG
                     GHLPDTTYDVNNPPPFSGKNNPNNSSFAYNITGRSYRPRTGQSLLDRIHRRRTPETGK
                     SSVTTMTALTSAHTDDSAVSDFASTSDVDHYSHTPRRRISQGKRPISSAPPISEDGVY
                     SEDGNFGRRRRRSRGSIGMTELTGDMTVPDGMTTWGDGMGGLAKGGSDGEVQSAMDVD
                     FDEEDSPYPEVRASVSNIDDPDMPAMTIRAWVLGIFLTILASGCNTYFHFRTPAPYIS
                     PLIVQVVAYPLGKFAAWILPIDTYKLPLWLGGREFSFNPGPFNIKEHTVIVMMANVAI
                     GPAYALYATVSSELYYNHPMGFGFSIMFLFATQMTGFTLAGICRRFVVWPASMIWPGN
                     LVVATNLNTFHAEEDGFTGGMSRFKFLIVCMAGSFAWYFFPGFVFTALSYFSWVCWIA
                     PRNNVVNQLFGVSTGLGMGLLTFDWTQITWIGNPLTTPWWAEVNVGIGFVIFYWILTP
                     ILYYTNVWHTAFLPISVIQAADRFGSTYDVFNILTPEITLNKTAYAEYSPIYLSASYC
                     VTYMVAFALSTALLVHTALYHGPRIYRAILNIKTEADDIHYKLMKMYPEVPDWWFLAL
                     FAVVFVFAVVSIEVYHTELPVWGYLISVLLPFIYIIPTAFIYAMTSQQITINLLAELI
                     PGYIFQGQPLPGMIFKVFSVQTIVEALSFVQDQKLGHYMKVPPRATFVAQLSATTVAC
                     FVQSGTKELLFHVVKDICTATQKSLLICSSTKVFFTSSIIWGLIGPNRLFSKGAFYYP
                     QLFALVFGAVLPIPLWFWVRRNPRSIFRNLNFPVMFNGALSIPPASGVNYASWLSTGF
                     IFQFWLRRKRFAWWSKYNYVLSAALDVGTALSAVALFLFIDLPGASLSWWGNNVYKQT
                     VDWDGVGATYYKPPPEGFGPDTWKV"
     gene            complement(210638..211251)
                     /locus_tag="CNC00730"
                     /db_xref="GeneID:3256177"
     mRNA            complement(join(210638..210857,211061..211251))
                     /locus_tag="CNC00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_569370.1"
                     /db_xref="GeneID:3256177"
     mRNA            complement(join(210638..210874,211061..211251))
                     /locus_tag="CNC00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_569372.1"
                     /db_xref="GeneID:3256177"
     mRNA            complement(210638..211251)
                     /locus_tag="CNC00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_569371.1"
                     /db_xref="GeneID:3256177"
     CDS             complement(join(210844..210857,211061..211184))
                     /locus_tag="CNC00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569370.1"
                     /db_xref="GeneID:3256177"
                     /translation="MSFTTLFTAALVLIAPALVAAAPAAEPAPSVKSQNFGAPGGAYP
                     W"
     CDS             complement(join(210861..210874,211061..211184))
                     /locus_tag="CNC00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569372.1"
                     /db_xref="GeneID:3256177"
                     /translation="MSFTTLFTAALVLIAPALVAAAPAAEPAPSVKSQNFGAPGGASP
                     I"
     CDS             complement(211050..211184)
                     /locus_tag="CNC00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569371.1"
                     /db_xref="GeneID:3256177"
                     /translation="MSFTTLFTAALVLIAPALVAAAPAAEPAPSVKSQNFGAPGGGKY
                     "
     gene            213170..216170
                     /locus_tag="CNC00740"
                     /pseudo
                     /db_xref="GeneID:3256779"
     gene            complement(215696..216182)
                     /locus_tag="CNC00750"
                     /pseudo
                     /db_xref="GeneID:3256493"
     gene            217274..219019
                     /locus_tag="CNC00760"
                     /db_xref="GeneID:3256630"
     mRNA            join(217274..217520,217608..217792,217852..219019)
                     /locus_tag="CNC00760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569376.1"
                     /db_xref="GeneID:3256630"
     CDS             join(217669..217792,217852..218681)
                     /locus_tag="CNC00760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569376.1"
                     /db_xref="GeneID:3256630"
                     /translation="MFAKAAVIALASASIVVAAPVNCARAKPTTYDEGYLESYDAYHT
                     RYLALSCSTQHNTTFFDDCCHPLLATETLADNRASYCTPNSTAIASVNATIAEATASA
                     TASADIEAESQYNNASSYAAEATASVTAEATASVTAEATASVTASAVNNLADVAQQTA
                     ASSYEEQPTASSSSSYGRASASSSSSDEESATSTSSSSASDSSSTSSSEVYTGGYATF
                     YSQGGVAGECGTVHSDDDYVIAIDSNGWWQDYESNDSSPYCGKSITLTNTNNGKSVTA
                     VVADVCPTCETANSLDLSIGAFNQIATEEDGMVPITWYFTD"
     gene            complement(217858..219019)
                     /locus_tag="CNC00770"
                     /pseudo
                     /db_xref="GeneID:3256425"
     gene            complement(219350..222564)
                     /locus_tag="CNC00780"
                     /db_xref="GeneID:3256392"
     mRNA            complement(join(219350..219679,219791..219878,
                     219945..220205,220283..220378,220444..220510,
                     220576..220632,220715..220871,220961..221150,
                     221207..221334,221412..221524,221594..221746,
                     221806..222094,222155..222564))
                     /locus_tag="CNC00780"
                     /product="histone deacetylase clr3, putative"
                     /transcript_id="XM_569378.2"
                     /db_xref="GeneID:3256392"
     CDS             complement(join(219495..219679,219791..219878,
                     219945..220205,220283..220378,220444..220510,
                     220576..220632,220715..220871,220961..221150,
                     221207..221334,221412..221524,221594..221746,
                     221806..222094,222155..222521))
                     /locus_tag="CNC00780"
                     /codon_start=1
                     /product="histone deacetylase clr3, putative"
                     /protein_id="XP_569378.2"
                     /db_xref="GeneID:3256392"
                     /translation="MAHTAAMHTGPPPAAPTNVGNSPSHTTMAMPGAAARIARTGYIY
                     DPLMMLHCMEGYMPTAENVMDNGDGHPEDPMRIKRIFTRLAEQGLIRRMKRLDFEEVK
                     FEQVLLVHGEEMWDKVQATELLSDQQIQDMKEYYDQLSLYVCRETAHCARLSAGGVIQ
                     ACRSVCKNEVRNAFAIVRPPGHHAEPNEHMGFCFFNNVAVATREMQREGLAKKVLILD
                     WDVHHGNGTQRAFWHDGDVLYMSLHRHEGGTFYPNSDFGSLNMVGDGEGVGKSVNIPW
                     PGPGFGDADYIYAFQRIIMPIAYEFDPDLVIISAGFDAADGDMLGQCRVTPAAYGHMT
                     HMLSSLAGGKLVVALEGGYNLRAISDSALAVARVLLGEIPPELGIMRASEAATEVVYQ
                     VALEQSKYWKCIDVKACEPPEVTELENGTSPVYTIPDLLKIHRAHHMFTKHQLYQIPL
                     ASQELEAAFGGQIICNENMYEVGEKGVLVVFVHDFGNLRVETDGARSTNIHLANSYLL
                     DTSDAVVSWVKTKGYNIIDVNILKQLPTEYPEGPKMVVKQANDMESKLMKYIWDNYIE
                     LSECEKVVFIGHGTGCQAIMDLVNARDVELKVKAVVQVAGLHSLVRPNPSNKEKLSWF
                     KQCNQIYVPAEHVVLEDEKVKRRLGDAVFTSQKAKVVDVLNDVLPRIKAFVESKVEDG
                     LAPRAHSGLDGLYGLGGAGAGGELVVVNGHVHVG"
     gene            222729..224806
                     /locus_tag="CNC00790"
                     /db_xref="GeneID:3256540"
     mRNA            join(222729..222898,222961..223359,223428..223706,
                     223776..224222,224283..224806)
                     /locus_tag="CNC00790"
                     /product="RNA-binding protein, putative"
                     /transcript_id="XM_569380.2"
                     /db_xref="GeneID:3256540"
     CDS             join(222743..222898,222961..223359,223428..223706,
                     223776..224222,224283..224756)
                     /locus_tag="CNC00790"
                     /codon_start=1
                     /product="RNA-binding protein, putative"
                     /protein_id="XP_569380.1"
                     /db_xref="GeneID:3256540"
                     /translation="MAKHSAHKGKAPVTDKNNKRKRDAQDSSQGDAPVALFAAVKDTE
                     LDDIFAKSNAFSAPAPVASTSKAHLQTTSAPAAKKGKKSPSPEMEEDVRVDDQDESES
                     SEEDEDGEDNEAELSEIDEELPDDDDEDVSDAESDSEAAKAKETKKTKKSKLGKYVPA
                     EESVQDKNRRTAFIGNLPIDAAKSKSTLKQLRAHIMSFVPSAKIESLRFRSVAFATPT
                     AALPTEDPEKDANQRAKREKERAAAWKAKQNADGEDAELDKAKVFIDAKGKRKVAFIK
                     KDFHSEIDSCNAYVVFAYPHPDRAANVAPILDPFEAAAKFIASANSSTFSGRTIRVDS
                     VRLPSSVGLAGASTSLSKRDAWLPSNTDPKKSLFVGGLDYAAKEEDVRVFFEELVKAE
                     RGANKEGSGKWVTGVRIVRDKETQLGKGFGYVHFADRESVEEILAMDAKQIKFAKRTL
                     RVQPCKTIPTANTLQNTIKKIAAGSGGASKDKTKKAYVRPGVIPKGDPALGDKLKNLS
                     KEERKTIKSSDADRQARRLAKKKAKMSLEKDKAKGAVKLTLTKSEREKTSASKKPKAK
                     KGKKRAPSAVAKMKGSRE"
     gene            224938..227592
                     /locus_tag="CNC00800"
                     /db_xref="GeneID:3256816"
     mRNA            join(224938..225315,225374..226820,226892..227592)
                     /locus_tag="CNC00800"
                     /product="biotin-[acetyl-CoA-carboxylase] ligase,
                     putative"
                     /transcript_id="XM_569383.2"
                     /db_xref="GeneID:3256816"
     mRNA            join(224938..225315,225374..226820,226892..227126,
                     227207..227592)
                     /locus_tag="CNC00800"
                     /product="biotin-[acetyl-CoA-carboxylase] ligase,
                     putative"
                     /transcript_id="XM_569382.2"
                     /db_xref="GeneID:3256816"
     CDS             join(224941..225315,225374..226820,226892..227126,
                     227207..227519)
                     /locus_tag="CNC00800"
                     /codon_start=1
                     /product="biotin-[acetyl-CoA-carboxylase] ligase,
                     putative"
                     /protein_id="XP_569382.1"
                     /db_xref="GeneID:3256816"
                     /translation="MPGPTPSAHQVLVYSGPGVSPLSLSHTLLTLRLLLLPHYTVQPA
                     APDLLALQPWEPSCALLVVPGGRDLPYVDELTHKRPVTNRIREYVQQGGRFLGICAGA
                     YFASAEVRFDVGGGMEVAGKRDLAFFPGPSRGPVFQGFQYASESGSRAVVLNLESSKL
                     ETLNHIYYNGGGQFILPSPPPPNVQILARFQETCSDPSGQQQQQLVAAVFTQNGKGCT
                     VLSSVHPEYPLSDPPASNAIAKLDVRPSQVEVEMSDKARLSWVEELLIKLGLTPPERL
                     TAANRAKSSADSEHEDEDPALLLHPTHPSPIFFLSHPNLPQLPEAAVNKPELKGKMEQ
                     RDGWDVLRDANDEIRFGTTEATSPERAASEDGITQWLAQARRTQPVFPPSVEDLSIQS
                     DSTPQPPSPPDLHALTKTILLPSPSVEYSSRWTPLFNFSTYWDELDQARKRSGRRSGV
                     MRQGSDGQGERCSLGDCVLYGETVTSTQTMLDGNPLLLTNLPTPLVFLASFQLSGRGR
                     GSNMWLSPPGCLQFSLLLDLPASLSSKMVFIQYIMALAVCEAIDEDGRLGVRIKWPND
                     IYAEVEGVGGTEIGSGKKGKAKLGGILVNTSFVGGKWRIVVGCGINILNALPTSSVSQ
                     LHALLAAKLSSTSSNKPLPPAPTMEGTFARIMSSFDAKWEQFIEEKGFKGFMDEYHGR
                     WLHSGQDVLLTTTEPHTRVRILSITPDHGLLRCIPISDKPKASTGLTPLYNRDIDAGE
                     DDRGSWSSSPSVPRSGAARAQTQNHSPFVDLQPDGNSFDLMSGLIKRKV"
     CDS             join(224941..225315,225374..226820,226892..227187)
                     /locus_tag="CNC00800"
                     /codon_start=1
                     /product="biotin-[acetyl-CoA-carboxylase] ligase,
                     putative"
                     /protein_id="XP_569383.1"
                     /db_xref="GeneID:3256816"
                     /translation="MPGPTPSAHQVLVYSGPGVSPLSLSHTLLTLRLLLLPHYTVQPA
                     APDLLALQPWEPSCALLVVPGGRDLPYVDELTHKRPVTNRIREYVQQGGRFLGICAGA
                     YFASAEVRFDVGGGMEVAGKRDLAFFPGPSRGPVFQGFQYASESGSRAVVLNLESSKL
                     ETLNHIYYNGGGQFILPSPPPPNVQILARFQETCSDPSGQQQQQLVAAVFTQNGKGCT
                     VLSSVHPEYPLSDPPASNAIAKLDVRPSQVEVEMSDKARLSWVEELLIKLGLTPPERL
                     TAANRAKSSADSEHEDEDPALLLHPTHPSPIFFLSHPNLPQLPEAAVNKPELKGKMEQ
                     RDGWDVLRDANDEIRFGTTEATSPERAASEDGITQWLAQARRTQPVFPPSVEDLSIQS
                     DSTPQPPSPPDLHALTKTILLPSPSVEYSSRWTPLFNFSTYWDELDQARKRSGRRSGV
                     MRQGSDGQGERCSLGDCVLYGETVTSTQTMLDGNPLLLTNLPTPLVFLASFQLSGRGR
                     GSNMWLSPPGCLQFSLLLDLPASLSSKMVFIQYIMALAVCEAIDEDGRLGVRIKWPND
                     IYAEVEGVGGTEIGSGKKGKAKLGGILVNTSFVGGKWRIVVGCGINILNALPTSSVSQ
                     LHALLAAKLSSTSSNKPLPPAPTMEGTFARIMSSFDAKWEQFIEEKGFKGFMDEYHGR
                     WLHSSVFFFFFIPIDCSVSMISY"
     gene            complement(228351..231902)
                     /locus_tag="CNC00810"
                     /db_xref="GeneID:3256318"
     mRNA            complement(join(228351..228740,228792..228854,
                     228911..229484,229536..229719,229768..229864,
                     229930..230193,230241..230335,230388..230583,
                     230647..230778,230830..231068,231120..231378,
                     231433..231583,231638..231902))
                     /locus_tag="CNC00810"
                     /product="gamma-tubulin complex component 3 (gcp-3),
                     putative"
                     /transcript_id="XM_024656672.1"
                     /db_xref="GeneID:3256318"
     CDS             complement(join(228432..228740,228792..228854,
                     228911..229484,229536..229719,229768..229864,
                     229930..230193,230241..230335,230388..230583,
                     230647..230778,230830..231068,231120..231378,
                     231433..231583,231638..231843))
                     /locus_tag="CNC00810"
                     /codon_start=1
                     /product="gamma-tubulin complex component 3 (gcp-3),
                     putative"
                     /protein_id="XP_024512345.1"
                     /db_xref="GeneID:3256318"
                     /translation="MVPRPSSVASSSRGTAAMPVSRPPLEQLIYSLVPSLAPVRGTRT
                     DDPKEKERRESVAEMMEWCQKILDSNLPSSTPLSAETLPETVKRMIYAYTSSGAKEGG
                     AEKALKFNAIWNKLERGKLLSSPNPHLELLAALSPINPNNASRSTVAGSSKSPKNMPP
                     PTFPSTKPSSSRQPLVDAVPNISLLGFDAKGKAKADIINQWRANRSQPPFPQHLLLRD
                     TLYLLQGIDGRYVHFAVSPPKEQNPYLTERGREGEGTGFPLGKEGPIIEEGYDDEVVG
                     IEIVADEEKDGVISQPTRTLLMQLSEMGMLYRRVTNFVNSRQAGDSKGGMIEQSLCHF
                     LHHELSEYHRLLAVLESQMNTASSSGEQPDSGLTLLRLRLWTEDMKLKLKQMSTIVDE
                     AKNTHGGALVSKLHSHTSNGDPLIRNFTTQILEEVSKPFFLTLQRWIFSGELHDPFKE
                     FFVQLNPENVSFREGQISPTGDVGFEMGMDADGGEEEAYKLWEKKYVFVKKMVPGFVG
                     EDFAKKIFSTGRSLNFIRYSCHDSDWIETQAKIANAGRALKYSDLAGLERSIDDAYSI
                     ASQRLLEIFFDKFRLLDHLRALKSYLMLGAGDFTELLMEAMAPRLSKPAINLYRHHLT
                     SDLESAIRGSNAQYDSPDILRRLDARILEYSHGETGWDCFALQYKVEAPLNAVLDHRA
                     MGDYDRLFNHLWRLKRVEVVLTQNWMRVTSGSKVYERVPGLNNDWHHCRIVQAEMVHF
                     LRQLQAFCQLEVIECSWADLIEFTTKREGDLDALITAHRKYLSRVVRKVLLLSAKRDK
                     EEILLDLVRDALELILQFKDAMDDLYAWSLGEATRLDRQRDASRGLYTPSTSSDDPTR
                     SEEQLQSIRIRIRECSNSFQHRVVSIVHMAGAHADLDVRFLAIRIAFNGHYSLRKKDK
                     GSSRSTRA"
     gene            232064..234193
                     /locus_tag="CNC00820"
                     /db_xref="GeneID:3256166"
     mRNA            join(232064..232649,232701..232734,232793..233092,
                     233145..233315,233370..233683,233751..233908,
                     233964..234193)
                     /locus_tag="CNC00820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569387.2"
                     /db_xref="GeneID:3256166"
     CDS             join(232488..232649,232701..232734,232793..233092,
                     233145..233315,233370..233683,233751..233908,
                     233964..234135)
                     /locus_tag="CNC00820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569387.1"
                     /db_xref="GeneID:3256166"
                     /translation="MSTPKVVTYLRSLEAVRDRSRQVYNLGVDGKLDHWTFDEAKLAD
                     IADYCSKIIERDFGVDYASIPPHCRRGHFITPSNNRIATLLAKPSFPPKSEPLSRAGT
                     LIDLYLVSVLLDAGAGPDWTFTETDEEGNETWKGGRSEGLAVASYHMFINGLFSSSGN
                     KFQVDANGLKKLTPELLAKHLQVSEDNPMTGLEGRCNLLIKLGDALAARPDLCATGRP
                     GDLLKYFEPKVKDSLPLSDFWSTLFDLLLPIWPSRVTLPSHPTYPLGDVWPCTSLSRS
                     LDQAGIDREEGDDFVPFHKLTQWLCYSLVDAIESEAGWKVDKGLGQTGLPEYRNGGLF
                     IDLGALTIKPESLGGNAYPNGKDKPPVLEPSHPAVIEWRAVTVISLDRIHNLLCEKLQ
                     VGKDVLALAQVLEAATWKGGREIAKEKRAGGGPPIDIVSDGTIF"
     gene            complement(234174..236367)
                     /locus_tag="CNC00830"
                     /db_xref="GeneID:3256562"
     mRNA            complement(join(234174..234631,234681..235300,
                     235351..235655,235708..235859,235911..236004,
                     236061..236115,236188..236242,236293..236367))
                     /locus_tag="CNC00830"
                     /product="t-complex protein 1, alpha subunit
                     (tcp-1-alpha), putative"
                     /transcript_id="XM_569389.2"
                     /db_xref="GeneID:3256562"
     CDS             complement(join(234272..234631,234681..235300,
                     235351..235655,235708..235859,235911..236004,
                     236061..236115,236188..236242,236293..236328))
                     /locus_tag="CNC00830"
                     /codon_start=1
                     /product="t-complex protein 1, alpha subunit
                     (tcp-1-alpha), putative"
                     /protein_id="XP_569389.1"
                     /db_xref="GeneID:3256562"
                     /translation="MASTMYQRDPRAGLFLGGTRTSGAEVRDANVMACQTVSNILKSS
                     LGPVGLDKMLVDNVGDVTITNDGATILSLLEVAHPAARVLVSLATQQDKEVGDGTTSV
                     VLLASELLRRANELVRNKIHPTTVITGYRLACKEACRYMAEQLSTKVDKLGKDSLINV
                     AKTSMSSKILGADDDFFAPLAVDAMLAVKTINAKGEKKYPVKAVNVLKAHGKSARESF
                     MVKGYALNCTVASHAMKTRITGAKIACLDMNLAKQRMHLGVHITIDDPDQLEAIRARE
                     SEITLERVRKILAAGANVVLTTKGIDDLVLKEFVEAGAMAVRRCRKEDLRRIAKATGA
                     TLISSLANLEGDETFEASSLGYAEEVVQERISDDELILVKGTKIVNSSSVILRGANDF
                     MLDEMERSLHDALSIVKRTLESGSVVPGGGAVETALSIYLENFATTLGSREQLAIAEF
                     AAALLTIPKTLSINAAKDSTDLVAKLRAYHNAAQNAPLNDPKRGLMYYGLDLINGEVI
                     DNRQAGVLEPTMSKIKSLKSALEAATSLLRIDDSIQVAPEQKEEVDPHGH"
     gene            236555..239367
                     /locus_tag="CNC00840"
                     /db_xref="GeneID:3256525"
     mRNA            join(236555..236894,236947..237107,237157..237600,
                     237655..237870,237948..237972,238035..238269,
                     238315..238500,238558..238721,238771..238981,
                     239032..239367)
                     /locus_tag="CNC00840"
                     /product="expressed protein"
                     /transcript_id="XM_569955.2"
                     /db_xref="GeneID:3256525"
     mRNA            join(236555..236894,236947..237107,237157..237600,
                     237655..237870,237948..237972,238035..238269,
                     238315..238476,238558..238721,238771..238981,
                     239032..239367)
                     /locus_tag="CNC00840"
                     /product="expressed protein"
                     /transcript_id="XM_024658920.1"
                     /db_xref="GeneID:3256525"
     CDS             join(236594..236894,236947..237107,237157..237600,
                     237655..237792)
                     /locus_tag="CNC00840"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514260.1"
                     /db_xref="GeneID:3256525"
                     /translation="MNRPISTLRLVLSATQPRFAPSPAVLRPFVSSTRLYATHHETAS
                     PHSQSQATSDLLKGLGNKTGTSSGTQDTVGPFPLGVGPNGRRKTWKSWSDLNIGGKLV
                     RTTQQTGNLTVILFGGALFVVLTFALTTELFAKNSPSVLYSHAIDMIRGSNALDAYLL
                     PPLKFTHSPHSSAPVRGSPPIAHTFIRNPTSGKDHLVISFWIHGRAKDEEETLSWIKQ
                     GWRSAVAWGKEGMDMLVGEKPEDVVKEDVEKKERVVVKKEPGTLSRWFGGLNLRSTAG
                     SRVPLAKELPPAGTYTVGEARGEYVKDEAGEFQMLSLIVDIPSSKASYPGRAVIFQSP
                     EAETEGLLGKRIR"
     CDS             join(236594..236894,236947..237107,237157..237600,
                     237655..237792)
                     /locus_tag="CNC00840"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569955.1"
                     /db_xref="GeneID:3256525"
                     /translation="MNRPISTLRLVLSATQPRFAPSPAVLRPFVSSTRLYATHHETAS
                     PHSQSQATSDLLKGLGNKTGTSSGTQDTVGPFPLGVGPNGRRKTWKSWSDLNIGGKLV
                     RTTQQTGNLTVILFGGALFVVLTFALTTELFAKNSPSVLYSHAIDMIRGSNALDAYLL
                     PPLKFTHSPHSSAPVRGSPPIAHTFIRNPTSGKDHLVISFWIHGRAKDEEETLSWIKQ
                     GWRSAVAWGKEGMDMLVGEKPEDVVKEDVEKKERVVVKKEPGTLSRWFGGLNLRSTAG
                     SRVPLAKELPPAGTYTVGEARGEYVKDEAGEFQMLSLIVDIPSSKASYPGRAVIFQSP
                     EAETEGLLGKRIR"
     gene            complement(237864..240142)
                     /locus_tag="CNC00843"
                     /db_xref="GeneID:36392771"
     mRNA            complement(join(237864..238297,238347..238486,
                     238544..238602,238653..238707,238762..238843,
                     238895..239016,239072..239175,239244..239301,
                     239429..239628,239680..240018,240086..240142))
                     /locus_tag="CNC00843"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658922.1"
                     /db_xref="GeneID:36392771"
     CDS             complement(join(238235..238297,238347..238486,
                     238544..238602,238653..238707,238762..238843,
                     238895..239016,239072..239175,239244..239301,
                     239429..239628,239680..239822))
                     /locus_tag="CNC00843"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514261.1"
                     /db_xref="GeneID:36392771"
                     /translation="MRLPFQSSSSSRPSTLFDSSFTFPASYRLSTHRMGWADGVSRLD
                     KKERLKQLDTMHRIVVEPYHSSVIHSHLSMVHSSGRRSAVLDVGTVSIFKHQVYPFLS
                     LHPDPRFRGQGSGQWAALLANAEPFADVVTLAPDWKSYTGERIHHGNLDFSSADIARP
                     LPWPSSSFDVIQVKGLARTYKSYGIFLERLARLLRHGGLLVIVEHCLGYESSSSQNLP
                     PCLLQWNASIEKALAANGIDSMMAARLSECVRSAGVFGLSAYVQDIGVPVACYMPENS
                     PTLAQAGSLHSRIISSELRSFLPELVAYGYRLTDLEGMIEGCLDELLNPYSRYLQRLV
                     ALYAVKQ"
     gene            241022..243350
                     /locus_tag="CNC00845"
                     /db_xref="GeneID:36392772"
     mRNA            join(241022..241044,241100..241324,241377..241387,
                     241438..241502,241550..241586,241640..242913,
                     242959..243350)
                     /locus_tag="CNC00845"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658923.1"
                     /db_xref="GeneID:36392772"
     CDS             join(241243..241324,241377..241387,241438..241502,
                     241550..241586,241640..242371)
                     /locus_tag="CNC00845"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514262.1"
                     /db_xref="GeneID:36392772"
                     /translation="MLSWFVGHDERVIKRGGSGYGITTTASSVASYGQGPPSSTLNRW
                     HGIGKGPEIAGSTGGFIGLLSGLAIFILVAVIAGIYVYNRYRKRIPPKSSNSFIFGIF
                     SPPKKPILPTLFLSRPSTDPYAQGPSALELNETPKASNFGYAFTRPVYTRQRSSDWDL
                     VFDGSPSPNSQRNERSRGSMEINMPGEPGEAVWPIRNIHHKSVSPSHSTSSSTSTSST
                     QREREREREYREYRGKGKALPEHRYDPSFSRSNPFEHPHYAADSSNLSARDGQNSRGR
                     EPLLRTDSGDAYDSADMEYCEEKTPRIQQHDE"
     gene            243354..246202
                     /locus_tag="CNC00850"
                     /db_xref="GeneID:3256616"
     mRNA            join(243354..243712,243767..243828,243881..243938,
                     243989..244051,244101..244236,244284..244302,
                     244367..244380,244459..244469,244528..244833,
                     244889..244965,245016..245083,245137..245365,
                     245418..245453,245501..245597,245656..245845,
                     245900..245978,246060..246202)
                     /locus_tag="CNC00850"
                     /product="transporter, putative"
                     /transcript_id="XM_024656673.1"
                     /db_xref="GeneID:3256616"
     CDS             join(243460..243712,243767..243828,243881..243938,
                     243989..244051,244101..244236,244284..244302,
                     244367..244380,244459..244469,244528..244833,
                     244889..244965,245016..245083,245137..245365,
                     245418..245453,245501..245597,245656..245845,
                     245900..245924)
                     /locus_tag="CNC00850"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_024512347.1"
                     /db_xref="GeneID:3256616"
                     /translation="MSAAVPVVVDTHAVTNPRPVDQPDSLIKDDIEDKGELSYSDIND
                     SVETLDAKWYEPPDSYESKHRWDPEAKWTTQEETRLRRTLDIRVAAFACLCFAALQLD
                     RGNITNALSDGMLADIGLTTAGYNTGMTIFYCCFLVAELPSQMISKKLGSDVWIPIQM
                     MAWSIVAICQVAIKGKSSFYATRALLGLLEGGFIADTVLYLSYYYTAAELTIRLSWFW
                     VSLTTTTIIGSLLAAGILQMRGVHGLAGWRWLFAIEGALTFLIGFWAWWYLPASPTET
                     KKWWRPNGWFTEREETIIVNKVLRDDPTKSSMHNREGLSPIDLWRSIADFDMWPLYVI
                     GLIAFIVPSTVQAYFTLTLRNLDFSTFQTNLLTIPSNVMFIFMNLGVSFLSKRLNERL
                     IVTTVQPIWHLIFLIVIIALPDDVNRWAKWVVTSLLMAYPYCHPILVSMNSMNAGSVR
                     TRTVASSVYNMFVQAASLIASNIYQPSDAPYYHKGNRVLIALSVVSIVMCWSAKAWYI
                     WRNKQRAKIWDSWTISQKEEYLATTKDLGNKRLNFRFLH"
     gene            complement(246417..247396)
                     /locus_tag="CNC00860"
                     /pseudo
                     /db_xref="GeneID:3256301"
     gene            249610..253342
                     /locus_tag="CNC00870"
                     /db_xref="GeneID:3256447"
     mRNA            join(249610..250295,250415..251020,251078..251965,
                     252014..253342)
                     /locus_tag="CNC00870"
                     /product="Mih1p, putative"
                     /transcript_id="XM_024656674.1"
                     /db_xref="GeneID:3256447"
     CDS             join(250472..251020,251078..251965,252014..252868)
                     /locus_tag="CNC00870"
                     /codon_start=1
                     /product="Mih1p, putative"
                     /protein_id="XP_024512349.1"
                     /db_xref="GeneID:3256447"
                     /translation="MALFGSSPLVDAFPSPRFSEPPSPTKTETDLPIDVDQSFNSSLS
                     LSDSPYFSPTPSMAVGAKSAGSSSMLSAAPPSFSLKCKQPEAAPTQVKPPLQSKSTTE
                     TTLGSGQLSRGRSFGMDITNNVLHQPDSNIRNNKGKMLPPAVPEARMLKANASVPMQW
                     TSSNEELGECSKNSSLFGVPRTESDPAISGSPLSSLSRDDSAMQVDSPQIRSNSRPGS
                     LMASPALGGPASCSSSPDLGSFFCDSPAPSSQAPPAKRRSLVSGPPASPSSGSPSAKR
                     TSLGLGVSRPPLDKTASSSALLFGGGRANTVASRRGPSYKRPTLGPLAAPSCDASRTA
                     STNSAFPILYGPPKQTLGQSGTFPRAANAPMRRAYSVCDQNTANEMDDDDSEFENSPC
                     VGAHAEYARRYGARMGPRIDGSPGFKSVRASIAASGEGVVSPLHKGKKTSPYGPGGLP
                     GFGDNEIDGKILPCHKVKEDGLVRITPDTLDELLSGKYSHKIKRYHVLDCRFDYEYDG
                     GHIAGAINVKSMDALDKLLLSEADGIHADGECLPRPSRSGQLEDGQPVVLIFHCEFSA
                     KRAPTFAKHLRSRDRLLNNAIYPKIYYPEVYILEGGYCGFYQTRPERCDPKGYTPMDD
                     PKHFERRDSDLHDFRKFSRTRSFTYGEQQQPSSRALLPCPPLAFAAASAAAARRIGAQ
                     GGSTSGNNTIKEEDDQDNSSSPHPGDSSAEMDTDASPCPRAVLSLGQPPIFGSAKTRV
                     LGRVGFSRVASYAGTTTIPAPRP"
     gene            complement(253328..256767)
                     /locus_tag="CNC00880"
                     /db_xref="GeneID:3256708"
     mRNA            complement(join(253328..253660,253713..254149,
                     254203..254856,254907..255232,255279..255346,
                     255396..255503,255545..255894,255945..256015,
                     256064..256172,256233..256319,256372..256443,
                     256493..256767))
                     /locus_tag="CNC00880"
                     /product="expressed protein"
                     /transcript_id="XM_024656675.1"
                     /db_xref="GeneID:3256708"
     CDS             complement(join(253463..253660,253713..254149,
                     254203..254856,254907..255232,255279..255346,
                     255396..255503,255545..255894,255945..256015,
                     256064..256172,256233..256319,256372..256443,
                     256493..256616))
                     /locus_tag="CNC00880"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512350.1"
                     /db_xref="GeneID:3256708"
                     /translation="MTSRNPTVNMSSSKPIKPMVINSNVRNTSHSTVLGAKRKVDDVL
                     NSSSEGEGKENGATQKKKALDATLGQPLFELRNRKLLFKQALPSRNLPRRRILNFQGY
                     VLDEVEGGRTINEIPEEHWALIAMAGNEMSSANEGSFVKQLKAALGLEPAEQKSLPNE
                     VLTVISRKLFTLSHYGFFPSQFPNSVKIPSSLQIRCWEVNEPEKWFPSEELEALRARR
                     TERESLTEECFKLLQGMTDAQKIELVGGSKDQKDTPSKSASTAEKSALPKEIQDSPQS
                     IFRVDESEGPDEDAASHGGSSPIKPGRTPEEIEADRLKKKQRDEKKAIWAEKKAAKER
                     EVKKKEEAMAKQAKAMSMFFKPKPTCIAKKTTALPSVSSSNQALSDYQKTFRPLPPKK
                     YVKTAKVNEWIRIENGINHAAGDISGGKVEQWINEGSPDVEGWSSQDFIKDHLKKHGH
                     QMRHPRRNLPRGFKVAPIDGSVGELWAALQVAEEPREVLDQLRDRRRFPWKTLAFDQQ
                     PRPPYSGTFTKKSLVVGPRTPFAQDPIFDYSYDSGDEWQDDDEGEDVDNFGGEKNLEE
                     EEEDEDEEDEGEFDDWLDDSEDVEATQPDSMDVDDAPEPEKLSRNVKKLKEQPIKRIV
                     KLVPNWKGPIWENRIGEKGTEGLESYRIQLLNDTPVSLNPFTFESTDTPQQYKANYST
                     TVIGHNLNVRCLLSVETIVQKEQPGPITKLSPVTAAAMSSPVPRSELPRRVRSAFPSS
                     HIPELYRLIEGDNRYLKDMITFLREKFDGVATKVSIENELKESAVREGRSKDSVWRVY
                     REAWIAAGLEPAVSAPSRPPTAPSTTAALSLNPKSTVNQPTNLPSPLDQSLQTSPVQD
                     GSAAEPTVVDS"
     gene            257343..260275
                     /locus_tag="CNC00890"
                     /db_xref="GeneID:3256152"
     mRNA            join(257343..257388,257909..258412,258550..258653,
                     258709..260275)
                     /locus_tag="CNC00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656676.1"
                     /db_xref="GeneID:3256152"
     CDS             join(258601..258653,258709..260086)
                     /locus_tag="CNC00890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512352.1"
                     /db_xref="GeneID:3256152"
                     /translation="MFEEDFERCFICQGPSKGLYCSSMCRQKDQGSFSPQVNPDQESV
                     HITSQLPPALSPHVRPMNTISLSPRNSGQPRATSNGTSSGSSSVNSSPLHSPQTNPSD
                     LDSPQKGLFNLPPPAYPVTQFGAPPSAVPMKIPPLLPRASPIFGAIGTPGSQGSTVYP
                     HGASIDTLRFGRRPGAVNSVTSPNALIPRCACGLPANHRTRARSKDRADVVDSGFSRL
                     SLGPSVVAREEPISRSLRIVSDSAIPPFTLSPKGTPQTITATLNHSGPFHTEQCSPVA
                     PNNVLSRSRSDPIPPSPKVGKRTLAPVPVVSTILPIRRQSSHEPERRTNVLEVSNIDS
                     PRRGRSRERQEHHGDAEDCPPAILNHPPEREAAPSRSRTRRDSRRRSGERSRSRPRER
                     IRDLDMSRDREHDGQRSPVSHEGPQILPSWSRPASVADHVVPLSMKGQSSGDKEKYAR
                     DEDERKREELRRATNQFGQVFGVAAG"
     gene            260793..267157
                     /locus_tag="CNC00900"
                     /db_xref="GeneID:3256654"
     mRNA            join(260793..260986,261056..261584,261645..262082,
                     262133..262865,262918..263001,263057..263303,
                     263360..263460,263511..263560,263613..263684,
                     263735..263974,264026..264350,264400..264494,
                     264545..264810,264864..265236,265297..265389,
                     265442..265504,265559..265708,265791..265792,
                     265847..266003,266057..266107,266154..266492,
                     266543..266800,266860..267157)
                     /locus_tag="CNC00900"
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /transcript_id="XM_024656677.1"
                     /db_xref="GeneID:3256654"
     CDS             join(260901..260986,261056..261584,261645..262082,
                     262133..262865,262918..263001,263057..263303,
                     263360..263460,263511..263560,263613..263684,
                     263735..263974,264026..264350,264400..264494,
                     264545..264810,264864..265236,265297..265389,
                     265442..265504,265559..265708,265791..265792,
                     265847..266003,266057..266107,266154..266492,
                     266543..266800,266860..267108)
                     /locus_tag="CNC00900"
                     /codon_start=1
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /protein_id="XP_024512353.1"
                     /db_xref="GeneID:3256654"
                     /translation="MVVQDLAQSVFSSVSESLVEVAKNKNKNPPPPLILRHSLFFLPL
                     FVSISALVLLLSWAVPKAYTFIRTKLYRQSYQPLLINDEELDVETEAVEVTPIPPSMP
                     SGGLLADFKAHVRSMKEFGSVLFGLEILRTLCLCALLGLSIYATILAESPEEHQTVYE
                     DGTVEDMAKQWGRKKNKKKKGKHSKSTVDDYSSLEWGEFGVSGFYLYTLIFSLLLLTL
                     RPATRLRRHIITHLDSLLLLAFAVYAYRDIWPLFTFNLDPADINTPVTWARVAILTVS
                     AVLIPLVRPRTYVPVDPENPSPPGEIHPEQTSPLLFYMFFEYMTGLVWKAWKTPALPY
                     EDLHPLADYDRAEYLYKQHMDKLDPVRRKEKGLKPRNLVLSLASVFKKEIVMVSLMSA
                     LSAIFELSGSVGINQLLDYLEKDGKGHSLRPIVWIIFLFLGPTFGSLTMQFYIFTTTR
                     SLVRSEALLTQLLFDHALRLRMKDQVDDDREKEVDSMTNGEGSAPLITVEDVEEVIDH
                     APGAPGEFHDRFDNETEEESTAQGNGKRKSAPQSTDATEVGSANGSNKDAAVDRKAAA
                     DEEARKSKGQGLAGKINVLMAADIESVIEGRDLALIFVYTPVQFVLCVVLLYRILSWS
                     SLIGMLTMFITLPLPGLLTKLNAQFQQKRMLATDSRIDTITESINALRIIKMFGWEDR
                     IKERVAAKREEELTLIWQRRLMNLFTTLLNTVLPVLTMTVTFAVYTTIQKQQLTAAKV
                     FTSMTVFELVKGQLGMCFYLINSVVTAWVSVRRLDKFLHESEMIDEYSEGKLATIKPP
                     EQLEAEQEGLIRIHNATFTWGSELYTSTEIPFRLSIEDTTFKKGKINLITGPTGSGKS
                     SFLKALIGELHFEQKQGAFYHLPREDGVSYAAQESWCTSDSVRDNILFGEPFEESRYW
                     KVISACGLEPDLKLFDDGDLTEVGEKGITLSGGQKARLTLARAIYSKTAVVLLDDIFS
                     ALDTLTSRWIIDNLLSGDLVKDRTILLITHHIHLAAPVADFIITLNEDGSVRSQGSIK
                     EGTLDASELQEAEEAEEQELKEAKQGEKKVEEKPTTKLIQAEEKSEGRISRKALFAFF
                     RTFGGPIFWFLYFGLLVGGQAMSSFETYWLGRWARAYDQAEDPRKVSVTFYLGLYFVF
                     VLIGLVQLAASAIIFYMGAVKASREVHKRLVNTIFGAYMRFLDSTPVGRIISRFTKDM
                     KSVDGSFTETFANVADVTVGLALKIIVVISLVPLFSLPAVFIGCLGGILGEMYIHGQL
                     SVKREMSNAKSPLFSHFSAAFNGIVSIRAYGAQQKVRKEAQRRADKYTRAATAFYNLN
                     RWVTIRLDMLGGLFAASLAAFLVYGPRLDASTSGFALSQAISFSSMILWWVRMVNEME
                     VQGNSVERIQDYLVIPQEPAFEESKQPPAAWPTSGEIVLDHLSAKYSNDGPLVLDNLN
                     LTIKSGEKVGIVGRTGSGKSTLALALLRMLPTTGKVLIDGVDTGKINLHALRSNVTII
                     PQDPILLSGSLRFNLDPFGEHDDYELNDALQQSGLGATRQPGGIGAATPQRLTLDTHI
                     SAGGGNLSQGQRQLVALARALVRNSKVLILDEATASVDFDTDTLIQKSIRDLPSSCTV
                     LTVAHRLSTIMDYDRVLVLGAGKVLEFDAPETLKKNSDSYFGKLCQAMEGKSSDER"
     gene            267779..269634
                     /locus_tag="CNC00910"
                     /db_xref="GeneID:3256638"
     mRNA            join(267779..268632,268688..268768,268829..268923,
                     268973..269191,269241..269634)
                     /locus_tag="CNC00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_569403.2"
                     /db_xref="GeneID:3256638"
     mRNA            join(267779..268240,268615..268632,268688..268768,
                     268829..268923,268973..269191,269241..269634)
                     /locus_tag="CNC00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_569404.2"
                     /db_xref="GeneID:3256638"
     CDS             join(268223..268240,268615..268632,268688..268768,
                     268829..268923,268973..269191,269241..269379)
                     /locus_tag="CNC00910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569404.1"
                     /db_xref="GeneID:3256638"
                     /translation="MNPHKMNKVDISQMNEQDQKAFKLYGKVPGKNLLTKMQKERKYF
                     DSGDYMMSKAGVPTASPPGTAHPTPEAVPHASPPSGPGGYLSSSPTGGSLPSPNIMEH
                     GIGGEKCAHNVGVGISPAATSEAIEMPGHGHHHGHQRRGSESRISPPNTWRESVNPSS
                     FPIHHPGIFGGSPVKASSLAKRVDEEGEQ"
     CDS             join(268591..268632,268688..268768,268829..268923,
                     268973..269191,269241..269379)
                     /locus_tag="CNC00910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569403.1"
                     /db_xref="GeneID:3256638"
                     /translation="MVVFPVIQNKVDISQMNEQDQKAFKLYGKVPGKNLLTKMQKERK
                     YFDSGDYMMSKAGVPTASPPGTAHPTPEAVPHASPPSGPGGYLSSSPTGGSLPSPNIM
                     EHGIGGEKCAHNVGVGISPAATSEAIEMPGHGHHHGHQRRGSESRISPPNTWRESVNP
                     SSFPIHHPGIFGGSPVKASSLAKRVDEEGEQ"
     gene            complement(269864..272073)
                     /locus_tag="CNC00920"
                     /db_xref="GeneID:3256603"
     mRNA            complement(join(269864..270269,270327..270483,
                     270538..270960,271012..271323,271373..271446,
                     271500..271631,271695..271727,271796..272073))
                     /locus_tag="CNC00920"
                     /product="glutamate dehydrogenase (NADP+), putative"
                     /transcript_id="XM_569406.1"
                     /db_xref="GeneID:3256603"
     CDS             complement(join(270081..270269,270327..270483,
                     270538..270960,271012..271323,271373..271446,
                     271500..271631,271695..271727,271796..271831))
                     /locus_tag="CNC00920"
                     /codon_start=1
                     /product="glutamate dehydrogenase (NADP+), putative"
                     /protein_id="XP_569406.1"
                     /db_xref="GeneID:3256603"
                     /translation="MSNYPSEPEFQQAVAEITQTLEPFLAKNPEYRRALDVVQVPERI
                     VQFRVTWERDDGTIAINRGYRVQFNSALGPYKGGLRLHPTVNLSILKFLGFEQIFKNA
                     LTGLMMGGGKGGSDFDPKGKTDSEIRRFCYAFMQELSRHIGTDTDVPAGDIGTGGREI
                     GFMFGAYKKYRNENAGILTGKGADWGGSHIRPEATGYGLVYYVTEMLRDLDNTDWKGK
                     RVLISGAGNVAQYAALKVIELGGTVLSLSDSTGALVATGDEGFTPEEIMNIADIKLQR
                     KSLTAFATGSKFQWHEGKRPWTLVSNADIALPSASQNELNDEEAKALIKAGVRYVAEG
                     SNMGCTLDAIKIFEESRTAAKNATDAGVCFYAPGKAANCGGVAVSGLEMAQNSQRLKW
                     THEEVDAKLKAIMINCYQTCWETGKQYAEAGVVPSLVAGANIAGFVKVANAMREQGDW
                     W"
     gene            272703..272784
                     /locus_tag="CNC00930"
                     /db_xref="GeneID:3256741"
     tRNA            272703..272784
                     /locus_tag="CNC00930"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:3256741"
     gene            274028..274903
                     /locus_tag="CNC00935"
                     /db_xref="GeneID:36392773"
     mRNA            join(274028..274172,274224..274477,274532..274903)
                     /locus_tag="CNC00935"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658924.1"
                     /db_xref="GeneID:36392773"
     CDS             join(274107..274172,274224..274477,274532..274865)
                     /locus_tag="CNC00935"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514263.1"
                     /db_xref="GeneID:36392773"
                     /translation="MFRGGPRQLQNPNRASSNTRCQKCLKFGHYTYQCKNPMPYVPRP
                     SRTKQLEMGAIGRDKPSVETPDEFKTSGKGVADKILAAKEEDRKKREEEAKRANNKGR
                     KRRNSSSSESDSASGSDSSSSSDSSRSRARRRRRYSSSSSSSSSSSTRHRSASARRRR
                     RYSSSSSSSSPRRRSASPRRKRKDSDDDESRNRSSSVSRSPSRSPPRRRRASSEESR"
     gene            complement(274888..281239)
                     /locus_tag="CNC00940"
                     /db_xref="GeneID:3256548"
     mRNA            complement(join(274888..275621,275669..276131,
                     276180..276308,276356..276815,276865..277196,
                     277247..278899,278948..279676,279728..280085,
                     280137..280930,280986..281239))
                     /locus_tag="CNC00940"
                     /product="vacuolar membrane protein, putative"
                     /transcript_id="XM_024656678.1"
                     /db_xref="GeneID:3256548"
     CDS             complement(join(274922..275621,275669..276131,
                     276180..276308,276356..276815,276865..277196,
                     277247..278899,278948..279676,279728..280085,
                     280137..280930,280986..281001))
                     /locus_tag="CNC00940"
                     /codon_start=1
                     /product="vacuolar membrane protein, putative"
                     /protein_id="XP_024512355.1"
                     /db_xref="GeneID:3256548"
                     /translation="MPPPPTPEMSKPPRSRARSSTIVGTGPLPPGSVQAGPPAIDVAA
                     SSFRVTTNPQTSAATEALSSLAGSIRRPKFRETSADHARTTSWPSPPQPVIISMPSAP
                     AVPTKGSMEGGVLDLSLLNKDRDNVALLLYTYKPLLNNTGASANPAHPSLLPSAAASP
                     NAPSSQVIINYAALPWNVQPGDYLEIRQINRTQPKVPTASTRIQGMEGEKPQKIKRPP
                     ALEDVKTGKGREGYVFRLGEDSPTANIHQIQVPDSVATAFGFQNRLEVEVRRIHDKES
                     SHADYIEFYFSQYLGRADMWRLGMSLEGTTLHVGEKVSLAGGAVRAEVNFIIRDEKSK
                     DGIAKPKRYSSGIVTAKTKTIFRSKSAQVYLFIQLCEETWQFDEDGERYVEKVVHGYL
                     PELFARWADKGTSHVVTIIFFARIFYRDDEVDYLRKHDMVDMLSQDYSGQWYKDFFKV
                     AVDLERRNDWMSSLPEIKRQLERSEREILLDYHLRLLKAKGAAEEEIKIVGKWCFAYQ
                     GNVLEAINLALNPFDEHYVDRDLSRTGLSITVVTPGTGHFAVDKNLLRLTTERMVDHG
                     MSVDFVCLTKMPLHSVPLFSYVSHRPKGPVQHEDGIGAKAKPVVPDLLYFDANLSQVK
                     DIELADCYSLPSWVSTSFYAVTHDKPFREDRFVARCKMYDIQMLGILDHNLTTVTVPL
                     LNVDDTPMPRRPLTVDDRKAIRDSFDQSIFSGISDLVKTGSSPLDSAPASVTASYQSA
                     RLLAEKAKERTSSMSLSKPRGSDIANSSRLSPIKATSESDNIDLGKKTTPRSPSPEPS
                     SLSLRRGSRRSLSPTKMTQLAHTSAVTNELNKDSPSLLKNSRPGSPITMARSISPVPP
                     LPPTREQGDSPLSPVDSLPLSASVERSPSPSRRSVRSNMTDREHLGSGASTPKGTPAK
                     SLRSQPSKGFIPSWVLNSFKPLLSTSKPSFAVPAMENVARTDVATGDDNRPSSPSPSV
                     GSLRGRPSKGGPNPKPIITPSTPSPSRSQKPPFKPAKIIQTQPHTQAQGTQPLPIAAP
                     PASRLPSQSEEDAISRSFRNKGHGLSRSHEDSSLRAQSNALVQSSRHFTINPCKPSAE
                     TIDRVRDAGGRRWRFVLPKLTQQHIVQWPSLIAPACLPLTTDFLPDQKQSDELYTTGT
                     YTVQCYLEDDQFLIRSDAAETNLALAMMREMVSQRLSQNFQVIVQPHELTEPEKPRPM
                     PIHLEKDADIGVELVSGGASEVLKKGQGAIWLSWANHIHRLLFHPTKPEIVVHWMTRK
                     ITHQTESVQWKGLVWPSGMKGYQKASATFAYPDVSMKINYNHLDHLINGERIDFAPLR
                     YWRTRFILIPSGREPVTFPGLMPKNENLGSNDLLWLGAQKVMETLNRYLLKRPEGTPQ
                     QRSLKIVATTFDPSTCVLDEELMMDLARQIHGDSSGDKKKKLEGMTLANVAELMCQPD
                     NGLVIRTRWWESRQHVSSFNGFELREWLQNTFEDVTGREKAQEWAAELTNKGLIEHVT
                     KSHGFLDYWHLYYRLREPYNHMYSHLAKKEGKNKSWFSTSSKGSRAAPPSLTSSQASS
                     STVIAAAVADPSQATADLNTSQSGKDPSAGEQDQSSLAKIYLKVHKGEPKQGGKKRKI
                     MMTQKRVLDLDPSRKSDRAEVAILHADVVHNARNAFHFELNWLGVTAALLEELRQKLS
                     AQSERYGLRFVETPVEQIADIPKKCAYRTPIPIRLALAPPVIPDLHTRLVAVAHGTGQ
                     AENYFEYSILTKKFGFVLDVEATDRYPDNVEVVYSYRKAGVKYTYSQFCHKTGLALVQ
                     CVGGEAGFLWSDNRLVVSAPTRKGVGNRVDEARALRKELEDFCSDAEQLSKFYEEVLP
                     PPPTTGESTPEEGQEEFEAKDDEEEQPAPQEKTEL"
     gene            281556..286453
                     /locus_tag="CNC00950"
                     /db_xref="GeneID:3256411"
     mRNA            join(281556..281983,282032..282913,282966..283310,
                     283366..283590,283644..283820,283874..286453)
                     /locus_tag="CNC00950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569410.2"
                     /db_xref="GeneID:3256411"
     CDS             join(281720..281983,282032..282913,282966..283310,
                     283366..283590,283644..283820,283874..286315)
                     /locus_tag="CNC00950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569410.1"
                     /db_xref="GeneID:3256411"
                     /translation="MSFVSSETPNAIASSSTAHAGSANSRARHRLDNGLRYHSNHLSS
                     DCRPLPRSAPRKQRVASKSKKLRWRKGLVTEAFRKFGEHCARNQIRTLLIDCLVMTNL
                     FYPSLALYLPKRFPPPSPRAVQDAHWPPLDNDVTSPYRTNVDHPLSFSTLGRLFPSAP
                     PLLPRLTWAGWWGSGTREREDDGWTATRAIPGAKEIGEGQNDQVWVMRIGWADVEDVL
                     DRHIEDGERKWEERDHHLLKLVQNVAENWERQIPSNRQRCVRQLKSSTSVRGDGVDSE
                     PPPCYVLTPSPDAFDSAIPISMSGFVHFDHGVSASPDSVPLGRSPNPDNIYHTFAALF
                     HVPQNSTSAFEQRWQSAMSDVAKEVEGEVFVEAKGPRVGDQIGEWFISYASSPLSQQP
                     NLTGPISSDRSKIFSSSPPPIIIVLYVILFTTLIVQLSNASKAHSRFGLAFTGVVQLC
                     CSSVMSFSILALLGWNGWGVPHAESSLPTYVLPFVIVVVGAENMSTLTQAIFSIPFTH
                     SVPVRIGLGLSKVGTTIALTSLTDLGILSVVWLCVNLQPVREFCLFAAVVIVTDWFML
                     HTFFLTVLSIDAQRLELADVLASNKVGMVSPVESTGEKDAQNENQGFLWRNMLRARTT
                     KSGSLLLLLFTVGLLYWLTERHRSPLNTTASLYGYTPTARSTSVSVPTPTASPFVSTP
                     EAISVLSSAEKLWRALNPEGWPFAHVIVPPASILVLPKFGHSMRPGDIRKLSLPASRL
                     LIPRLKALFYIFKVLVLPQAITAGALYALLLYLLKDADLLDAQRNRLGRMGDAHEDES
                     DFRGSTKNASGLLNCLRARMLPCSHEADVDVIASSSDGRIAISVAIDNSVCLWRFLDT
                     PGSGTREPLPTGGLDGGDAIVAAAVSEDGQHVAVCTNMAVVQIWEVPREGAVVPLQVR
                     KPEQTFTAKILGIAFDETAPNVDDPFTANEPATEEARKATSIMIGYGDGSVMALTEMD
                     AKVVIPAQDRGAYSSCRVLFMREIGGSVSILIARQHDIDIWRKSTFGWVSSSLIADLP
                     GEDRVTALSPLNAELPGVFAVGRRSGNITIYDESHGQLELMPQGSSIEGVRKIQLVRP
                     SSMKCLGCGLQSAEGYAIISSTSSQVSIDRIAPRTSIPTFCRCTRRVSSADDVPALMH
                     RSDSPQRSKPNSLIVPPVTFRQRPTPGSSPHKSISLLSPVSNGEFPLSSHGSARRSSN
                     FHREDDSLKIISSPHDRSALSSIGGGSGLVSPSGDMEVTSLGGISAQGASDGGWAILD
                     GDVLVGVRRGREGIDDAQWQVWSVDMTAPWDMAGLVVDSIDLSELQRRTFEADCTIRG
                     QASGGGSTNGVVSMRDRRTERLLSLNGRASFPERVGSFAVPTYESLGYVEVVGLNILG
                     TKGMIGGFGNRLGTISLERFEEKKVIGRSSMDGQLGMGLGGLTPTRRQSLFPLTPPPP
                     CDGSIGRF"
     gene            complement(286478..287868)
                     /locus_tag="CNC00960"
                     /db_xref="GeneID:3256554"
     mRNA            complement(join(286478..286733,286793..286910,
                     286963..287077,287136..287227,287288..287373,
                     287562..287868))
                     /locus_tag="CNC00960"
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /transcript_id="XM_569412.2"
                     /db_xref="GeneID:3256554"
     CDS             complement(join(286660..286733,286793..286910,
                     286963..287077,287136..287227,287288..287373,
                     287562..287739))
                     /locus_tag="CNC00960"
                     /codon_start=1
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /protein_id="XP_569412.1"
                     /db_xref="GeneID:3256554"
                     /translation="MSGWMSYFTGRKDTRESARDAIVGLRQQLLMLEKKEEFLQKKIE
                     EEMKKAKANATGNKRLAMAALRQKKAHENELDRIAGTRLTLETQVNAIESANLNAETM
                     VAMKKGADALKGIHSNLTAEGVDATMDKIREQMDLTNDISDAISNPVGMGIVLDEDDL
                     KEELEALEQEQLDDRLAGADRVPSHLPASPVGQTTGRAAVEEDEDDEEAQLRKLQAEL
                     AM"
     gene            complement(288042..289571)
                     /locus_tag="CNC00970"
                     /db_xref="GeneID:3256254"
     mRNA            complement(join(288042..288599,288654..288826,
                     288882..289009,289062..289226,289305..289571))
                     /locus_tag="CNC00970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569414.2"
                     /db_xref="GeneID:3256254"
     CDS             complement(join(288224..288599,288654..288826,
                     288882..289009,289062..289226,289305..289443))
                     /locus_tag="CNC00970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569414.2"
                     /db_xref="GeneID:3256254"
                     /translation="MVTTAMSIPLPDTSSVPSHALDALQEDALLPICKTCGTQYPSPR
                     DDCPICEDPRQWVPASGQAWTSLADLGSKSKHSLLPDKEDVRISHIVTEPAFAIGQTP
                     FLIETAGGSYIWECSAFLSLGLIGHLSELKKPLKAMAISHPHFFSSSLTWSRALNIPL
                     YICAADKEWYSRIGDLKDSDDVRLWSRETELGPGVKLVQCGGHFPGSCVFYWDRLSEP
                     PPSPSNLPTKPTPVSGIIFTSDTLMVQPNQTHFTFAWSIPNMIPMRPKAVLRIKESLK
                     GVEYSQATSSWPERWIREDAKKALEESVVRYLGAEGWRFEGDSLFELVTQ"
     gene            289721..290634
                     /locus_tag="CNC00980"
                     /db_xref="GeneID:3256362"
     mRNA            join(289721..290156,290212..290244,290307..290315,
                     290387..290634)
                     /locus_tag="CNC00980"
                     /product="expressed protein"
                     /transcript_id="XM_569416.2"
                     /db_xref="GeneID:3256362"
     CDS             join(290039..290156,290212..290244,290307..290315,
                     290387..290568)
                     /locus_tag="CNC00980"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569416.1"
                     /db_xref="GeneID:3256362"
                     /translation="MSASNTDAYSAGTSGVDQKGNTYVAGSKADGSAGANAAQTAGDK
                     VKGGWNVFHGTGEGIRGNINSFVDNIGEQIAGRDPAAAPQRSTAGGERPAEVTSKGAD
                     EFRTGVQQLRH"
     gene            complement(290756..292071)
                     /locus_tag="CNC00990"
                     /db_xref="GeneID:3256631"
     mRNA            complement(join(290756..290886,290940..291396,
                     291526..291653,291717..291736,291795..291837,
                     291995..292071))
                     /locus_tag="CNC00990"
                     /product="ATP synthase, putative"
                     /transcript_id="XM_569417.1"
                     /db_xref="GeneID:3256631"
     CDS             complement(join(290861..290886,290940..291396,
                     291526..291653,291717..291736,291795..291837,
                     291995..292034))
                     /locus_tag="CNC00990"
                     /codon_start=1
                     /product="ATP synthase, putative"
                     /protein_id="XP_569417.1"
                     /db_xref="GeneID:3256631"
                     /translation="MASRFAIKSLRSAAIRPAIAPRAVVAQSARFLATQPTPDEKAAS
                     IINSVPSSSLFTKTGGVILGTGLTAAAVSSELYVANEETVLLVGFLVIATVIGKSVSA
                     PYAEWANGQIEKVKSILNSAREEHTRAVTDRIDSVGQLKEVVPLTESLYAVAKETNKL
                     EHENFILAQENAVKAELKSVLDSWVRYEQQQREAEQIALVKTVQANVEAELAKPAFKK
                     QLLEEALAQVEQIAKSKAI"
     gene            292223..293851
                     /locus_tag="CNC01000"
                     /db_xref="GeneID:3256511"
     mRNA            join(292223..292414,292462..292650,292697..292885,
                     292931..293851)
                     /locus_tag="CNC01000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569419.2"
                     /db_xref="GeneID:3256511"
     CDS             join(292247..292414,292462..292650,292697..292885,
                     292931..293824)
                     /locus_tag="CNC01000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569419.1"
                     /db_xref="GeneID:3256511"
                     /translation="MSDSESAADLFGDEGRSRNNSPGYEKSPSPQLSHKSDDEEQDDE
                     EQDDEEQDVGDLFGDDAEEDEAQIGRRSTDTPASGSRSPHPLEYVEEDEEAVPQKQNV
                     VTLPIPQWPHMTATDGKVWQMKFPAYVNLDPKPFDPDLYRATQEEEPIDGAADPIAAK
                     SMMIGVKNTIRWRWVTGPDGEPVRQSNARMLRWSDGSVTLQLGDDFYDVAPSQGATLA
                     RPSDPQPVRKRDDKPATNSSTTFLCVGAAAERVLVTERPIAGQLSLLPTSMTSKTYLE
                     LVKHVGKQHTKHSKMKMLEETQDEEALQALLLKSAPNREAIKGAKSTVRRTSSKTGLG
                     KGKKTRKIGYSDSESDAGFSPDERRPRKKPERESVEYDDDDGFIVSDSDEDDYASKKK
                     KAKGKNKKRKGFTDDEESLDEMEEAERRIEERERERKRARKDKGGPSKKSREYVDTED
                     EEDEKKVDDDDAEGEEEMDMDMDVESEED"
     gene            294982..295988
                     /locus_tag="CNC01010"
                     /db_xref="GeneID:3256357"
     mRNA            join(294982..295087,295142..295192,295251..295281,
                     295462..295624,295681..295698,295764..295988)
                     /locus_tag="CNC01010"
                     /product="cation transport-related protein, putative"
                     /transcript_id="XM_024656679.1"
                     /db_xref="GeneID:3256357"
     CDS             join(295034..295087,295142..295192,295251..295281,
                     295462..295499)
                     /locus_tag="CNC01010"
                     /codon_start=1
                     /product="cation transport-related protein, putative"
                     /protein_id="XP_024512358.1"
                     /db_xref="GeneID:3256357"
                     /translation="MAFTCSDIFKIILAIILPPLGVFLERGCGADLLINILLTILGYI
                     PGIIHALYIILKY"
     gene            296457..296538
                     /locus_tag="CNC01020"
                     /db_xref="GeneID:3256742"
     tRNA            296457..296538
                     /locus_tag="CNC01020"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3256742"
     gene            296676..297378
                     /locus_tag="CNC01030"
                     /db_xref="GeneID:3256415"
     mRNA            join(296676..297078,297139..297220,297273..297378)
                     /locus_tag="CNC01030"
                     /product="ribosomal protein YmL32 precursor, putative"
                     /transcript_id="XM_569422.2"
                     /db_xref="GeneID:3256415"
     CDS             join(296763..297078,297139..297220,297273..297327)
                     /locus_tag="CNC01030"
                     /codon_start=1
                     /product="ribosomal protein YmL32 precursor, putative"
                     /protein_id="XP_569422.1"
                     /db_xref="GeneID:3256415"
                     /translation="MAALQLTNRSLNTPFFSLRSFLPTLRSSWSTPCEASSSSSTLSS
                     SLVAHAPSTSSPSLSSLFPSFSLESLLELIPPFLWASVPKKKVSHSRKNMRAANKGLK
                     NKTNLSLCPACGSIKLTHHVCPTCYSQISRRWKEEARNQLPSALHSHP"
     gene            complement(297327..301790)
                     /locus_tag="CNC01040"
                     /db_xref="GeneID:3256194"
     mRNA            complement(join(297327..297557,297616..297696,
                     297743..298728,298776..299939,299989..301220,
                     301270..301434,301498..301556,301626..301790))
                     /locus_tag="CNC01040"
                     /product="chromatin modification-related protein,
                     putative"
                     /transcript_id="XM_024656680.1"
                     /db_xref="GeneID:3256194"
     CDS             complement(join(297465..297557,297616..297696,
                     297743..298728,298776..299939,299989..301220,
                     301270..301434,301498..301556,301626..301643))
                     /locus_tag="CNC01040"
                     /codon_start=1
                     /product="chromatin modification-related protein,
                     putative"
                     /protein_id="XP_024512546.1"
                     /db_xref="GeneID:3256194"
                     /translation="MDSQPTHFQLRSVVHDTLKSHQGQISDLTAQHEGSLKQLFLMFK
                     PRNNMLDKEYDHQAIQGGDESLEGFDEWREQYKLGEGSSVNTISIPNLPAISPPATTV
                     DYPDEPSVDLPTVASSSTSAARPNPIRDPSSSIIDSPLTNVPLDTSITSLVDGVEEEP
                     TVNMSQIQPRPFVPRDYTPPPELDVPEWVPLDNYRPAATPTTPPQLLMPLTSAYATEL
                     PPLPLLNSTSSSASFRRRKRTNSPQPDMFKLQATFSLNPLSSALTRSSKCVLTCDWKV
                     AMDEMRHVRAMERIEAKKAENRWSLRQPKKARGPGVPKSHWDYMLEEMEWMRTDFAEE
                     RRWKVVEAREFAYQVVEWHLASPEEKKALMVGGRGWGECRNVPIPGHAGKRKEVTVEV
                     EAEDEDVEMLVGQEGELDGEGEANKVLESIDEMRVNEKERENRPEDPRETVNINQDIG
                     EEVDAEGEADADGEPENGEADAEGEADADGGPVGDDVVGLSEIDAAQDDTRETSERPS
                     YRRDTVLPNGLVIHKRFANAYEIAIARGPVLDTPLANATVDLDTLTKSSSAATPATVP
                     AEPSVSPDEPASFDQLFPDLAMYSGPAPPENDKKYRRDEGGTYSHRMAHTSRIMDIRP
                     ILVSTLQPAKNLIDGEWDLHDGPYYEEVKGAADIPPNVVAAFNTPFGGKASRPLEHMR
                     VPEVPKPAAHHLRAQLLWSPEEDKCLLKLVAMYPFNWDLIADSFNTEMILIPVEKRNP
                     YECWERWYYTFGEGKNKPRQDAPPSAPPPAPASATQPGTATATPVPQSAVTTPGVPPS
                     ANLPSASGRPQQTGGNSVSSLPTPTGEALPDGAPPPPGMSKRDRMAAKPKYEGTKRSV
                     RHQAIYDAVKRMNRRREAARAKSHKDNAQRKVINVHESHSMSFPHVAASTPWELVEAK
                     YQRDVQIAQQRQQRAMQEQQRQLAIRQQQAMMSAQQQAQMRPPNMPNVPNMPNAQPIR
                     MGPNGQPMPTMAPSQQQLLNAVAAATAANRQNANGAVQGNPNVRPMPVVQGQSPQVQQ
                     QMLLQAQQMAAQQARVLQAQAQAQAQQGRAPSMGGNLQPPQLGVSSPFAQSRTPDLPA
                     EGAGPSGINPTPSPAMQAAAIGAQSSPQIATMGRAPSNNVPPHLRVPNAGTSSPQISS
                     PMALPQGIPNGAGMPVQGAQTQGIQIPAAMMNNATVQQLLATLAASGQQMTPEQLRGL
                     MLRSAHMQAQAQSQVGNPGTPQMGVQNIQGVQHFARSPSLQNAQSQPRSSPKPGPANG
                     QGT"
     gene            301973..303098
                     /locus_tag="CNC01050"
                     /db_xref="GeneID:3256751"
     mRNA            join(301973..302284,302338..302469,302529..302658,
                     302718..302848,302899..303098)
                     /locus_tag="CNC01050"
                     /product="protein-S-isoprenylcysteine O-methyltransferase,
                     putative"
                     /transcript_id="XM_569424.2"
                     /db_xref="GeneID:3256751"
     CDS             join(301999..302284,302338..302469,302529..302658,
                     302718..302848,302899..302993)
                     /locus_tag="CNC01050"
                     /codon_start=1
                     /product="protein-S-isoprenylcysteine O-methyltransferase,
                     putative"
                     /protein_id="XP_569424.1"
                     /db_xref="GeneID:3256751"
                     /translation="MSDQTSQSPVSLPRTDQYDPRGSIPNTVFAVALIASILGAVGGS
                     SLALASQTLFNAFAGTWARPQLGIYLGAMCIFHLMEFFTTAGWNPQKLSVDAFLLNNG
                     RQYHFAHAIGLAEYFISSWLFPGKWNTFWGSFPWLTLVTLGMVAAQCIRSMAMIQAAQ
                     SFSHIVKSKKHDDHLLVTHGLYSWSRHPSYAGFFYWAVATQLLLGNIVSTLGFMIVLN
                     KFFSARIVDEEKWLVKFFGNDYVEYRKRVGTKLPFYFSK"
     gene            complement(303088..304780)
                     /locus_tag="CNC01060"
                     /db_xref="GeneID:3256487"
     mRNA            complement(join(303088..304040,304090..304197,
                     304256..304609,304670..304780))
                     /locus_tag="CNC01060"
                     /product="rRNA binding protein, putative"
                     /transcript_id="XM_569426.2"
                     /db_xref="GeneID:3256487"
     CDS             complement(join(303105..304040,304090..304197,
                     304256..304609,304670..304732))
                     /locus_tag="CNC01060"
                     /codon_start=1
                     /product="rRNA binding protein, putative"
                     /protein_id="XP_569426.1"
                     /db_xref="GeneID:3256487"
                     /translation="MGRQRRKNRTHLKGPPKGETEENVPKSFVIKSGHVTKSISQLVR
                     DTRKVMEPNTASRLRERPNARLRDYLTIAPSLKVTHLLAFTLTDAANVHLRVARFPQG
                     PTMTFRVQKYSLMKDLFNSGLRNVGRSPAGEYRNPPLLVLNGFQQPQNGPALPQLRLM
                     STMFQGIFPPIQVEKSALPTFRRVLLISYSHVTGCISFRHFTITVRPHGVSRRVRKLL
                     SSTVTSANPTSSKSRKTVDLSNTDDIADYLLRRTGSETSGASTAGYDSASETEASEAE
                     SDTNAVELPEDYVGRGNKKGERKAVRLVETGPRMEWRLIKVVEGLVGSKKGEGETVFH
                     EFVHKSAKDANAQAQAHERKRKAKEARRAEQAANVARKKAERAKKKGKAVGDGEEDED
                     NDSEEEPDIEGLSDIDPEEELERLRERKVGFQDEDDDEDFEYEDRGANADDEDDDDWG
                     EDVGAGEGDVTSDDEESSEDEEAKPPPKKRASGKRK"
     gene            305709..309373
                     /locus_tag="CNC01070"
                     /db_xref="GeneID:3256793"
     mRNA            join(305709..306187,306237..306826,306875..307012,
                     307065..308186,308235..308796,308851..309373)
                     /locus_tag="CNC01070"
                     /product="glycine dehydrogenase mitochondrial precursor,
                     putative"
                     /transcript_id="XM_569428.2"
                     /db_xref="GeneID:3256793"
     CDS             join(305730..306187,306237..306826,306875..307012,
                     307065..308186,308235..308796,308851..309124)
                     /locus_tag="CNC01070"
                     /codon_start=1
                     /product="glycine dehydrogenase mitochondrial precursor,
                     putative"
                     /protein_id="XP_569428.1"
                     /db_xref="GeneID:3256793"
                     /translation="MSVSILRRAARLPLSRQHQPLFARPLSISSIVLRPTSTSPTRSS
                     TTATQPHPRSPSESFHPAPTSVFTPLDTFLPRHLGPREADIQAMLEVLGHKTLDEFVA
                     TTIPSEVRIDQLTNKEEKGKGLRALSELELRRRIEEIAAMNRPVKSYIGMGYHNAIVP
                     PVIQRNVFENPAWYTAYTPYSPEQSQGRLESLINFQTVAISLTGLPIANASLLDEGTA
                     AAEAMAMCLASVAKPKFNKGKKVFLVSPNVAPQTIEVLQTRASGFDIDLRIAESDANF
                     LSEVESLGEAQLMGALVQYPDVNGEIGDWEEVATKVKATGAKMVVTTDLLALTMIKPP
                     GEWGADIVCGNSQRFGVPAGYGGPHAAFFACTDDLKRKMPGRLVGLSKDSQGAPAYRL
                     ALQTREQHIRREKATSNVCTAQALLANMAAMYAVYHGPEGLRRIAGKVHSLTRVLSES
                     LASLGFTTVNKAFFDTLTIDVSSAGVTAADVHTASVKAGINFRKIDDKTIGITLDESV
                     GPLDLTDIINVFYAVKGQPAVEPEVLEALAQKLELSAESVTSPIATLARTTPFLTQPV
                     FNKHHSETDMLRYMMHLQEKDYSLVHGMIPLGSCTMKLNSTSSMVPLSWKEFGGLHPF
                     APTDQAKGYEVIIKELENDLSLVTGYDATSVQPNSGASGEYAGLRVIQAYHESRGEGH
                     RDVCLIPLSAHGTNPASAAMVGYKVVPIKALNDGSLDLADLKEKAEKHKDKLAAFMVT
                     YPSTFGVFEEGIEEACQIVHDNGGQVYVDGANCNSLIGLTSLGRVGGDVSHTNLHKTF
                     SIPHGGGGPGVGPISCKSHLAPFLPSHPIVPTGGSTPITAVSAAPYGSASINTISWAY
                     IKMLGGEGLTTVSKIALLNANYIAERLKPYYNLRYSNKNGRVAHECLIDLAEFEKSAG
                     LKVPDFSKRLQDYSFHPPTAQWPISTCWLIEPTESESKEEIDRFIEALISIRKEIDEI
                     VSGEQSKDDNVFKNAPHPLSLLTADKWDRPYSREKAVFPVPGLKKSKFWPSVGRLDDA
                     AGDLNLICECGSVEEYA"
     gene            complement(309340..311484)
                     /locus_tag="CNC01080"
                     /db_xref="GeneID:3256612"
     mRNA            complement(join(309340..311293,311344..311484))
                     /locus_tag="CNC01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_569430.2"
                     /db_xref="GeneID:3256612"
     CDS             complement(join(309411..311293,311344..311455))
                     /locus_tag="CNC01080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569430.1"
                     /db_xref="GeneID:3256612"
                     /translation="MDIAHVKASVKAWEKAFKAEHGREPTKEDIKNDTSDIAEQYALY
                     RKLSKSAASHGKPGESSKSSKQALSQQQQPQPRVTPRTIPTSAYPTTPTPPSRRSYTS
                     LSRPNGSQSMQNLTAGPSSNAESSANGKPSHTQSLKRKASHAKLSPPPSALESSSAAR
                     TLFTTPKKKAYSGPIIDPNPVNPFNILNSPGKARSITNGGFNPNSGTGLSGVERMGSG
                     AGAAGSKEAVSPFIHASSPKKLKQVLEANSYHKTLVSGPVTTVGCKVSERITPRTKAR
                     KRLRGEPVEDTPMKDRQVRRRRSHMAVSKSQSQSQLDSTRDVNFGKPLGSVFGDQNRD
                     PMDEGQEDEEEGDEDEDEEGLGPSPVKPLGGKTFTSLFDDEDMPPRSIVSAKAKAPGG
                     KMDGKGKSGKGASQPGIMGFFGKLKKAKEKEKEKEKEKEKEADVSTTPSLALDKSADN
                     TLNSDIPSPTSFNPDIDLPELSAPSSAPHLGRKDKILSLSEDEDDEWDPEGGKVQQKV
                     VIVPTRRQVKRRTSIDGLSGLLDGVEKGMVDEGQDEEVEEEGDVIFENGNGDTDGQSP
                     HIPLDLLAITSPHKQRSAELESLRVSAIFNPFARKRLLALKRGQEIHTTGEAAIGGEE
                     GDVDGWEGLDNVLEGEGKKDDDWESEDEGWKKIEEGLDDW"
     gene            311663..312838
                     /locus_tag="CNC01090"
                     /db_xref="GeneID:3256699"
     mRNA            join(311663..312057,312148..312838)
                     /locus_tag="CNC01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656681.1"
                     /db_xref="GeneID:3256699"
     CDS             join(311691..312057,312148..312818)
                     /locus_tag="CNC01090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512361.1"
                     /db_xref="GeneID:3256699"
                     /translation="MRPPALRTFRQLQLRQPNSFLRPLHSTPLLLAAENNDKKSKTKF
                     VTDRPVKVDRSPAFPPPANPFAPKPEPVHYSDLTLGILWKINKLLGYNGRRRTTARES
                     GRMLTGIIEAVKQDKVFWYDECDLPRTFHTFFSVHLVYLLITLIRLRALPNQIPNPLS
                     PIPQSALPGQPGTTTPIQPPSLKDKFEDLVSPAHEYKYRQTLLTHFFNVVENEIRLML
                     GVEITRDSAVQTRMKDYANWWREAQLGMDYAIGLTASEDPRERAVADAELASWVWRLI
                     FGRRGEGVNGQGELVYPEGEAMKEGKELEMAEQVEAIVRFIRREMARLDKISDRDVIA
                     GNVGMFGKVRE"
     gene            complement(312829..314191)
                     /locus_tag="CNC01100"
                     /db_xref="GeneID:3256798"
     mRNA            complement(join(312829..312954,313012..313071,
                     313135..313189,313251..313279,313330..313437,
                     313495..313557,313622..313637,313700..314191))
                     /locus_tag="CNC01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656682.1"
                     /db_xref="GeneID:3256798"
     CDS             complement(join(312869..312954,313012..313071,
                     313135..313189,313251..313279,313330..313437,
                     313495..313557,313622..313637,313700..314044))
                     /locus_tag="CNC01100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512362.1"
                     /db_xref="GeneID:3256798"
                     /translation="MHLARLPLPRPAARAAIRHLSTRSPPPPPPPHQPQPTSFTAKAS
                     PRQTLSHPEEIRGMPPLSPRDAVNKGKADTVTVGERGKGRDGKEVFEAFEGPSKPRLI
                     YERPGGRELPKVRGTAPFVIALGLLGLGWGLFILHATNSERLSSSVLRQATFQLRNSK
                     EVIALLGENVRLVEEWWALGAPWISGTINLMQGRVDLSFRIRGSKGAGTVYFTSIRPQ
                     EQGAWRIVRYKVIADDGQVIRLEDQAIRPEQKGAK"
     gene            complement(314234..316061)
                     /locus_tag="CNC01120"
                     /pseudo
                     /db_xref="GeneID:3256494"
     gene            314264..315588
                     /locus_tag="CNC01110"
                     /db_xref="GeneID:3256665"
     mRNA            join(314264..314336,314387..314422,314485..314600,
                     314664..314786,314835..314978,315032..315196,
                     315237..315416,315467..315588)
                     /locus_tag="CNC01110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569957.2"
                     /db_xref="GeneID:3256665"
     CDS             join(314303..314336,314387..314422,314485..314600,
                     314664..314786,314835..314978,315032..315196,
                     315237..315416,315467..315481)
                     /locus_tag="CNC01110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569957.1"
                     /db_xref="GeneID:3256665"
                     /translation="MSAEDFELSPGQISDSVRHQLEIEEGNKNVQYQRFHTKQTQDYL
                     AHLRPKVKDVDQFWLIVLLSHQIVAPHVTSKLDQHALSFLEDIELKQDVNDFRPYELV
                     FHFKENPYFTNKTLSKKYTLKKGIKPAPADGSVTDELRKFNEEQDLEVNRATIDWKDG
                     QNLCERMPRQAQAQREGGEADDLEDGFEGDPGSFFWYFQEKADRFNFGEQFKDDILPE
                     AFAYFEGRGESGFGGESDDEDDSLDEEDDEDEDEIDLEEDEKPKKKRKVGAH"
     gene            316541..318200
                     /locus_tag="CNC01130"
                     /db_xref="GeneID:3256172"
     mRNA            join(316541..316717,316763..317735,317788..318200)
                     /locus_tag="CNC01130"
                     /product="ribosome biogenesis-related protein, putative"
                     /transcript_id="XM_024656683.1"
                     /db_xref="GeneID:3256172"
     CDS             join(316633..316717,316763..317735,317788..318109)
                     /locus_tag="CNC01130"
                     /codon_start=1
                     /product="ribosome biogenesis-related protein, putative"
                     /protein_id="XP_024512543.1"
                     /db_xref="GeneID:3256172"
                     /translation="MGEFEDRWEDEIESEEEVVEHDADGEADDDFTPAQEDAEPPAAP
                     TQTYLPGTAIAEDEQLVPDNSVYLALHSLSYAWPCLSFDVLRDSLGTDRATYPHTSWI
                     VTGTQAGEVPGEGKAKDEVVIMRLGNLSKTQHDDDDDSDDGKDDDDDEADDEDATLDF
                     LTIPHVGSVNRVRAAPAPVGGAVPDPYHVATFSETGKVHIFDVRPYIDTLAGPSRPRQ
                     KLPVHTISNHGRAEGFAVEWGATGLLTGDIDRKIYLTTLTPSGFTTSPNPYLSHTSSV
                     EDLQWSPTEPTVFASASADRTVRVWDVRAKGRRSVVSVEAHSEDVNVISWNKTVDYLL
                     VSGGDEGGLKVWDLRMFKDTPSPVAQFQWHTAPITSVEWHPTDSSVFAASGSDDQLTL
                     WDLSVEPDEDEAPIGPADGNITAVPPQLLFVHQGQKDVKELHWHPQIPGMVISTASDS
                     FNVFKTISC"
     gene            complement(318158..320014)
                     /locus_tag="CNC01140"
                     /db_xref="GeneID:3256692"
     mRNA            complement(join(318158..318907,318966..319112,
                     319185..319286,319345..320014))
                     /locus_tag="CNC01140"
                     /product="lipase, putative"
                     /transcript_id="XM_569436.2"
                     /db_xref="GeneID:3256692"
     CDS             complement(join(318230..318907,318966..319112,
                     319185..319286,319345..319986))
                     /locus_tag="CNC01140"
                     /codon_start=1
                     /product="lipase, putative"
                     /protein_id="XP_569436.1"
                     /db_xref="GeneID:3256692"
                     /translation="MYIPGPLRLSSYLLPFLSSPSPPAQSSPDTRTISFKPVHAHGHA
                     FVDNASTPTLLFLDQSPSASLYAHDYPIGAFGDDYVLPRLTSDVLEIRTRKKLIRRPK
                     VRPPRIISWAQSYRAQALHFNGINNNNDNSNKSISLPESWLAPDLANPSDEWSDVEVT
                     VPDLTDRQTVITLAKMSSNAYVTPGGAGWYTLNDWNASMPFGWEPDADGLRGHVFADE
                     KNETVIISIKGTSAGVLGSGGPTAKNDKFNDNLLFSCCCARVDFSWTPVCDCYAGGYK
                     CGQTCLEDALVSESVYATVGTNLYNNITYMYPNATIWLTGHSLGGAVSSLIGLSFGAP
                     AVTYESPGELLPASRLHLPLPPGMPANLSGITHVYHTADPIAMGVCNGPYSSCYAAGF
                     AMESKCHTGETILYDTVRVKGWSVDVRTHRIEEVIDKVLADPWPEEGEGKSGVWEKAV
                     EGWYRAADRVRAALDESVVRDDVNVWWGWGRRGPKRQPGGEDPGWRKHGGVPKPVSEE
                     DCVDCYKWEFGEWN"
     STS             319211..319512
                     /standard_name="CT7"
                     /db_xref="UniSTS:470766"
     gene            complement(320166..322923)
                     /locus_tag="CNC01150"
                     /db_xref="GeneID:3256725"
     mRNA            complement(join(320166..320640,320702..320712,
                     320769..320846,320903..321006,321054..321496,
                     321541..321606,321666..321740,321799..321865,
                     321918..321927,321988..322009,322058..322297,
                     322355..322450,322559..322923))
                     /locus_tag="CNC01150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569438.2"
                     /db_xref="GeneID:3256725"
     CDS             complement(join(320340..320640,320702..320712,
                     320769..320846,320903..321006,321054..321496,
                     321541..321606,321666..321740,321799..321865,
                     321918..321927,321988..322009,322058..322297,
                     322355..322450,322559..322815))
                     /locus_tag="CNC01150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569438.1"
                     /db_xref="GeneID:3256725"
                     /translation="MDPNSVVKPEIDTTSTSLGARQNTLIPPIDASIQGRYTKREDEA
                     TANKNMQAGTEEEKEMAGRAAVIIQKHYRGHAARKHVRELRLQREARWNDLVKHSQEV
                     TYAKDQLDNKNDVVSRWHRAAHAASRLQTGDGLYSSPISTLPSGQVEECDPKKLTDKE
                     LRARKATFWGSLSLGVGKDRDEKKELPFHSKELETQHWLEMIDGKHRYGSNMKYYFRK
                     WKEADTSDNFFRWLDKGEGKDLDLEEMPRERFEKERITYLSAEERLNYLVKVDKDGRL
                     RWVHNNEFVDTAAGRWKDAGDGTGIVPADPQSEEDENTPKPQPTIDPYATPHNHHIRK
                     VSRTSSLSSLSSDSYSPQSSELDENESTHYAGLDQKPEGWLERQRKRLTPGGVRRELL
                     RKTVRRNTWIYVSDMKLNLFVGIKQSGTFQHSSFLAGGKVTSAGIIVVKHGLIKSLNP
                     LSGHYRSSIDGFRSFIGQLEAKGVDLSHVKIAKSVLSLWGLSKYSKVTKAQNNLITHV
                     QRTLHLSHEPTEEEKSQALQENAEREEREHQERTKIVRDAEEEAKRSGEIKDDRDDVA
                     TEKDKEEMREFRREVLYGRRDRV"
     gene            complement(323087..324728)
                     /locus_tag="CNC01160"
                     /db_xref="GeneID:3256661"
     mRNA            complement(323087..324728)
                     /locus_tag="CNC01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_569423.2"
                     /db_xref="GeneID:3256661"
     CDS             complement(323255..324244)
                     /locus_tag="CNC01160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569423.1"
                     /db_xref="GeneID:3256661"
                     /translation="MRFTSPDTRPSLTPLGYRLLHLSELKLSSMDGSSYDEGVSLWKG
                     VLVREAVRSAWKSVQDGSVPEMNDWSARGAMGLDIYEEEVEEEEEQQEERWFEDMVTS
                     FGEEEYAVEAADGEHEWVESSVSIPEYDLDFNVDGMEAYTFPASSPSTPLLDDSHLEP
                     SGTVDIIEVDDDESDISDEDLASLAQSQHWHSPSTISMAATSPSTPILFGHPLSSPNS
                     PTLSPVPSPTLLAPTPMPLPAALTGSFVFPDPRSYYTDFEEYVDDFSLPPPLLRSMSS
                     STTESDVDDGEVCKTPPLRTEELEYESSEEENVKEEELLMGLGLRIGHLNLRL"
     gene            complement(326549..328065)
                     /locus_tag="CNC01170"
                     /db_xref="GeneID:3256420"
     mRNA            complement(join(326549..326894,326977..327473,
                     327531..327788,327862..328065))
                     /locus_tag="CNC01170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569963.2"
                     /db_xref="GeneID:3256420"
     CDS             complement(join(326794..326894,326977..327473,
                     327531..327788,327862..327869))
                     /locus_tag="CNC01170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569963.1"
                     /db_xref="GeneID:3256420"
                     /translation="MPYSQKLKALLIDLNGTLHIGSESTPSAVKAIERLRSVRIPFIF
                     CSNSTKESSASLLDKLKKIGFDVKKEELMTSLSACRMIVEEKGLKHPLLLMSPSAKEE
                     FSTLPPSQGINHDAVILGLHPDSLSYEHLNKAFRVLKGEPLSSQEKNNSTGEHRPVLI
                     APHASMFMQDPGSSSFPPGLSLGIGPFVRALEEAASVKAEIVGKPTKGFFELALEKLK
                     ELSGEDFERNEVAVVGDDVDNDLGEGARELGLKRILVKTGKYRTDVEKKIEHPPDTVY
                     DTFAAFVDDLL"
     gene            328257..329523
                     /locus_tag="CNC01180"
                     /db_xref="GeneID:3256205"
     mRNA            join(328257..328624,328681..328961,329027..329072,
                     329134..329523)
                     /locus_tag="CNC01180"
                     /product="Rossman fold oxidoreductase, putative"
                     /transcript_id="XM_569425.2"
                     /db_xref="GeneID:3256205"
     CDS             join(328328..328624,328681..328961,329027..329072,
                     329134..329382)
                     /locus_tag="CNC01180"
                     /codon_start=1
                     /product="Rossman fold oxidoreductase, putative"
                     /protein_id="XP_569425.1"
                     /db_xref="GeneID:3256205"
                     /translation="MSVAVIQGASGGLGQALTRYILRHTGLTVYALTHQASSQGVRES
                     LLSEVWDKGKHDSERLTVVSNVDVREEEGLRRGAEMIRSREGSGSVRVVVCLAGILKA
                     EKSLSAINLHDALSSFQINALGQLITYKHIVPLIPTKNELSILKAKWNSEEEGHDPAK
                     GMVNGDHSICCSLSARVGSIKDNEKGGWYSYRSSKAAVNQIIRTLDHELYNRSSSAIA
                     YAYHPGTVLTSFTSPIIGSPKPHLSQGLLTVDQAIDRLVNIMSQVKRGVQGSQNGVDW
                     GGRCWDWKGDVVEW"
     gene            complement(329249..331786)
                     /locus_tag="CNC01200"
                     /db_xref="GeneID:3256450"
     mRNA            complement(join(329249..330201,330272..330830,
                     330902..331123,331175..331353,331409..331786))
                     /locus_tag="CNC01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656685.1"
                     /db_xref="GeneID:3256450"
     gene            329658..>331043
                     /locus_tag="CNC01190"
                     /db_xref="GeneID:3256449"
     mRNA            join(329658..329880,329938..329958,330020..330073,
                     330126..330137,330194..330236,330277..>331043)
                     /locus_tag="CNC01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656684.1"
                     /db_xref="GeneID:3256449"
     CDS             join(329719..329880,329938..329958,330020..330073,
                     330126..330137,330194..330236,330277..331043)
                     /locus_tag="CNC01190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512359.1"
                     /db_xref="GeneID:3256449"
                     /translation="MAPLDLGDVGNAIQGAGESAVNGAEGVVGTVTDKAAGAVATATD
                     KAKGAVASATAIAGDVANGASQAAGLLKWMEKIQDWITKIEGYWDEYKNLIIFIFAAI
                     VTLYVLCILYCCYHCVHDFCRCCCCYVKCTYKCERWCWRHRGPCISCCKSGCHAVERQ
                     DYHKCSRCCLKSVPRSIRNELERQHGDLRKGWWDPTYFARACGRYELPENPVERAKWH
                     WWGHEEGWVHNGVESSLQCLGRTIDKNKRLTKELSSAARRDEHFTKLFQQMSRAEGRM
                     RQEGGDLKDRINHQWAARKGLVHKLDRKLTKAEKKILDRAQTRLEKKMESEHWNSDDS
                     EMESEDEKPRMGDRGETV"
     CDS             complement(join(331074..331123,331175..331353,
                     331409..331596))
                     /locus_tag="CNC01200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512360.1"
                     /db_xref="GeneID:3256450"
                     /translation="MLGQLSRPVRLSVAPLRTILTQRAFHASPIARDHILDASNEVFE
                     KRALDADNSKPVLVDFYASWCQPCRVLTPLLKRVTGPESNYDLLTINVDEYPEVAAKY
                     KVSALPTVVAFKNGAVKNKFVGFRGQDDINKFLGML"
     gene            331854..334515
                     /locus_tag="CNC01210"
                     /db_xref="GeneID:3256299"
     mRNA            join(331854..331982,332031..332084,332135..332178,
                     332230..332539,332588..333121,333171..333606,
                     333660..334252,334309..334515)
                     /locus_tag="CNC01210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569431.2"
                     /db_xref="GeneID:3256299"
     CDS             join(331970..331982,332031..332084,332135..332178,
                     332230..332539,332588..333121,333171..333606,
                     333660..334252,334309..334334)
                     /locus_tag="CNC01210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569431.1"
                     /db_xref="GeneID:3256299"
                     /translation="MPKTNKGGKGQKNKVYALPTAQKKKGLDVPKFQMKAKAASQAQL
                     APTSLGALSSNDQDISNSSFDLGNVTFHDVIDTSLTKDSSSKAFMRELRKVIERSDVI
                     IQVLDARDPEGTRSRWVEDEVRKRDMQGKKLLGVLNKIDLVPRANLEAWLKHLRHSFP
                     TMPFKSSTQSQKQHLSQNAVPLAQPSTVPGKQAVLQELPTTSASLGAPALLHLLKQYA
                     LSTPHSSLTVGVVGYPNVGKSSLINSLKRSRACAVAAMPGKTRVVQEVALDKGVKILD
                     CPGVVLEDVGSHMEGEEGRRRQAEIMLRNCVKAELVQDPISPVEVILNKVEPAQLQKL
                     YNIPAYDDVRDFLIKMALIRGRLGKGGVPDLEASAVQVLRDWNSGKISYYTTPPKFHP
                     SSAPAPAPVVTPVLAPNEAAGDMEMGGDKVGDAKILTTLSEAFTIEGLFDNLGDDAAW
                     EGEGVVKEEGIAEDADLIAPEPVIPPALVPEQTAPRASLTKRPFMGSEDESDADSDAS
                     DSFRPRTTLGPSPASFQSTSSNALHFPAQPQTAQANRLFTAEELAVLPSGLLDRKKVK
                     SLAKKAKKRRAAVERTEGELMAGFMDMEMDEPGAREETEVQMPAFEQKSKKDKRKEKK
                     ETQAKQRKEMTKVVAEMEIDEDARKEAEFANFLANMNADGSDEEL"
     gene            334900..335752
                     /locus_tag="CNC01215"
                     /db_xref="GeneID:36392774"
     mRNA            join(334900..335038,335092..335529,335581..335752)
                     /locus_tag="CNC01215"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658925.1"
                     /db_xref="GeneID:36392774"
     CDS             join(334958..335038,335092..335529,335581..335667)
                     /locus_tag="CNC01215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514264.1"
                     /db_xref="GeneID:36392774"
                     /translation="MSHKYRWFLMLLSCNLVSFGAPLPTRQATPAQVTDVLDISMTGE
                     GKMMFFDVINNSKKSSGNTHIQRSPSAHSSLLGATRTTSSDPPLPIEDEPSLEEIRSW
                     RKHNGLLSTMLRIFGPWVHTSMKEPLWKNDMDEDNQRIGPIRMGRPKEVLVLGEDHFG
                     RRIVKRGTEVFIEEPVFNGRQWEGAEEMDDETDEPYLLGLV"
     gene            335851..338066
                     /locus_tag="CNC01220"
                     /db_xref="GeneID:3256518"
     mRNA            join(335851..336075,336125..336963,337015..337368,
                     337422..338066)
                     /locus_tag="CNC01220"
                     /product="cystathionine gamma-synthase, putative"
                     /transcript_id="XM_569433.2"
                     /db_xref="GeneID:3256518"
     CDS             join(335881..336075,336125..336963,337015..337368,
                     337422..338025)
                     /locus_tag="CNC01220"
                     /codon_start=1
                     /product="cystathionine gamma-synthase, putative"
                     /protein_id="XP_569433.1"
                     /db_xref="GeneID:3256518"
                     /translation="MPTSTSNLPAPIPLGCSVPALTAHAISVSLPTWEDNIGYEEGHK
                     RVVDKMETGYPRFFIHRSIQKLAALCLSKFGQPNELCILLPAPRVAAAGRDFLAAQDP
                     PIPSRTVEFVICPSSKSLTDLSSAKSLGIDCIELQILLFDKDKWPYGKAFWQHTGDGV
                     SSRMAERALSFLGETPAGVQPRAPSPPTLERPASKAPSSRNRHYSKRTGSVPPTPTTP
                     SESPNSMPQSSTILEKPPVDPITDENLTSDLTTYLEERYGRNLPLFNAPLAKQALKRR
                     IAGGLLPSDEDYGKIEDVARGAGSGKKAVTEENVYLYPCGMSAIWHAHDISRIARKLQ
                     GEAEGISVCYGFPYTDTLKILNKWGPGCHFLGTGGSEDINALEKILVEAKENPNEPPI
                     LALFCEFPSNPLLRSPDLVRIRELADKYSFFIIVDETIGNFINVEVVTFADIVVSSLT
                     KIFSGDANVMGGSLILNPNGPHYDTLKAAQSSVYEDYYYPEDAVYMERNSRDYRARIK
                     KVNDNAYDMCDFLHKRSLDDESTPAEGKVLKKVYYPRYITPETYAQAQRHPTLGKGGY
                     GGLFSLTFTSLAASKAFYDAIGCAKGPSLGTSFTLASPYTILAHYLELDWAAGYGVEK
                     GLVRISVGQEDQSVLKTWFETALAASEAAGRAEKEGRKE"
     gene            complement(338077..342828)
                     /locus_tag="CNC01230"
                     /db_xref="GeneID:3256122"
     mRNA            complement(join(338077..338656,338723..339053,
                     339108..339670,339724..339885,339937..340110,
                     340160..340357,340410..340577,340630..340892,
                     340948..341923,341971..342140,342188..342828))
                     /locus_tag="CNC01230"
                     /product="DigA protein, putative"
                     /transcript_id="XM_024656686.1"
                     /db_xref="GeneID:3256122"
     CDS             complement(join(338147..338656,338723..339053,
                     339108..339670,339724..339885,339937..340110,
                     340160..340357,340410..340577,340630..340892,
                     340948..341923,341971..342140,342188..342206))
                     /locus_tag="CNC01230"
                     /codon_start=1
                     /product="DigA protein, putative"
                     /protein_id="XP_024512363.1"
                     /db_xref="GeneID:3256122"
                     /translation="MSMLDDFVEHTSGPSAASYAVSGIYQGSNNVGYGGSGIQAVGYE
                     GFEEGDEEQPGEDAVMVRALETGFIPSARSQALSPLFSLSLVQYSPPSSVLCLTSVNN
                     VLFLAIAPLALVIIDLEKPEELVTIDLPKPTPEKGSQRTKESPVVSQLFADPTARHLL
                     ISTSSGDTFYLPISPGNAAIQSRRPRPLRLRQSITAAGWSPISGVTVDANGEGTGQGK
                     GDAVTPPSTDVLLGTTNGQILSLLLPPQDDIFKSVSIGMSKPVERDLQTVYTLPDQQP
                     VAGIGFGFWPANGSSSDRHHKGGKKGAGKRAWVVITTKERLYEVQGNVSTTTAGGKTG
                     GWAEELFKPIRNSTPKFQELPGDIVNPSLVFYTPSTPAQSSSTLPAPSAIAWLTAPGL
                     YTSSLSSAPSNDILLRPSLIPYPIFDDSALHDFAPRPAPSSPSLPAIPIAVAVTQWHW
                     LLLYSDRVAGVSRENEKVVWEEKLPLSVDEKAIGMSADPVSRTFWIYTNKSILEILVR
                     NEDRDIWRAKLEKGEYTEALNFAKTLSQKDVILSKQGDYLFEQGRYIQSAQCYSQTNR
                     SFEYVTLRFIDADERDALRIYLSERLNRLDKKQRTQRMMLATWLIEIFLNKWNALEDL
                     LAIDSANTDMDSLNIERQITEEDLKEFMNTYQNDLESKVVYELIQSHGRTDLYLFYAT
                     LIKDHGKVIEHWITEEQWLKAIEALSRQNTIELYYRFASILMRHAPKETVDSWIRQPA
                     LSPRRLIPAILQQHRRSEPMSSNHAVRYLSHVIHHQSCTDTTIYNLLLTFYATDPDPD
                     DGPLIRFLSSCPDDPETERPYYDLDYALRTCKQHGRIQPCVLIYSKLGLYESSVDLAL
                     DKGDLELAKENADKPEDDDVLRKKLWLKIAKYVVQEQKDIKSAMQFLGSTNLLKIEDI
                     LPFFPDFVVIDDFKIEICSALEEYSARIDALKAEMDEAITSSESIKRDISNLAKRFVT
                     VEQSDKCWKCGLELVSRQFYVFPCQHQFHGDCLISMAMEYLPSPSLRRILRLQNELVS
                     RSGPSFGRHLLSSNFTPSGSGSSTPGRGKEHPFRQAPASSNVATDLLLGGVTGRNKLI
                     AAGDKLRELIIPDALAQAVSMVSVGVGVGGTGEAKKGGKREKPDDSRAEEFRNELDAL
                     VASNCPLCEGAVMSLDKPFIALSEDTADWEV"
     gene            342519..345253
                     /locus_tag="CNC01240"
                     /db_xref="GeneID:3256380"
     mRNA            join(342519..343858,343917..344023,344072..345253)
                     /locus_tag="CNC01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_569437.2"
                     /db_xref="GeneID:3256380"
     CDS             join(343157..343858,343917..344023,344072..345041)
                     /locus_tag="CNC01240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569437.1"
                     /db_xref="GeneID:3256380"
                     /translation="MCTHSMLTSHTELALEQLRLCHILNGETCPPISFADFATFLTNK
                     DYTAENLVFVLWYRDYRSKWKQVDKAVKIRVPVPSTILGHRYDPFAYLHHGPMNFPTK
                     VGEQEVEESRSSSISAGAYSTDATALHPNDGSGKPLRSCFSRVNSHFAGSRFGTSSST
                     CSSSPALHVLHRSHSPYLPDGTTFLPVDEQPLRDQALQAFATFFKNGGSKELSISDEL
                     REYVRTCLEVSSAPESFLPVLEEIYHTLESQCLPRFLETAKGNINRPKQLLWYFAGVI
                     GLLIGLAIFLLLTFLLPPSPFGLRTYRLFSTIFVSFGTMQVYSAYRGFCSQVWRRSSR
                     QIWPWELDALEDEHSKVGDMIGIPAIVGCGPKPEVKVLKEVVFPEEVRPLSNLGAIQD
                     FNSTCKVNIRENSINASQASLEKSGDYDLSSQTFGFRNALARQFAPICDTSSLEDKTG
                     LISRPCCMWLGILAAKGHKLPNPTQREISPFAFDSGGKEGETSLGNATITTPFPHSVP
                     AQSLHPLTSFMLISNPRSTKHEARVPPRRKAHTKIQVFGPERLVEDPRIKKVYRDIKR
                     DILIAGGIVSALWIVVCLVVPCTASS"
     gene            complement(345841..347977)
                     /locus_tag="CNC01250"
                     /db_xref="GeneID:3256343"
     mRNA            complement(join(345841..347492,347545..347703,
                     347756..347977))
                     /locus_tag="CNC01250"
                     /product="expressed protein"
                     /transcript_id="XM_569439.2"
                     /db_xref="GeneID:3256343"
     CDS             complement(345980..347488)
                     /locus_tag="CNC01250"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569439.1"
                     /db_xref="GeneID:3256343"
                     /translation="MPPFARRQARQISQVRGENTPVTGTARLQSVVPQRRRIEIVLPA
                     RSRRTPINRQSRIAPSHPPSPANPSSSEPESTTSAIASSSPPSSASEISAPPVIERRR
                     IEAVLMDCAAQGIDVDSWNITMSPSHYYQTFCNTLSIATIGSQGSHIYSQVKDDGMYA
                     KWVLIGDAGCRLLIAPEYKRRLIRAIKQKRPIHPSTSSCKLTDAPFTMSCFELMEHLT
                     SIGCRAIRIQLYGQKLPLHPRFFPQAPEEPVHYLAETNQWDIGVTYRSNKIFLFAPTK
                     GVSSGMDVYPMLIPISKDFGSISVKMSARGKECRVKIYPRLVHVLKSIRGQLQKYNSK
                     TMSGLMKQMTAAQELLKEITSMDEEECGGFRIEVSLNTFTLEEARTLAVESQLLEPET
                     WLLEGGPAYVQPYKLCLKLVTKAELLTNANRLVRVAVEQRLLTGDGNRHSEEWEKKVV
                     ADVFAAIGWNNGKRRLTKSTSTDAWWITGQGDTADDPRNEGDQILMDINRVE"
     gene            348156..351379
                     /locus_tag="CNC01260"
                     /db_xref="GeneID:3256405"
     mRNA            join(348156..348332,348397..348712,348765..348947,
                     349015..349228,349280..349559,349612..349851,
                     349903..350218,350274..350362,350410..350673,
                     350748..350905,350960..351009,351058..351379)
                     /locus_tag="CNC01260"
                     /product="SNF1 family protein kinase, putative"
                     /transcript_id="XM_024656687.1"
                     /db_xref="GeneID:3256405"
     CDS             join(348863..348947,349015..349228,349280..349559,
                     349612..349851,349903..350218,350274..350362,
                     350410..350673,350748..350905,350960..351009,
                     351058..351152)
                     /locus_tag="CNC01260"
                     /codon_start=1
                     /product="SNF1 family protein kinase, putative"
                     /protein_id="XP_024512544.1"
                     /db_xref="GeneID:3256405"
                     /translation="MEAAQTPRSVLTHIGGWKLGKTLGRGAYAHVRLATHKNGHQAAC
                     KILPALHKDPGLPVTWDETIDAVEAHKEVVLLKALCGAGVEGIAGLEGVVEEGGWTYV
                     FLTLYPCSISSISKPWASDAVVIFFRRLLHTVRNLHQLNVSHEDIKRSNVLADSQGSP
                     VLVDFGFSHFKANGGYVKSAGGTLDYSSPEKTADKHYDPKANDIWALGILLTKILCIQ
                     HPYAHSYVDDTSTTVKRRILTGDAKFHWKTDHLVPGGVAELIMGMLERDPQQRWTITR
                     ILGHPWLRTKYPDLRPFQLPSYELKLLHKPSQSVIEDLCFLAYLNGEFALCETSMRIE
                     EHLEGKEPCWEKRWAGMLGSWSQRAEMDWQDIPTAITPLPKSRSSFTRVNGPTKANAI
                     GNSKGGILKEIHLLPNAQALTTLGSNGDIKKGLRPARSRFYNMKTKNGAQNLLVCSLR
                     PGIHTQTTLQEKFVPDDLMAATNNQSSKAKPGIVRVKKPKAKQKSKADFKIFISDTDN
                     SGEENETVEKRQNQQGPRKLDKTGAKNLIIGESPTLAALVTDSKEGFITSVPDEQMKG
                     LFLSKPDPPRARCTQRRSPRLQEEKRIDLN"
     gene            complement(351354..359018)
                     /locus_tag="CNC01270"
                     /db_xref="GeneID:3256280"
     mRNA            complement(join(351354..351760,351811..355450,
                     355507..355938,355993..356081,356139..356576,
                     356622..356726,356783..357202,357254..359018))
                     /locus_tag="CNC01270"
                     /product="expressed protein"
                     /transcript_id="XM_024656688.1"
                     /db_xref="GeneID:3256280"
     CDS             complement(join(351509..351760,351811..355450,
                     355507..355938,355993..356081,356139..356576,
                     356622..356726,356783..357202,357254..358942))
                     /locus_tag="CNC01270"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512365.1"
                     /db_xref="GeneID:3256280"
                     /translation="MPLQPSTFAPAKNRQPSGPRPPPLRSSIASTASSPKSTSDVPIS
                     VRPSTTSLAKLEYRTESPLDALLSLESQYTVSPETSPKLREAAGPSRQVSEYEPLPPS
                     TFHTRPPTGGHTKIAQDAPSSREASKAHSKSGPDRPDALPMPTFSIASRPSTPTSSAT
                     SKSKPRPKPTRLNTNVISSSSLTSPAKIVSPGIKHWQQVRAHVLAPTPIEERQQHTAR
                     LGKKPGLVSKAAGRFGFRHAADNVIGYTDRRRSMNGLLAELGDLTEEEKEAVARERRR
                     FARDIKACLDACALEESRRRLSRIDSNQNPSYPDDARPSAASIHSAAIHAHPHTAQRF
                     TFDPSFSAFAPLLTELHKYLPDARSKKPWSRTCPHHSEILAELGVAFLEDSTSTDGEK
                     QQALEVFGTIVKNWAADTAEEVIARWQWLCRALLTDDRQIRSRGLALLDNFVHFDTSL
                     PRGHEVPHTALSFLALASDLLILLHAVQTARNPEPSHQSKVQRFLDELSDGRIIQVEV
                     ASIVELVGDVEMSTTMGGIEKEIMWMAVGVVIQTHPHLARWLLEINVHGKQLVLDQFA
                     PLPFLHATPPHLPPLRSHTTVVLLTSLASLVRTLTDFALIPAIWKTVRIHVLPEIETL
                     PSGDVLAQALGKLVFELEVLFYRVQPLHPGTAEDSFRAYAESHPANAGLAFFEHRDLI
                     LRYTVNETLWKGPFVEAAKQVIKSASLGSACDMVEGFVRRKDMAALGRECVATLFSQH
                     LTSTHSTQLAFPLLSYLSQFHPQILYKPLFALSASTQANSLLPSLLQVITFTHILSPS
                     KFWLTDPQMVTIVLMGDARPKVSKGKGKEGEKAVRDVRLGRWAAAVEFILVLKEISEV
                     EGMNKDGKKRKTFGDEVEGRLAAFLEAEEKDGALPTGYRALMCQVLWTLRFKTQSAKQ
                     APWTKQLISWFIDTSRYLIPSEEEQATKYLRAMYRTFSPETLPIDQSIGQPIVLPFSA
                     PHASVNFNHEARIKILTRGIEDVLPPLLVLTHDSLSTQDWETILPFLWAWYGTKASAT
                     REIGFLLEKCAEMAPAQLRSIVISDLTSTNAEVRCQALHNISILFAWRNQILSQPIFT
                     SRRGPLFHFPAKTLEFVPTEIGSSKWVSPQDVQDTQLQKFGQTLPLELRQRLNELRWS
                     DEDELKGNSDWEQTPVSSLPGLAFQSDGNLINGSSSGRPSSPVESLVRKGSNASAGSS
                     SNKRRKAIFAPLFVNMTYDQMTILAGEVDGPISATSLEVVRLLQRDDVVSFLRPFTER
                     MKDQFLNAMERLDRVTNVLTPGFAYSAINAIVGYLKSSLKANADVEYWDIALASVVRL
                     VPSVSEISLRDIRKNKAEHVLLPASIHEEDGGFRIHAPWRRGQRGVQTAQLLILNEIL
                     KVNPREVYLVKKMLHNLHIQSSINHLPFARAWLVLVLTLFSFVNRNYNDRAELRHFLS
                     NVGDILLLHGQSDLVIVAHAMRIFTLCSARFRRVFSSMGFPTIMRPVYETYAASNAAI
                     KDCIEYAAKSFYRIHEEVFVYQTCVVIADGGYDAEAVYAFLSSLSHESTVLSGVTSGI
                     RGSNDKEETDALVQMVSGPEITLAEIGKEAAERQAIKLASITLEDKLFPRENIVRLFV
                     TAIASNPATTCAANFLRLLSALVPKMNDSVSKDLLSEGVEALGSVIIKGKTGDDAAKS
                     VFHPGANDSEADWTRARREYVFLVQSFAKAGGHLGTSATRRTLDMVLDLLRKQPESVG
                     PSASSIVGELAKTRLASGRPTPFLREIAPIFRAFISVVDFSGMLDSISALIRLSNYNL
                     DEEITRIIVHDYVEPAVKLLASASKDSLAFIVPLRSSAVKLLSVAVFLQGDALGALER
                     HHASASLLASVVMPLCLLLEPPREVDRQDIYSSLWIRLLHYVLKGSIEEGGDSRKSSN
                     ASLYHPRSIAASTVLVVQIVKIVLIRAPGSINRVKGLWTYVARRILQIVDCGNARFMD
                     SQRSLSPRVVDWLMWSVFELIALHPSALHIEFQARVHQALAMIDKQETYSSRPSSPAL
                     GPTLSASTYPQYYPGRARLSSNRPSSFIGHARSPSNVGHDHTQFGSPDRSTTANLAVT
                     PSRNRISSNNSSPNHSPSLLPSSLAQPHGVGPGVEVVHSRSPSQRKTTGLSPAGAARP
                     SFVALSARRASQPVFEAFSSAYPTKNRFASSANIRDLGNSSEKPGGAIIHLLGAPNQV
                     LSATSSGFPTLSLTNSSVISPTGPKISTQSVEKALRDVYIKSEELTQMASKAVRTVML
                     VYGWRFDKEEEDVVRNWTVLDALHIVSKQTKVFVEEEFRDVFSPAADLYESDDAYIDS
                     EKQEGVYDFPDRMRASESLEETSIEKERQLMDEKENDVPIVSVSSPYD"
     gene            359181..361191
                     /locus_tag="CNC01280"
                     /db_xref="GeneID:3256829"
     mRNA            join(359181..359462,359512..359694,359747..360350,
                     360403..360548,360601..360751,360809..361191)
                     /locus_tag="CNC01280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569443.2"
                     /db_xref="GeneID:3256829"
     CDS             join(359205..359462,359512..359694,359747..360350,
                     360403..360548,360601..360751,360809..361155)
                     /locus_tag="CNC01280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569443.1"
                     /db_xref="GeneID:3256829"
                     /translation="MSTASPPALSPPAAKRIKLDTEGVPLSSPLKSQQDASELPPATS
                     APEALPAWTSTPPVDDFLSDEEELEDVKEEEDLTRRDMYLDTISRQSLDFDFEKLCSK
                     SLSNINVYACLVCGKYFQGRGKGSWAYRHAVGDNHRVWLNLDTEKFYVLPEGYPVSDP
                     SLNDILRVLHPRYNASDIKALSTLPAPSYTLSGQQYTPGFIGVNNIKKNDYCNVVIHL
                     LLHVPPLRNFLLNPDTPELQDDRRPTELVKRFATLARRLWNSHLFKSQISPHEFLQEV
                     SKRSNGKFKTTEQGDPVELLGWLVNTLHRDLGGSKKRNSSIIYSTFQGKVQIETQQVI
                     VHKEYARPVFDIGRDIQTISSPFLFLALDLPITPLFTDMNEKKIIPQVPLSQILAKFD
                     GKTTQEFGPSLKRHHLTSLPPYLILHIKRFTKNNFVEERNPTIVNFPLRGVEMSDYVD
                     PKPSDPMHTQYDLLSNVFLDTTTASTSSSGTGPGISKRNPAPGEENQMSWKIHVRAGR
                     AGGNANGSGEAENKGEKWFELQDLNVTEVRKEMVFLGETVVQVWERKDLSEGKK"
     gene            361416..362734
                     /locus_tag="CNC01290"
                     /db_xref="GeneID:3256169"
     mRNA            join(361416..361693,361757..361789,361851..362130,
                     362186..362431,362486..362734)
                     /locus_tag="CNC01290"
                     /product="aldo-keto reductase, putative"
                     /transcript_id="XM_024656689.1"
                     /db_xref="GeneID:3256169"
     CDS             join(361555..361693,361757..361789,361851..362130,
                     362186..362431,362486..362642)
                     /locus_tag="CNC01290"
                     /codon_start=1
                     /product="aldo-keto reductase, putative"
                     /protein_id="XP_024512367.1"
                     /db_xref="GeneID:3256169"
                     /translation="MSLSLDSTIKLASGNLIPRLGFGVYQARSKECEDAVKKAIDTGY
                     RHVDTAQAYHNEENVGRAIRNSGVPRPSVFLTSKYMPSHTVYSPTEVLDVVRKSLKKV
                     DRCGDDKPYIDLMLIHAPWGGEEGRKNNWEALTIAQKEGWVKDIGVSNFGIHHLKALP
                     PPVPAVNQIELHPFCQQRDIVKYCEEHGIAIEAYSPLVRANKKHYDNEVLVKVAKKYG
                     KEVAQVLLRWSLQKGYIPLPKSVTPSRIESNADLYDFKLDQEDMAEIDGLDKGSEGAI
                     SWNPVNHE"
     gene            complement(362708..366834)
                     /locus_tag="CNC01300"
                     /db_xref="GeneID:3256418"
     mRNA            complement(join(362708..363486,363534..364051,
                     364104..364321,364374..364644,364701..364947,
                     365000..365898,365950..366501,366554..366834))
                     /locus_tag="CNC01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_569447.2"
                     /db_xref="GeneID:3256418"
     CDS             complement(join(362908..363486,363534..364051,
                     364104..364321,364374..364644,364701..364947,
                     365000..365898,365950..366501,366554..366635))
                     /locus_tag="CNC01300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569447.1"
                     /db_xref="GeneID:3256418"
                     /translation="MIPSPRRAASTPAVQTWPDLDDDDGWQDMPVVRSDSNPFGLDEE
                     DQKKYHYRTSISLDDDPAGPSGTGNATGKHLELEADTLATDSWREKVEQDESDYTRIR
                     LDEDEESEEVHMRTKYLFNEDKAMTPLSQMQTTKELLTEGQRIAYVALCHLIMKRMLR
                     DMGRGWEGYKAKNKLGVKGKGKAEVPVVESGHIWMLKLMARLYQHMELTKDEQRMIES
                     LAEHGVDPSDLVPALMTTHTVNNPDFDPKEKERVDLEEALRKEAEADDEAEREAKAEE
                     ERHVVVEDQGASDTETEPPPPYEVEERSISFAASPMGKKASSSSLELLSKSINPFGFD
                     DDDVPKPLLGTKSPLSEGSFPNDSSTIISPQANVNPFGSDDENEGSLAVSEIRAPGAQ
                     SKAQTLSSFEKDEGDIGGAHSSPFSEPSNSPLDAAFASTADRPTPCRPQSLQTEDASQ
                     STSDATEKPSVDTKLTPKDEPVTLFDAADPQAPALLPALPGVSTSLSTTDEHVTLDIR
                     WTVLCDLFLVLIADSVFDARSRAFLVRVAAALGFDWLDVVRFENRVTEALEIQEGMEK
                     KGQHEIIEGRRKAARNKRYAMMGLAAVGGGLVIGLSAGLMAPFIGAGLGTAFATVGIT
                     GTTGFLAGAGGAAVITTGGVLTGANIAGKGMARRTREVRIFELKPLHNDKRVNCYITM
                     GGFMASKVDDVRLPFSVLDPVVGDVFSVLWEPEMMAEMGNALKILTSEILTQVGQQVL
                     QATVMTALMSALQWPLILTKLGYLIDNPWSNALDRARAAGLVLADVIIQRHAGVRPIS
                     LIGFSLGARAIFYALIELARQKAYGLVQEVFIFGTTVTASRDTWLDVRSVVAGRFVNG
                     YATNDWMLGYLFRATSGGLNTVAGLRPVETVWGLENVDVTEIITGHMSYRSCMPQLLA
                     KVGFPVTADYFDEPDDPEIDMNVQERTVVDEAEEEAKRNHKKVLGIFPVKKNRSSGSG
                     HNTPTTEKHSGASTPNPSVSQAAAGEYELEDDDLPPREEVDIGQMASEKDTSTPVEEE
                     KELEIKAVKQREEEEQKEREAIQAIPKTAGFDFQAISRELGKDIDVDKLKEPEPRYFP
                     PALMEIRAPLERSGSAPPPTSFVPPPAEKNVWV"
     gene            complement(367000..369715)
                     /locus_tag="CNC01310"
                     /db_xref="GeneID:3256466"
     mRNA            complement(join(367000..367295,367355..367428,
                     367481..367524,367578..367711,367761..367783,
                     367838..368172,368227..368796,368850..368997,
                     369056..369061,369115..369178,369236..369297,
                     369540..369715))
                     /locus_tag="CNC01310"
                     /product="expressed protein"
                     /transcript_id="XM_569962.2"
                     /db_xref="GeneID:3256466"
     CDS             complement(join(367163..367295,367355..367428,
                     367481..367524,367578..367711,367761..367783,
                     367838..368172,368227..368796,368850..368997,
                     369056..369061,369115..369178,369236..369297,
                     369540..369569))
                     /locus_tag="CNC01310"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569962.1"
                     /db_xref="GeneID:3256466"
                     /translation="MPPKDPTFSDDEASSGRGDSAQPEDIHGRGSSSSARKAQNRIAQ
                     REFRLRKQQYIRDLEAKVQMLEGDKEERVELMTLLVRNLMKENKDLRHMLRLTASFIG
                     EGLGSCLPRLGLSADQLDAILNRADTDTVYEAFINLKASRELEMSNPGIKLGEPRRRA
                     GNLPPKRKRTEDEGGTPIGPAETPEDGASSAGKEKGKTSQNSDISNSKRIKSVFDQPI
                     PSDEYTYLFPDLDSMLMASESFDDPSISRFDINGQMGQSRVPNELPRVDYGQQQRLMS
                     SNTGNVRFPSYNGSTALAGDPLAANLAVSNSSSANYPPSNPSMPSCVTPVRPVAPLVN
                     EGNQSTRRSSTSNEPSTQSDSIRRLAAEHRGAFDGPGMTSQEIEERRKAEDSLIKSIE
                     EGDTPDRKLEAMQLITYHLNNFRMNHEYHLPPSLRPTVVQRTVPHEHAIDGICFPSLR
                     DRMILLRGRYDLVEVFHSLLAEFTLHGDDVLDHRSYEVSEKFIHDYSILVDDSIVAIS
                     NKWRALRGEPPIQWPLKDQGQNQLILSGATSQ"
     gene            complement(369798..371169)
                     /locus_tag="CNC01320"
                     /db_xref="GeneID:3256337"
     mRNA            complement(join(369798..370161,370215..370399,
                     370450..370507,370583..370716,370768..371067,
                     371137..371169))
                     /locus_tag="CNC01320"
                     /product="expressed protein"
                     /transcript_id="XM_024656690.1"
                     /db_xref="GeneID:3256337"
     mRNA            complement(join(369798..370161,370215..370399,
                     370450..370507,370583..370716,370768..371108))
                     /locus_tag="CNC01320"
                     /product="expressed protein"
                     /transcript_id="XM_569961.2"
                     /db_xref="GeneID:3256337"
     CDS             complement(join(369907..370161,370215..370399,
                     370450..370507,370583..370716,370768..370954))
                     /locus_tag="CNC01320"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512545.1"
                     /db_xref="GeneID:3256337"
                     /translation="MSLIPSSSPSSVPFFVPHLGPSSKHGVYPTPGGKGKGKELFGGG
                     KGFDPEEEVDDREWDMRVARAMIHLQETLPHFFNAEMTAATMLPPDIYSQNMLLKLPA
                     PLPLKISSLSGYSMAFSLTRNGMQALHTDLRSEMERMTFSPSPQDMGQESKRAAVLLA
                     RKGIPSHRMKQIRVLVSVYGTLRLPPHKEAKWHTSSLYTFSPTSGLIVSHEVETIRPL
                     PGEGVAEWMMSRLLGWTSKNAGHEGAIPCPRTVALPPEHRVARFREEREEKRED"
     CDS             complement(join(369907..370161,370215..370399,
                     370450..370507,370583..370716,370768..370954))
                     /locus_tag="CNC01320"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569961.1"
                     /db_xref="GeneID:3256337"
                     /translation="MSLIPSSSPSSVPFFVPHLGPSSKHGVYPTPGGKGKGKELFGGG
                     KGFDPEEEVDDREWDMRVARAMIHLQETLPHFFNAEMTAATMLPPDIYSQNMLLKLPA
                     PLPLKISSLSGYSMAFSLTRNGMQALHTDLRSEMERMTFSPSPQDMGQESKRAAVLLA
                     RKGIPSHRMKQIRVLVSVYGTLRLPPHKEAKWHTSSLYTFSPTSGLIVSHEVETIRPL
                     PGEGVAEWMMSRLLGWTSKNAGHEGAIPCPRTVALPPEHRVARFREEREEKRED"
     STS             370143..370951
                     /standard_name="Xba14"
                     /db_xref="UniSTS:470777"
     gene            371416..374174
                     /locus_tag="CNC01330"
                     /db_xref="GeneID:3256639"
     mRNA            join(371416..372118,372174..372287,372351..372377,
                     372430..372487,372542..372598,372657..372793,
                     372854..373071,373137..373259,373313..373416,
                     373465..373518,373570..373670,373723..373777,
                     373844..373969,374023..374174)
                     /locus_tag="CNC01330"
                     /product="polyamine transport-related protein, putative"
                     /transcript_id="XM_569449.2"
                     /db_xref="GeneID:3256639"
     CDS             join(371673..372118,372174..372287,372351..372377,
                     372430..372487,372542..372598,372657..372793,
                     372854..373071,373137..373259,373313..373416,
                     373465..373518,373570..373670,373723..373777,
                     373844..373969,374023..374073)
                     /locus_tag="CNC01330"
                     /codon_start=1
                     /product="polyamine transport-related protein, putative"
                     /protein_id="XP_569449.1"
                     /db_xref="GeneID:3256639"
                     /translation="MEKVGGTRNIVSEKGQSSMDHDYDTESYPIVNCGKPLPFQHNKR
                     RRSSTGVVETSTPAPPPEIELSSTSLSSREARQVITSFPTSPANPINWATRKKWTITA
                     ILALTGFISTAGSSIGVPGLHAVMSEFGETNEKIGVLIAGAYVLGLGTGPFVFAPVSE
                     LYGRQIAYISSQIFYVLFTLGTGFTQSMTALIILRFFCGCFASPPPSLGVATCADMFL
                     PHERGKPISLYALGPIGGPIIGNMIGYWLLFGGWRWAYYFMTIVAFFNFVLMVFFLRE
                     TYAPAIQKIMDYQITHPLSPSTSRRRHHLPKLTWMMAMVSKEDAKAVYGRAFSRPPRL
                     LFTNPVAFAFSLYYAYVYGIIYLFLVALPLLYGKPPFSQPALFSYEWPLATMGLPYIS
                     MGLGFVSAVAIASQCQDRIYKHFSKINGDNGQPEYRLVLTQIGMCIMPIGLFIFGWTA
                     NAEVHWMGPFVGQAVMGIGLMLAFNTIQNFFVDAFYPYSAAAVAGATAARSVVACIMP
                     LFTTTMFVKLGWGWGGTLIACIAIVGIPAPMIMFFFGQRLRERYAFQG"
     gene            complement(374070..376348)
                     /locus_tag="CNC01340"
                     /db_xref="GeneID:3256401"
     mRNA            complement(join(374070..374418,374479..374811,
                     374866..374943,375005..375520,375570..375664,
                     375721..375832,375893..376057,376115..376348))
                     /locus_tag="CNC01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_569451.2"
                     /db_xref="GeneID:3256401"
     CDS             complement(join(374293..374418,374479..374811,
                     374866..374943,375005..375520,375570..375664,
                     375721..375832,375893..376057,376115..376261))
                     /locus_tag="CNC01340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569451.1"
                     /db_xref="GeneID:3256401"
                     /translation="MSMIQKTPPRLPASFLVEESSETPGPSRARINNLQHQVSELVRK
                     NQTLERKLTAVKSASENDLKEKAAKLNEMQVSLHNTQRELERSKKDLERCVLEGSEMK
                     EELQLHSMVQQQKALLAVAQEQMLVVELETRLLDAEKARILRDHKITLFQAKEEELVR
                     EIEERDIRIEDLEAMLERSNASLEQERNAIRKASSSQLTSSKDLTKAQMELEFARAEI
                     NTLEDKVTSLETKVRGLKDREKEARSELESWLREEGSASKHQKEKKESQIQLRAMKSE
                     LEKKKEEIEELKEELEEAVRSGKEKEKILKKRLRDANEEKERLLGIEEELHGLRAGIS
                     KTSPGNRKIRKESPVKEGSGDEVTTKKKAKKAETAVSPSKLSSKARAKTKASVDSSSE
                     LDDSAPAPIKKSKAARKSPIKSKPKSIAVEVSDAENEVDSLKTRSSKNEVVEHKPMEK
                     EEQAASANEKKKKKRILGTQPPPTFNWDPVMNSGDGVIPAYLSPLKPDSVRATGTIPR
                     AGFPSLPSSRLNRFG"
     gene            378309..379340
                     /locus_tag="CNC01350"
                     /db_xref="GeneID:3256349"
     mRNA            join(378309..378442,378502..378559,378612..378810,
                     378878..378969,379027..379340)
                     /locus_tag="CNC01350"
                     /product="expressed protein"
                     /transcript_id="XM_569453.1"
                     /db_xref="GeneID:3256349"
     CDS             join(378429..378442,378502..378559,378612..378810,
                     378878..378969,379027..379185)
                     /locus_tag="CNC01350"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569453.1"
                     /db_xref="GeneID:3256349"
                     /translation="MAGSWFRSLKPFLMGLLLVTAYSSFILDIIMIIKVRHYSNTYPP
                     AVVALLVCSLLEALYCLCLLVKSGRGAAFRASAVAGALAFFACFSFACVVATTVLRHH
                     RQYCNPDLEDNSDLCGVLRGTMGLGWMLFGLNLIWLCLMPVLVSGQGTWSHYYNDLPY
                     EERDIEEEKAPVH"
     gene            complement(379303..380841)
                     /locus_tag="CNC01360"
                     /db_xref="GeneID:3256492"
     mRNA            complement(join(379303..379689,379743..379951,
                     379998..380043,380100..380370,380423..380504,
                     380553..380841))
                     /locus_tag="CNC01360"
                     /product="expressed protein"
                     /transcript_id="XM_569960.2"
                     /db_xref="GeneID:3256492"
     CDS             complement(join(379325..379689,379743..379951,
                     379998..380043,380100..380370,380423..380504,
                     380553..380740))
                     /locus_tag="CNC01360"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569960.1"
                     /db_xref="GeneID:3256492"
                     /translation="MIMAEVSSSASATHTKQYKPYFSPANVERLSAKQRGKLSVSREE
                     RARQQACGFIDAVGVRCGFPRRTIATAQTLYMRFHLFFPYKDFSYIEVALATLYVSSK
                     LHDTLKKPRDIILASFPIRFPHLLRKGTIDPSVAQAHGLDSERARILSIERLVLESMA
                     FKFSANDGLRPVIKIGKKLGLNKDFCKICWKVAVDSYRTPAPLSYPPHIIALGSIYTA
                     ALLTMESLSLETAEIMDQTRTPRGIVELLGNTGSWEEDYVAGVTHVDEVVHALLDLYH
                     TVLSNPENQALQAPSPVSPKEPLGSTAATSALSSSGTTAFPLSAFWTPQTLTKLKISL
                     RERRGGLTAMPGWATEDTGETDEVAEGMGKNDVTIRFLWDEDLMACARECSH"
     gene            380964..382662
                     /locus_tag="CNC01370"
                     /db_xref="GeneID:3256480"
     mRNA            join(380964..381181,381232..381404,381457..381512,
                     381566..381720,381769..382662)
                     /locus_tag="CNC01370"
                     /product="pseudouridylate synthase 4, putative"
                     /transcript_id="XM_569456.2"
                     /db_xref="GeneID:3256480"
     CDS             join(381105..381181,381232..381404,381457..381512,
                     381566..381720,381769..382639)
                     /locus_tag="CNC01370"
                     /codon_start=1
                     /product="pseudouridylate synthase 4, putative"
                     /protein_id="XP_569456.1"
                     /db_xref="GeneID:3256480"
                     /translation="MPKALPTPTLPLNGLFPIAKPSGKSSMRVIDRITPLLLDSKLFD
                     DPVKRAQPQMKGKRKKNLTQFGLKIGQGGTLDPLADGVLVLGVNRGTKHLNQFLECSK
                     EYESIGLIGATTTSMDADDPVLSTAPWEHITREDVEKVLDRFRGEIMQVPPIFSALKM
                     DGKPLYEYARESKPLPRPIPARKCQVSIELIDFTPASVTPGDGGHDYHWPEKRLTSEE
                     KETFRRLTEIVHNAQTGPVETAKTSGNKDQVEEEKLRVVEPLVPDLDAPEYPEISPNN
                     GLRPPTFTVRMTVSSGTYVRSIVNDIGLALGCGAHVVKLTRTRQGEFSLYGDEKALST
                     ASASAPAEGEEASVNEDRREAPGPSGGSIPWTVWERALAERDEMIKREKLEKEEAIMA
                     GMSAEEIHQVYNPEAIKQRRWEGGWKEWEVEVLKRFKPVPVPINGGHGFRI"
     gene            complement(382506..383830)
                     /locus_tag="CNC01375"
                     /db_xref="GeneID:36392775"
     mRNA            complement(join(382506..382993,383051..383346,
                     383407..383496,383562..383602,383663..383830))
                     /locus_tag="CNC01375"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658926.1"
                     /db_xref="GeneID:36392775"
     CDS             complement(join(382658..382993,383051..383346,
                     383407..383496,383562..383602,383663..383742))
                     /locus_tag="CNC01375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514265.1"
                     /db_xref="GeneID:36392775"
                     /translation="MALVDYGSSSDDEEGHALQKSASPSKKQKKLPSLPLTFDTAPKD
                     DPSLHQGRKRSRPYVDGEYNTHVYLSLSIPLRLSKILETIIAKLPPSPNPIHALLPSL
                     HISLTRPVPLRRHQIQPFKDELASRLGQICTFKLSLTGSVKAYYNEVTGGGSNRVFLA
                     LRVGAGVSELKKIVDVVLDPTLKKIHLPTYHDNPEFHTSFAWTLFSTKTNDQDTSRGN
                     LSAFGDRSEETPGLPFGEEDLDRVNSIFESEVLKAQPAGGWTISSVEVKVAKEIATIP
                     LKLA"
     gene            383897..385668
                     /locus_tag="CNC01380"
                     /db_xref="GeneID:3256555"
     mRNA            join(383897..384023,384086..384632,384685..384820,
                     384886..384975,385041..385230,385302..385668)
                     /locus_tag="CNC01380"
                     /product="expressed protein"
                     /transcript_id="XM_569459.2"
                     /db_xref="GeneID:3256555"
     CDS             join(383920..384023,384086..384632,384685..384820,
                     384886..384975,385041..385230,385302..385566)
                     /locus_tag="CNC01380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569459.1"
                     /db_xref="GeneID:3256555"
                     /translation="MYWYISFLRPPPVSTSNTDQRITITPQVANDLRTELRYEPTTIY
                     YTWQRVIPSISIATTLQELTTFIPPGSTYKPLDVPLPKNVQVGESWRLGLFSHNENPH
                     SSNGLLSGEERKWKLEPTNELLDLIDDTPDVLGVWSEGIEIARAVSGLNSGTIRGLGR
                     QKEPSIDKGKSKGKSKGKEKEKERDDRPKQGRIMREWALPEEGTLRIIEQTSFDLDKK
                     VWDSGLALSAWFWKHLANEGSLPLTGQKIFTLLKRQEKLRIVELGTGTGLVSIVLSLA
                     LKRIASLERKITATDLESAIPLMDENIALNNLNSQMNHISTDHENEQGEQSKGTLVDA
                     RVLDWDQPIPAWVNNDHPELVIAADVTYNTSAFPSLLSTLTSLLLPSASSASLPNRPL
                     LVLAYKERDPAERELWGMLKEKGIDMVMVDEIKGAEDYGSTEIWIGGSSLS"
     gene            complement(385643..388651)
                     /locus_tag="CNC01390"
                     /db_xref="GeneID:3256832"
     mRNA            complement(join(385643..386235,386288..386453,
                     386520..386626,386681..386798,386853..387298,
                     387347..387431,387480..387743,387791..387927,
                     387983..388018,388078..388651))
                     /locus_tag="CNC01390"
                     /product="transcription coactivator, putative"
                     /transcript_id="XM_024656691.1"
                     /db_xref="GeneID:3256832"
     CDS             complement(join(385793..386235,386288..386453,
                     386520..386626,386681..386798,386853..387298,
                     387347..387431,387480..387743,387791..387927,
                     387983..388018,388078..388135))
                     /locus_tag="CNC01390"
                     /codon_start=1
                     /product="transcription coactivator, putative"
                     /protein_id="XP_024512370.1"
                     /db_xref="GeneID:3256832"
                     /translation="MTVTQRKPRVDNAQNDSRPIIEPGIKYTCDFCHVDITHTVRIKC
                     AMKQCEEVDLCPTCFCEGKEGLQHKAWHDYMVVEQNSQPIFTPDWGADEELLLISGLI
                     QNGLGNWAEVAQHVGTRTKEECEQHYLQVYLGVGEHGEDLRVKEKEADEKVDESKRRR
                     REFMPPMDRSFPYDPDEFQQRKKARIEELRKPQALPPSNAAPPVSAPTNHEIGGFMPA
                     RLEFEHEVDNDAEMAVKDMEFGLVMQYGGDEQPQAKITRPPDEEEEEDEEGGGEDEKG
                     VEKKGKVKKEKQKEDEKEDKPVSPAIEDPDELEVKLAMMDIYFSKLDKREDAKEIIFD
                     RGLTEYRAIQAQDKKLTKEERELVQRYKPFAKLQTAEDFEVLVEGLIYEQTLRRRIAE
                     LQEYRRMGITTAAEADVYDNVKNTRSMEFPTQKPAEVLPSGARINAGQHRFLHGTMAT
                     PLPDAKTREPTPRAIPAVGRKPPQPLNLANSASLDLLSSEEQSLCSTLRVLPKPYLTI
                     KELYIRENERRQGLLRRRDARKMLNIDVNKSGRIFDFLVQSGMLVLAYEPQGKGKASL
                     QAAAAAVAHGAANGMTTMDGQSQGKDMLMERVNGLGMTNGLNKPITHEIRLNG"
     gene            388906..390478
                     /locus_tag="CNC01400"
                     /db_xref="GeneID:3256334"
     mRNA            join(388906..389285,389332..390478)
                     /locus_tag="CNC01400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569463.2"
                     /db_xref="GeneID:3256334"
     CDS             join(388979..389285,389332..390437)
                     /locus_tag="CNC01400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569463.1"
                     /db_xref="GeneID:3256334"
                     /translation="MRTSLIRNMSKSYDSIILGAGWAGSVAAKELTSKGHRVLVLEAR
                     DRVGGRARTWTGGGAKIDIGCSWIHGYKEGNPARDIAKSLGVEARLPAAAEGVIYGPN
                     GPLSAEEADALRASLGTAVASSKLPHPSPPPTTSLASALFSPNSALLSTASDQSLAKA
                     LARSLEIPLGLKLEQASLKWAGWETTTSYAGSDAAPDGGYQSLVTKVLESSKAEVKLN
                     SPAVSIKETSSGVEVTTQSGETYSAASVLSTIPLGVLKSLPENFFTPALPAHLRETIG
                     GTHVGVLEKLLVQYPTAWWPNAEKVGSYTFLPTGPEPSASSTLEQVFEGSTLITANFA
                     APTLPGPTPTLLTYLSETPAKILLQHPTEKVAEAFHSFLVKRFSPSSRPPAPSASALT
                     TWLTDPLSRGATTTPSIISTGERSPMDFKELSRPVWGGKLGFAGEHTEMDNRGSVAGA
                     VISGFREADRIDKWLAARKE"
     gene            complement(390533..391173)
                     /locus_tag="CNC01410"
                     /db_xref="GeneID:3256469"
     mRNA            complement(join(390533..390724,390788..390887,
                     390956..391173))
                     /locus_tag="CNC01410"
                     /product="ribosomal protein S20, putative"
                     /transcript_id="XM_569465.2"
                     /db_xref="GeneID:3256469"
     CDS             complement(join(390571..390724,390788..390887,
                     390956..391061))
                     /locus_tag="CNC01410"
                     /codon_start=1
                     /product="ribosomal protein S20, putative"
                     /protein_id="XP_569465.1"
                     /db_xref="GeneID:3256469"
                     /translation="MAEYKEDLEKTGAGAQKIHKIRITLTSKNVKPLEKFCADLINRA
                     KDRDLNVRGPVRLPTKVLKHTTRKSPCGEGSKTWDRYQMRIHKRLIDLNSSADVVKQI
                     TSISLEPGVEVEVTIAA"
     gene            391332..392136
                     /locus_tag="CNC01420"
                     /db_xref="GeneID:3256211"
     mRNA            join(391332..391418,391498..391637,391714..391797,
                     391877..391954,392038..392136)
                     /locus_tag="CNC01420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569469.2"
                     /db_xref="GeneID:3256211"
     CDS             join(391376..391418,391498..391637,391714..391797,
                     391877..391954,392038..392067)
                     /locus_tag="CNC01420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569469.1"
                     /db_xref="GeneID:3256211"
                     /translation="MVRLITHNMLACHVKNCTKDNFPLVFSEVELVERPAPINPDFIK
                     RFLPKLDWKALVDTARSLGDTSLPDTMPENWTDEEIQALHHVLFELHVEEGIMTCRGC
                     GHAYPVANGIPNMLLAEHEVGR"
     gene            complement(391895..394639)
                     /locus_tag="CNC01430"
                     /db_xref="GeneID:3256507"
     mRNA            complement(join(391895..393405,393457..393577,
                     393624..393969,394019..394123,394172..394240,
                     394290..394639))
                     /locus_tag="CNC01430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569471.2"
                     /db_xref="GeneID:3256507"
     CDS             complement(join(392154..393405,393457..393577,
                     393624..393969,394019..394123,394172..394240,
                     394290..394535))
                     /locus_tag="CNC01430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569471.1"
                     /db_xref="GeneID:3256507"
                     /translation="MTAPTVPADQHGHPLPGPADPAANDTWRPSRYREPLHPDNEEVL
                     EQAAYQAAVTRSSGDDRKRKIKPRRTVDYQGGVQKWRMLNKLKGVHEFRPAIHPNPSD
                     IVNFLPPVALRSNPSTSICDYWVHTSINKERSPTRVVRWTPDARRLLTGNDKGQFTLW
                     NGASFNYESITQVHDDSIRSFTYSHNGQALVSADKGGTIKYFTPHLTNIHGFQGHREA
                     CHDVSWSPNDERFVTCGDDGLVKIWSYREAKEERSLSGHGWDVRCVDWHPTKGLIVSG
                     SKDMLVKFWDPRTGKDLSTLHSSKSTINTCRWSPDGHLVATAGQDSVIRLFDIRTFRE
                     LEVLKGHEKEVNCIEWHPIHHSLLVSGDALGTINYFSLLSPTPSTPITTLSAAHEDAV
                     FSLSFHPLGHILCSGSKDFTARFWCRARPPGGQEFDKWHLTEEGAAQKELERITKREW
                     GTNAPPANAAGGGGGGGGDKQQVALPGLSNLVAAVNSVKTGPTTTGGGPSGLPGLGAP
                     NVHAGTPPSRVSTPSSMGPPGPGAQGQAQGGQFPRGRSALPSQNDMLRHNHGSRGGFA
                     DRDRNGGGDRGGMDRDRDSRGGRQDPRGNQMYGRGPGGPPPGPPPGQGGYNYPPAPPN
                     YPPYPPSSYPPPPNNQPGYPPAPNYAMPPGPGAPPQSYPYNRPPQGPPQNNNPGGQGN
                     YGASASGGYGQYGGGGGGGGGGGYGRDGRR"
     STS             392775..392948
                     /standard_name="GGC5"
                     /db_xref="UniSTS:470778"
     gene            394770..397498
                     /locus_tag="CNC01440"
                     /db_xref="GeneID:3256695"
     mRNA            join(394770..395925,395990..396193,396267..396364,
                     396453..396643,396709..396888,396942..397105,
                     397181..397498)
                     /locus_tag="CNC01440"
                     /product="mRNA (guanine-N7-)-methyltransferase, putative"
                     /transcript_id="XM_024656692.1"
                     /db_xref="GeneID:3256695"
     CDS             join(394935..395925,395990..396193,396267..396364,
                     396453..396643,396709..396888,396942..397105,
                     397181..397215)
                     /locus_tag="CNC01440"
                     /codon_start=1
                     /product="mRNA (guanine-N7-)-methyltransferase, putative"
                     /protein_id="XP_024512374.1"
                     /db_xref="GeneID:3256695"
                     /translation="MLPPQQPIHAELEHGRRTSAGSHAAQLARSPSMSLSPRSQNQSL
                     PYPSSRPGSAAGSAHPFGYDPRQGTLSPVLSARRTSEDQPRPTSSSSASGRRYTEPAS
                     QTPAPAPLGSSAYRPRHTSTPGNPSSAYAPRFTPQPTTTPSSPSTSQHTPYTPHHSAP
                     PRILHYNPHRQSAPSSVLRPIYPDEVAHLRQLAHANNPLRQKPAARRYSYSGGRAPEP
                     TPTPRTSLPGENDHSYFPPQWDDRPSMPPSEVSYGGPPSSTPGAPPSGYSQYPPNWEA
                     QTPGGNWDGERPGRLGKRRARDEEDDEYERNKRVVSGPVAGQAYSKKVTVVAEHYNSR
                     PEVGVERREFSPIIGLKKFNNWIKSVLIGKFAYRPRGKVLDVGCGKGGDLNKWKQARI
                     ALYVGLDVADQSVQQAADRYRRMPKPGFDAFFYAHDCFSNPLSDVLSPELQIKDLYDN
                     VTMQFCMHYAFENAAKARMMIENVSRYLRRGGIFIGTIPNAELLLERLNELPDRDEEL
                     RFGNSCYSIQFTERRHKGVYGHDYRFYLTDAVEDVPEYLVDWENFVSLASESGLRLVY
                     KKAFHEILQEEKDSRDFGPLLGKMGVLNEYGESAMDADQWEAANLYMGFAFEKM"
     gene            complement(397481..399677)
                     /locus_tag="CNC01450"
                     /db_xref="GeneID:3256519"
     mRNA            complement(join(397481..397579,397655..397745,
                     397815..398254,398323..398497,398546..398624,
                     398674..399677))
                     /locus_tag="CNC01450"
                     /product="triacylglycerol lipase, putative"
                     /transcript_id="XM_024656693.1"
                     /db_xref="GeneID:3256519"
     CDS             complement(join(397550..397579,397655..397745,
                     397815..398254,398323..398497,398546..398624,
                     398674..399646))
                     /locus_tag="CNC01450"
                     /codon_start=1
                     /product="triacylglycerol lipase, putative"
                     /protein_id="XP_024512550.1"
                     /db_xref="GeneID:3256519"
                     /translation="MLPRAPRTLYHPTKAMYQPHKVGNSARQTFNSQSRSDIRHHQQP
                     PSTETADGAAKSRRKGKQRADPLLIQPNPGKEREIEGSTSSVPALIDEAIHTSISPTS
                     LSSSLESSFDRACPSPIPEPPRVHYPPSLRPRHPRLLSQLARSTLPTASVSCPSLEQP
                     QHGRRWSVSESMVIGAGEGSSLWQRSVPTTALSDEPFPDLDPTTGLPLELSFHRRGSA
                     SSDTPSLHLQRTITGLLSAPTAKSAGESSVANMMPNFNFSLPRVSFPSKPSLDFGKRN
                     FSTSSSQDDWGSWASGWWSGNKGKVDQMMSEEDKADTVEEEQEKLRKKYRSPKHPVVF
                     CHGLLGFDYLGPASMPPLQISHWRGIREVLESNGVEVLIARVPATSSIKDRARILADF
                     ISEKYPGREINLVGHSMGGLDCRYLVSQIKDKSFKPISLTTISTPHRGSPFADYLIDN
                     VIGRERLPSLLGLLETMRLPQSGDGSAFSALGTNSMKEFNAEVVDSEDVKYYSWGASF
                     EPGLLDTFKWPHSIIYAKEGANDGLVSVHSAMWGEYRGTLVGVNHLDLVGWVNTVRYA
                     VAGWTGKPIAFKPATFYLEVTDYLAEQGF"
     gene            399831..403200
                     /locus_tag="CNC01460"
                     /db_xref="GeneID:3256478"
     mRNA            join(399831..400083,400142..400312,400361..400406,
                     400454..400503,400542..400565,400618..400777,
                     400826..400877,400927..401092,401148..401215,
                     401265..401418,401476..401650,401707..401807,
                     401862..401998,402052..402466,402529..402631,
                     402681..403200)
                     /locus_tag="CNC01460"
                     /product="expressed protein"
                     /transcript_id="XM_024656694.1"
                     /db_xref="GeneID:3256478"
     CDS             join(399883..400083,400142..400312,400361..400406,
                     400454..400503,400542..400565,400618..400777,
                     400826..400877,400927..401092,401148..401215,
                     401265..401418,401476..401650,401707..401807,
                     401862..401998,402052..402466,402529..402631,
                     402681..402979)
                     /locus_tag="CNC01460"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512375.1"
                     /db_xref="GeneID:3256478"
                     /translation="MSSPHKQSKLTSHQCRKLNEPLLPLHLALAWIIIRVFPIDSDLQ
                     SLPVYSLQFTQKVLHIVGREILDVGSEPATFGSLKMELDRLVKAETVQIIRRNEKKRS
                     RGVHIEHEFEDAEKNRSWLGDMCDRFGDIADGCSFIDGLDKELRERLNYGDDDEPIEM
                     PPPIERHSPLGIFCRNLINILRKLSFDETAHLSREVSKWCGVGTSGSSKPVTAWSLDR
                     KSGMEDNLDKRIQAMQDYQAAKSSADYSGALASLREFYDYQFPSVNKGQHQHALLNIA
                     VFHYSTGGLESARSAINEAIRVARTAGDKACLQHCTSLSQRLETEVNSLAFTATETLK
                     IHQTPIPSSRLPDVSTPMDELWAVKTALDLGEPVHIAFRRIHAALGKEYQTEALDDED
                     ERLSPKQWATGQGLEEAAWHATQAGLWNLLGSNALANFHEELALSEVEPWSDGGLTVI
                     LVQAQRIAEKGEYDQALAVLLDIVNLHGLTISQYHTWSRTVWTLLERRATLNGNPDTL
                     SYLSSLQPPKRYSSRFGPGGPLREYGHPKPIPLPMDGCYEEVRNDGKFSTQISLLQDH
                     VRSSLSMATELRLSSAPSHLVLPHVLSAVQLSSELGMWRLYRFGVVVLAEVMLGMEAV
                     PLSKKAIHEIESVWSQLIASDDYEALARGALVIAKGYIELSLDSGSTAEHDSANDHLF
                     QAFTYAKLLESRSLVMEITSLLALLSELRLSGEFADSAYIRGSKKSRDSMVDAYEEAQ
                     KGVGEAFSKGDMIVREVAEVVKWVGVRVAEGWK"
     gene            403433..406169
                     /locus_tag="CNC01470"
                     /db_xref="GeneID:3256187"
     mRNA            join(403433..403507,403563..403655,403708..404036,
                     404092..404361,404415..404887,404934..405350,
                     405398..406169)
                     /locus_tag="CNC01470"
                     /product="GTP-binding protein, putative"
                     /transcript_id="XM_569478.2"
                     /db_xref="GeneID:3256187"
     CDS             join(403505..403507,403563..403655,403708..404036,
                     404092..404361,404415..404887,404934..405350,
                     405398..406044)
                     /locus_tag="CNC01470"
                     /codon_start=1
                     /product="GTP-binding protein, putative"
                     /protein_id="XP_569478.1"
                     /db_xref="GeneID:3256187"
                     /translation="MPPRTKVQSSGLGKALINRKAKEAVAPKESQLYTLDDNNPLASV
                     THERDLDEFLANAALADQDFTTERTKLRVISAPNMPTPSTNPFLLSAEEEKEVTKKKR
                     DFQGDLTVPRRPPWTRQMTRLELEKQERESFLEWRRDIAKLAETSNLLLTPFERNVQL
                     WRQLWRVLERSQLVVQIVDARNPLGFRCQDLENYVKEIGSDENDEEITVAGKGKRRSL
                     LLINKADLLTYDQRSAWAEYFEKEGISYAFFSAANAAAAQEQAEKQRLRQQEEYDGPK
                     GSSEENEEESEEQQDETEDEQDETEEEHLINDLRETHLDEEDWSSESAGRSGNVSRSE
                     VDEKLAEGQTLSLSEVAQDVGARFGESTEQEDVRTRVLTVTELEDLFINAAPDLKDFA
                     TPQHPNPKLMVGLVGYPNVGKSSTINSLLGAKKVSVSATPGKTKHFQTLVLSDTITLC
                     DCPGLVFPQFANTQADMVVDGVLPIDQMREYSAPVDLLCKRIPREILEGTYGIRIDVK
                     DEEEGGTGKVGWEEFLSAYAIARGMTRSSFGMPDTSRAARYVLKDYVNAKLLFAHPPP
                     GIDADDFMSVSRAETIARIEESYENGRKRAPVTHVSKNADTYVQPASAKAKDSLDDET
                     EQGQDQTKRERQSTSRQVKSTAASAPARSGREKASALDSVYFNESGAQPRLVIKGRNQ
                     PGDAQEGGQGFSRTTRYPHQRLLGPDGMPILGAGGRDLGGANGKKHFKRKEGKKRSGK
                     GYD"
     gene            406502..408787
                     /locus_tag="CNC01480"
                     /db_xref="GeneID:3256271"
     mRNA            join(406502..406780,406880..407062,407126..407334,
                     407392..407722,407778..407905,407950..408158,
                     408218..408443,408494..408562,408613..408787)
                     /locus_tag="CNC01480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569480.2"
                     /db_xref="GeneID:3256271"
     CDS             join(406625..406780,406880..407062,407126..407334,
                     407392..407722,407778..407905,407950..408158,
                     408218..408443,408494..408562,408613..408634)
                     /locus_tag="CNC01480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569480.1"
                     /db_xref="GeneID:3256271"
                     /translation="MLRTSGSTNKVLLSRLGCRLMQTQTAGGRAPNLPLPSMVGSKPP
                     RKEREEGNISSVFSSLSGEAEKPLPPRFAELKRTIIGEEANQRRLIAGWERLTKRLRD
                     AAEEIERKQQDNIPQTSYDEFINGGNASLIERIKACGAVIIRGVVDEQTALKWLEDVK
                     AYIAKNPSVKGFPENDKQVFELYWSKSQLAARSHPRSMAIQRALLSLFSHNPSAPVSL
                     HTPVTYADRLRIRHPGDAQFALGPHADGGSVERWEDETYRKVYQRCLEGRWEEFDAWT
                     IGERALANQNMYDGPGSCGVFRAFQGWTSMSDTGPNEGTLRVYPLIKELTAYTMMRPL
                     FREKQPRATLSRDEYLSPANWELDFETSRFPNSPLARCQEYNDETHPHLELERTMVSV
                     PRVKPGDQAWWHGDMIHSVESMHQGQGPSAVLYIPAVPLTPQNADYVRDQRSQFMQGR
                     PAPDFPGGVGESSFAGRGTQEDIESHDGRQAMGLEPFEINERLAPGERQVRQQANEIL
                     GF"
     STS             406711..407325
                     /locus_tag="CNC01480"
                     /standard_name="Sac3"
                     /db_xref="UniSTS:470779"
     gene            complement(408610..409664)
                     /locus_tag="CNC01490"
                     /db_xref="GeneID:3256253"
     mRNA            complement(join(408610..408900,408957..408979,
                     409040..409190,409244..409315,409373..409549,
                     409609..409664))
                     /locus_tag="CNC01490"
                     /product="cyclophilin-like peptidyl prolyl cis-trans
                     isomerase, putative"
                     /transcript_id="XM_024656695.1"
                     /db_xref="GeneID:3256253"
     CDS             complement(join(408709..408900,408957..408979,
                     409040..409190,409244..409315,409373..409459))
                     /locus_tag="CNC01490"
                     /codon_start=1
                     /product="cyclophilin-like peptidyl prolyl cis-trans
                     isomerase, putative"
                     /protein_id="XP_024512377.1"
                     /db_xref="GeneID:3256253"
                     /translation="MSGPSPTYVTFDTSVGSFTVELYTAHAPKTCNNFAKLAERGYYN
                     GVIFHRIIPNFMIQGGDPTGTGRGGTSIYGDRFADEIHPELRFVGAGILAMANSGPNT
                     NGSQFFITCAPTPYLDGKHTIFGRVSSGMKTIQRLEAVRTDKDDRPVEEIKIHRARLG
                     DATQGGGLAVAMPA"
     gene            409843..412017
                     /locus_tag="CNC01500"
                     /db_xref="GeneID:3256587"
     mRNA            join(409843..409937,409991..410033,410091..410249,
                     410302..410418,410475..410562,410618..410699,
                     410755..410838,410898..411144,411194..411211,
                     411278..411409,411465..411510,411561..411629,
                     411681..411804,411859..412017)
                     /locus_tag="CNC01500"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_569484.2"
                     /db_xref="GeneID:3256587"
     CDS             join(409884..409937,409991..410033,410091..410249,
                     410302..410418,410475..410562,410618..410699,
                     410755..410838,410898..411144,411194..411211,
                     411278..411409,411465..411510,411561..411629,
                     411681..411804,411859..411864)
                     /locus_tag="CNC01500"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_569484.1"
                     /db_xref="GeneID:3256587"
                     /translation="MGRNGMFGSFQGFDAFGKTMEDVKIKTRTGALLTFISLSIILTS
                     VMLEFIDYRRIHMEPSIIVDRSRGEKLVIDFDIEFPRVPCYLLSLDVMDISGEHQTEF
                     EHQVTKTRMNKDGNVISKVQGGQLKGDVERANLNQDPNYCGSCYGALPPESGCCNSCE
                     EVRQAYGRKGWSFSDPEGIEQCVEEGWMDKMKEQNEEGCRIDGHIRVNKVIGNLHFSP
                     GRSFQNNMMQMLELVPYLRDKNHHDFGHIVHKFRFGADMTKAEELTVLPKEQRWRDKL
                     GLRDPLQGIKAHTEVSNYMFQYFLKVVSTNFISLSGEEISSHQYSVTQYERDLRTGNA
                     PGKDAHGHMTSHGMMGVPGVFFNYEISPMKVIHTEERQSFAHFLTSTCAIVGGVLTVA
                     SLVDSLIFNSSKRLKKKSEDSFRGPSGKIL"
     gene            complement(411908..413003)
                     /locus_tag="CNC01510"
                     /db_xref="GeneID:3256611"
     mRNA            complement(join(411908..412082,412133..412281,
                     412341..412595,412645..412733,412783..412824,
                     412871..413003))
                     /locus_tag="CNC01510"
                     /product="mitotic spindle checkpoint-related protein,
                     putative"
                     /transcript_id="XM_569486.2"
                     /db_xref="GeneID:3256611"
     CDS             complement(join(412053..412082,412133..412281,
                     412341..412595,412645..412733,412783..412824,
                     412871..412965))
                     /locus_tag="CNC01510"
                     /codon_start=1
                     /product="mitotic spindle checkpoint-related protein,
                     putative"
                     /protein_id="XP_569486.1"
                     /db_xref="GeneID:3256611"
                     /translation="MAQKQATRTNQAITLKGSTALVTEFFEYSVNSILYQRGVYPSDD
                     FRMVKKYGLPMLVTADEELKEYISTVLNQVQEWLLSSSLSRIVLAIKSVETGETLERW
                     QFDIYTDESALAPLPGGPPKSAGSKKKEKTEKEVQGEIREIMKQITSSVTFLPILEEQ
                     CTFTILAHTNDSPDVAIPATWNDADPHLIDKGKVEQVRLRSFSTNVHSLEAMVAYRVG
                     E"
     gene            413167..416092
                     /locus_tag="CNC01520"
                     /db_xref="GeneID:3256371"
     mRNA            join(413167..413546,413603..414156,414206..414827,
                     414877..415020,415076..415375,415440..416092)
                     /locus_tag="CNC01520"
                     /product="elongation factor g 1, mitochondrial precursor
                     (mef-g-1), putative"
                     /transcript_id="XM_569488.2"
                     /db_xref="GeneID:3256371"
     CDS             join(413196..413546,413603..414156,414206..414827,
                     414877..415020,415076..415375,415440..415904)
                     /locus_tag="CNC01520"
                     /codon_start=1
                     /product="elongation factor g 1, mitochondrial precursor
                     (mef-g-1), putative"
                     /protein_id="XP_569488.1"
                     /db_xref="GeneID:3256371"
                     /translation="MSAIARAAARVRQQNTTPLQRPLLLQRKPVLTHTLALHASPLKP
                     SLATSITSPNFQQSFQRRWASASATAEEGAKEEVWPQRKLPELTETDKLRLRRQRNVG
                     ISAHIDSGKTTLTERVLYYTGRIRDIHEVRGRDAVGAKMDSMELEREKGITIQSAATF
                     ADWVAPKPPTELKEGETVGNTDKQKFAINIIDTPGHVDFTIEVERALRVLDGAVLVLC
                     AVSGVQSQTITVDRQMRRYNVPRLAFINKMDRAGSNPFRVIGQLRGKLKMNAAAVQVP
                     IGSESDFAGVVDIVRMKAIYNEGVKGNQIVETDEIPESVRALAEEKRAELIEQLSEAD
                     ETLCDLFLDEAPITPTDIAQALQRATTSLRFTPVFMGSAIKNTGVQPLLDGVCAYLPN
                     PSEVQNQAMDATLPAHAPTIPLVPATDAPLVGLAFKLEEGRYGQLTYMRVYQGELKRG
                     SMIYNARTGKRVKVPRLVRMHADEMEDVDAVVAGEICAMFGVECSSGDTFTDGSSTYT
                     MTSMFVPEPVISLSIRPEGNETPNFSRALNRFQKEDPTFRVHVDSESQETIISGMGEL
                     HLDIYVERMKREYNVACVTGKPRVAFRETITEAAKFNYTHKKQSGGSGQFGRVIGSIE
                     PMETDPDTGKDTAFENRIIGGNIPNQFIPAIQKGFQEALDRGLITGHPITGCKFVLDD
                     GSAHAVDSNELAFRLAAIGAFREAFNKARPVVLEPVMTVEIVAPIEFQGNVIGAINQR
                     KGTIVDTEVRDDEFTLTAEVALNDMFGYSSQLRGMTQGKGEFSMEYKNHQPVLPNIQK
                     EMAEAFRKKQLSK"
     gene            complement(416064..426670)
                     /locus_tag="CNC01530"
                     /db_xref="GeneID:3256564"
     mRNA            complement(join(416064..416236,416290..416729,
                     416784..417414,417468..418459,418507..419071,
                     419122..420387,420437..422479,422533..422653,
                     422707..422760,422819..423172,423220..423691,
                     423749..424194,424239..424515,424553..424762,
                     424801..424960,425002..425143,425183..425812,
                     425853..426113,426164..426670))
                     /locus_tag="CNC01530"
                     /product="fermentation-related protein, putative"
                     /transcript_id="XM_024656696.1"
                     /db_xref="GeneID:3256564"
     CDS             complement(join(416182..416236,416290..416729,
                     416784..417414,417468..418459,418507..419071,
                     419122..420387,420437..422479,422533..422653,
                     422707..422760,422819..423172,423220..423691,
                     423749..424194,424239..424515,424553..424762,
                     424801..424960,425002..425143,425183..425812,
                     425853..426113,426164..426488))
                     /locus_tag="CNC01530"
                     /codon_start=1
                     /product="fermentation-related protein, putative"
                     /protein_id="XP_024512378.1"
                     /db_xref="GeneID:3256564"
                     /translation="MAVPVNLLLLIELAAVIVASTAFLFYWNRLLASFVAFLIRLYAW
                     RVHHAYISIGSLQISPLAGRLSFRNAEYHSSNISIRALTGHITWRYWKIRVRQEADSQ
                     SNNSRRSKLPCRIIVYAKGVEAFVYNRTPAYDDIVERMKKHENEAGGVKGASHGYGDF
                     EEELGLRARLKNLARMSTKDSSAKGTPSDNGHSSSSYPPVTHELPAQVKPVKPPPSDS
                     INWFREALPLELRVVAGSIVLGNDATPTLLIGDFKRAEGILETSDSRSLLDLYKMAVE
                     LKFHEANVLTRTNVDYSGPLLAHGKKVYDELLKQQVDLVNKPPSTISVFSGFHFLSRQ
                     FPFLYDPKFSTAPVPGLPTDKLWKGLARYRLPEDDTIQSPRKEGGDEREYAKATNLLE
                     APELTLTYYADIPGNVPDPLQTPYGDILDEIGNVDLPPEYGIDIIIRKGTVKYGPWAD
                     RQREALQKAFAPALFFDSEPKARLRPGDTRVHTALVLRVMLEDETVLRIPTRESSKDW
                     QYDNSPANAERRYGWLDVVVGPNSSVTYTQDQIATQRGYDSMLVLHLDSLGISSSVNL
                     DTFIQAKTCKLSMAMPTPLQWNAKRDWGMDVVFDTPSISLLRDHVTLISDLAKDWSSG
                     TTGGDYHHFVPNHYNFRVSLINYAFHLYINDYNIVDAPGSRDSNAFMDVYGPRLDAVV
                     AVASTQYRPEASVVPFSISLSDARVELCVPKWDTHRTFGPEVLEVGQVGQLIASGSYR
                     YYAVPRPEHQETLTLHLEGKHVKFKMLGWVLRRLFCVKDNYFGSFTQFTTMDEFLERF
                     DHDPASVGDPVEEKYRPGRSDPYAVHITMNVEESLILMCDEIYNFSGGIALPVPQLQM
                     TIKSVEQFMELSLNATPTYIAAAPQLLPLYERGSAPVVSGEEAIFIEGIELKASRLFG
                     PKPRATTYLCLWEANIPKISAFLTPSLLTTLQAIGRSVGYTFSDPDNAPDQNYQLKTP
                     PDVTFFKFSINHALAMLTADSSAISLEALSGLTLDTSTWGTRSYSSNIGLLLPSFTIN
                     IVHRSPRKTWRVVSSAAVGATLDVYNAPDRWRERVSAQQEFLKEQDSETGRVWYMYRG
                     GQKPTGHHVNNLYLPMPMEEKTVEMIDEEESESLLSERHGYDSNDSQPSSSIESGPEE
                     SNPSKTWGKRNPVKPFMTIQETDDSSVSSAGDESDSASGTSSDSASEVSFPAEYVFDM
                     ADVLANKLRHFQFARDRYPPEIRLSASDSDYGGGEEEIKGKRKARDEMASGKVVRLVT
                     HAAQVNLHPESLQSISEIVSAISTGSVSYEKRLDSLLISQVQDVADSKIPEQQMVLDI
                     HVPSATMRLSGGEPSSALISHIQHIRCNIHRYTLINQRPVLDLIFSVVSITASAMSSS
                     DTASSLKDIVGPTTESPEYLPLAHFVASAITAGFHSGHGIRIHSKVSHAHFDTVTPAI
                     TFGSAFAERWQAVIQEANFSHPKTGSDAAMLCHILYSAINSQRGAYLPSFAYVTPHGL
                     HEQDSQLGNRRQTGWWLLTRFRDWLRGGLLDEADVVANISDMANYFVSNLIQVDDSLV
                     GTENLVRDQPFFKRAFNIGSSCTPETECDTPIDVFVYIDNASVRHYGRLLGSTATAMS
                     YINISKLSFGCATVIAMIEERKISQMRMVVAIQTVGLEVHDSILTLARLIVHIPCKPK
                     PEFGKGESPGESLPSFNAIGKSPSAIAINIQLETLDATIIGGGLRLRSGARQLQLTAL
                     TRHRLHSNPVSGRSTRESLSLTCRLIEIILIQPVENPAAITHSTDRVVISLKTQGWRA
                     SGERIASVDKPSTEIRAMAGLKLLEFDSRPQLRAFYSFIQQWKAKELPLYASAVDDMK
                     GAIKAWTNGPPSKSTPVLLTDLDITIEALHFQVRAAKALWLRWEVGKIYVVKSEKKKD
                     IRFAVKVAPQVVGAYYSRRSKSSESSSLNLPSVAIIGNHRHLQDKPHVFANLQLGLFS
                     GVLRPAILDRLLSLHQNLQDDINHLVNDWRKDVRKAKEKLHAQKGWRSPSPGARKVSL
                     NKILYDVHVRVDGVRFGLRADDVPATIVFEALAAKGRATNQYHHGNGLHWRAKVDHFS
                     LSLGHLDDGYVSNDTEPFRRQRTASMTLDVEVEEIPATPLLTSQLIIHLSHVRTVMHV
                     EALSELTDLLKSWSSDLYILRDHRAREMAEVKQRTTKVLKRFESAEHVNRSEISWLAN
                     RLLTVEIGGIGVAIPLVEGAVIEDCRKSDVPALLYSIRVISFHNRHNEAARFRLQNMA
                     LQFIDRFDQSLPEHFTSDFHGSKNCMVVPSIESEAEMSSTHEAWHLSAHCSASDFKLT
                     LSPDISDDVIQLVELFERGKEKIAKVEAQYKVEVAGHAKETIASKYESPASPSARRQS
                     QRIMVRTSFTFNSGTVELHRDLSDTEKATLSSETRRGRGWHDTVVLPAVSLWMEYTGP
                     KDEVPLFPQDEGDGSLLFNLAVHESRNLLRPTILPFFLQIANRLGRKAKRTQSTPLDT
                     SPKMPMEVSPAVPQGLSRRPITRTVSTRVQVSVTLRIDKSELRLSCAPDSNAYVDLKW
                     KSGGFFASTIIGDGSKATVAGTVSGVRAYLRHEFAEGKSCIEAGAKDMAFSIDYSFES
                     LTGRKYLSIVLDSLLSAQFRLEQFSAWLAFAAVWLDNAPNLELPSRPPLGEASSSSPS
                     IHTASIPKVTVSALVRFRTVDFDTNIGVTNAKLEMTPVVLRTSSNGVKAELELDLGVT
                     QITAKGDISGEIRSESLIFRTARQSSRGGAPDDPTVLNMSINAGTLSSNLSLQELSVI
                     RFTLDPATVTLADDWQAFAQDPSSQVLLSFAVKAGVFRSVIRLLSIPSLVSKFYSLSN
                     TIESQERMACHRSSAYKSKRLRKSTEPSPMAAAILHTARKTGQTLTSTSTVKTAQNMR
                     FDLGGVDIGLFNSPPTDDHRGDFYRFTMGKVEADLERQLTAENLPKRDLNLLVSYVKW
                     VSSDGVKAAREVKKHRNLEESIQAASAHGRKEIASLPLMTMTMDSIEESKPPVLVYDF
                     DLVWGDGDLDIAIMPYFFEQVYKTFDKLIKGLDQEQITKAKRRGDGGTAKDRSHATSH
                     EKDQECIGAALAFRRRLEGQRPLPVPRLRLLGEATGEAMAWVPKINAANAQLPIMVHR
                     FVTSPLEDGMDLLLKLYEKQLPDRVQQQM"
     gene            426880..431062
                     /locus_tag="CNC01540"
                     /db_xref="GeneID:3256585"
     mRNA            join(426880..427290,427340..427744,427796..427888,
                     427936..428101,428151..428547,428598..429075,
                     429128..429424,429474..429834,429890..431062)
                     /locus_tag="CNC01540"
                     /product="DNA-directed DNA polymerase, putative"
                     /transcript_id="XM_569492.2"
                     /db_xref="GeneID:3256585"
     CDS             join(426904..427290,427340..427744,427796..427888,
                     427936..428101,428151..428547,428598..429075,
                     429128..429424,429474..429834,429890..430818)
                     /locus_tag="CNC01540"
                     /codon_start=1
                     /product="DNA-directed DNA polymerase, putative"
                     /protein_id="XP_569492.1"
                     /db_xref="GeneID:3256585"
                     /translation="MTSNVLPLFWPLSNLSKETRLTASANLVSSLESFQRSFSQNAGS
                     SKGKEIEDDDEDEESASDSEESGMEVDASDDEEENDEKHSQAAKLDRQLSKDNAEDVV
                     YSVKRLVRGLGSSRESSRLGFAVALTELLSRIPTVTARQVFSLVIRNSQYSKNMKGSD
                     ERDMMFARLFGMTAIVQSQSLFAPSATKDDFRGVIEELEKLGQAKAWMRESAWWALVQ
                     SVLLLLESRVQWKEDALREVIDVVFEEKGWTQEKVALVLTLEQSGLDIDWKTHLAPTF
                     KHTPLLNTHNLVTLSRILKETSGDEEDGVSATITGSWKPQLHFVWNIILDRYFGPSAL
                     STTLASFQDFFRVVVDESLFSNTSSPQRRYWGFQVFERALPLLPSSQMPLIFTPNFMR
                     CWMNNLSSPDRYLHKAAQQIAKKVQDIIKENPKVGYTLLSQLVGKHGRPDFDKVTKTK
                     TVESIMGKLNEKGVRDFVDFLKETILGASSHENLDAARLAERRSWALDQIQALCRNGS
                     VPKDDAWVAPLFDFLLVHGFFIIRSVNKKSPITAIHTVPKPPLSENTSIACRAKFFAC
                     AVELTTASIPRKNGSEDSKARQQGCDASGRLWLRRAIDIISILVDDKKHVEVIADADE
                     EIKSIRNAALESLSSLDKVKEDRKSISRAFEILISFFILQTYDEVEDSLENLEEVNTA
                     AQQYLGQKEEEETQAADMLLDVLIALLDKGSSDLRNLANLVFDIISPELTKSSLNLLS
                     AQLEQSAAEAAANESAEESDEDADGDDAASDSDGGEANEEDEDEEEDEEHDEDLGDVD
                     PAFRQRVAEALKVSGMDAGEDVEEGSEAESEEYWDDDQMMKVDEQLAQVFRERAAAAS
                     KNDMKHILTESIHFKNRILDFYDTYAKRQPTNPLIIDVILTLLKLIRSGGVSEAEVTN
                     KAAGILRSKFNKPKDVPSTVNIEAASESLKTIHSMAQKAHSAEFSTLCSLCSLFVSRA
                     IDASGISSNSATSTVVEIYRATLKDFIIRKASLVHPPFLLEFVKRFPVRAFSLYHDLV
                     SYVAPGAAVNAFRQLQAYNALQILAQHLPVISKSVSPTEVIKFVQEASESVFTTLETA
                     AEANSDSKDALNAQKLKDVVKFALQLARNSKNVGISWDIRRVSEVGETLKHGRRTKEM
                     KGVHSMWIQLEAILSNKKGEKRKR"
     gene            complement(431349..436718)
                     /locus_tag="CNC01550"
                     /db_xref="GeneID:3256655"
     mRNA            complement(join(431349..431678,431731..431809,
                     431863..432032,432073..432196,432247..432257,
                     432319..432401,432457..432482,432536..432632,
                     432698..432929,432981..433025,433083..433147,
                     433208..433309,433368..433746,433799..433864,
                     433920..433929,433980..434032,434087..434136,
                     434186..434232,434280..434360,434413..434663,
                     434712..434838,434889..435103,435157..435282,
                     435344..435409,435463..435491,435542..435563,
                     435609..435624,435674..436434,436506..436541,
                     436612..436718))
                     /locus_tag="CNC01550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656697.1"
                     /db_xref="GeneID:3256655"
     CDS             complement(join(431459..431678,431731..431809,
                     431863..432032,432073..432196,432247..432257,
                     432319..432401,432457..432482,432536..432632,
                     432698..432929,432981..433025,433083..433147,
                     433208..433309,433368..433746,433799..433864,
                     433920..433929,433980..434032,434087..434136,
                     434186..434232,434280..434360,434413..434663,
                     434712..434838,434889..435103,435157..435282,
                     435344..435409,435463..435491,435542..435563,
                     435609..435624,435674..436434,436506..436528))
                     /locus_tag="CNC01550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512380.1"
                     /db_xref="GeneID:3256655"
                     /translation="MPSEGSQQPSLDSFFKRKNPRVEPYSRTGNNAIIDLTDSPPNKK
                     IKLDDEGSQKNRSMTQTSSSYFKGHPTARPLSVDKRLPRKPSAAIQAYKLQDVIPPQP
                     SHSGLAFETCSLVPQASFVPDSQPEPSASPAPQRTTEQLKRHEEWKTRILAMSGSFRR
                     KRSLALDEAVAAEAREAAGLEDEGTPFDGSDGDDYKSESEKNAEEVGKQLKKYVAKEL
                     AGKGKSKGKKKEEIGPSGLAYTPLEKQFMEIKEQNRDVLLLMEVGYKYKFHGEDAKTA
                     SRELGIVAFPNRNFFTASIPTHRLHIHVKKLLSLGYKVGVITQTETAALKKIGDNRNA
                     PFARKLTHLFTAATYVEDPSLSSSSSSSSSVRFDDPVVPGTAPPPTNALVAIVEQPVD
                     RASDDRVKVGLVCVVPGTGDITWDEFDDSQIRTELETRLAHLSPAELLLPKQRLSKAT
                     EKVLTYFAGEPKHRGRNAVRIERIDNIPEYDAAFDFLTNFYHCKEHKATVSKGDVNDE
                     RHLMTEGNKQWSLQPKLSQDGADISLDEEIYLASGVSSSKAILTLVDFPKQVVISMAV
                     AIRYMKRFGLENAFKHTSSFVRFANRSHMLLSSNTLANLEIYQNQTDGGLYGSLIWLL
                     DHCKTRMGKRLLREWVGRPLLDVAALKARADAIEEIMENNSYHMEKLRSLLINMPDLV
                     RGLTRVQYGKATPNELATLLITLVRLASEFKPNMGNVFRSCLLNNIPNTLPTILDTSQ
                     RFLNALNLKQARENDVANLWADPDRFPDIQDVKDCISVCEMELNEHLMELRKILKKPT
                     LRYITVSGIEYLVEVPIRDTKIVPAQWMKISATRTVNRYHTPKILAITKERTQHLEKL
                     SIVAREAFIAFQSEVAEYHELVVVSKQIAVIDCLMSLAQTAAASGYCKPKFVAEPELK
                     ILAGRHPMVEMLREESYVPFDIHFSKEEGTTKIITGPNMAGKSSTVRAMALIVCMAQI
                     GSFVPAASVTLSVHDSVQTRMGASDEIGRGKSTFMVELSETSDILQTITPRSLVVLDE
                     LGRGTSTYDGIAIAYATLSHIAEIGCNTLFVTHYPTVAQDLAREKPDKISNWHMSFDE
                     IQMPDGGAEITFLYQLTRGLQEASFGVWCARLAGLPKPILDTAQMRSSSLKAETQERL
                     RGIVARRVGWMLHNLFDNKTSSSQVLRNVEMLHNSLSSSSISFSQ"
     gene            complement(436889..436970)
                     /locus_tag="CNC01560"
                     /db_xref="GeneID:3256390"
     tRNA            complement(436889..436970)
                     /locus_tag="CNC01560"
                     /product="tRNA-Met"
                     /db_xref="GeneID:3256390"
     gene            complement(437859..439087)
                     /locus_tag="CNC01570"
                     /db_xref="GeneID:3256790"
     mRNA            complement(join(437859..438769,438834..439087))
                     /locus_tag="CNC01570"
                     /product="expressed protein"
                     /transcript_id="XM_569496.2"
                     /db_xref="GeneID:3256790"
     CDS             complement(join(438081..438769,438834..439053))
                     /locus_tag="CNC01570"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569496.1"
                     /db_xref="GeneID:3256790"
                     /translation="MGRSLDPVWEFYYRIEQDVQSLGLKAKANSAHNNGWCKNCVRMK
                     LVGPEMATWVPDDSVLAETGQIETARRYKAMSLCQPYTGVPSRLRSHLQRCSHSQGIM
                     IPDAVPLKKRKSHPGSPGTEAGPSGRHSTPVKAGGRGKLSDEQQGEFNVHLWHIFNML
                     DIPIETLTNPTFVQFFSKYIPQATLPSRSLFYTLSASRNIAPPNLSSAAATVGPTGSP
                     DFQGLARLAAGFASVPGVTGVSELSGVQGESGVPHHVESDGAHEPDLSHDSQMQQVSG
                     ASHIRGVPGVSEDDISDGGKGELSYE"
     gene            439299..441016
                     /locus_tag="CNC01580"
                     /db_xref="GeneID:3256586"
     mRNA            join(439299..439380,439430..441016)
                     /locus_tag="CNC01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656698.1"
                     /db_xref="GeneID:3256586"
     CDS             439671..440879
                     /locus_tag="CNC01580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512381.1"
                     /db_xref="GeneID:3256586"
                     /translation="MAYAISRLTAESDFSQCFDSHMLQQQSPDQEQTHVVAPGATIYD
                     DVTRLPIYDGEPWREAFNATKTTHKNGTNTAVSQLAGIDTSLLLSSPNSNASSPTNIF
                     VPELLDVHKALDSEPLNQNQFRQLDSITEQYIIPGSLDFTSPAIKLEFDSQARQQYEA
                     NSQFDHASLFRKLGKPLSTPQVQFNVFSQFFVSPADNESFLSVNPDDVTLKRKVFESE
                     LTNGREIKRRDVTSSFGDFTHGVQPPLLSQQLVSPVTDSGNVVFNSELHPKEGSDATH
                     NSKVSTTRPKSVVPEKFLNDGSAELALGMSVTKIQSFPTFEELLKHVQPCHYSHAKSF
                     GEKIARNRIKAKNAAKRSRDQRRAKIERVEDLEKRIEELKMQVKGMKLLLGRLVDSGA
                     INEDVVQAYL"
     gene            complement(440970..442767)
                     /locus_tag="CNC01590"
                     /db_xref="GeneID:3256559"
     mRNA            complement(join(440970..441347,441398..441801,
                     441855..442086,442138..442767))
                     /locus_tag="CNC01590"
                     /product="Rab escort protein, putative"
                     /transcript_id="XM_569500.2"
                     /db_xref="GeneID:3256559"
     CDS             complement(join(441025..441347,441398..441801,
                     441855..442086,442138..442681))
                     /locus_tag="CNC01590"
                     /codon_start=1
                     /product="Rab escort protein, putative"
                     /protein_id="XP_569500.1"
                     /db_xref="GeneID:3256559"
                     /translation="MSNIELESDSYDVVVIGTGIAESIAAAALAKAGKTVLHLDPNEY
                     YGGEQASLTLDELVEWSTTRVESSSAAVSYTHASTSVVTPTLQNDRRRYALSLFPAIL
                     PSRGPLIDVLISSDVSKYVSFKLLDSVNIWDEDCAGARKVPGSKEEIFKDKSVSLMDK
                     RKLMKFFMFAAGEFEHNDIIRGKETQPLLGFLQDSFALPTGLALSIAYAIAHCTSPED
                     QTLPALMKTRRYLKSLGRYGSSAFLVGQYGGAGEIAQGFCRGCAVYGGTYVLGQFGKP
                     TLIDANDDDVTLSLPCHPRPVTAKHLISSSNHLPPSLLIPKSEPSKRTITAHSIAIIS
                     SLPKVLQRQLPSADDENGRSQLPEENDDTGLIVFPPENGNPTVRCLINGEGTGSCPSG
                     QYILYFSCPASTASSPSNLLKPYLQRITSEPLFESYYVSTRATSSYSASSPKVIIVTP
                     FYRDDLITEGLDWEVKEAEKAYYSVVGQDGVPFFDVTESEADEMGIFEDH"
     gene            443055..444157
                     /locus_tag="CNC01600"
                     /db_xref="GeneID:3256483"
     mRNA            join(443055..443243,443309..443704,443762..443977,
                     444027..444157)
                     /locus_tag="CNC01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656699.1"
                     /db_xref="GeneID:3256483"
     CDS             join(443150..443243,443309..443704,443762..443799)
                     /locus_tag="CNC01600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512382.1"
                     /db_xref="GeneID:3256483"
                     /translation="MTTSLFVPVAYITVLVTAMAIFSRVYRRRRAVSKTSIEPWFPSH
                     PTREVYMSLLADEPPAPENLLKAALLSRAITDVQRIWRLKDDKTALASLHTRGLVGDD
                     TMARFAAAEKELEAEIVDVISEANTFKQGWGQFLFATATEMAQSEKTKEAVINMHKTR
                     IAEEKRLARRAKYDT"
     gene            complement(444372..445116)
                     /locus_tag="CNC01610"
                     /db_xref="GeneID:3256757"
     mRNA            complement(join(444372..444549,444603..444703,
                     444755..444814,444870..445116))
                     /locus_tag="CNC01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_569504.2"
                     /db_xref="GeneID:3256757"
     CDS             complement(join(444482..444549,444603..444703,
                     444755..444814,444870..444952))
                     /locus_tag="CNC01610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569504.1"
                     /db_xref="GeneID:3256757"
                     /translation="MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     A"
     gene            complement(445459..450206)
                     /locus_tag="CNC01620"
                     /db_xref="GeneID:3256358"
     mRNA            complement(join(445459..446251,446302..446910,
                     446957..448089,448138..449446,449494..449755,
                     449801..449959,450007..450206))
                     /locus_tag="CNC01620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569506.2"
                     /db_xref="GeneID:3256358"
     CDS             complement(join(445894..446251,446302..446910,
                     446957..448089,448138..449446,449494..449755,
                     449801..449959,450007..450154))
                     /locus_tag="CNC01620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569506.1"
                     /db_xref="GeneID:3256358"
                     /translation="MPSPPLSILQSLSPRIAVLTSEDVVKSSKENGCAGLHELLRPWE
                     GGTERVSILSTTLTPTVHPTFPVRFVSYDTVYTNPPRSAPSPDILVDIISSVVGAKKP
                     EDEQHYPLTRSLLLSSRPVAPYETFNHPVGVLFAVSTSTPDPLGALNKLHARTIAPSA
                     QSLPWLDGHTVLRFYVVVHDVSQMGDDMTPAHELLASVKRAYGPHSTLLVINSQVDRR
                     PEPPSPDTSTHPAIIVPRPFTPENVNPSALSQVYASALSSLTLSPMSATSPSMKDDNG
                     ELNGLDKPRKLYGSRLTAEDTQRLAALVRELVVQSLVPWMEARIREWSEIYHNNRRGI
                     TGRLFGAGRKFFGSRPNSPATNAVGYNASAGYYSLAAVEALSRRLADFEFMLRDYRSA
                     ANIYDSLRRDFAQDRAWRYASAATEMYGLSLLLAHSFFSPSIPPTTTPIPFTNLQHTE
                     ITSWLEQAVISYHQSGPSSQIQIDALRITVLYYEAWKAIREWRGVGAALVKGAGEADE
                     VPSAVLIEEAAVADTEGGKSGKGKRRSAFHLILAARRYETAGLKTYSRRCLDRASQIY
                     RSTPWTAAQDRIEYSLGRQAYTLGESDVAVEHFLRLLKKENTGVPGSQAGPLQDMALA
                     YEQLRVHPELLESSKDRLQLPTPIFDVKKTRIITSFSSSFESGPSKDNWAQLEEQALR
                     SWDRKGKKPSNLLPDEKRNIVGTDESFIVELVATNPINAPLFLSDIALAFSPSDNITV
                     SPVDEITLNPYETRAICVNVTANGAMSTTSVIRLFGVSFRFHKFFPCTQSLERKGRRL
                     HATKAHRLTPTYASDTSLSLSIIPERPRLDVDLVGIPDRVFVGEEVGGIIRVKNPGRK
                     TVKDLKMIWTKGVLIRRKNDADESSTMTISNRIENNKPSILLPEEIPAGQTKDIAIIL
                     SGFKQGQINLLGLITFESAGDGEIVAGIVKTCINVQPLMTFKTTITPIEASAKELALV
                     LEVMNVSSTEVRVDGVHGVSVLWNVKAHEVVGTLLPNQTLRSVVQIKQGATIADLSQT
                     AVVEALAKLIEGQAPDEIAADIQPTVSLCSELPIDTLPHYFASRNIHRISYLREQFPT
                     ISADFLPDLFPLLDPLDLDIVLSYTICSPNSLRKGRLISHSLRPAPSFSMVESLRRDV
                     EAAIAGGSKQTRTMYEETGRLRRVLMASVLDGCLGREEDPVEVTVKVGEDNGPIEHDF
                     KMGACKVPVAFTIHNRSPILPIRFILYLPSPSPSIPSIASEPSALIPARFIGNLIFRG
                     TLKSGETHVLNSAVWVYIAGLMSLNGWNLIVETGEIEVDTAGWIPRKIWSKKGSEKVV
                     EIRGL"
     gene            450347..453655
                     /locus_tag="CNC01630"
                     /db_xref="GeneID:3256596"
     mRNA            join(450347..450412,450489..451629,451683..452490,
                     452561..453655)
                     /locus_tag="CNC01630"
                     /product="60s ribosomal protein l7, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_024656700.1"
                     /db_xref="GeneID:3256596"
     CDS             450705..451601
                     /locus_tag="CNC01630"
                     /codon_start=1
                     /product="60s ribosomal protein l7, mitochondrial
                     precursor, putative"
                     /protein_id="XP_024512384.1"
                     /db_xref="GeneID:3256596"
                     /translation="MGAQSVRSFTASASRVSLKRAAPISRHASTKAAVQQDEWSLPYI
                     HLGPTHASRYSQHYNNSLASDVMYMTYSHRLSQRPAKPETLQPPQTPYEANRARPPIM
                     RGNRAVRTKTTEITPATVPKLESIIVHTMVKEAIGNKNSLLSAIAALRAISGETPNGA
                     GRKGSSGVQVITAKKSAAAWKLREGMPVAVKVELKGEAMYDFIQSLVDFVLPRLRDFS
                     GVPLPPASTPKSSPASLAGVVSFGFGPTAMSFFPQIEANTDAYPKMHGFHVFFKTNLT
                     GENAQEHARTLVSGFRIPFHRR"
     gene            complement(451738..454824)
                     /locus_tag="CNC01640"
                     /db_xref="GeneID:3256516"
     mRNA            complement(join(451738..452498,452550..452614,
                     452664..453150,453198..453417,453472..453610,
                     453666..453772,453824..454824))
                     /locus_tag="CNC01640"
                     /product="glicosidase, putative"
                     /transcript_id="XM_024656701.1"
                     /db_xref="GeneID:3256516"
     CDS             complement(join(451769..452498,452550..452614,
                     452664..453150,453198..453417,453472..453610,
                     453666..453772,453824..454703))
                     /locus_tag="CNC01640"
                     /codon_start=1
                     /product="glicosidase, putative"
                     /protein_id="XP_024512549.1"
                     /db_xref="GeneID:3256516"
                     /translation="MPIVERELFGFQLATSPSIGDSITSFSLVSSPESIYKDFTYSIS
                     FPLPNVYRILLTGPNRTRPLQDNVVLDTSESKFKVIALDNDGCEATFDFPSPISESLD
                     GAEKRRRQLHLSWKEHITLTTYETLLSTGQQLRLLGDLPNRSYALTEHGVMRHWWVEI
                     DNLHLGLGEKAAPLDLSNRSFMNHGSDSAAYDAYQTDPLYKHTPYLISTPKPTSEGEE
                     LPSTYAIYHPTNAGGEWNVRRLHDDPWGYFKSYTQDYGGLEEWVLVGKGVEQVVRTFA
                     EIVGRPRLVGRDWLGYLASGMGLGESDDPPAQELLSTWPELCRKYDIPCSAMHLSSGY
                     TADKDGNRCVFTMNTKRYPDFKGMVAHFHKAGIKVVPNIKPYVLQTHPHYKDLHSSNA
                     LFYDPYSKSPVVTRIWSSGVGDNEKGSWVDMTSEEGRQWWADGVKSLIDLGVDGMWDD
                     NNEYYLHDDSFVCATSLPHEFTSSPSGPVTIGEIGRMINTELVNYVSHTTLEKAHPTR
                     RTYVLTRSGNVGTFKYANSTWSGDNYTSWHNLRGSQAIQFNAGMSLMQSYGSDIGGFG
                     GPLPGEEMFVRWVQLGVTHSRFCIHSFKPDQSDISGVGATNTPWMYPAVLPIIREAIK
                     WRYEHLPFFNSLMWESHLRATPTTTWLGFGPFASDPALYEASILEGFDAWLGTGRILV
                     CPALFEGQLTREVYFPKACMDDKSLYFDLHAPYRTYKAGDRVMIATPMEHMGLFAREG
                     AVVPVGKRYHTVTQKQGPARQTPDGVDVVLEDEGGVVGLDDWRGVKIFPGHEGNAYRG
                     QWTEDDGISATPDKTVVEVEYVGGKDEVTIGFKLTEHKFKTLWGRKLAVLLPVGDERS
                     VKGGKEDVWEGRKVWNIEF"
     gene            complement(455015..457730)
                     /locus_tag="CNC01650"
                     /db_xref="GeneID:3256632"
     mRNA            complement(join(455015..455295,455362..455594,
                     455792..456067,456127..456358,456427..456541,
                     456607..456672,456723..456788,456838..457271,
                     457324..457730))
                     /locus_tag="CNC01650"
                     /product="peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagine amidase, putative"
                     /transcript_id="XM_569511.2"
                     /db_xref="GeneID:3256632"
     mRNA            complement(join(455015..455295,455362..455690,
                     455768..456067,456127..456358,456427..456541,
                     456607..456672,456723..456788,456838..457271,
                     457324..457730))
                     /locus_tag="CNC01650"
                     /product="peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagine amidase, putative"
                     /transcript_id="XM_569510.2"
                     /db_xref="GeneID:3256632"
     CDS             complement(join(455173..455295,455362..455594,
                     455792..456067,456127..456358,456427..456541,
                     456607..456672,456723..456788,456838..457271,
                     457324..457620))
                     /locus_tag="CNC01650"
                     /codon_start=1
                     /product="peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagine amidase, putative"
                     /protein_id="XP_569511.1"
                     /db_xref="GeneID:3256632"
                     /translation="MFNQPSDSPFRDYQAYVHIVNYCAAALAAGIYQGIPQLSVPSPK
                     EVGDLNRLWREYLLTHKLEVLSSFRRRRSVVSDDMQGVIKNLQQHTYSLRDPRGDPSM
                     QGVSEYELRALVPDITSSIAFISSNPPFTPFGQVDAEVLALCRWFKDDYMRWVDPIKC
                     PTCDGPTFSAGTVPPDGTEHWEGAGRVELHVCKDKNCAAQRRFPRYGKVSTLLRTREG
                     RCGEWAHLFYVFLRAKGIESRYVWNSEDHVWCEYWSPALRHWVHVDPCEGAINKPLIY
                     ALGWGKKQAFCLAFGQYGAEDVSAAYIDDFDGDCRLRRRARGWKERDLRRALFAQTVA
                     LRLKMDLPQRSRLEVMDQLQALWISDREGRMREAEKSELIGRISGPDDWKRLRDELGL
                     NAKIIQKPQYTVVSNLESDNQALVTFGDAHWDGSTIVLTTGNSQTSAVFHPHPIDQSD
                     TFSCTVTFRLTSPPGAGEADGISIIFVPKKALGLGGYGLGYSGLGGCTAPGTLPKLSN
                     GKEHKLQILYRGEDRRVRGYLTISSEGSVKDETDIEVFDIVVPSGNEQKPWFIGVTGS
                     CGGLWQKQEIVDWSLQLVAFGDGQTILQKSSGKAKAGCERNDERDNI"
     CDS             complement(join(455173..455295,455362..455690,
                     455768..456067,456127..456358,456427..456541,
                     456607..456672,456723..456788,456838..457271,
                     457324..457620))
                     /locus_tag="CNC01650"
                     /codon_start=1
                     /product="peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagine amidase, putative"
                     /protein_id="XP_569510.1"
                     /db_xref="GeneID:3256632"
                     /translation="MFNQPSDSPFRDYQAYVHIVNYCAAALAAGIYQGIPQLSVPSPK
                     EVGDLNRLWREYLLTHKLEVLSSFRRRRSVVSDDMQGVIKNLQQHTYSLRDPRGDPSM
                     QGVSEYELRALVPDITSSIAFISSNPPFTPFGQVDAEVLALCRWFKDDYMRWVDPIKC
                     PTCDGPTFSAGTVPPDGTEHWEGAGRVELHVCKDKNCAAQRRFPRYGKVSTLLRTREG
                     RCGEWAHLFYVFLRAKGIESRYVWNSEDHVWCEYWSPALRHWVHVDPCEGAINKPLIY
                     ALGWGKKQAFCLAFGQYGAEDVSAAYIDDFDGDCRLRRRARGWKERDLRRALFAQTVA
                     LRLKMDLPQRSRLEVMDQLQALWISDREGRMREAEKSELIGRISGPDDWKRLRDELGL
                     NAKIIQKPQYTVVSNLESDNQALVTFGDAHWDGSTIVLTTGNSQTSAVFHPHPIDQSD
                     TFSCTVTFRLTSPPGAGEADGISIIFVPKKALGLGGYGLGYSGLGGKGDFAVEVDTYR
                     TQDYADDPPTPHISVHSPPDAHHRNSIGCTAPGTLPKLSNGKEHKLQILYRGEDRRVR
                     GYLTISSEGSVKDETDIEVFDIVVPSGNEQKPWFIGVTGSCGGLWQKQEIVDWSLQLV
                     AFGDGQTILQKSSGKAKAGCERNDERDNI"
     gene            complement(457896..459116)
                     /locus_tag="CNC01660"
                     /db_xref="GeneID:3256784"
     mRNA            complement(join(457896..458482,458531..458745,
                     458803..458923,458974..459116))
                     /locus_tag="CNC01660"
                     /product="cytokine inducing-glycoprotein, putative"
                     /transcript_id="XM_569968.1"
                     /db_xref="GeneID:3256784"
     CDS             complement(join(458057..458482,458531..458745,
                     458803..458923,458974..459060))
                     /locus_tag="CNC01660"
                     /codon_start=1
                     /product="cytokine inducing-glycoprotein, putative"
                     /protein_id="XP_569968.1"
                     /db_xref="GeneID:3256784"
                     /translation="MIFNRFTFTAAMAASAASAISVQRRAAITDFDTSPVAFAFPEPR
                     GFSASTASEAPCGGFDPVNRTSYPLSGGDVALIQQTDATNVNILWTSESDPTLFHSFS
                     TYSNSILDIAAGHYCQDAPDFSSLGFAEGDNATLLVIYQLDGADTYYYQCADVSLVSA
                     TSFTTDEQYVCGNYTSELEIASSEESLHLGNTTTSESTSSGTTGTASTSSGSTNPHVS
                     SSSSGSKLSAAEGGGIGASVTIFVFAVIAGLLWWSGLLRFGKKKQAVVHDHESVSSGV
                     PTKERL"
     gene            complement(461051..464101)
                     /locus_tag="CNC01670"
                     /db_xref="GeneID:3256340"
     mRNA            complement(join(461051..461535,461595..462092,
                     462142..462308,462367..462519,462579..462804,
                     462862..463006,463075..463461,463516..463596,
                     463662..463696,463758..464101))
                     /locus_tag="CNC01670"
                     /product="expressed protein"
                     /transcript_id="XM_024656702.1"
                     /db_xref="GeneID:3256340"
     CDS             complement(join(461412..461535,461595..462092,
                     462142..462308,462367..462519,462579..462804,
                     462862..463006,463075..463461,463516..463596,
                     463662..463696,463758..463966))
                     /locus_tag="CNC01670"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512548.1"
                     /db_xref="GeneID:3256340"
                     /translation="MFSPILSPYRLPKPIFVLVCLLLILGLLFLSFASHDESRGYMID
                     IFKKAGANVGVSASRLSGNAEEDAMREWEFRRALQHEGTSARVQAFLDKARSGKAFTV
                     ASIGGSVSKGRGLTPPKPSQLVHNTFRRSSEGDSVRPSDVPDDSPQDNIDLTEVIPSS
                     AQSELEPTGSAIEENQGKNVSHPIAPLVHLGASTLYSHENLHVQIFEWLNETFPNPDN
                     RFINGAQGGVGAAYFGWCFKEHIPEDADLVLLELGINDLLEFDVFSQYEHLVRGLLEL
                     ENKPALINIETFTTLFPSLLSSSSFHNDVLSFYDVPSLSIRDVVLPRILADPQQQMRR
                     WFRTGDDVAMGDPKVKEWGGVPVDVMHISAIGHSLAAGLVIRYLHEQIDRSTSYGLSA
                     LGRLTSTPKKPTVRIMDVPATTLTGLFNPDKADMRHAPVCRSQNSGKTHGKVSSLVDD
                     FSEGTYKGLTLAEGSHGWSEWSWKEKRYLIAREPGSRAIFDFTISLPQEPLISDDPSA
                     FLLDGADDITAETPSQVHKTEGEDDMPVEQEFPRGSLAHRSAGLRKIWSSAISHQPRP
                     TSPTLPGRRYISQPNAKQNPQAGGSILIGYQRSAKLGLGSVWCWIDDDRDGGQRVDGW
                     WKLDKRNMGMVKEIAVGLEPGKHTLTCEILEDTLDPMGGTEFRLFAIMHD"
     gene            complement(464307..467597)
                     /locus_tag="CNC01680"
                     /db_xref="GeneID:3256181"
     mRNA            complement(join(464307..464691,464749..464886,
                     464941..465666,465717..466076,466133..466258,
                     466311..466653,466704..466870,466933..467597))
                     /locus_tag="CNC01680"
                     /product="dynamin protein dnm1, putative"
                     /transcript_id="XM_569513.2"
                     /db_xref="GeneID:3256181"
     CDS             complement(join(464506..464691,464749..464886,
                     464941..465666,465717..466076,466133..466258,
                     466311..466653,466704..466870,466933..467385))
                     /locus_tag="CNC01680"
                     /codon_start=1
                     /product="dynamin protein dnm1, putative"
                     /protein_id="XP_569513.1"
                     /db_xref="GeneID:3256181"
                     /translation="MSMDGDLIALVNKLQDTFNAIGGDAVDLPQIVVVGSQSSGKSSV
                     LETIVGRDFLPRGSGIVTRRPLILQLIHTPPRSSPRTLENIDDGYLPNLDQTPTAGAG
                     VMRPGGRSMGEGTGAEYAEFLHINRRFTDFEEIRKEIEAETFRVAGQNKGVSKLPINL
                     KIYGPGVLNLTLVDLPGLTKVPVGDQPTDIERQIKNLVLDYISKPNAVILAVSPANVD
                     LANSDALKLARSVDPRGLRTLGVLTKLDLMDAGTNALDILTGRTYPLKLGFVGVVNRS
                     QQDINENLPMEDARAKEEEFFRTHPVYRNIAHRCGTKYLAKTLNHVLMNHIREKLPDM
                     KARLNTLMGQTQQELNAFGDATFLGEQHRGSLILKLMTEFSKDFVSSIEGTSLEISTK
                     ELSGGARVYYIFNEVFGHALQGIDPAHNLSLADIRTAIRNSTGPRPSLFVPEVAFDLL
                     VKPQIKLLEAPSLRCVELVYEELMKICHNCTSPELQRFPRLLTQLVEVVSDLLRERLG
                     PTSDYVSSLISIQAAYINTNHPDFVAGSAAIARAGAPPTTQISKVQEATSEVDDEESE
                     AESEASAPNGYVTHPRSASASVPDIRRPTTALGGKETKSRKHIRTASGSHSGHTSGAR
                     QGANALLGAASAHNMAGTSPHTAKETFLNYFLGGRNGAGEDAGSVQRALGKSHVMQHH
                     AQGQYQPQQREKDLLPDLGGRRGGRLENSASFDMKSLGKHLEATTGDEMQLTPREEME
                     TTLIRSLIASYFGITRQTIQDLVPKAIMHLLVNFSRDAIQQRLVTQLYKPELFADLLF
                     EDEALVSERTRVKALLDAYKEAFKVLSEVSLKST"
     gene            complement(467940..469618)
                     /locus_tag="CNC01690"
                     /db_xref="GeneID:3256295"
     mRNA            complement(join(467940..468354,468412..468719,
                     468768..469539,469588..469618))
                     /locus_tag="CNC01690"
                     /product="expressed protein"
                     /transcript_id="XM_569515.2"
                     /db_xref="GeneID:3256295"
     CDS             complement(join(468111..468354,468412..468719,
                     468768..469539,469588..469598))
                     /locus_tag="CNC01690"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569515.1"
                     /db_xref="GeneID:3256295"
                     /translation="MSAKPTVRRTYGKAPPRASSPLFDPSSPPPALSSTYRSSSPLSY
                     RLDSPLGSSPPRPIRTRAKSPLFLPSEDDDDMDEQDTSQPEPSIVADLLGKGKQRAKR
                     NPIMEKKQVQSSLKGFFTSLPKKRPLEPSMTVSAVKPKQPKVFGPSRPITIASFLKTP
                     QPSNAKTSGSVKAKTGSMAQMHLTHLPLLHTCPTCGMSFVRGGPDEGVHVTHHARVLR
                     GILWEGMKKREGEGWKVVQEDVEFGGKRRGRIIALDGSFGGNKLVEILSTVDRVLSAP
                     PLPPAILNRCKVFVFLTHSPPPPPSSSKRIKLDPTDNKLGKDKDKERVVSVVVAQGIK
                     WAMKVLKEGEMKTEKSKTIETGGFGSVTCDPTPLPTPLGIHRLYTTPSYRSHSLSSRL
                     LDVACEHTVYGCTFDPKKGEVAFSQPTESGRGVMERWGGGEVRVFVDDQSQL"
     gene            469829..471806
                     /locus_tag="CNC01700"
                     /db_xref="GeneID:3256300"
     mRNA            join(469829..469900,469950..470124,470174..470498,
                     470557..470920,470979..471157,471215..471501,
                     471558..471671,471735..471806)
                     /locus_tag="CNC01700"
                     /product="fumarate hydratase, putative"
                     /transcript_id="XM_569517.2"
                     /db_xref="GeneID:3256300"
     CDS             join(469838..469900,469950..470124,470174..470498,
                     470557..470920,470979..471157,471215..471501,
                     471558..471671,471735..471760)
                     /locus_tag="CNC01700"
                     /codon_start=1
                     /product="fumarate hydratase, putative"
                     /protein_id="XP_569517.1"
                     /db_xref="GeneID:3256300"
                     /translation="MTTPTKTSSLKTTQMLARSLRLTRTLPRVSLASRGFSSTSYIMA
                     EQKFRKEKDTFGDLQVPADRYWGAQTQRSLMNFDIGGPTERMPPPLIKAFGVLKKAAA
                     AVNQTYGLPAEVAEHIQKAADEVISGKLIDEFPLVVFQTGSGTQTNMNVNEVISNRAI
                     EMMGGELGSKKPVHPNDHVNMSQSSNDTFPTAMHIAAVVEINEQLLPAMKELHAALKA
                     KQDAFENIIKIGRTHLQDATPLTLGQEFSGYVTQVERGIGRVEATLKNLSMLAQGGTA
                     VGTGLNTRKGFDEKVAAEISKITGYDFVTAPNKFEALAAHDAIVEASGALNVVAVSFM
                     KIANDIRYLGSGPRCGLGELELPENEPGSSIMPGKVNPTQCEALTMVAAQVMGNNTTI
                     SVAGSYGQFELNVFKPVLIKNLLQSIRLLSDGARSFTKNCVVGIKANEDRIKKIMNES
                     LMLATCLNSTLGYDDVAAIAKKAHKEGLTLKESTLALGKLTSEQFDEKVRPELMLAPT
                     DA"
     gene            472014..476273
                     /locus_tag="CNC01710"
                     /db_xref="GeneID:3256422"
     mRNA            join(472014..472359,472451..473398,473451..473567,
                     473619..473726,473780..474203,474250..474872,
                     475312..475572,475625..475884,475936..476272)
                     /locus_tag="CNC01710"
                     /product="expressed protein"
                     /transcript_id="XM_024656703.1"
                     /db_xref="GeneID:3256422"
     CDS             join(472189..472359,472451..473398,473451..473567,
                     473619..473726,473780..474203,474250..474872,
                     475312..475572,475625..475884,475936..476104)
                     /locus_tag="CNC01710"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512388.1"
                     /db_xref="GeneID:3256422"
                     /translation="MEAICPVGDQYQNNDSLSDSENSPVNNLPPPPEPFPVDLLSQNV
                     SSSIGSRAESDQTLIVKHLRSVQRSCIDALSALLPDHFTQNGDFDWDPTLIADSDDRL
                     AQALMELLEVTYELEDLTPSPAESVLQEERGEEVVIGDSGSLENLTSQLDKLQAARVA
                     SRPQTPIIGTYSDASAIHPAIRIVRLEFSWARLESLSLAVVELSRQRYQQSTEDRETS
                     PPSYETYHNGSHELPQYSEVNSHGSSASVSKLADSPTAKDDFTSRSSLESSRSRRPAD
                     REKMLNELEAVTSAIERLYSISPQLSNQRVEFRPLARSSTEGRHHQNNETVDLKVDER
                     VDEGQKMKELDEIWCQLQGAKKKRMEDQRAGVNTSQSRSKEKFIARLIEQAEKRRLPC
                     QDSEMAAVDGELAKARELKDRDHFLRGLIERSADRRFDNQDAAAPAEDRSAARLAKQQ
                     ALISALVNHTQATRLSSQDFPLTLEDKLAENRSAFVSQLVEYSSAGRLYDQDSLPPSP
                     REDENMRVGEEKDPMEIVTVKDFLASSRPPVPQNKADAGEPAGKREMSSSEGGGKRRV
                     VSKIAGMVRKGSVHLGLKSTFSPDENNVTYVVEHQENLRSLQVLVHGIGISSNLELNI
                     QTLPSSSGSTNTAVITSKREPSLSIDVALPVLVYSDQITPLVPQSLYQEAKLSALPTP
                     PASNALIITHALSAPDFRSLKATVLCCAICERHLASLPFSQDPKQAYKDLPSDHWAEM
                     IDIWMCHDDPAFTARLAGMTEEGFWPRDGGVLVGGSYLLVEKTSGQWEILRMGTQKEN
                     ETWRLISCKCGEVVGKQRIDDGKPGSGTLRFSKWAIGLLDDGNDDGEITRFPLSVFIV
                     SDMLELAQAHASFRFIISEEETGVQKLYLWLFNASTSVSYFKPTPTSAQTSPLRSSFT
                     VCQASEKRSVRSRRSSTASSIKTSNSGGNGGSAKCDGRGKTIKAVKTMYKIVDESTNI
                     DRLPGFGPGGQIEHLTYSREVCSRLIATLKESTLVYPAAKRSMGAFDVGFLERA"
     gene            complement(476193..478099)
                     /locus_tag="CNC01720"
                     /db_xref="GeneID:3256206"
     mRNA            complement(join(476193..476436,476490..476705,
                     476761..477502,477564..477680,477743..478099))
                     /locus_tag="CNC01720"
                     /product="expressed protein"
                     /transcript_id="XM_569521.2"
                     /db_xref="GeneID:3256206"
     CDS             complement(join(476296..476436,476490..476705,
                     476761..477502,477564..477680,477743..478047))
                     /locus_tag="CNC01720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569521.1"
                     /db_xref="GeneID:3256206"
                     /translation="MPRITPAAILRSAAATRQPLTSRAAIRPILSPAVPSLLATTKRY
                     QSTSQQPNEHPKAENKEPDPKSTEPKPEGGKEGKKGLKVSWIFSGLAGLGALVTIYGL
                     LEFYSTLTTWPKEVRKPLRAALKAKLRGDYGKAETFFREALEIALQMGPSALQPEPLL
                     KISGIYVELANVLEIQRQRVSAFVELRTALEMFGPDPLRRPGILPLPEATTLGGGPGG
                     QWIGEGYRLTEKDHVRAIGLYQKLGQLALEVASSPTGSTYASTLGEGSTGQMFKTWDD
                     AAEYYLSSALTSMLHLGLPGSSPTPSTEGPVILGRDVSLPDALPSDNPEDVDQGGQVD
                     KRGLGMTMESLSEVYARKGQYDMAGQLLLQAISLLLPPQSKETPPMRDRCQAAMLMTT
                     VSSHALHPPTPKSLKVSRSWSLRSLQLSQQALAEAEGGSFKDTPLEAAEAVCQRARAV
                     GLHNMGMLAEMEKDYAGAQNLFKKALAASRETGFVEGKREALAALRRVQNLAGESA"
     STS             477116..477885
                     /standard_name="Pst6"
                     /db_xref="UniSTS:470782"
     gene            478171..479828
                     /locus_tag="CNC01730"
                     /db_xref="GeneID:3256399"
     mRNA            join(478171..478357,478419..478476,478539..478675,
                     478754..478876,478944..479053,479109..479238,
                     479302..479828)
                     /locus_tag="CNC01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_569965.2"
                     /db_xref="GeneID:3256399"
     CDS             join(478229..478357,478419..478476,478539..478675,
                     478754..478876,478944..479053,479109..479238,
                     479302..479775)
                     /locus_tag="CNC01730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569965.1"
                     /db_xref="GeneID:3256399"
                     /translation="MQYVASPQEYPDTPSQSSTSARIPSPRAFDVVTAYRRALEDDKV
                     PHPIAAILALVELMEASTASTVTGLASELTVGRQALINTQASLGVRAGCQLWERFFAL
                     FPGVGEDFPAYKKSLISQGRSFCAITAPQCREKIAELAVGFLRDDCVILTHSYSRTVI
                     QTILRAHKQHKRIRVYVTEARPGCLGMKTHQFLTANGIPCTVVLDSAVAYVMERVDMV
                     LVGSEAVVESGGLVSSVGTYQVALVAKVMQKPFYALAESYKFLRHYPLSQTDLPIPAS
                     SDRPAIPLEFPSTIPDTQFIPGFLSRGSSLTPQSRSPQAPATPPHAVGGGGVGVDGGK
                     KYERMEMTKEMEEINPMVDVTTPDLIDFIITDLGEPLSPTSVSQYLVAQFSS"
     gene            complement(479794..482207)
                     /locus_tag="CNC01740"
                     /db_xref="GeneID:3256453"
     mRNA            complement(join(479794..479972,480034..481722,
                     481765..482207))
                     /locus_tag="CNC01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656704.1"
                     /db_xref="GeneID:3256453"
     CDS             complement(join(479933..479972,480034..481502))
                     /locus_tag="CNC01740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512389.1"
                     /db_xref="GeneID:3256453"
                     /translation="MLGGAIDEIGLIDSRDTPPPMVGEPGKKQKPDMRIELDKAKGLE
                     PAAEVVNKGPMTPTSLPARGASLSSTTSPPPPPPPPVQGPTEMGAGIASSFPLHQPEL
                     ETTSNNPFSSQAGPFTHSPTTLSFHSPTAHPWPSAMSMSTSALKSHKSAGARALAYAR
                     AINEIARAETGLKAWCAAAAAEAHRRPIHHAPSKTQAPASSSPPVGLSPHPRNVSTGS
                     EFPMRADSYTAREISQRVIDPADQPTALPPNLPYPQLQAQINYHHQLSPGGSSLVGGG
                     GLKPSQSMQSVSSFTSSKKGGGGGGGGGGGFFSAIRKGSSRKESMSMSLGPPGGYLGG
                     SASKKDVRGLPISAPRSASPQKPDGTTTTTSSPRSGSGSGSHTPRVQTVPSPMGPRPL
                     GPRGPGARGSFTPPGRTSLDTAAPSRISVVSPPRNLRASMDSVRLVGKTSAPPPSGTA
                     TVADSGEDVKYMADVLPYVEKSVLRAYLNRYGGDQMQALGAYLEDEKNGAVR"
     STS             480346..480552
                     /standard_name="CGT1"
                     /db_xref="UniSTS:470787"
     STS             480497..480764
                     /standard_name="CCG1"
                     /db_xref="UniSTS:470786"
     STS             481190..481340
                     /standard_name="GGC2"
                     /db_xref="UniSTS:470785"
     gene            complement(482896..484883)
                     /locus_tag="CNC01745"
                     /db_xref="GeneID:36392776"
     mRNA            complement(join(482896..483818,483874..484291,
                     484363..484553,484621..484883))
                     /locus_tag="CNC01745"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658927.1"
                     /db_xref="GeneID:36392776"
     CDS             complement(join(482981..483818,483874..484291,
                     484363..484553,484621..484847))
                     /locus_tag="CNC01745"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514266.1"
                     /db_xref="GeneID:36392776"
                     /translation="MSVRYACSHLDTPAPPLPPSYPSSGPSFFPIEQLYFCEECDALR
                     CDLCVGVEVASYFCPNCLFDVPGANVRGDRNRCARSCFSCPQCSSSLSIQASDFARDD
                     VSGDGAPPGPLYLLVCPGCRWSSKQIGWEFEKPTGIALQVQKRWTQPERIQAEFDHIK
                     DHLESYMTCSSSTPTTPHHRPRAPSRHISHLTQMAAKALNRPVHGFAVRKRPLQAPGG
                     EKVGWDELEAYESKASWRELGLEKGMGDVEAVRSLEEAGWEGMAAVDRRWGTSWECDR
                     MSKSVLPQRIPLRTKLTKRCPEPSCRHLLVQPDTKSVRMKIKMVALNYLPILEVGRRR
                     RRVVVVPGGDTDERPGVEAHAHDAEREEKRRERRRTRPALSGISWSGGEKGEEEDEAG
                     DRPLVAGETYTFQLALTNPLYDPIQIRLTRPPLPKHAPPEKCEVRIATPHFTCNASKD
                     AWAYDDEEDGDGSEDAAGTGTMRKGGRLGVLAGGSLRDKRREAGVEKRGNVSKVPIEV
                     EISEQARGDVEFDLEVRFTYRVEGEGTGEKGREEYKHFTFWARVHLGEV"
     gene            484983..486664
                     /locus_tag="CNC01750"
                     /db_xref="GeneID:3256126"
     mRNA            join(484983..485248,485329..485488,485547..485670,
                     485747..485917,485985..486148,486200..486378,
                     486448..486664)
                     /locus_tag="CNC01750"
                     /product="Cdc2 cyclin-dependent kinase, putative"
                     /transcript_id="XM_569525.2"
                     /db_xref="GeneID:3256126"
     CDS             join(485206..485248,485329..485488,485547..485670,
                     485747..485917,485985..486148,486200..486378,
                     486448..486503)
                     /locus_tag="CNC01750"
                     /codon_start=1
                     /product="Cdc2 cyclin-dependent kinase, putative"
                     /protein_id="XP_569525.1"
                     /db_xref="GeneID:3256126"
                     /translation="MSLDNYQKIEKVGEGTYGVVYKAKDINTGHIVALKKIRLEAEDE
                     GVPSTSIREISLLKELSKDDNIVKLLDIVHSEAKLYLVFEFLDMDLKKYMDTIGEKDG
                     LGPDMVKKFSYQLVKGLYYCHGHRILHRDLKPQNLLINKSGDLKIGDFGLARAFGIPL
                     RTYTHEVVTLWYRAPEVLLGSRHYSTAIDMWSVGCIVAEMATRQPLFPGDSEIDEIFR
                     IFRVLGTPDEDVWPGVRGLPDYKPTFPQWHPVELADVVKGFEADGLDLIAQTLVYDPA
                     HRISAKRALQHPYFDTVNLSAA"
     STS             486251..487002
                     /standard_name="Sal5"
                     /db_xref="UniSTS:470784"
     gene            complement(486648..487830)
                     /locus_tag="CNC01760"
                     /db_xref="GeneID:3256552"
     mRNA            complement(join(486648..487476,487540..487677,
                     487736..487830))
                     /locus_tag="CNC01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_569527.2"
                     /db_xref="GeneID:3256552"
     CDS             complement(join(486707..487476,487540..487677,
                     487736..487805))
                     /locus_tag="CNC01760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569527.1"
                     /db_xref="GeneID:3256552"
                     /translation="MSPPPHSIPLYLVNGVATVWDAQTAATLHCVHNVSGLRAGTLPG
                     VAQQNGFLGLPLTLMQEETAYLVTQGIAHLVPLDPSPSPPSDETVKAHTAARVARLKA
                     LEEKTREAEAKRLEESKKAFDKGGEKARLKREARARAKAEKAKESGEGLFAEDVKENV
                     TAPIVVSPAKTKTKHAGAPAAGHFHIVPSHPVLSQHPPESQSITSLPHPLFPFPTTPR
                     QCALLGVFSKLQSLSYRVGLGPRFGGEWLIYPGDYLRYHAHFTSQVIVRDEPIRPTEI
                     VAWGRLGTGTKKAGLICCWDDGKREDGQDDQGGKEEDVEFYSLEWANFG"
     gene            487996..488934
                     /locus_tag="CNC01770"
                     /db_xref="GeneID:3256459"
     mRNA            join(487996..488012,488068..488078,488194..488280,
                     488401..488461,488693..488795,488847..488934)
                     /locus_tag="CNC01770"
                     /product="u6 snRNA-associated sm-like protein lsm2,
                     putative"
                     /transcript_id="XM_024656705.1"
                     /db_xref="GeneID:3256459"
     CDS             join(488010..488012,488068..488078,488194..488280,
                     488401..488461,488693..488795,488847..488869)
                     /locus_tag="CNC01770"
                     /codon_start=1
                     /product="u6 snRNA-associated sm-like protein lsm2,
                     putative"
                     /protein_id="XP_024512391.1"
                     /db_xref="GeneID:3256459"
                     /translation="MLIFSFFKTLTDQVITVELKNDLSITGTLKSVDQFLNIRLDNIS
                     VEDPERHPHMMAVKNCFIRGSVVRYVRMAARSVDTTLLEDATRREAKEGKK"
     gene            489033..490869
                     /locus_tag="CNC01780"
                     /db_xref="GeneID:3256501"
     mRNA            join(489033..489352,489410..489562,489627..489744,
                     489807..489892,489951..490084,490143..490712,
                     490764..490869)
                     /locus_tag="CNC01780"
                     /product="prenyltransferase, putative"
                     /transcript_id="XM_024656706.1"
                     /db_xref="GeneID:3256501"
     CDS             join(489049..489352,489410..489562,489627..489744,
                     489807..489892,489951..490084,490143..490469)
                     /locus_tag="CNC01780"
                     /codon_start=1
                     /product="prenyltransferase, putative"
                     /protein_id="XP_024512393.1"
                     /db_xref="GeneID:3256501"
                     /translation="MLLLSRTRLFPRPLLSPLSRPLPLRPRVLTTSAIRRASLPPTVP
                     RVSTELVHPKEQQQQLPAQPPTVFDKILPQWAQGAKPYLYLTRLDKPIGSVLLYWPCA
                     WSITMASTVNHLPPTTPLFYMSLFAVGALIMRGAGCTINDMWDWKMDAKVERTKTRPL
                     AAGDVTQFGALTFLGAQLTAGLAVLTQLNWYSIVLGASSLGLVVIYPFMKRITYFPQV
                     VLGFAFNWGALLGWSAVAGAVDWTIATPMYLGGAAWCVAYDIIYAHQDKKDDVIAGVK
                     SMALRFPDTSRQVISTLSASFVSLLTFTGYMAGLGPLYYLISCGGAAAHLAWQCLTVN
                     FDSRSDCWKKFSSNGWLGGLIWSGIAADYVQQVMFGVPA"
     gene            complement(490401..492347)
                     /locus_tag="CNC01790"
                     /db_xref="GeneID:3256566"
     mRNA            complement(join(490401..490567,490616..490702,
                     490755..490784,490837..490918,490975..490989,
                     491037..491117,491163..491291,491347..491406,
                     491455..491538,491593..491611,491668..491687,
                     491741..491781,491848..491852,491908..491909,
                     491985..491986,492041..492087,492157..492347))
                     /locus_tag="CNC01790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656707.1"
                     /db_xref="GeneID:3256566"
     CDS             complement(join(490557..490567,490616..490702,
                     490755..490784,490837..490918,490975..490989,
                     491037..491117,491163..491291,491347..491406,
                     491455..491538,491593..491611,491668..491687,
                     491741..491781,491848..491852,491908..491909,
                     491985..491986,492041..492087,492157..492248))
                     /locus_tag="CNC01790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512547.1"
                     /db_xref="GeneID:3256566"
                     /translation="MAPTIHSYHAPSHYYPRRDVAEQLTPNDTQKVTLIVAACYIVAI
                     AILWHVPILEKLIYPFKLLTVGLHEMSHALAGVLTCATVEKITLDPQEGGSTRMRGGI
                     PAITLPAGYLGSSFIGACLVACGFDINASKVACLVLAFIWILTLWWARSSWVAWATIA
                     LMVGLVLVCWLVAQSVALRFLILFIGVMSCFYSIWDIIDDTLARKINSSDASEYAHMI
                     GCCGSRFWGAFWLIISCCFFAAGVLVGIAAFKDDWQTQADKASNFLGGTP"
     gene            complement(492441..494175)
                     /locus_tag="CNC01800"
                     /db_xref="GeneID:3256217"
     mRNA            complement(join(492441..493282,493338..493414,
                     493462..493618,493676..494175))
                     /locus_tag="CNC01800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569533.2"
                     /db_xref="GeneID:3256217"
     CDS             complement(join(492528..493282,493338..493414,
                     493462..493618,493676..494129))
                     /locus_tag="CNC01800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569533.1"
                     /db_xref="GeneID:3256217"
                     /translation="MPASQPLQLLFLGTATSTGLPLTPCLTLSTPYPHRWSNMVPLLQ
                     GRDLSDRSPSPASTTISSTYSGSTYDPEGQWPKNIPCACCRSTVDPDVPEGWKNKRGN
                     TSVLLRKQSAEGDWKNVLVDVGKTFREQAMRFFPTWGVKTIDAVLLTHGHADAYFGLD
                     DLREWCVRQGKAIPVYLNKETFHKVEETFPYMVDKTKVSGGGDVPQLIWKIIEDEGEF
                     QVEGIDVKVLPVHHGIYFHSILPPTNAEPVREPPAKIEPEPLICLAFEFDDSIIYMSD
                     VSGIPQRTWDRMLQTSSRRQTIFPTPVDSRGGDDTPKGVPKNQSISDLANLSISPRVP
                     GRLEQLRTHNVPVLIIDALWPLQPHASHFSLAQALIAALRLRAANTYVIGSTHPTSHF
                     MWEEICNSLTHRDGRDYEVRDHPDAAQAEWLVKRVWDKVFGEGEHEGLGERWMEEGGK
                     VKPAWDGLVIEVGGDQGLERADLSSKGLLI"
     gene            494348..495522
                     /locus_tag="CNC01810"
                     /db_xref="GeneID:3256823"
     mRNA            join(494348..494675,494731..495003,495056..495522)
                     /locus_tag="CNC01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_569535.2"
                     /db_xref="GeneID:3256823"
     CDS             join(494481..494675,494731..495003,495056..495397)
                     /locus_tag="CNC01810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569535.1"
                     /db_xref="GeneID:3256823"
                     /translation="MSSSIPTPSASNRPFQSQFAGDQDQPGSFYRNLFYILVGLLCAF
                     SLFSFLTLMRARRRRRAVIDEALRLGVMVPGVPGYVPLQDRQALMWMKSDGNQLPDWW
                     EIGKLKGPDDPPLLNEEGRSNGPMDQQNSVAPPTGDLHQRQTNQESSSHNSDFFQPLA
                     IIPPVATETSAQPIPTSKLKFFPNHLAYRPSALLPPPARFNDINSENMMEKLDQLKGN
                     VVEVVTVIQMPVPSWTGTSTDDGDVQVFKEWGGIELGITNLRVAAESHQVS"
     gene            complement(495493..497961)
                     /locus_tag="CNC01820"
                     /db_xref="GeneID:3256398"
     mRNA            complement(join(495493..495745,495804..496041,
                     496107..496346,496407..496746,496807..496885,
                     496933..496972,497018..497115,497167..497283,
                     497345..497421,497471..497580,497632..497961))
                     /locus_tag="CNC01820"
                     /product="acetyl/propionyl CoA carboxylase, beta subunit,
                     putative"
                     /transcript_id="XM_569537.2"
                     /db_xref="GeneID:3256398"
     CDS             complement(join(495584..495745,495804..496041,
                     496107..496346,496407..496746,496807..496885,
                     496933..496972,497018..497115,497167..497283,
                     497345..497421,497471..497580,497632..497924))
                     /locus_tag="CNC01820"
                     /codon_start=1
                     /product="acetyl/propionyl CoA carboxylase, beta subunit,
                     putative"
                     /protein_id="XP_569537.1"
                     /db_xref="GeneID:3256398"
                     /translation="MYPRSLTLPPVRPRPFSPVFLSLARTLIPQPPPPLVSSRPLPTT
                     FKKVSPQSESNRLFMEGLIREIETLRAQAKEGGGQKVLDRWKAKGTGKLSVRERVSAL
                     LDPASPFLELSPLAAHDVYPDALPGAGLVTGIGMIAGRKCMIIANDPTVKGGTYFPLT
                     VKKHLRAQQVALENSLPCIYLVESGGAALPYQAEVFPDHDHFGRIFYNIARMSGMGIP
                     QISVVHGISVAGGAYMPAMSDVVIIVKDQGRIFLAGPPLVKAATGEIVDEEALGGGDM
                     HTSVSGVADYLATSDSHALRLAREAIRDLCPIPIAQALPSGSTAAGTREVVPPLYPTE
                     DLNAIVPADPRQTYDPREIIARLVDGSEFREFKKEFGKTIITGFAEVHGYTVGIIANA
                     GVLLSPSAQKATHFINLCSQRRIPLVFLVNVGGYMVGEKAERGGIAKDGAKMVRAVAR
                     AKVEKYTFVVGGSYGAGNYGMCGRAYSPRFLFMWPNARISVMGPDQLSTVMHTVQGKR
                     AQENGKAAEDAERKRQELRDAIEKQSMGIYSTARLWDDGIIKPSDTRDILGLALELAH
                     DERAKRPHGAQGTRGEIGADGDNGDWGVFRM"
     gene            498230..499820
                     /locus_tag="CNC01830"
                     /db_xref="GeneID:3256195"
     mRNA            join(498230..498660,498719..498773,498835..498929,
                     498996..499162,499220..499375,499434..499820)
                     /locus_tag="CNC01830"
                     /product="RAS1, putative"
                     /transcript_id="XM_024656708.1"
                     /db_xref="GeneID:3256195"
     CDS             join(498603..498660,498719..498773,498835..498929,
                     498996..499162,499220..499375,499434..499610)
                     /locus_tag="CNC01830"
                     /codon_start=1
                     /product="RAS1, putative"
                     /protein_id="XP_024512394.1"
                     /db_xref="GeneID:3256195"
                     /translation="MSEKGYYGGDQRLVIVGCGGVGKTAITIRFVTSQFYDQEYNPTI
                     EDSYRKQVVVDNEATTLEILDTAGQEEYAAMADQWYTFGSGFLLVYSLTDRSSFEEIK
                     NFHREILRVKDRNYVPCVIVCNKCDLQKYRSVGQLEGRELARSVHAPFIECSAAERVN
                     VDVAFNELIKLVRKDEQRISLAARKLLEGPFLSPPQPPRPKQIKQMKEKDKSGHNRRQ
                     REKNSDDVPFCNDCTVM"
     gene            complement(499331..502926)
                     /locus_tag="CNC01840"
                     /db_xref="GeneID:3256580"
     mRNA            complement(join(499331..499643,499698..500366,
                     500421..501221,501271..502205,502262..502829,
                     502893..502926))
                     /locus_tag="CNC01840"
                     /product="expressed protein"
                     /transcript_id="XM_024656709.1"
                     /db_xref="GeneID:3256580"
     CDS             complement(join(499982..500366,500421..501221,
                     501271..502205,502262..502678))
                     /locus_tag="CNC01840"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512395.1"
                     /db_xref="GeneID:3256580"
                     /translation="MPSPKVPSNDSLLLSGDSPGPRVQWRVGPPLSAGQNGQNTAQSS
                     TSDSSLSKKKKKHEIREKIINGFDSDSEDELDVGEETKPKTNVIGEVAEEPDLDGELA
                     ALVEEQEVDELEDDDDDVNEQIMQKRSVSIDDDISGELLELASGPPKKKKKQAMAPPL
                     SHRPSAQSQRSLSKSQVTPVQITSHRVSRHVPPPSVAPRPTPSVLQHFPSTPNTTIPF
                     IPGFPMNTTIISTANDPYSSPLQILAQSLPSPEMQNILFGTFFSDPILTEGLSLLQPQ
                     FMDHFNRFMERRPARLQRGDATTLALTFIILASALRILPEETSRLLLASHGGSNAPSQ
                     IPRSLAKIISGQSVSAADITPLDQRYLDLALLSAQIAEQADTYSIMLVMFKLVSYRYW
                     MLGHRREESVLAGTWLAQGIKIAQALGFGREWEGLPQGDRELRRRLMWSLYIADRQYS
                     FETSLPYTILDAHQGIQLPSPLSEPDLYRVPQDARELPSVPPDSPPTPCTALLAHTHL
                     ARRVTAMLDSFATISASNISPDMVHHYDQILDTFQDSLPPFFKVFPMTDSRYDASFPY
                     LPLQRVRLHTALFSYRCGLHRAQLPAYLWPTTSATARQVVAQISLSSLRVQRSARMLD
                     AKVAFRLFSPVTVFENAATLCLIMYIDKAVSADAGLSPGPPRSAEFMGMRAGVAEALE
                     LLDMTGAGVDAVALFSKKATVVIRGMVSHVDAPLESVFIQAPASSRRSANGDMPSPTK
                     SNVMSGGGHQPHHMTSDNHARSAGPSPVASTHPAQPGGTPVNNVTSVSSAAAKSAGAG
                     AMDGPLGPYSAKAAAWLESLLQGGPDLERLLREAEWVNGWERVIATM"
     gene            complement(503262..505901)
                     /locus_tag="CNC01850"
                     /db_xref="GeneID:3256629"
     mRNA            complement(join(503262..503718,503780..503960,
                     504013..504070,504134..504422,504476..504526,
                     504587..504683,504754..504971,505031..505100,
                     505153..505468,505524..505724,505789..505901))
                     /locus_tag="CNC01850"
                     /product="MFS transporter, putative"
                     /transcript_id="XM_024656710.1"
                     /db_xref="GeneID:3256629"
     CDS             complement(join(503422..503718,503780..503960,
                     504013..504070,504134..504422,504476..504526,
                     504587..504683,504754..504971,505031..505100,
                     505153..505367))
                     /locus_tag="CNC01850"
                     /codon_start=1
                     /product="MFS transporter, putative"
                     /protein_id="XP_024512396.1"
                     /db_xref="GeneID:3256629"
                     /translation="MPSQEDPKDSIKRDEEEWHENDLEKMDQLELAAQYEPNSDAEKA
                     LVWKIDKRIIPTIWALYTLSYLDRANVGNAKTGGLEADLNLTSTQYSIVLLVFFISYV
                     IFEVPSNMMISRLRPSLYLSGLCIIWGGIAACMAAAKTYQALAGIRFVLGFIEAGFAP
                     GVAFYLSSWYKRYELASRFSLYYTATAVSGAFSGLLAGAITGNLDGARGLAGWQWLFI
                     IEGCASSFLGFFTWFIMPDWPSTTKFLSSDERVLAVQRLAYDGLSSTAGAQGHISHWA
                     AFKMAACDWRTWVFALLYMLTQGAQTIQYFVPTLIGALGWTGYLGQYRTIPLYACAFV
                     CIIGFCWGADYYKAKPLFIIIGGALGTIFFIIVTCVTSHMVQYVFLIFAFGCVYALPP
                     LVLTWVPNVLSHPAEKRGVAIALVNALGCSASIYGVFLWPSEDAPRYIPGFAATTCFM
                     ALIVIITPIMWYLVNRYPIQGPDVDKAVREEIERQKGRGTA"
     STS             505283..506081
                     /standard_name="Xba3"
                     /db_xref="UniSTS:470783"
     gene            complement(506093..509899)
                     /locus_tag="CNC01870"
                     /db_xref="GeneID:3256767"
     mRNA            complement(join(506093..507993,508041..508304,
                     508356..508485,508537..508886,508945..509146,
                     509200..509477,509527..509899))
                     /locus_tag="CNC01870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569555.2"
                     /db_xref="GeneID:3256767"
     gene            506141..507777
                     /locus_tag="CNC01860"
                     /db_xref="GeneID:3256514"
     mRNA            join(506141..506468,506532..506642,506701..506829,
                     506884..507189,507248..507334,507393..507507,
                     507569..507777)
                     /locus_tag="CNC01860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569553.2"
                     /db_xref="GeneID:3256514"
     CDS             join(506563..506642,506701..506829,506884..507189,
                     507248..507334,507393..507507,507569..507733)
                     /locus_tag="CNC01860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569553.1"
                     /db_xref="GeneID:3256514"
                     /translation="MSLANNLTLDILKKAEEGGYGIVAQTCYDANMAVALVRAAERNK
                     SPAILQLFPVTLAAGGGPLLQYCLDVAHNASVPISVHLDHATDPEHLELSIGLAEKGI
                     KFDSIMVDASHADTDEENIAIAVPYIKRCRAAGVATEVELGRLEGGEAGLREITGAML
                     TDPANAEEFMKATGADILAPSYGNLHGSYKFIGGPKYKLEILKDLQERFRGRIPYLCA
                     HGTDELPDSLFQDLVKAGVSKFNINSWARDPYVETLGKELSAGTPFPDASEKAIEAFA
                     QVCDHMMELLGSKGKAA"
     CDS             complement(join(507831..507993,508041..508304,
                     508356..508485,508537..508886,508945..509146,
                     509200..509477,509527..509822))
                     /locus_tag="CNC01870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569555.1"
                     /db_xref="GeneID:3256767"
                     /translation="MTEKQQNSQQPSQLDSTASISALPPQLQQPAAGITGAPGNAEAT
                     TSEPPSTKRPRKAIESSEPLTEVILRRLTTIKEGDTVLLRLPSDLVKSVVVQGDNLVQ
                     LGKYGAFPASQLIGLHYDITYEIVSSSGSGASTPQPQSLDFSTEETQSKKGNKKNKNK
                     GKDTAAVSKNNPGWNNILRPLKRQLVVDAVIDDIVETNEFIEDLSETEKTTLSHDEIA
                     ELRAQGCTPEEIIQAQIARHEKFGLKTDFSKEKWRRRKEKKFYQTVQPLAPSIPNVLY
                     HYNLRSPQSILHLRDDTLSQLLTMANVRPGGRYLVVDDTGGLITAAVLERMGSEGSIL
                     LFNESDSPPAWGILQTMNFSDRELEPIKWLNWLEAEEEYQKPAPPVQAEPPTNPIKAA
                     AKQRKYAAQVAELNNTRNELHLGGWDGLILATTLNPISVVARLTPYLLGSAPIVVYSP
                     YYQVLAELLSWSKKDPNYLNDTLTESWERTYQVLPGRTHPMMTTSATGGYLWNATRVH
                     PSQFQPESHQRFKRRKTGKAPGKEQLSSVAKDEEAVNESLEIDPEELANEGE"
     gene            510095..511597
                     /locus_tag="CNC01880"
                     /db_xref="GeneID:3256303"
     mRNA            join(510095..510556,510603..510807,510857..511170,
                     511225..511597)
                     /locus_tag="CNC01880"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_569557.2"
                     /db_xref="GeneID:3256303"
     CDS             join(510122..510556,510603..510807,510857..511170,
                     511225..511377)
                     /locus_tag="CNC01880"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_569557.1"
                     /db_xref="GeneID:3256303"
                     /translation="MSIPAMAQQPYMSHSPPPLQHPKPTHIAYPPPEPPHTPAQSTDS
                     SPYSQAQRISQDGYLRYSSPPAGEPLASSSGFSSYAPPPTGQQPVQSRQTYGQAGTPG
                     VQGVHGYGVPGYAWPGMNDATAQMGMQFGKSAVAAGQEYVEKNFTRYLPLQLIKISFS
                     VTNSYVLNKLRLILFPWRHKPWSRQSRRSTDNGAVEGWQAPRDDINAPDLYIPTMALV
                     TYTLLCALASGLQSRFHPEVLGLSLSKALAVVITEFCAIKLGCYLLDVRGSGASGVEL
                     VGYGGYKFVGIIATIVVSLLGLGKMITLGVFIYTFAANAFFLLRSLKYVLLPDASVSS
                     SVTTLSHSQRSRRVQFLFFVAVAQVLWMGWLSRV"
     gene            complement(511714..515267)
                     /locus_tag="CNC01890"
                     /db_xref="GeneID:3256691"
     mRNA            complement(join(511714..512776,512835..513403,
                     513444..513596,513648..513780,513827..513953,
                     514004..514073,514125..514270,514335..514681,
                     514742..515267))
                     /locus_tag="CNC01890"
                     /product="Na+/H+ exchanger AnNHA1, putative"
                     /transcript_id="XM_569560.2"
                     /db_xref="GeneID:3256691"
     CDS             complement(join(511859..512776,512835..513403,
                     513444..513596,513648..513780,513827..513953,
                     514004..514073,514125..514270,514335..514681,
                     514742..515035))
                     /locus_tag="CNC01890"
                     /codon_start=1
                     /product="Na+/H+ exchanger AnNHA1, putative"
                     /protein_id="XP_569560.1"
                     /db_xref="GeneID:3256691"
                     /translation="MTAFHPFEVTAPHLAYTFLGGFVVIFGMVSLFVKEKLYVGEAPI
                     ATVVGIIIGPHCLNFFNPAGWGSGTQEVANDITLEFTRVVIAISVFAVGVELPKAYMK
                     RHWRSLFFLLGPCMVWGWMVSALLIWGLIPDLTFLASLVVAAGVTPTDPILAQAVIGG
                     KFADKHVPAHIRHLLSAESGSNDGAAFPFLYIALYLLLDASPGHAVGEWFYMTWAYEI
                     ILGIVIGAILGFCARKFMKFAERKRLVDRQSYVAQYVSLAVLSIGVTSLLGSDDLLSA
                     FACGCAFAWDGFFNKATEDAVFSNVIDLLFNCAAFIYIGAIIPFNHFNDLPDLRVWRL
                     VVLAILVLLVRRLPSIIVCYKFIPDIKTFREALFTGWFGPMGVGAVFISTLARSSLPE
                     GEPEQNTEAVDRLKDVIMPVTLFLVLSSIVTHGMSIPFFSLGRRVHSITYTRSRNLSM
                     DTRGDEPAWTTHARRIIPGQEIIVNRDDDEEGDLGVRRRDTLTSDSNGRITEKIEEED
                     SGESGESSSSRTRQGEMIEMIEKRGSSRHGSQASQGEAAEEGERWRSSRGGSPDLAND
                     PETQREIEEGREEIEDKEGAGRRTPPLAKYREGNHLIVERKIRDSDEVEVEVIRNHFA
                     ENKKTESDRFNHPHRLKSRELDDLLHHLPKSLEHATSRVQDGGKDAVDRLGLGLMGIR
                     TPEPSPPIESHGDSRHDHGYGLERTQSPEGLAGEGRDTEGGGDVSHGSDYEEDEANYE
                     DVPDETPRQRRKRMKPPAIVVSRQNSAGPPKRSIRSRLFGRRQHSSNSPSRAEEGLAP
                     PNHSLLAPSSSRSRPRNIAAEPESILAEDSRGVSSPSQPQNLAIPLTRTLSASRSSPA
                     VRFADDASPSSETAPGQSNYGSNAPGFKKNPALAMYRSASVQSTGSNKDGPSVSFKEP
                     EIKR"
     gene            515482..517889
                     /locus_tag="CNC01900"
                     /db_xref="GeneID:3256136"
     mRNA            join(515482..516074,516131..516355,516547..517615,
                     517675..517889)
                     /locus_tag="CNC01900"
                     /product="structural constituent of ribosome, putative"
                     /transcript_id="XM_024656711.1"
                     /db_xref="GeneID:3256136"
     CDS             join(515486..516074,516131..516351)
                     /locus_tag="CNC01900"
                     /codon_start=1
                     /product="structural constituent of ribosome, putative"
                     /protein_id="XP_024512402.1"
                     /db_xref="GeneID:3256136"
                     /translation="MSRQNLLFTTLRATFAPLAGPSTPRAFSSSQPSLVSTRKLVAKR
                     RKAANLALQASRVRKPDSIDPVLGRVQYKGEAPTNPWEGCRLQRVLLDYNAIAYSMPP
                     DYTAGEQPPYLLPGVSKEDAELLFRAVPHASTELRYASGQGSEKTEQEQARQSEMMMR
                     ILDLRNANKNAINVLNRQRVIDEFGAGVDSGSSAVQAALLTAKIHNLLSHIEENPRDT
                     SNKRALRLLVQERARHLKYWKRKQGEEAYDKLLTDLGLQREAVEGELFIGF"
     gene            complement(516479..519515)
                     /locus_tag="CNC01910"
                     /db_xref="GeneID:3256510"
     mRNA            complement(join(516479..517222,517266..517436,
                     517486..517603,517659..517753,517804..517858,
                     517909..517929,518020..518085,518124..518217,
                     518268..518581,518633..518654,518707..518851,
                     518902..518949,518997..519044,519097..519199,
                     519240..519515))
                     /locus_tag="CNC01910"
                     /product="methylcrotonoyl-Coenzyme A carboxylase 1,
                     putative"
                     /transcript_id="XM_569564.2"
                     /db_xref="GeneID:3256510"
     CDS             complement(join(516551..517222,517266..517436,
                     517486..517603,517659..517753,517804..517858,
                     517909..517929,518020..518085,518124..518217,
                     518268..518581,518633..518654,518707..518851,
                     518902..518949,518997..519044,519097..519199,
                     519240..519469))
                     /locus_tag="CNC01910"
                     /codon_start=1
                     /product="methylcrotonoyl-Coenzyme A carboxylase 1,
                     putative"
                     /protein_id="XP_569564.1"
                     /db_xref="GeneID:3256510"
                     /translation="MRPIRGILINRGALAMPQYIKPHRLTRAHHMVAANRTPCGGQYS
                     TVAQHGNLVHLFDGNTELKVGKRPFKKILIANRGEIACAIIRTARRLGIATVSVYSEA
                     DRNCQHVAMADEAYLIGPSPSSESYLKMEKILHIAKLTGAEAIHPGYGFLSESSDFAE
                     KVRDAGLIFIGPSAEAIKSMGSKRESKEIMVAAGVPCVPGYHGADQSYDALLKGSQQT
                     GYPLIIKPTHGGGGKGMRIVRDPLTLQDELLSAQREALKSFGNDEVLLERWLEKPRHV
                     EVQVFGDQFGNCVALWERDCSVQRRHQKIIEEAPAPGLSPALKRDFAEKAVAAAKAIN
                     YVGAGTVEFIMDAETGEHFFMEMNTRLQVEHPVTEMITGMDLIEWQLSIAAGNPIPYT
                     QDKIPCIGHAFEARIYAEKPEYNFLPDTGKLFHVRSPINTPHRLETGFQEGDEISSHY
                     DPMIAKLVVHGKDRPQALSLLRSALAEYQIVGPSTNIEFLKSVAEHDDFAAGSVETSF
                     IPSHHDELFPPRVVPQDILAQAAVFLVLRAESGQKSLAPAGPWASLVHRRFSDICTFS
                     FRLDSEQVTVNPVESGYHVAIAGQDLYSQLIQSCVTSSTEFSAQIGPKKIQSTIIPIF
                     VNGLEKLHIFSSSSHYVITHHPSPLEGIEGPQSSSSSGTGTLVSPMPATVIEVKVKKG
                     DKVKENQVLCVLESMKMEINLRAERDGVVGEVRAEKGKGVEEGEILVLLEP"
     gene            521279..523892
                     /locus_tag="CNC01920"
                     /db_xref="GeneID:3256131"
     mRNA            join(521279..521326,521384..521527,521593..521822,
                     521881..521928,521989..522040,522091..522813,
                     522860..522926,522983..523353,523404..523468,
                     523527..523892)
                     /locus_tag="CNC01920"
                     /product="cytosine-purine permease, putative"
                     /transcript_id="XM_024656712.1"
                     /db_xref="GeneID:3256131"
     CDS             join(521637..521822,521881..521928,521989..522040,
                     522091..522813,522860..522926,522983..523353,
                     523404..523468,523527..523589)
                     /locus_tag="CNC01920"
                     /codon_start=1
                     /product="cytosine-purine permease, putative"
                     /protein_id="XP_024512364.1"
                     /db_xref="GeneID:3256131"
                     /translation="MSDIEKGLQPLDAPKVSDSYEGLPTVDAGVYSGKHNAGEPTSRW
                     AKFDELNRKLEHKMGIESRGIERVSESDRTDTRLHGNLFIWASANTVLPTLGVGILGP
                     LLFGLGLGDSMLSVFFFNAATACIPAFMSTFGPKLGLRQMTSARYSWGFWGAKLVALL
                     NCIACVGWSIVNTISGAQTLVAVSEYKISAAVGVVIIALVTLFIGLFGYRFVHQYERY
                     SWLPTFITFLVMLGVSAKHLANVPWGVGQAEAAGVLSFGGTIWGFAIGWSSLSSDFNV
                     YMPAEAKSWKVFAWTYTGLIFPLVLVEWLGAAIGCAALVVTDWSDAYHEHELGGLVGA
                     VFIPSMHNGGKFFMTLLVLSVVANNTVNVYSMGLSVSVISNWLAAIPRLVWPCVITAI
                     YIPVAIVGASSFATSLENFLNVLGYWLSIYATVVIEEHFIFRKGRYENYEAASTWNRS
                     DRLPVGFAAIAAGCCGAAGAVLGMAQAWFTGPIGKKVGGTADPSGGDIGWLLAFAFTG
                     VTYPAFRVLEKKWLRR"
     gene            complement(526145..528473)
                     /locus_tag="CNC01930"
                     /db_xref="GeneID:3256649"
     mRNA            complement(join(526145..526361,526419..526744,
                     526802..526997,527047..527133,527198..527812,
                     527866..528473))
                     /locus_tag="CNC01930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569442.1"
                     /db_xref="GeneID:3256649"
     CDS             complement(join(526273..526361,526419..526744,
                     526802..526997,527047..527133,527198..527812,
                     527866..528430))
                     /locus_tag="CNC01930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569442.1"
                     /db_xref="GeneID:3256649"
                     /translation="MPPLPTAPPASIPTPSASVSATPPPSSFLTRTQKFLEENQRLIL
                     LGCAVLAATGAGYYLYSRPDKSSPSTSTTSASKKNKKKKKKGGEKKDDKYLKNEGDRG
                     PLLEEIQPQAVKEDDSEEAIHLQGVPDQKELEGMSESARNELGATLKDRGNKLYSKKS
                     FQKAIECYTKAIEVSVKKVAVFYSNRAACYGNLTPPDYEKCVADCNEAIKLDRTYTKA
                     LKRRATAFENLNRNEEAVRDFTAVTIIERFQDDQASAAVERCLKKLASSRAAEILSKR
                     EANLPSPTFISAYLAAFRPHPKPALPENPSQGDLTLSLAFDALEAADYPHALTYAAES
                     IEQGISSKKGEAEAYNLRGTFKFLMGNAEGARDDLQKSLDIDSGFVQSWVKIASVHME
                     LGDPATAFGDFEAAIRHDADNPDIYYHRGQVYFITQEFDKALADYTKSVQLDSSFIFP
                     HIQTAVCQYKMGNVGSSMASFRRILREFPDRGEASNYYGEILLDQQKFSESLDRFDKS
                     IELDKERKPRNVLPFVNKALALFQWKQDIAGAEALCKEALEIDPDCDVAVATLAQLSL
                     QQGKIDEAIKWFEKSAQLARTEGELINAITYEHASKAQVHFLKTYPEFAERLSQIAQA
                     A"
     gene            533586..536065
                     /locus_tag="CNC01940"
                     /db_xref="GeneID:3256266"
     mRNA            join(533586..533803,533861..533867,533929..533981,
                     534034..534450,534519..534714,534765..534906,
                     534958..535454,535503..535560,535609..536065)
                     /locus_tag="CNC01940"
                     /product="monosaccharide transporter, putative"
                     /transcript_id="XM_024656713.1"
                     /db_xref="GeneID:3256266"
     CDS             join(533675..533803,533861..533867,533929..533981,
                     534034..534450,534519..534714,534765..534906,
                     534958..535454,535503..535560,535609..535912)
                     /locus_tag="CNC01940"
                     /codon_start=1
                     /product="monosaccharide transporter, putative"
                     /protein_id="XP_024512366.1"
                     /db_xref="GeneID:3256266"
                     /translation="MSSSEKGPVVGPGKIVTYGRLHGNALLYAIVGTATTGFSLFGYD
                     QGLMSGIIASDQFNTEFPATFQHDVNDVHAGTVQGSVTSCYEVGCFLGALFAYFFGER
                     MGRRRVMLMGAVIMIIGTIISVCAFGPGDPRGNVGGFVQFIVGRVITGVGNGANTATI
                     PSWVAESSKAHNRGFLICMEASTVAVGTVIAYWIDFGLSFVNSSVSWRFPIALQILFA
                     LVLIGGVMVLPESPRWLIAHGYDHEGLRVIAALDSKAEDDPVAIADKNKVSDAIAAQQ
                     NAKASRKRDILKGGKNQHLRRAMVGASTQLFQQIGGCNAVIYYSTVLFENQIGLDSTL
                     ALILGGVLSIVYAIFALTSFFLVERVGRRKLFLIGTFGQAAAMFITFGCLLPGDAQSA
                     KGGAFGLYLFIAFFGATWLPLPWLYPAELNSMAVRTQANAISTMVNWLFNFTVVQVLP
                     TMTASIGAYTFLFFACINCVFLPFIYLFYPETTGRTLEELDVIFAHAHLTERRPTLVA
                     AELPKLTDFQVQEMTDRYDIHGGAADTENPSAYGAPINAGAPDTSLPPKHPQDDPNYY
                     PDGSRRPSGGTAESGEQTRVTTPSGEKAGATPPS"
     gene            complement(535493..538981)
                     /locus_tag="CNC01945"
                     /db_xref="GeneID:36392777"
     mRNA            complement(join(535493..535624,535682..536043,
                     536116..537478,537525..537703,537763..537912,
                     537976..538373,538461..538670,538725..538981))
                     /locus_tag="CNC01945"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658928.1"
                     /db_xref="GeneID:36392777"
     CDS             complement(join(536318..537478,537525..537703,
                     537763..537912,537976..538327))
                     /locus_tag="CNC01945"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514267.1"
                     /db_xref="GeneID:36392777"
                     /translation="MQPPPNQLPDSPSAAHLPSFFSSFSKTCSSQSRELLGTPPESSH
                     TSRHGKSSKEEAPYSFPHNRIPHPHIGLSTSRWPSENSSQSDALQPLMAQELFVHNKG
                     RKIATASDRIMKAVEDLSDRVTSVQQDVAMLKSDNRYNRDRLHDLQLGQKLLPIRDEI
                     ADEIMNTLTPVMQDIYQSSTSTHCLDNANRSIAQDLTETFFPRLEAMICGLEKTIQES
                     KRDVDMNLERSNNLSEQINCMSDVIKKLDDSLENSSRIFNDCKESFDRFERLIIGTNM
                     NPNVHFVQNNLQESELHVKVNQLSSPSPPSEHVELNKHVTHLVASSASITRVFDLLRV
                     ILSNQTHLKMLVQHLLSTRSSNKLQNLPYQHDPLWSISQHLSLDYLSKAFPNEASQDH
                     TTSAAQLFPTTPSGTMPSNSPDDPSLTGSDLTDIFGSKSYIPGSVSFPCSTFLEEVTS
                     LNSHSRSTAMNQNKPSSNPSVAATASSRACSASTAESTTKRCCKEGKFQRNKSKPITG
                     SALTSTLKRPTTRSTHKAIPRTPPAIGTTKSLINAQTHRRSSKKASHLSSSDVQSSVI
                     PDCKGPVLQPFGPTERDIAVPVLTEARVSKGKKRTWDFSSDEEAEDT"
     gene            complement(539342..540525)
                     /locus_tag="CNC01950"
                     /db_xref="GeneID:3256196"
     mRNA            complement(join(539342..539477,539543..539795,
                     539849..539923,540020..540265,540336..540525))
                     /locus_tag="CNC01950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569446.2"
                     /db_xref="GeneID:3256196"
     CDS             complement(join(539416..539477,539543..539795,
                     539849..539923,540020..540265,540336..540401))
                     /locus_tag="CNC01950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569446.1"
                     /db_xref="GeneID:3256196"
                     /translation="MSQPSKAVLFVFTSAEKLLNGAPTGWYLPEAAHPYYVLSPHYRI
                     EAISTKGGPVPVDETSVKNFQDEDSQKFLKDPEAQNLVKNTKKVEDVKAADYEAMFVI
                     GGHGPLIDLAKSEKFAKLVEDFYVAKKPVSAVCHGPGAFILATNPATRRSIFAGARVT
                     GFSNSEEAQTPYNDFVNILPFSLEDKIKELGGQYEKADQDWGVKVIWDQGVLTGQNPA
                     SAGPLAVKLKEILEA"
     gene            542536..544662
                     /locus_tag="CNC01960"
                     /db_xref="GeneID:3256506"
     mRNA            join(542536..542705,542763..542904,542971..543145,
                     543203..543323,543383..543471,543517..543711,
                     543765..544008,544084..544662)
                     /locus_tag="CNC01960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569448.2"
                     /db_xref="GeneID:3256506"
     CDS             join(542643..542705,542763..542904,542971..543145,
                     543203..543323,543383..543471,543517..543711,
                     543765..544008,544084..544635)
                     /locus_tag="CNC01960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569448.1"
                     /db_xref="GeneID:3256506"
                     /translation="MKLDATDLRYISADEFRVLTAVEMGSKNHEVVPSQLAAELSQIR
                     GGNVKKALGDLAKRNLVARVQNVKYDGFRLTYGGLDYLALRTFSRRKPPSVHSVGTRI
                     GVGKESDIYVVADEHGEKRVLKMHRLGRISFRAIKSKRDYLGKRKSASWMYMSRLSAQ
                     KEFAFMKALYQHGFPVPVPIDQARHCVVMSLVDGYPLRSVEAVEDPADLYSKLMELIV
                     RLAHAGLIHGDFNEFNIMLLRKTGEPIVIDFPQMVSTRHENAEYFFNRDVNCIRRFFR
                     RRFRYEATSWPTWKNVLEIEAGNAENAVQEEVSDGLTDLAMVQNRVRIDLEVEASGFG
                     RALQRELEDYMIEVQDIPASESEEEEEEEEDEDKKEEEEAEALSSHVQGNDEEELSDE
                     AAVAAHLEALRLHRALGNDVSDEDAGPYSEHSLTDFASDDDSDDSDDSTGVAQTDFTT
                     YTPSMRNQPRHHTRLPVKEFEKKGGARSAIAKQVERERHQTERKANAGKTSVKLGKQK
                     GHKWKSSDKYVVGKDSGW"
     gene            545344..548579
                     /locus_tag="CNC01970"
                     /db_xref="GeneID:3256599"
     mRNA            join(545344..545531,545591..546484,546545..546746,
                     546803..547054,547105..547323,547372..547504,
                     547558..547619,547668..547819,547870..547973,
                     548028..548094,548153..548579)
                     /locus_tag="CNC01970"
                     /product="ATP-dependent peptidase, putative"
                     /transcript_id="XM_569450.2"
                     /db_xref="GeneID:3256599"
     CDS             join(545424..545531,545591..546484,546545..546746,
                     546803..547054,547105..547323,547372..547504,
                     547558..547619,547668..547819,547870..547973,
                     548028..548094,548153..548308)
                     /locus_tag="CNC01970"
                     /codon_start=1
                     /product="ATP-dependent peptidase, putative"
                     /protein_id="XP_569450.1"
                     /db_xref="GeneID:3256599"
                     /translation="MLSRSVQVAGLDLFVSSRAASLRCQKYCARSPSNLKEMRIPRKT
                     SQMVSRPCISFRGLHSSTSWNGIFSSRSTTAKPSETQTDVDQPLTPFQARVAELEIKA
                     HANKEDPDAQLEFLRQLSEGGEFAGLVAYYEGMALAEDTSGSQALLRNDEAWAIFMDA
                     LARSGRLGDIVTKVRRRDQLLASIGANGGSSSSAPLVSNPTPSSVSANNSSTSTPSVS
                     SPGPSLTSSLLSRAVSPTSLANASNASTSQSHPGAGSPLNPIYVQMAPPTPQMNAWRA
                     LRWVAGFLLWGFIILTVMSMVIENTGLLKAGPGPVEFEPEEGKIVKFSDVHGVEEAKA
                     ELEEIVEFLKNPEKFSALGGKLPKGVLLTGPPGTGKTMLARAVAGEAEVPFLFASGSS
                     FDEMFVGVGAKRVRELFAAARKKAPAIIFIDELDAIGSKRSAKDQHYMKQTLNQLLVE
                     LDGFEQAEGVIIIAATNFPESLDKALTRPGRFDRHVVVGLPDVRGRIEILKHHMSEVQ
                     YDVDVDPSVIARGCPGMSGADLQNLVNQAAVKASRDGSNSVQLKHFEWAKDRILMGAE
                     RKSHYVTEESKRATAYHEGGHALVALHTPGAMPLHKVTIMPRGQALGITFQLPEQDKD
                     SYTRREFNAMIDVALGGRAAEEMIFGHDNVTSGCSSDLQRATDVATRMIRNYGFSDKV
                     GLVAHGDEESVYLSSKKKDEIESEIRSFLDQSMTRTENLLKTHENELHRLADALIEYE
                     TLSLDEVKQVLEGKRLSRPTTEGESLKGQGEKSGKGPIVDGI"
     gene            complement(548697..549899)
                     /locus_tag="CNC01980"
                     /db_xref="GeneID:3256712"
     mRNA            complement(join(548697..548938,548995..549082,
                     549156..549629,549686..549899))
                     /locus_tag="CNC01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656714.1"
                     /db_xref="GeneID:3256712"
     CDS             complement(join(548834..548938,548995..549082,
                     549156..549556))
                     /locus_tag="CNC01980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512368.1"
                     /db_xref="GeneID:3256712"
                     /translation="MSNSPVDPPAPGAFASVNHSTRPAISDCSQDVDTTDNSPRLPCY
                     DLPASPPLAYSPVSIEATEPTCPPSYHNQQSAQEFPRYDMGLFSPIEFPIMTEDLPTY
                     SKMNTEEPNTLAKVLWKWGFLCPLLWFIGMTIMWIPLKSTEEEHGPEKAQKLEEMIVI
                     LRKTELKYAKKCAWAFSGLSITLIVLIVVVIAWSTTR"
     gene            550044..553373
                     /locus_tag="CNC01990"
                     /db_xref="GeneID:3256378"
     mRNA            join(550044..550164,550222..550264,550326..550656,
                     550713..550716,550774..550879,550940..550961,
                     551076..551095,551143..551190,551242..551315,
                     551389..551425,551483..551567,551627..551704,
                     551772..551965,552025..552089,552148..552223,
                     552275..552389,552440..552516,552568..552636,
                     552709..552744,552803..552883,552940..553119,
                     553179..553373)
                     /locus_tag="CNC01990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656715.1"
                     /db_xref="GeneID:3256378"
     CDS             join(550407..550656,550713..550716,550774..550879,
                     550940..550961,551076..551095,551143..551190,
                     551242..551315,551389..551425,551483..551567,
                     551627..551704,551772..551965,552025..552089,
                     552148..552223,552275..552389,552440..552516,
                     552568..552636,552709..552744,552803..552883,
                     552940..553107)
                     /locus_tag="CNC01990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512369.1"
                     /db_xref="GeneID:3256378"
                     /translation="MEKSSSGYGAAPVALSYEQQLKETGQSEFHESVGEAQAPSSMAL
                     KVAGLHDDGLAPGTEARKRIEKRLKLKLDLRFSILIVIYILNYIDRNNAAAARLKGFE
                     EDLNLTGQRFPTILSILYVGYILFQVPSNMLLNHIGRPSIYLPIAMLIWGMISVLTGV
                     CHNYVGVLLTRLFLGVVEAAFLPGALFILSKWYRKDEISLRYTLLYCGNLISNAFGSL
                     IAAGVLANMDGKLGHAAWRWLFYIEGALTMFFALIAMIMLPDFPHNSKRGFTEEELKV
                     AQLRMLEDVGEIDQDSKDEKWHTGFIMAITDWKIYILMGSLTTCVTGLSFNIYFPTLT
                     KTLGYGTTETLLLAAPPWIFSCLLALANSTHSDRTNEKFWHSTWPLLMGIVGFIISIA
                     VPPEKKAGRYVALFLQAGSYAGYIIMYTWMSSSFPRPPAKRAVALAFMNAMSQVGNIV
                     GSYIWPTKFGPSYAKSYGIVLSMFGATILLNMWFRIILMRANKRLEEGERAFDEHGDT
                     LERAAALESTTVQDAMRMQRGFRYLV"
     gene            complement(553404..555348)
                     /locus_tag="CNC01995"
                     /db_xref="GeneID:36392778"
     mRNA            complement(join(553404..553903,553958..554507,
                     554561..554881,554961..555348))
                     /locus_tag="CNC01995"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658929.1"
                     /db_xref="GeneID:36392778"
     CDS             complement(join(554001..554507,554561..554881,
                     554961..555128))
                     /locus_tag="CNC01995"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514268.1"
                     /db_xref="GeneID:36392778"
                     /translation="MSSSTSISSTSSSSQSALFPTSATSSYSALFPTSTASTNSGDGD
                     GDKNSTNVYYLVFLGVLVVLMLIALCLAVRAMRMRRRYRRATRVALARGETVPDTIRE
                     DFWGLGGLAGWTSDGWDRFGAVRPGEQAKKEKKWDKMPVLVEAEAMKEAKLGTGDLWD
                     EIRPLTVQSARLLHELPSFTDSLANFQSRHPTQDVPPRLRQPTLFSRNRNTLFSDTTV
                     PSRRARKKPEDLELNRTIEAGEALRIAVVVQMPTFSVDGQRYRQGDNDEEVAWESGME
                     LGLWEGVVEPHCNAGRHSPDPGQSFQNGTEEEEWRGLARRRSEESYEDGDIALYR"
     gene            complement(557164..559134)
                     /locus_tag="CNC02000"
                     /db_xref="GeneID:3256541"
     mRNA            complement(join(557164..557481,557536..557687,
                     557735..557802,557858..558022,558072..558189,
                     558233..558291,558342..558511,558578..558658,
                     558706..558781,558830..558917,558965..559134))
                     /locus_tag="CNC02000"
                     /product="NEDD8 activating enzyme, putative"
                     /transcript_id="XM_569457.2"
                     /db_xref="GeneID:3256541"
     CDS             complement(join(557289..557481,557536..557687,
                     557735..557802,557858..558022,558072..558189,
                     558233..558291,558342..558511,558578..558658,
                     558706..558781,558830..558917,558965..559081))
                     /locus_tag="CNC02000"
                     /codon_start=1
                     /product="NEDD8 activating enzyme, putative"
                     /protein_id="XP_569457.1"
                     /db_xref="GeneID:3256541"
                     /translation="MTAAHIQSYHSDPTRYAAVDNLLHRKGPWTDERFQGGTETANFL
                     RTKAKILVIGAGGLGCEILQNLALSGFNDIHVIDMDTIDISNLNRQFLFREADVGKSK
                     ALVAAEFVMKRVPGCTVTPYHGRIQDHPTSFYSTFDVIVAGLDSISARRWINATLVQM
                     AQEDEENIKPLVDGGTEGFKGQARVILPTITSCYECSIDMLTPPTAFPICTIANTPRL
                     PEHCIEWASVLEWPKVFRDKKLDTDDPEHIEWLYKQAAARAGQFNIEGVTWALTQGVV
                     KNIIPAIASTNAIIAASCCNEAFKIATASAPYLNNYMMYVGNESVYTYTFEHEQRPDC
                     PVCGGESLVAEVKRDWTLQQLIESLSQRQDLQVSRPSLSFSSGKALFWPSPPDVYEAT
                     KANLELLLSDLVQDNDAIVLVDPALPVSASVTVKFV"
     gene            559321..560597
                     /locus_tag="CNC02010"
                     /db_xref="GeneID:3256461"
     mRNA            join(559321..559512,559573..559692,559745..559847,
                     559897..560034,560087..560166,560215..560597)
                     /locus_tag="CNC02010"
                     /product="exosome complex exonuclease rrp45, putative"
                     /transcript_id="XM_569460.2"
                     /db_xref="GeneID:3256461"
     CDS             join(559349..559512,559573..559692,559745..559847,
                     559897..560034,560087..560166,560215..560455)
                     /locus_tag="CNC02010"
                     /codon_start=1
                     /product="exosome complex exonuclease rrp45, putative"
                     /protein_id="XP_569460.1"
                     /db_xref="GeneID:3256461"
                     /translation="MVREIDPPSVQNEFLLAALAEGKRLDGRLPLQMRDVHYIFGDEL
                     GCVECRLGKTAILAQVSATIVKPRDDRPYEGFLLINSEIGPMASSVYENGRPGDDEVM
                     IGRLLEKSIRRTEAIDREALCILAGEKVWQLRLTLHFLSDSGNLLDCAALAGMAALKH
                     FRKPDVEVIGDEVIIHSPEERAPVPLAIHHTPLCLTFAYFENLPPILDPSHVEMMLCS
                     GTLTLTLNAQREICVLSKAGGAPLGAEEIMGVVKVGVDKVRELVRHLEEELEKDRTSR
                     VVEVR"
     gene            560692..566571
                     /locus_tag="CNC02020"
                     /db_xref="GeneID:3256625"
     mRNA            join(560692..560881,560934..561116,561167..563501,
                     563552..565455,565505..565781,565830..566571)
                     /locus_tag="CNC02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656716.1"
                     /db_xref="GeneID:3256625"
     CDS             join(560865..560881,560934..561116,561167..563501,
                     563552..565455,565505..565781,565830..566333)
                     /locus_tag="CNC02020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512371.1"
                     /db_xref="GeneID:3256625"
                     /translation="MDRLFRKKSSRTSEKLLNSSKRKSKQSAALSESSGDDGSKDVYG
                     EKRVPGVAPSLDVDIRNSLILPSLSQRFSVLLPPLATAPEDSIRTLLASQRARIHGPA
                     LTEEEEELLFAELRASERNEWYRMPPKSNCDDDRIRTPNSKADIIPNPVSPFIETSAP
                     SPSINVSDDGQSSPLHPGSSPLISSPPPTSNSFSSFKTFGVASSPEQPTLGSLKSKEL
                     ESGMGGSMGLRENAYLRRAPEQGGTNDLKYTSGKSRGKKEQGDKGDVPTTTLMKTATD
                     HDLKPQSRIPDSSMRSESTMASLSSVVGPHSHATPIINTLRPDLGSPELSNFAGQPRQ
                     RYSKSLLSELTPAQIKRISMALEEIGGQLKRGGNIMENNIHKECEHTAGDEEEVLASG
                     ESQKNLSGNQDEMRGERPRRPSDVFSEGSRSATSSVFPFKTSPTNSTFTGRSANTLTN
                     TDSASPSRLPSSPRSHNLRAVVNEDIPPVPESTLTPTRLQPVKANSILSNASAASTPT
                     PSLVLHNPAYVPGQPRPIRPTHHGEGSLSSRAATPNGQPHFDILLNSRSVTPDSQSPP
                     NTLRSSAAYSDATQSTNTSPSPLLHYPISLAKATSLSRSYSVNQASLPIGGDSDQSSV
                     TRRRAGTITLGETESGRGLNFSSEAHPFLQREIVEEEEYEHEEEQKTRSREHLKEEEN
                     DAGSTLELKEAINRHSLGASWYDPKTSIDEEESFQNGHKSQARDVVETAIFSLDALRT
                     DDETAEGAGFFSPIPLQRLSCDSLDSVFDPKQDVPQWIDIFDGNDFVRVDSETDDISD
                     WPEKPELLLEKITGLGVEELMLLQEELVTKARREREAMGLGFSPLISDTPTIPKQYCS
                     LKQQSPRLNVEGPPAVDARTTNPMTMNGIIPVTSAMESSSSMASQIADTIPCAPQRPV
                     LDMPPQPLPAPPTQEVPNAESFSSATRMRGNVIDNTTESLETEKEKDFRTRIAAATAA
                     LNRNPSIQGARLERKNTKRGAAMVISSPKLLSSTAKVPTHPLTPPDHPSAVDSILEKS
                     LEKMSGSGSKMSQKWKKLMKKGPSVSSSEAFKPVHPMSAANSGSTDPNSIPQPAPVAR
                     LQRSNSQSVSRTLGAPIQLRQEANTAISLSSAPPDLKSFQFPRRIDQREGSNADQKTC
                     PAMTISQVPTRVITPPNTTVHGDAPLDQLSERTQSPTQDTAILNFLQAGRQLGLKEDQ
                     LKAILVQKEMLNDSDTIASKDSALPNSEPVLKISPSSSARQRSPTPIWQAEKAIAKQK
                     KEGLFRSLSKKARELPIRMRTPEPPQKEVVTPVSVSRPLHDKVVLRRTMIFPDGLTPS
                     AFQMSSDVTPGSPSSSNVGRQPSQRKLSIRRKPLNLSKEDRELVSNSPPAHQTGFGSN
                     ASPSQKHENIAHEDQNFGFVYRNPAHRADDSTKRRSLASMTLSRRSLSGMSERSSTAG
                     SLIDMYGDDRNGGEEMLLKSPPLDRDSRIIETIQNGPAQAVEICEYADGQVVWSVVDA
                     LRTSVAASVDENDGPFGHRLSQSSSNYSANKVSVFGEKHDYFTETESMSRPSGANIAP
                     LNVRHIANRKSIIKPRPPTDVYFTSSHDVADLIDHLSRDLEASRGRIDIISSHDSSVD
                     TDRPFHHTPFNIEQHRTPGSPSSNSQFEDAPSPAPPPRRIPFSQRIHPRSPRSYHPAS
                     EINIEEETSLKHHVGHQIGRSSNTNSFTNCETHDPSSRHFANSSHVQGKSLEYRLQEL
                     MDRMRNAKPDGRR"
     gene            complement(567292..569131)
                     /locus_tag="CNC02030"
                     /db_xref="GeneID:3256803"
     mRNA            complement(join(567292..567715,567771..568070,
                     568122..568221,568302..568488,568558..568978,
                     569049..569131))
                     /locus_tag="CNC02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656717.1"
                     /db_xref="GeneID:3256803"
     CDS             complement(join(567356..567715,567771..568070,
                     568122..568221,568302..568488,568558..568909))
                     /locus_tag="CNC02030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512372.1"
                     /db_xref="GeneID:3256803"
                     /translation="MFPHRHPHTIHWIVVSLVLFLSSLTSSQSTATVTSSSGVSSVTQ
                     SSWTESSLKEDTQTTARIAAVNDTTFGTAGGTAPQSDTTATTTTHNLVTATTPIPLAA
                     TLGLIMPNPWQTLYTELNYTFGFVDAVPRPAPTYGGWMREVVPLIIMSNYTVDVLPSS
                     GSEDPTSVEAIPVGSTGLCGTTAENFPIGYPFRFTTPGWYMFVVNQTYMQANITENNQ
                     CSWPILQQKSFFATQIFSLAAYPTVSPGPASPTSAYTVWADVSTTTPGSLPIDAEPTT
                     EGQKLGLALGIAGGVLGLAIIASIIWWVRKKRNLEAECLAFSRLPSQEQEAFLREHAK
                     NLRPFLNTRQPQYPDRNGLYRYQAPPSAPPGTMAYALWYSRQLWNNQVMQRQNPSIWN
                     NKYGFEPRMGNAVALGPESNMLNPVHIPYAQQHAQVYGPH"
     gene            569300..571582
                     /locus_tag="CNC02040"
                     /db_xref="GeneID:3256292"
     mRNA            join(569300..569589,569640..569750,569810..569890,
                     569943..570838,570888..571582)
                     /locus_tag="CNC02040"
                     /product="DNAj protein, putative"
                     /transcript_id="XM_024656718.1"
                     /db_xref="GeneID:3256292"
     mRNA            join(569300..569589,569640..569750,569810..569890,
                     569943..570838,570888..571260,571318..571582)
                     /locus_tag="CNC02040"
                     /product="DNAj protein, putative"
                     /transcript_id="XM_024658930.1"
                     /db_xref="GeneID:3256292"
     mRNA            join(569300..569589,569640..569750,569810..569890,
                     569943..570838,570888..571030,571318..571582)
                     /locus_tag="CNC02040"
                     /product="DNAj protein, putative"
                     /transcript_id="XM_569467.1"
                     /db_xref="GeneID:3256292"
     CDS             join(569386..569589,569640..569750,569810..569890,
                     569943..570838,570888..571030,571318..571394)
                     /locus_tag="CNC02040"
                     /codon_start=1
                     /product="DNAj protein, putative"
                     /protein_id="XP_024512373.1"
                     /db_xref="GeneID:3256292"
                     /translation="MPPRITSRALSTLSTAQSSAGSSSTLPPSTFSLRQHKRSPSSHS
                     FTFRHFGPLLAHPRNPSTASLGWRRSFHSSTVHPASAKDPYNVLGVNKDASSSDIKKA
                     YYSLAKKWHPDSSKEKDAKEKFHEIQAAYDILSDDKKRQAYDRYGSASTQEGFDPNFA
                     HGAGGFGGFQGFGPGFGDGASDLFESLFGGAFGGGSSAFGGRQRPVRGDDLEVGVNLS
                     FLEACNGVTRKVTVTPVIDCKTCTGSGLKPGEKKSQCPACRGSGQRTFQVQGMVMAST
                     CQTCGGTGSTIPKNARCGECDGVGKVKEKKVLDVEIPAGVEDGMMIRVPGAGDKPLSA
                     SGPAGDLLVRVLVKPSSVFRRQGVNLYHDAKVPLHIALLGGVIRIPTLEGDVDVKVKN
                     GTQNGEEAVLKGRGVKSVYGGRRNDRGDLIVGWKVQIPRSLTPFQRKILQAYADDIEG
                     RNPQVHFGPLPSDPPVTNPSSPPKEPTNGETKKEIGEEGRQTKSEEDEVGGKI"
     CDS             join(569386..569589,569640..569750,569810..569890,
                     569943..570838,570888..571030,571318..571394)
                     /locus_tag="CNC02040"
                     /codon_start=1
                     /product="DNAj protein, putative"
                     /protein_id="XP_024514269.1"
                     /db_xref="GeneID:3256292"
                     /translation="MPPRITSRALSTLSTAQSSAGSSSTLPPSTFSLRQHKRSPSSHS
                     FTFRHFGPLLAHPRNPSTASLGWRRSFHSSTVHPASAKDPYNVLGVNKDASSSDIKKA
                     YYSLAKKWHPDSSKEKDAKEKFHEIQAAYDILSDDKKRQAYDRYGSASTQEGFDPNFA
                     HGAGGFGGFQGFGPGFGDGASDLFESLFGGAFGGGSSAFGGRQRPVRGDDLEVGVNLS
                     FLEACNGVTRKVTVTPVIDCKTCTGSGLKPGEKKSQCPACRGSGQRTFQVQGMVMAST
                     CQTCGGTGSTIPKNARCGECDGVGKVKEKKVLDVEIPAGVEDGMMIRVPGAGDKPLSA
                     SGPAGDLLVRVLVKPSSVFRRQGVNLYHDAKVPLHIALLGGVIRIPTLEGDVDVKVKN
                     GTQNGEEAVLKGRGVKSVYGGRRNDRGDLIVGWKVQIPRSLTPFQRKILQAYADDIEG
                     RNPQVHFGPLPSDPPVTNPSSPPKEPTNGETKKEIGEEGRQTKSEEDEVGGKI"
     CDS             join(569386..569589,569640..569750,569810..569890,
                     569943..570838,570888..571030,571318..571394)
                     /locus_tag="CNC02040"
                     /codon_start=1
                     /product="DNAj protein, putative"
                     /protein_id="XP_569467.1"
                     /db_xref="GeneID:3256292"
                     /translation="MPPRITSRALSTLSTAQSSAGSSSTLPPSTFSLRQHKRSPSSHS
                     FTFRHFGPLLAHPRNPSTASLGWRRSFHSSTVHPASAKDPYNVLGVNKDASSSDIKKA
                     YYSLAKKWHPDSSKEKDAKEKFHEIQAAYDILSDDKKRQAYDRYGSASTQEGFDPNFA
                     HGAGGFGGFQGFGPGFGDGASDLFESLFGGAFGGGSSAFGGRQRPVRGDDLEVGVNLS
                     FLEACNGVTRKVTVTPVIDCKTCTGSGLKPGEKKSQCPACRGSGQRTFQVQGMVMAST
                     CQTCGGTGSTIPKNARCGECDGVGKVKEKKVLDVEIPAGVEDGMMIRVPGAGDKPLSA
                     SGPAGDLLVRVLVKPSSVFRRQGVNLYHDAKVPLHIALLGGVIRIPTLEGDVDVKVKN
                     GTQNGEEAVLKGRGVKSVYGGRRNDRGDLIVGWKVQIPRSLTPFQRKILQAYADDIEG
                     RNPQVHFGPLPSDPPVTNPSSPPKEPTNGETKKEIGEEGRQTKSEEDEVGGKI"
     gene            complement(570642..573378)
                     /locus_tag="CNC02045"
                     /db_xref="GeneID:36392779"
     mRNA            complement(join(570642..571406,571469..571710,
                     571760..571925,571979..572221,572272..572507,
                     572564..572882,572940..573130,573182..573378))
                     /locus_tag="CNC02045"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658932.1"
                     /db_xref="GeneID:36392779"
     CDS             complement(join(571585..571710,571760..571925,
                     571979..572221,572272..572507,572564..572882,
                     572940..573130,573182..573319))
                     /locus_tag="CNC02045"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514270.1"
                     /db_xref="GeneID:36392779"
                     /translation="MEPLISQFISHVDQCFAARSADNIVSSLPLDETHPFYGPLVQAL
                     ALSNPAALASSNIHPRLTTLPGELKENLSTLISALLRNIRGETDDHEVDQEERAYRKF
                     NRLQQIYSEANKIFGLSDAEGSTSYAFLNPLIKHLSQKISQSSDAAASLSTYPLRHPK
                     SARSIRDATRQLIERSMQIASVPMSELEWNNAREQQHAVGDIIWPLANELFRIYAQRK
                     LHTQSTELQKSLHNLIPPEDERLTSRQNSIRVTDVCQSYYWRGKLGVVLLDMRGAVFW
                     LQKAWATCPQDTSGWKQRRSIIIRLIAVNLLLGRLPCPKTLETYDLPQFRPLIDSFRT
                     GNIPLWRRVLEEHREWFRRRSIWLVLYERGEILLWRNLFRQALKLYYRVDPMASKGRC
                     PTWIFIAAASQAFAGSSEIEDATIEIEDIIVIVSSLIDQGLILGYLSYSHKQLVMKPS
                     PDGMGGFPKIAQVLPRRIEAIH"
     gene            complement(573708..576428)
                     /locus_tag="CNC02050"
                     /db_xref="GeneID:3256698"
     mRNA            complement(join(573708..575316,575382..575441,
                     575506..575560,575617..575746,575800..575979,
                     576035..576428))
                     /locus_tag="CNC02050"
                     /product="expressed protein"
                     /transcript_id="XM_569972.2"
                     /db_xref="GeneID:3256698"
     CDS             complement(join(573958..575316,575382..575441,
                     575506..575560,575617..575746,575800..575979,
                     576035..576335))
                     /locus_tag="CNC02050"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569972.1"
                     /db_xref="GeneID:3256698"
                     /translation="MRHRFYLPTIVRDQTFLSFVRQRHHSHHHPYLTPSLPSLTPKHE
                     PDLSSDAPPGSSSAASEKDITSVLSLLREDYVAVKEHIKVMDYKQVLKRAAQRHMYKW
                     YAILIIAGTLTALITAKHDAVVDFCRPITEKIRSWPAGWLVPIAILVIVSFPPLVGHE
                     IIGILCGLVWGLWVGFAILAAGTFVGEIATWVAFKWCCQTRAAKFEKKNRLYAALTQL
                     IREKSFMFVLILRFSAVPGHITTAVSASAGANFWSYLLAAFLTLPKQWTIVYLGKAFG
                     TTNRTNTIISVLTTVLTILATAVAAVYIYYQMRLVMRRWTLALPAHVESSSTSNITLS
                     EWADEKGQDGLYTRRRWMASNGSDEYVNRCEGRTLTRSWSMPEHMSEEELKEWVKSLE
                     NEEYASSASAQLSAETGDDSASESAANIKINIQMELGSLLPTSWPPVTPRFPEPSNNV
                     MKSPGLGIPQSVSRDSNCSSPSPPLLELDNAYTPTLASRRPSYSRRIPSSSSISFDVP
                     CTIPGTTCPHRVGGREVADEADAYAIAHGARRPEFRRMRGDSRAALLGRPVDDAALHQ
                     CGSSWRREYSHSYGRSRGSSNATLSRSDIDELGRARGDSVSTAGTGYSYGPPTLADLG
                     VVRGEGGYVRMDQPQRGKGESSAAVLGGLIDEGLRTEISRDRNDMESYQREGSTILKG
                     NEGKNQLGDENV"
     gene            complement(576439..579527)
                     /locus_tag="CNC02060"
                     /db_xref="GeneID:3256683"
     mRNA            complement(join(576439..577318,577370..577521,
                     577577..577666,577717..577800,577858..577933,
                     577985..578093,578151..578243,578300..578441,
                     578490..578628,578684..578758,578825..578942,
                     579030..579527))
                     /locus_tag="CNC02060"
                     /product="histone deacetylase 1-1 (hd1), putative"
                     /transcript_id="XM_569971.2"
                     /db_xref="GeneID:3256683"
     CDS             complement(join(576723..577318,577370..577521,
                     577577..577666,577717..577800,577858..577933,
                     577985..578093,578151..578243,578300..578441,
                     578490..578628,578684..578758,578825..578942,
                     579030..579335))
                     /locus_tag="CNC02060"
                     /codon_start=1
                     /product="histone deacetylase 1-1 (hd1), putative"
                     /protein_id="XP_569971.1"
                     /db_xref="GeneID:3256683"
                     /translation="MSSAAIHPPLDFSPVRPDGRRVAYYYDHDVGNYHFGLGHPMKPH
                     RIRMTHNLVVNYGLADDYEAMEEEGRRKVNARMGMENDEARWVNAEMRGSRAKRMQIF
                     RPRRATKTDMTRFHTDEYIELLESVLPENADALTGNRSRGLTGSDCPAVEGIFEFSSI
                     SAGGSIGAAEKLNEGIADIAINWAGGLHHAKKTEASGFCYVNDIVLGILELLRVNSRV
                     LYIDIDVHHGDGVEEAFYSTDRVMTCSFHLFGNFFPGTGTLKDVGLGKGKGYAVNVPL
                     REGITDEGFHSIFKPVIAEIMEHYRPCVVVLQGGADSMSGDKLGRLNLSDKGHAECAK
                     FLRTFSVPLMLLGGGGYTTKNVARAWTRETAIACGQELSEDLPSNQYMEYYGPRYKLE
                     VLPSNVEDFNTPEYLEDLKRQISNHLKNLPFAPSAQMRQITGSNVSQAVGLSNEWETD
                     DPEDQIDQRLKKLFASKNLNGTYTQESDALLSDLTSISRIRRQGGPKKLPRSSGTCGR
                     ARKRYLEDIAMGEDPCCLLPAMTSKKNERKTIAKSGSSAPPTSAPEWHAHLTVHEMKS
                     RPSLGEILQQPSPGSEDECDRNRCITEGSQLHMIAQGRGKRSFFSRKGLPPSIISPQA
                     IIGGSTVKVDRLIRARMAAATNNSPVVVEWDRQQE"
     gene            complement(579811..583725)
                     /locus_tag="CNC02070"
                     /db_xref="GeneID:3256436"
     mRNA            complement(join(579811..579887,579939..580018,
                     580078..580462,580518..580691,580740..581043,
                     581089..581337,581389..581504,581561..581694,
                     581748..581894,581944..582146,582196..582264,
                     582310..582439,582494..582977,583031..583110,
                     583156..583323,583395..583725))
                     /locus_tag="CNC02070"
                     /product="importin-alpha export receptor, putative"
                     /transcript_id="XM_569470.2"
                     /db_xref="GeneID:3256436"
     CDS             complement(join(579872..579887,579939..580018,
                     580078..580462,580518..580691,580740..581043,
                     581089..581337,581389..581504,581561..581694,
                     581748..581894,581944..582146,582196..582264,
                     582310..582439,582494..582977,583031..583110,
                     583156..583323,583395..583631))
                     /locus_tag="CNC02070"
                     /codon_start=1
                     /product="importin-alpha export receptor, putative"
                     /protein_id="XP_569470.1"
                     /db_xref="GeneID:3256436"
                     /translation="MQATPETLSLLTNYLSSTVSPDAHTRRSAEESLRQAEGQQGFLL
                     LVLELVKADSVNMIVRQAGGVYFKNTVKRLWSGDEETQIDPADKAAIKSQLVPMMIAL
                     GTPQTSRLQSQIGEGLSHIASLDFPGEWEGLCDELVNSLTPDNFVINNGVLATAHSIF
                     KRWRSQFRTNELYSEINFVLSRFCEPYYRLFQHVDQLLQTPPASLPTNSSILLLGQSL
                     LLLIQLFHDLSSQDLPPFFEDHMTEFMGGDQPGWLRKYLDWEVKELKGDDDDEAPGPL
                     QKIRSSICEIAELYAQKYSDVFTQLGSFVDGVWNMLTRVGTSTREDVLVSRALRFLSV
                     VVKMGNHRAMFAASETLNAFCEKIILPNMAIREHEEEMFEDDPMEYIRRDLEPSTESD
                     TRRQAATDFTRALMELFEKEVTGIIKGYISVFLQEYNKNPVGNWKSKDTAIYLLTSIA
                     SRGSTQQLGVTSTNVLVDVVDFFGQNVFSDLQAAPGSVHPILTVDAIKFLYTFRNQLT
                     KDQLVSVLPLLVQHLASDNYVISSYAAITIERILFIKVERQALFTQADIRPFAENILM
                     ALFANIEKGGTPEKIAENDYLMKCVMRVIITARTSLTPSHEGILTRLVNIMGEISKNP
                     SNPKFNQYCFESVSALIRFVCEGTPAALPTFENALFGPAQHILTNDVAEFIPYIFQIL
                     AQLLELHSPSELPPAYQALTGPLLSAALWEQRGNIPALVRIWKALLLRGAPSIVAAGQ
                     VQGLLGIFQRLAGSKVNDVWAFELVQALYEFVPIEVMRPFSQTVFVLLLNRLQGKPST
                     QFNHCFVYFFAFLANLDSVGADFLVGVLEGIQTGLFGNLLTGVILSNSQKITARNRKL
                     VEVGLTKTLSRSDSLLVEPNRQFWPPIFLALLDMFTLPQDITYANPEGSGDITELDPE
                     EAGFQSSFSKLGASEKTVSDPTAGVEDSKVFAAKELAKRSNEKPGMLGPLIEAAQKEE
                     QVTVTNFVQFMATSGNTIS"
     gene            584561..586502
                     /locus_tag="CNC02080"
                     /db_xref="GeneID:3256756"
     mRNA            join(584561..585142,585217..585305,585363..585473,
                     585529..585690,585742..585901,585955..586077,
                     586132..586502)
                     /locus_tag="CNC02080"
                     /product="expressed protein"
                     /transcript_id="XM_569472.2"
                     /db_xref="GeneID:3256756"
     CDS             join(585021..585142,585217..585305,585363..585473,
                     585529..585690,585742..585901,585955..586077,
                     586132..586429)
                     /locus_tag="CNC02080"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569472.1"
                     /db_xref="GeneID:3256756"
                     /translation="MIRVNSPLQGLIAFSLLSTSVFARSDRICPEDPYASPSTDTCNP
                     MRYIPNKGINIAAAVLYFIVAAILTFHSFRQKANYFLALVIGAWCEGIGLVLRVAFRT
                     NPHSTGLYIVCYLFVVLSPCAFLAGDYILLGRLVQYLDAHHYLRPLRAQLVSWIFIVS
                     DVITFLIQAAGGGLSTATDVQTAQNGGHIFLAGIAAQMASFIFFTIAWLIFGIRAWRE
                     DKELWRRPGWKPLFFALGFTCICFLIRSFYRTVELSQGYVGYLAIHERYFLGLDCLPL
                     LLGIATYVFFWPGKYLRFAPKPKKSKESKESKKSKKSKKSKKSKNGVAEDVEEGLPMH
                     DLNGEGLGDMVKGDENYQMR"
     gene            complement(586491..587273)
                     /locus_tag="CNC02090"
                     /pseudo
                     /db_xref="GeneID:3256165"
     gene            588010..589759
                     /locus_tag="CNC02100"
                     /db_xref="GeneID:3256774"
     mRNA            join(588010..588394,588444..588532,588587..588735,
                     588797..588920,588970..589129,589190..589759)
                     /locus_tag="CNC02100"
                     /product="integral to membrane protein, putative"
                     /transcript_id="XM_569475.2"
                     /db_xref="GeneID:3256774"
     CDS             join(588276..588394,588444..588532,588587..588735,
                     588797..588920,588970..589129,589190..589577)
                     /locus_tag="CNC02100"
                     /codon_start=1
                     /product="integral to membrane protein, putative"
                     /protein_id="XP_569475.1"
                     /db_xref="GeneID:3256774"
                     /translation="MRRSTLFEVLILSSLVSSAYALGGDRDCPADPYADPANDTCNPL
                     RYIPNMALNCLGAALFLIVAAILTFYSFRRKANYFLCLVIGAWFEGIGFVLRVLMRDN
                     LHNLNLYIVANLFIVLAPCAFLAGDYILFGRLVQFLEAHHHIRPFKARQVSWIFISSD
                     ILTFLIQGSGGGLSASSSIDSAELGAHLFLAGIVIQMVSFIFFSCVWVLFGIRVFTGD
                     KQLWHREGWKPLYFALGFTCICFIVRSIYRTAELSGGYISYLSTHEGYFLGLDSLPLL
                     LGIATYIFFWPGNYLQFDGNPFKKSKTRRIEEGAQMYPLKAGDSYETQPGLDAKMTPT
                     YTNHYERR"
     gene            complement(589675..591973)
                     /locus_tag="CNC02110"
                     /db_xref="GeneID:3256186"
     mRNA            complement(join(589675..589978,590030..591245,
                     591329..591502,591571..591649,591719..591973))
                     /locus_tag="CNC02110"
                     /product="expressed protein"
                     /transcript_id="XM_024656719.1"
                     /db_xref="GeneID:3256186"
     CDS             complement(join(589936..589978,590030..591245,
                     591329..591502,591571..591649,591719..591748))
                     /locus_tag="CNC02110"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512376.1"
                     /db_xref="GeneID:3256186"
                     /translation="MPPIVELLVPPLWNSWPTTLAVHLVPSSSSVDMPLEVTPAPFAA
                     SQRLPYVPAVPRPADSGGGMFPSGASSLDGAGPAMAAASAIIPPAPGGVAGPHRAIPA
                     LPDAGYTSVNPPWFSMRSQGPPSIYSSSYAGPCSLYDSELREPPHYQGHIYSHHPVIR
                     NENWASSSLPAPRRGPPSPDSVMIHHRHHHHHHRRHHDHDDDLDRKSDTSYYAMPKDK
                     QRSRAGSVSSVPDTEGLNESQAYRRRSRSISQGQTYKRHRSPSLPPGNVHHLHTSISP
                     SPLAVNDGELPGNVGHSVLPPLDAARRPQRMSLPPEEEHRPRPQLFVPPGYEAPELRK
                     GKKQDIRGGFEATDERRGRHSSAASEDSVRSHLHRNNSTFIPGGFQTHSRHRSGSYLL
                     PESGYDRSASPPLVMHGPASAVSGPHYPPDIEGNYRRRTASMQGLERPEQTSSEYQIP
                     SMAGGQVVYDDSASVASDSRMTLEDGAVSGRTSQYGLPRYPHQPKMDYRRFCVQRGNA
                     DVFLD"
     gene            complement(592226..595877)
                     /locus_tag="CNC02120"
                     /db_xref="GeneID:3256527"
     mRNA            complement(join(592226..592705,592754..592833,
                     592892..593162,593212..593327,593376..593753,
                     593803..593876,593925..594593,594643..594789,
                     594841..595226,595343..595434,595565..595698,
                     595755..595877))
                     /locus_tag="CNC02120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569479.2"
                     /db_xref="GeneID:3256527"
     CDS             complement(join(592404..592705,592754..592833,
                     592892..593162,593212..593327,593376..593753,
                     593803..593876,593925..594593,594643..594789,
                     594841..595226,595343..595434,595565..595698,
                     595755..595793))
                     /locus_tag="CNC02120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569479.1"
                     /db_xref="GeneID:3256527"
                     /translation="MSDGRSTGRQDNLHYPVQAGHTVSLVPRSQTQERETHPELQGIT
                     RNYLGSDPNSGHIRDQSLDMPEGEGYGMTDIPHNSSKSHLTPADGNAPYTGASTPNRV
                     HYPPSPLMPRGQPQGDAYTTIPLQDGHSNASVSGATTPHSESMNKRKWSFLPGNRSSA
                     SLEKSGVDEKGTKRRPKNQRGTSWDLLGDRGEWEEFSPKNASVENLRFAEGDVGTNKF
                     SRLYYWALNKGIIVRWAMYIIPVLILFWIPGIIFYAGLRDAKVWSVTLNWWSIWLTII
                     WLTFWGATAAFMMLPHVWRNTVAVIVPSAKPLTDIIAALGRYAKLTIWCLAIWVSFTP
                     LIVNHYTGDESATSRSDLSTVANLLFGLFLCSIVYCVEKLIIQLIALQFHRDSYEDRL
                     QEQKFCLKALTYLYTNSHDIPGRTDTLTDAMSTKTKGSQMPKVALRKALKGLKEAAQT
                     TTTALGNVASEMAGQSVLQTNSPSNRVTMALNSANKSKALARRLFYSFRAPGAAHLDI
                     QDIVQYFPNLETAQAAFAIFDKDGNGDATRDEIESAVLGIHRERLALEASMRDLDGAV
                     RRLDDIFMVVVIAIVVLIMASMITNKLTTFVTSAGTFILGLSWLIGTTMQEVLGACIF
                     LFVKHPYDVGDRVDIDGVQYTVAKMQLLSSSFKGVDGKYVWIGHNVLTTKVIENIRRS
                     GAISEEFSFEVAFDTSFEALQALRSRMIVFLKENSRDFLPVFDVTVDDMPAQGKLVLK
                     ADIRYKSNWQQVSLKIQRRNKWICALKMALADLKIFGPDGAGNPNPEEAGPTQYTLVP
                     WEECRPNTTEGSTAPPPPFTSAAPSPPPLMDARAAVDDPYGDIWNEGDELLGFRSADP
                     SRPGTPGPGPATRQRQPQVPQHQDTLGMSEVAVDAKRQP"
     gene            complement(596493..598811)
                     /locus_tag="CNC02125"
                     /db_xref="GeneID:36392780"
     mRNA            complement(join(596493..596776,596831..597096,
                     597178..597214,597264..597489,597547..597822,
                     597893..597905,597959..597999,598057..598132,
                     598208..598278,598337..598365,598417..598558,
                     598610..598811))
                     /locus_tag="CNC02125"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658933.1"
                     /db_xref="GeneID:36392780"
     CDS             complement(join(596876..597096,597178..597214,
                     597264..597489,597547..597822,597893..597905,
                     597959..597999,598057..598132,598208..598278,
                     598337..598365,598417..598558,598610..598755))
                     /locus_tag="CNC02125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514271.1"
                     /db_xref="GeneID:36392780"
                     /translation="MECRGLVDPLVNWVKEGSDGDWSPSHPTDAQRESILFLCGAFLF
                     ILIFWQGKIAYWYTTKRMRNKKTAVIKKVRVWKSVPIPILWPFKILTVLYHELSHAVV
                     GMLTIWWREVMYGRPAQRGRIEFIMVDKYEGGLTQFGGDTKPNYALTLPAGYVGSCLI
                     GCWFLFTGFNAKWSKYGALSLLCLTVIATIVCAFVKVKYAIIHHWHRICAWGFRWIFC
                     NKEKAREKMDNHFASTRTRNEKANYYHDDSEEDGGPTEHDLHVSQDIIIGCSLLVGIL
                     LWAAWNWDDSIYLRFAMLGMGLLSALYAVWDIALDGIKYAEVAESDATLMAEVYNQSI
                     QEYNGLHPHHPKRERGARFYAFIWLSAKVVVIIAVLIGAYFSFRETVAQQAIQSRGFL
                     PAQFHYGLADLREDTKGASDAVSDTVSGWIDDN"
     STS             597098..598491
                     /standard_name="ha2600"
                     /db_xref="UniSTS:515570"
     gene            complement(598904..603504)
                     /locus_tag="CNC02130"
                     /db_xref="GeneID:3256765"
     mRNA            complement(join(598904..599126,599188..599303,
                     599353..599534,599592..600055,600109..602238,
                     602287..603504))
                     /locus_tag="CNC02130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569481.2"
                     /db_xref="GeneID:3256765"
     CDS             complement(join(599076..599126,599188..599303,
                     599353..599534,599592..600055,600109..602238,
                     602287..603492))
                     /locus_tag="CNC02130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569481.1"
                     /db_xref="GeneID:3256765"
                     /translation="MPSAALSPPTAAALAALALVLLPHIPRLLSCATLCLSILALALA
                     ALFCAALTTDYARTPQLLRQRSVLYRLRLSPAPSRSPTKSPISSFSSQVNAAISAFLD
                     LVVQHFVIPWYSRISPSPDFPDALEELIQNAIAQVAEKSDKVDWPSFVVSKILPIVTD
                     HLRHYRAIEHLPVGPQALPLPLPPHPHKALTDPHLAAQAIEEHLRQTLSRILPDLLPK
                     SEQTPVVFTLVQEILLGSVVLPGFQMVCESDFWNRQIDERVGQYLHEQKQVDQFLSAL
                     SSFPATSPSVRSPTVSRVRRKSHSKNPSIDANSSSSQFDVFLKSIRKLWTLGEARRLK
                     ADVERELRSARLALDEENKELDDAGPTHQSTDKAPSKGTRKSQKYVERLVRAKSAIDS
                     RIVELSGGSKPSNSGPTFVSLDTSQPISLYSILSNPSSLAYWLEFMDRRHRSRLVQYW
                     LTIEGFKDPLEATGTDVSEDSKSTERNIHDTTIEDAQSLYATYFSAPQSASVFISPQH
                     QHMIETAASSSHNLSPQDIARVRRAVFASQREVYEQMEDEDWSAFSKSELYLKAVGDL
                     QRTHSALKSASAVNADVQTPDNRRATLSRTPSPMAQVHHSLPRHQTPALLHRPLQQIT
                     PQTPKVINFLKPHSPASVSSPSLPPGPSSVQQKRQSLPPAILTAPTTPAGPSISVSEF
                     VRVASPPPFGRSVSDSRDSLNSSSNDSAGRRKGSANEMNSPSPSLSPSYASTPLILSP
                     KLVSPPPPSAKHSSQLNFLIGNEENGESHGRDRLFGDEPDDSREWERGEEARRIEAIQ
                     AALSEIIADDNGKRSNDGTPSDSLMSEREKPRERGNDMSSSLILGSATDKKERKRKSR
                     SLEDLKSASLLSSTTFSSAANLSQEPGRNSSKLLFEDDLPEDDLSSTPSVEEDSDIPH
                     NVPLPVPGDLQLTAQISELDANLLELDKQNELLSTLVRQAELTGNQKELKILRKSQSS
                     VQRETRAKQWQKQEYERVQDESRLVPGRTRVSIPSAAVTEDTENTSASTLGVVGPKQV
                     VRYTIHVCQIDDGHPAAKWAVSRRYNEFWELDKNLKEWASEHGDLETTETLRKVEIPG
                     KSLVGGISANFVESRRTGLEKYLQGLMTSPTICDSTHLRSFLSRSNSLVPSAIRTQPA
                     VTQLTKLPHNLMKSFYKSISLGPPSEDMFNANTADVMYSGLTRQINDLGGFVGLGLGS
                     PEVEVKEGHVQVTRDVSVEGMTSFTGPICDLFIELFDLKEKNWLRRQAVIVILQQFLG
                     GTIERKVRDYFRSVTSQSSFLRIIQNLQDTLFPSGKRRTSTASRSEEEKAETRARAGK
                     KLGLLIPDVAANMIGRGNARRAARRVFGVLQDERLNQQLMLRILDTVLDTIFPSMEGS
                     GVTY"
     gene            603687..607177
                     /locus_tag="CNC02140"
                     /db_xref="GeneID:3256606"
     mRNA            join(603687..603832,603884..606585,606657..607177)
                     /locus_tag="CNC02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_569483.2"
                     /db_xref="GeneID:3256606"
     CDS             join(603714..603832,603884..606585,606657..607033)
                     /locus_tag="CNC02140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569483.1"
                     /db_xref="GeneID:3256606"
                     /translation="MASVKALLRTPAYNPLPLPTLPSPEPHGRDAEQLPPLAESLVLP
                     YSLIQTRHHHLTSLLPLAFSHPPIPSHNKPRAKPLPKGVFVFPTPPPPVHPLPTREYH
                     GPRDLLNEASPSATPPANPASTPVPPQPKGRKRSGEPEPPAHEIECIARVTLALGPMS
                     FHGTELWVGRFVEPRANKPKKERAKPGERREREKKRREGIEKERQRTHSGPSATPKPA
                     ASVARPTVATAGPSAPRMRPPAPGPAVTNRTAASPQLIQLVNQAASRHPWLSSLIYKA
                     AGSTANQDELERLGRAVARLSKGEAIDDLAPQRVNIASSEVLKGKGKETAASTSHASK
                     TSVPAVPGPSSLSEKPTSAPAPLLSQNTSSSTLTPVVPAEKDKEDKKDDAESDWDSEV
                     EMKGPKQVGGGPIGPSTLDSAAAASTIPLTSTATQPSYAPSSVPASQAANPSVPSPVP
                     GIVPSPIPVSASTSSAVPLSPHAPPPKPNLPNPPPFLLIAFKEHPTDKFLIPLGSRSF
                     VSRVGGDWVTSKPPHLAPDTTLPLGQSLETSGNTNPTVAPQPAAQAAISRELQALQSS
                     AKSSSFELEAQSHSKRRGRTHVRPTNANSPSPAPPKVKTKPIEEPSLTTTTTTPEFPP
                     LPQLPGQNPPPGTVLISTLVPANKWNKVDWASLGKKVPWSEDWNSKVKAGTNENVREE
                     EPLPLPLSDASSQNHVQLLNLAAEDFLPENGPLKAITIRLGQVDDQIWGRMKDVMTLV
                     DRAEIMALSAMGVLPPAPDSITHPADDPEIREAYLLHKTSLFSSLMGRTRQPRRFLHT
                     RPSSPPAALVDATVDKMAPRPYPISTKPLYHVEEGDNEMEGRRDSVRQWSPDVEFDDG
                     LGRRKKKKTAQETVGFEMPVSLEALDERVEASAQKALLGKRGRAGGGEGARKEKQRRG
                     IEKGICEGCAREGIKIWRRGPSGKGTLCNSCGDLFTEGKLQYSDLKAPGAMKTLLAAN
                     QDVSGADAMHNQVEEKNDSVPVKAEQGRTTEEALGDGTAINSEEQKETSTQVVQAERP
                     PEHSPQHHAVESQPATQSLPETIEPGVDMQNQKSL"
     STS             605491..605701
                     /locus_tag="CNC02140"
                     /standard_name="AAC7"
                     /db_xref="UniSTS:470781"
     gene            complement(607238..609287)
                     /locus_tag="CNC02150"
                     /db_xref="GeneID:3256618"
     mRNA            complement(join(607238..607412,607470..607712,
                     607765..608640,608694..608752,608805..608903,
                     609104..609287))
                     /locus_tag="CNC02150"
                     /product="translation initiation factor, putative"
                     /transcript_id="XM_569485.2"
                     /db_xref="GeneID:3256618"
     CDS             complement(join(607368..607412,607470..607712,
                     607765..608640,608694..608738))
                     /locus_tag="CNC02150"
                     /codon_start=1
                     /product="translation initiation factor, putative"
                     /protein_id="XP_569485.1"
                     /db_xref="GeneID:3256618"
                     /translation="MATVNIRRDVDDKFYRYKMPLLQIKIEGRGNGIKTVVPNMEDIA
                     RALNRPPTYPTKFFGFELGAQTSMANDRYIVNGAHTADRLRELLDVFIEKFVLCPSCK
                     NPETEIVITGRSGHEDMHRDCKACGRQNPIDMRHKLSVFIIKNPPKKKDKGGKKGKKS
                     GGMTAEANLGGPMVFEKTEDGSGEDDSSPDAGIAGVPTTGTEIDAVLGRGDPILGDPD
                     AAEAASKKLAKLDVNGGGDEEEDEDADSPYAALGSWLENNKEADDASIIAQIKDLGIA
                     GKHKVLVEIGQHLFSDDICDEIAGRTALLQALVTSEKHQKSLLGGIERLIGLSPSLES
                     LIAAGTTSKILMVLYQADIIEEDVVQQWGTHVSKKYVDKDKSKKVRKNAEAFLKWLEE
                     AEDESDSDEE"
     gene            609523..611639
                     /locus_tag="CNC02155"
                     /db_xref="GeneID:36392781"
     mRNA            join(609523..609714,609760..609885,609935..611639)
                     /locus_tag="CNC02155"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658934.1"
                     /db_xref="GeneID:36392781"
     CDS             join(609627..609714,609760..609885,609935..611385)
                     /locus_tag="CNC02155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514272.1"
                     /db_xref="GeneID:36392781"
                     /translation="MASSPTSTSSDDQTSSHSPPRSPSRHSYKDRSKCSVCQTPVNQC
                     LKKARAFGRDWTTFIVLHGCINPECSANYCTACAMVCTLHETRSKRVPLCRICIKPLY
                     FRSLPKRVQFFDQTFMTHSIINTPIESRQSTREAYLFLISLVVERYRILRPGSAFNID
                     DFYVWMMDTHYSFTKQPIDWTNVDRVALTLVWISSFAGKPPVLRYNLIDTRLRFEDVW
                     RDPGLRHAATLEGLLALHLHPEGNQIISKLQLARRLARAKEPQHPQIWTISERIHRIA
                     VYHVTKARQLYVYCHTQTYAPLSATRPRISVNIPPNAGMNELLRILEGLNPIVEDFDW
                     DYMLHHPTRSPVWPHSDFRVAPGLGQPLPQALRLLVSSKDGVPFPKQPPGPSLPSQNL
                     GISASIAPPIATSLNPPPPEPTKNQSTPNTYETPQLLPLAQNAQALLQVTGTNQPAPP
                     PSSHSHISSSEGVARDDYMDVDEERRPSEAQLRVSPGHPQLSSSAESLSSEFGLINET
                     PTNVYAPNELPDNLYSHRDVSKPHQVQPRLSTDNRALLAKRVLNAN"
     gene            complement(611658..614733)
                     /locus_tag="CNC02160"
                     /db_xref="GeneID:3256646"
     mRNA            complement(join(611658..612319,612377..612483,
                     612539..612785,612851..613199,613250..613956,
                     614016..614064,614143..614290,614341..614398,
                     614472..614733))
                     /locus_tag="CNC02160"
                     /product="glycerol-3-phosphate O-acyltransferase,
                     putative"
                     /transcript_id="XM_569487.1"
                     /db_xref="GeneID:3256646"
     CDS             complement(join(611736..612319,612377..612483,
                     612539..612785,612851..613199,613250..613956,
                     614016..614064,614143..614290,614341..614398,
                     614472..614490))
                     /locus_tag="CNC02160"
                     /codon_start=1
                     /product="glycerol-3-phosphate O-acyltransferase,
                     putative"
                     /protein_id="XP_569487.1"
                     /db_xref="GeneID:3256646"
                     /translation="MAAGLAYDLVLIFWRIVINIFFREIRPRGAFNIPREGPVLFICG
                     PHANQFLDPLLLFSEARKEAGRRVSVLTAAKSMNRKFIGAVARIMDSIPVARAADYAA
                     AGKGRIILSESDPLIVTGIGTSFIEQVKPRSQLMLPKSAGYASAPVAEVISDTEIRLK
                     SEFVVPSKDGSANVKASHRVRNESELKEGLQFKVLPHVEQEDTYGACFQRLYEGGCIG
                     VFPEGGSHDRTDFLPLKAGFSIMALGAIAAHPGLDVKLVPVGLSYFHAHKFRSRAVIE
                     FGSPISVDPELVELYKQGGAKKREACGKLLEQVHDGLRAVTLRAPDWETMQVIQAARR
                     LYRVPGQHLTLGQVVELSKRMMEGYLTYKDEPKIIDLRQKVIAYNRLLRDMGIADHQV
                     ERASSRSIKSLLLLVYRVGLLLWWSILALPGALLHAPVFILAKLISIQKAKEALAAST
                     VKIQGRDVLATWKVLVSLAVTPLLYIFYSVLATFLAYKYDLAPEWRHWTPVVIFCWLP
                     GWAMASLKFGEAGVDVAKSLRPLFLSVWPYNQREVNRLREMREGLTNEISEVIDEFGP
                     QLYDNFQKGRILPSASVPQTGRNPGLLSRKSQTADSSVLSHPMLWLDERIFGWSRSAS
                     VGQSVWSSSAANKQQESEAAPASPYDSEGEEEEEADVDYDDVLAIIDTRRSSGGGVGL
                     ASPKGKKRRYTGQARSEGSVASPKSDIEGVPLPRADDNGVVRLHKRPGAAKDGISETK
                     GEEGLGLDTGREKGQ"
     gene            614900..617608
                     /locus_tag="CNC02170"
                     /db_xref="GeneID:3256634"
     mRNA            join(614900..615543,615592..617608)
                     /locus_tag="CNC02170"
                     /product="expressed protein"
                     /transcript_id="XM_569489.2"
                     /db_xref="GeneID:3256634"
     CDS             join(615052..615543,615592..617463)
                     /locus_tag="CNC02170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569489.1"
                     /db_xref="GeneID:3256634"
                     /translation="MWALRTSAPLVRPPALTLLRSVPRLLLERGYSRPAGRAGSRGGH
                     SRTSLATAPGNTPRQPKRFELPPHHTPHTGKAKVPSDNTRSSSRPSRPIQNDDNPWTT
                     SVRLRRWIERHKLPLSPGQVDEVTKLVTEAPQHMLNAPVWNMLIGYMGRLRKLDRVWN
                     LYNQMKKRNFTPTARTYSTILNAYAGVAHSGQIPDFSFREPQKRTMSRVTIVYNNSQE
                     YMKKLIEAQEAEEDLGVATPGVQLREDRHQEPMESLQSDIDIAPTNAYLKFLSRHGLF
                     SEMQRTFLSLPQSGPLAPDTVTYSLMFTALYHVHRSLERDPNGKANAMMIGPTAKALW
                     DHCLKQYSKEEGQAGQVDNGLVAMYVRCLLRGRPEDQRLAVSVIEQVWNLPSPGNSNP
                     TSTSIYLPPPLLTTYPIPKLDIDVKSATALISSLHTAKLPVLATHYTHLILSSSSLIP
                     LFDLEFFKAAILALSVTGEVQSIVDIMDTYQPPSSGKEGWPRDTYRAALTAARWAGDY
                     VSALSIFRRATHLSSNVGCISTDPSTLPKKIEPYRWVTPNGLAHDKRGVFWVKPTKID
                     ADAQLLGLLVKTAMQKSNKEIRSALDVYARTGGESKFLALPSSVQAGNVSTGRKLLRD
                     GRPDEIDSSVIRKQVASSVDLARDIQRAAERLGKGYEKMAAEAGEVVTKWAWVERETR
                     KKTSDVKGDTKKVEMDIEGSAEDEELDWEDERSVDQRESRVRGNNQDRHHPTERRRWE
                     QRGTSKSRHDSPSHRRYGHEQDSNKVKPREREATMHEGKVSSFGLRR"
     gene            complement(617542..618432)
                     /locus_tag="CNC02175"
                     /db_xref="GeneID:36392782"
     mRNA            complement(join(617542..617843,617906..618432))
                     /locus_tag="CNC02175"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658935.1"
                     /db_xref="GeneID:36392782"
     CDS             complement(join(617668..617843,617906..618191))
                     /locus_tag="CNC02175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514273.1"
                     /db_xref="GeneID:36392782"
                     /translation="MPSRSRTPSPATETSCTFCLSPAPNEGHLPTLSRPILVSDNQTA
                     QERSTSKNRNRSTSRTRKHQNDGIGGNLVGSMKRGIQIDDGSRKTTRLGVLLTVALML
                     FTVLTTIWILRLNTQAQSVGGWSRIVGRWQKAFGDQVGPVMKKWSERDVEF"
     gene            complement(618767..620644)
                     /locus_tag="CNC02180"
                     /db_xref="GeneID:3256623"
     mRNA            complement(join(618767..619028,619086..619096,
                     619153..619229,619294..619627,619680..619862,
                     619934..620029,620083..620186,620260..620357,
                     620420..620644))
                     /locus_tag="CNC02180"
                     /product="sulfonate dioxygenase, putative"
                     /transcript_id="XM_569491.2"
                     /db_xref="GeneID:3256623"
     CDS             complement(join(618841..619028,619086..619096,
                     619153..619229,619294..619627,619680..619862,
                     619934..620029,620083..620186,620260..620357,
                     620420..620495))
                     /locus_tag="CNC02180"
                     /codon_start=1
                     /product="sulfonate dioxygenase, putative"
                     /protein_id="XP_569491.1"
                     /db_xref="GeneID:3256623"
                     /translation="MPIAVNDNVDKDTLGRPFSLAKSTRERLVQAGIDLSKGYPEYPI
                     RPKTIELASDIRKEGWEHKDPGARADKEKKALFGAAKEVIHLSPHLGTEIVGLQLNQL
                     SDQQKDELALLIAERTVVFFRDQDLTPQTQLELGKYFGTPEIHPSAARVPGLPGVSII
                     TDEVLRSTGRVPDYKNPFATQKWHTDLTHEPQPPGVTHLHLDHLPGVGGDTLWSSGYA
                     AYDKLSPAFQKVLDGLEGLYRSAHSYPNPVTGELEPIINAHPIVRVHPATGWKALFVN
                     SRYTIGIKGFEQSEAQAILQKLFQVYEQNPDTQVRFRWTPRSSALWDNRVSIHSAVYD
                     YLDEGSAEPRHGTRVSSLAEKPIPVSEGVGKSRREALGLNTGVVHELPIDTHAY"
     gene            complement(621368..625441)
                     /locus_tag="CNC02190"
                     /db_xref="GeneID:3256650"
     mRNA            complement(join(621368..622219,622275..624038,
                     624099..624717,624766..625173,625226..625441))
                     /locus_tag="CNC02190"
                     /product="GTP binding protein, putative"
                     /transcript_id="XM_024656720.1"
                     /db_xref="GeneID:3256650"
     CDS             complement(join(621657..622219,622275..624038,
                     624099..624717,624766..625173,625226..625336))
                     /locus_tag="CNC02190"
                     /codon_start=1
                     /product="GTP binding protein, putative"
                     /protein_id="XP_024512379.1"
                     /db_xref="GeneID:3256650"
                     /translation="MEAPHKAHHKPSAGAKHAKKDAAKGVDRSGGKNFNPKAFTNTSF
                     RAADRAARRTAEKNQQRLHVPLVNRNPEERKVTNEKGKGMDEGALPPPPIVVGIVGPP
                     GVGKTTLLRSLVRRFTKHNLSQPQGPVTVVSGKTRRITFIECGNDLNSMIDLGKVVDL
                     VLLMIDGSFGFEMETFEFLNILQSHGFPKVIGVLTHVDLIKKASTLKDTKKRLKHRFW
                     TEIYQGAKLFSLSGVMNGRYPDAEINLLSRFISVMKFRPLVFRNQHPYLVADRIQDLT
                     PREAIRENAKIDRTITLYGYVRGPNLPPRNAKIHIPGAGDLEVKEVERLADPCPLPTL
                     ESERRRKMGEKAKLIHAPMSDVGGVMYDKDAVYINVPGNFTKGGDTPQGEGEKMVMDL
                     QDAEKTFADNIQASEIRLFGHSSAPLQVTEERKDRVRRKAEPRSGGPMLGKADEDEFD
                     ESEDDEFDDRSDTEEGGVLNGESDEDDDQDERDVAYAESESDHDDLAFATGFEQEGGR
                     INFDDEDDDDFPSDEDDEDVPGWKRNLASRASSTLADRLRKKRNLMTLIYDTPLSPEE
                     IVNGKTRPSSADASSSFAELQNEGLFRISHEENKGDDGDQVKEEVDRDQLKNKWADEE
                     MLESLRGLFISGPVAGEGVDEDGEAYEEEGEDFEDLEGGSDGRGDGEDDVPYVGVKPS
                     QVSVEDARAAALAKKKEALKIKFDEQYDDSDDEASKMDFYDQQKAEMARQKQINEEEF
                     GNLDLDARTQIEGYRSGMYVRLEIEAVPYELIENFDPRFPIIVGGLLAAEERFGFITV
                     RIKRHRWFTKTLKTNDPLIFSLGWRRFQTLPLYHLDDHSIRNRYLKYTPEHMHCFATF
                     YGPVSAPNTGFCAFNSLQGDAPGFRVSATGVVLDVDRSTKIVKKLKLTGAPYKIFKNT
                     AFIKDMFNTGLEVAKFEGANIKTVSGIRGQVKKALSKPDGAFRATFEDKILLRDIVFL
                     RAWYSIEPKKLYNPVCSLLLSNKESWQGMRLTGQIRREEGLKTPLDPNSAYRPIERTT
                     RRFNPLKVPRKLAASLPFASKTPELSKQRKPTYMQSRAVVLGEDEKKAVTLLQQIQTL
                     KKDKAERRKAKQDERKGAYRKKVGEKDEKREEKIREERRERFKKEGLKRKREEMSEGK
                     GRGKKSRA"
     gene            625520..628260
                     /locus_tag="CNC02200"
                     /db_xref="GeneID:3256229"
     mRNA            join(625520..626285,626341..626462,626529..628260)
                     /locus_tag="CNC02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_569495.2"
                     /db_xref="GeneID:3256229"
     CDS             join(625562..626285,626341..626462,626529..628172)
                     /locus_tag="CNC02200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569495.1"
                     /db_xref="GeneID:3256229"
                     /translation="MVNSPPQGLPPIKLKLSLTNIHQPSTPTPTHNKKGKRAAPPIDA
                     HDANSSSLLPRPKLKPNAAGPSAFRISLPAVGSSTADLSTVATPVPSTASSPANPITP
                     SGSASKAQTSPGKKSSIKKSAKPLASKKKTGPRRPPSAIPQRLLSSTSTTPSKPSAAI
                     PETPTQVKAEPEDISPASSSIPPAEEVTGISTPSQNGGEETPGTGKRPTKWMRVKKPL
                     KELLQKIMVEIRKKDDYALFEEPVDLEAFPDYLDVIGGEDNMMDMGTMQAKVDRNEYR
                     NIEQIEADLRTLASAAQKFNPPGSVPHKSAGIILAHGLKHIERSRPLVLTPPSSPRDS
                     ATPARATSVLSTRELTAALEERKARDDVPPHLYIPEEMLSFPPNSVMARAVGWNLNGG
                     KRMYNKRISRAREKFGGKWRNWTTDGSRDIAEADDIHLLFDPWRVRTGEEWRKVPDWQ
                     ALRNETNWWELEMPPPPPQSAAQQAPLPFNPGEPRLDKVPLHDFVPYDFGQYPSISSE
                     ISFLRQRIPNLSEEEDILSEHIRPVYPRLKKGESAPPPNLVNIYDGPLRRTAGDWVRE
                     MATGGVIGEAYIDSLNRFVKGAMKEGAEKDLSGEQDTKPNLGSEQLPLDEYVMTSYHT
                     PFLQTSTRQTIHDTLGHLSPLSARPDYILPLAKAAYARVALRLLTGPSNPMDIKPLLR
                     EEGDFMYQGVGGKSGVNVGLEWTGEELRRLVEKMSVQKQYLAGKRKREEGNGVEGETK
                     RIKMEADSAAAITDKPSLISESVTSHPPQPRDAAVSEEPEKINDEELKRLRLELVALS
                     KFYPLPALKKMSKEEAAKLLPVNVRGLMCRP"
     gene            complement(628356..630266)
                     /locus_tag="CNC02210"
                     /db_xref="GeneID:3256452"
     mRNA            complement(join(628356..628878,628937..629226,
                     629278..629384,629433..629588,629635..630266))
                     /locus_tag="CNC02210"
                     /product="regulation of transcription from Pol II
                     promoter-related protein, putative"
                     /transcript_id="XM_569497.2"
                     /db_xref="GeneID:3256452"
     CDS             complement(join(628731..628878,628937..629226,
                     629278..629384,629433..629588,629635..630265))
                     /locus_tag="CNC02210"
                     /codon_start=1
                     /product="regulation of transcription from Pol II
                     promoter-related protein, putative"
                     /protein_id="XP_569497.1"
                     /db_xref="GeneID:3256452"
                     /translation="MFSHAPPHLPHQHQHHPLQHQSLHRPPTAPSTPDTEHSTHTWAP
                     TPSFPQHMSQQLQPASNIPAYLFDRRQFPYSAPSADATRQNAAHTPQIAAAQSTTPGA
                     SASGPLLPQNLAQHLNNPPPPTGSQQSINPPMQTQAGPGTGSVAGAAAGGKVLLMPNG
                     APPPAGSDEEKIYILITELLEPETREAALLELSKKRELYEDLALVLWGGFGIMSSLLL
                     EIVAVYPALSPPSLTAHASNRVCNALALLQCVASHSDTRALFLNAHIPLFLYPFLNTT
                     SKTRPFEYLRLTSLGVIGALVKQNDNSDVINFLLSTEIIPLCLRIMETGSELSKTVAI
                     FIVQKILADDLGLQYICQTYERFYAVGTVLANMVDALVESQAVRLLKHVVRCYLRMSD
                     NPRAREALRACLPKALQDNTFNPLLKGDMVTKRCLQTLLMNLNERPSSDIQ"
     gene            630369..633047
                     /locus_tag="CNC02220"
                     /db_xref="GeneID:3256651"
     mRNA            join(630369..630432,630478..630510,630561..630606,
                     630659..630686,630754..630761,630816..630884,
                     630939..630968,631023..631066,631120..631153,
                     631213..631227,631277..631306,631363..631526,
                     631582..631754,631811..631973,632033..632646,
                     632723..633047)
                     /locus_tag="CNC02220"
                     /product="expressed protein"
                     /transcript_id="XM_024656721.1"
                     /db_xref="GeneID:3256651"
     CDS             join(630416..630432,630478..630510,630561..630606,
                     630659..630686,630754..630761,630816..630884,
                     630939..630968,631023..631066,631120..631153,
                     631213..631227,631277..631306,631363..631526,
                     631582..631754,631811..631973,632033..632646,
                     632723..632781)
                     /locus_tag="CNC02220"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512551.1"
                     /db_xref="GeneID:3256651"
                     /translation="MQAPQIRLNERQANPNPYVVFIRSLQNKADHTDAEDILRAVAAQ
                     MRTIMKDRFMQIGTLEEAEFNRVFAGRNWNHGQSIELVLRGPSGRFLPMPYIISVMCH
                     EMAHIEQMNHGPKFQKLMREIKADVAKLQARGYYGDGFWSDGKRLADSVRMGGEGLRP
                     SDFPEYICGVSSSDAKKARRGPRRQANRTTGLVKGEASHRSGRQTEYRKKAGRRNNAD
                     MGDNGLRLDGIRVITKQDREERKAFVDDKIQMLTRGGMPLARARKQAGEMWEQENPWW
                     AESNTRSKVAKSKSAAALRAEAAEARLRALAGPSRDTKHKLEPMSSNSEDEDESSDDG
                     IEEIPDPHLSVEDRKKEMDEMDEEEKDGLRGGWEDYITPPNVYRPITSTNSSDSSETK
                     PSVKRPPPESSGPSKIRKLQHQAPLPFTTKSIKKERSSFPGESTSALGGRPSIISPAT
                     PQMSKELGRGEDAFPREDGQPGWRCRLCTFINLMDHGRCDICQARPDGTLPEDVQSII
                     "
     STS             631146..631939
                     /locus_tag="CNC02220"
                     /standard_name="Pst7"
                     /db_xref="UniSTS:470780"
     gene            633165..635283
                     /locus_tag="CNC02230"
                     /db_xref="GeneID:3256269"
     mRNA            join(633165..633656,633728..633950,634015..634184,
                     634251..634497,634556..634739,634803..634956,
                     635012..635283)
                     /locus_tag="CNC02230"
                     /product="expressed protein"
                     /transcript_id="XM_024656722.1"
                     /db_xref="GeneID:3256269"
     CDS             join(633446..633656,633728..633950,634015..634184,
                     634251..634497,634556..634739,634803..634956,
                     635012..635049)
                     /locus_tag="CNC02230"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512552.1"
                     /db_xref="GeneID:3256269"
                     /translation="MSQLLWISDASPLFFYSPAEAYFAGQGLNSWVGSAGLNSTTTVA
                     AANGGGGTTTYHSTTGMAGVIIPAIYATSFVPIFSAPDSYDVTMQQNSNDPQDWKSGQ
                     NWTSSGGDFSAQTFTIEVSCQGDCDDDFIFEGAWVETELAPEGSDTESVSLDDSSLLI
                     QYTGFTSVEANSQPVQVSSSDYNSSLSMTSTAGATAQVMFTGASVMVSGVSCPFCSTF
                     SVSLDSKTAATLDSANNATVHGTLLYFATNLDTSDTHTLILEAEGGGTLVIDEFTVNG
                     PKGRVGFIGTVDGLTTTVGPSSTGVISSDGSSSNTASNSGATALSAATEGGAPNVGVI
                     IGAILGSLAGVAILYFLCRKAVPAAKSSEKKKMDPWDEANLLQNMKNEGVHVTTVANQ
                     RYVYPGLIAHSDLTKK"
     gene            complement(634914..636978)
                     /locus_tag="CNC02240"
                     /db_xref="GeneID:3256213"
     mRNA            complement(join(634914..635282,635338..636221,
                     636269..636469,636524..636762,636812..636978))
                     /locus_tag="CNC02240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569499.2"
                     /db_xref="GeneID:3256213"
     CDS             complement(join(635090..635282,635338..636221,
                     636269..636469,636524..636762,636812..636947))
                     /locus_tag="CNC02240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569499.1"
                     /db_xref="GeneID:3256213"
                     /translation="MSSLSLTRDWLHSVLRPFPARETITQEVLYVLQQRRTLAVKTDA
                     FTFDSGHTALLLLLHGTLPVTYRGAIYQIPIHLWVPHEYPRAPPLIFVMPTKDMGVRK
                     SREVEPSGRVREEVVEGWWRAWEVKNLDMLLKHLADVFSAAPPVYAKPSTPSQSQGLP
                     PGARTSTPEGQTGAPQPPIPVTRPTFGHPNPEILPVYRSAPTPPPHPYSHNPTRQLSP
                     PTSSAPQHVQTPRESQYMSNQPRQTQSPSPSASAPPVPQRPYSGVGPLPQVAGSLQQH
                     YTGPQQVWQGVPASRPPPPAGMMSSQSTAAGQPWPIPSGENGNNAVHPSQQINHPPSH
                     PHQAQKSQSLPVPRQPPQDLLSSPGTQPTVLSNESDGASGPPPIPPSKPPPPSLLHLH
                     SILLPHLNASLPPLMNSLHSSVEHLRARQEDLVTGEPAIRDEMARLEAVKKVCDSVGK
                     KMEEVVAKGGERVADLESKGEVAVDELVCGISIVHNQLVDLVAEDNAIEDTIYHMTRA
                     LDAERVDLDRYLKSIRSLAREQYMKRALIERILQGMGQKQGW"
     gene            637732..639410
                     /locus_tag="CNC02250"
                     /db_xref="GeneID:3256245"
     mRNA            join(637732..638375,638434..639410)
                     /locus_tag="CNC02250"
                     /product="hydroxymethylbilane synthase, putative"
                     /transcript_id="XM_569501.2"
                     /db_xref="GeneID:3256245"
     CDS             join(637746..638375,638434..639249)
                     /locus_tag="CNC02250"
                     /codon_start=1
                     /product="hydroxymethylbilane synthase, putative"
                     /protein_id="XP_569501.1"
                     /db_xref="GeneID:3256245"
                     /translation="MSCPFHTTTNTSNRSPLPDRALLLAMKSQTNTFILGTRKSNLAL
                     VQTGHVADDLRRLHSGAGSKFGETREEGDDAEQGDVPFVHPYTFSIESMTTVGDRNQT
                     TPLHLLSPYSSTQPAKSLWTDELEARLINGHFDMLVHSLKDVPTVLKDGCEIGCMAKR
                     HDPRDALVVKQGLPYKRLEDLPDGAVVGTGSVRRVAQLKRAFPNLVFEDMRGNLNTRF
                     NKLDNPQSPFSALILAMSGLERLGMAHRATSPLSSPTLMHAVGQGALAIEIRSTDPRV
                     RNCLRGLGHWQTEWSCGAERGCLRVLEGGCSVPVGVESELVELDEDEVAAHPELLEGV
                     EDPFKGQEEIPLEGDSPMLWFSGLVDTTSAPTPSTPTFSSHSLPPLRTRLAKLTLHSC
                     VTSTDGSKHVLFTPPPVLVRSYRQAEQFGEECARRLRGMGAGEILDEINKLRKERELR
                     DLESAIERSRAAQEESEKMGLVQDGTAEVVA"
     gene            639672..651177
                     /locus_tag="CNC02260"
                     /db_xref="GeneID:3256417"
     mRNA            join(639672..639940,640005..640420,640471..640680,
                     640728..640784,640833..642077,642129..642181,
                     642234..642423,642471..642932,642983..644784,
                     644835..645612,645666..645782,645836..645934,
                     645985..646302,646351..646705,646751..647110,
                     647164..647281,647331..647476,647534..647566,
                     647618..647688,647744..647851,647902..648098,
                     648147..648354,648409..648630,648681..649173,
                     649221..649356,649408..649551,649602..649926,
                     649975..650202,650268..650486,650547..650595,
                     650647..650911,650961..651177)
                     /locus_tag="CNC02260"
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /transcript_id="XM_024656723.1"
                     /db_xref="GeneID:3256417"
     CDS             join(639838..639940,640005..640420,640471..640680,
                     640728..640784,640833..642077,642129..642181,
                     642234..642423,642471..642932,642983..644784,
                     644835..645612,645666..645782,645836..645934,
                     645985..646302,646351..646705,646751..647110,
                     647164..647281,647331..647476,647534..647566,
                     647618..647688,647744..647851,647902..648098,
                     648147..648354,648409..648630,648681..649173,
                     649221..649356,649408..649551,649602..649926,
                     649975..650202,650268..650486,650547..650595,
                     650647..650911,650961..651006)
                     /locus_tag="CNC02260"
                     /codon_start=1
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /protein_id="XP_024512383.1"
                     /db_xref="GeneID:3256417"
                     /translation="MQALKNAALGLLNVYVSPYVENLNAQDLSLSLFSGNLQFHGLHL
                     KKSLLERFGLPVEIVAGDIGTLSISIPWTALKTQPVKIVIDDIYVLARARPPGKVDPE
                     EDERVEQATKQEKLKSAEAVDSAASQMGPQGGNEETKQTYVGAIVSKVVDNVQIHIKG
                     IHIRYEDGTSTPDHPFAAGVTLNEFKAVSTDANWMEAFIHDSLHGVHKLVQLEALAIY
                     FDTDTESLEKGPEERSETIQALKDMLDGPHNHQYILKPVTGEARAIINKHMSNDTPKF
                     DAQVIFDEIGVVIDRDQYRDVLSVIDVFHFYRRTHQYHKFRPSEEQFKANPAQARLKF
                     ALEAIRSEVHERNRRWSWDYLQERRDTRKQYVDLFVKKLALPEGKQLPVDEATALSGI
                     EVRSSYEDIRFFRSVARAKAKKDAATRRKMELERQKNQPQTQTWGQWLWGPSARSSDI
                     DGGISEEEKKELDDIIDYDSSAAQETIEATPRDFMKARVSAKLNKGSFSLRTDPHGKC
                     TDVMALVFDSFSADAVQLTDSMKGKFALGGFRVYDGTTPDSLYPQIVHVKDLVKNAGG
                     QARQAGLNEQGIQAAMDAVEEHLTDDKDPFFLMEVEHNPLDGRADNAVTVKMRHLEII
                     YHRGYVEAVVRFFRPPESQLESIGALLDAAGQTLDGIRKETRAGLEYALEQHKTIDLR
                     VDMNAPIIIIPMDVKVKQSQTLVLDAGHIFVGSKLADKEQLQEVQSKRGRQYNEDDYK
                     QLEDLMYDRLDLRLESTQLLMGDDVEACMRALEDTHSSSSYEFHILERIGMSFTVQNA
                     IVNAPNLTRFKVAGELPELHVNFSDRKYQALMKFIDVSIPKFESDQTQQEHVTPTTAA
                     QGRRHFGQREIEEYNFEDDRSIISARTTEERDTLDDGSSNGDKGDRFYEAHDQQTESQ
                     KSALRQVTFEFSFSVGKLQASLFKSVSPTTERPLADAVLEGFGLTFALRKWDMSVDLF
                     LRSVTLAMIEQGSARRPLLSSASEGGNSPSDLKLVQVKYLKAQKDSPEFMTKHEGVDT
                     SIDTELSTFKFTISPEPILYLYDFIMTTFVPNNQSSVNQPSQGVETQVLGVDQEEAQP
                     STDKMRIRVKLTSAQVALENNGNKFALLALPSADVAILLRNGGLRVGARLGNLSLEDL
                     SPEPVADTSFKKLLSIEGGELADFSYETFDPTDKETFPGYNSSVNLRAGSFKFTFMEK
                     PISDLYAFATKFARMKAVYDAAQQAAVQRASEVTRMHFDVVIKTPIIILPRDGITSPD
                     RLILRLGEIIAKNEYFNDPDDTSAIDASLRGINVASEIMVGDKKAILQMIDDVAITAS
                     IRQAGGTAHRSDPHHADTEITTNMSDVKLSLTQRQYVLLMCVLEALPRALNDVSDAET
                     PAESLEDTPETSTPSTPDSVEIREATGVSLEPELVVSQDQRQLDVKLWTAFDFVFSVD
                     TIALEIYSVDAITEDDLKSNSIARFALVKSHLGFKKLSDGATEAEFSLKTLSFSNTRT
                     GNSVFRDIIPPASHEGNQIMLQYTMTGGTDPSALAIVTVDSPQLILAVDPLAALLEFA
                     VSPFKKHADAELQPQENVEQADEFEEGPKQGASLSFRVEVVKATVVVIADDTNPKTQA
                     IQLNIKEVLLSQQSILALKVDRIGMSFGRMDRPNDRVKFLDDLSMALSLDTRRKGSQQ
                     MTSFEVEIPDPVIFRASYTNIMLIIDIVNKATTVAAKALAPAEGTGRAEKDSKSLTKD
                     SAYGTSSAAVMDPRRSRRRSSVTRRTSISKRRRSLEGPQVIISKEQLEARVNGFQFVL
                     VGDLQEMPMAHLSTDAFNVSIQDWSGDLKLATSITTSVRYFNLANSYFEPLVDPWNFD
                     LTVNRVSAGPQNSPLNVKLSARERLEVNLTSAFIELAITSMTIWSKEGERAMAGRGSD
                     APFRVRNLTGLSILIWPEATDLGKAVTGVKRLDDGADVPWRFEDRKHTRENISAVRHN
                     SLGIQLQDTPWDPLRDISVDRAGDHILTLRPRLDRVSHQIACEIKLVNNIKVITFRST
                     LNVENKTSLPVEMIVVDSHGKAASAALKINPGESCPLPLEAAFEKRFRLRPLRGFGFD
                     FSWSAPLHWKTLLAKPIRPISCKHQTPKEPAFYFQAQANFDPKDPAARIYPRMALVLR
                     APVELENLLPYDLKFRVHDKNSGLSSSSFLVKGGSSPIHTVELSHMFLLNVTPEETSF
                     KQSEYAIINTDDPELPIEDNFQLTDQQGLKTTLKLHYTTYPNSGGAFKVQIYSPFIFM
                     NKTGLPFDLAAKTWAGGQRPIAGRDQFENDWQNETPTPFLFSFPNEDRRSRLHIRVNN
                     SKWSQPVSFEPVSADMQIVVPSASGDNDNYVGLSYAEGIGKYKLTKVITIAPRFLVKN
                     IYSRPIKIRQYGTRHEYSVGVGERIAIHQLQRGAPPQLAMAFDEPNVTWSAPFNIADL
                     GRTNITVRRQSGSNSKTYLMRVETHLEGSSIFLYVSKEKDDAWPLRLRNDTNLSLAFQ
                     QIDHDPALTDRERARPVHFLPPRSVQNYAWDWPTAGNKRIKLYVDPGNTSSGEKGVEL
                     PNAIDMMAIGIQPPMKVPSTTANKRSTTVSIDVRADGGSQLLTISPYNEETSVYKPTR
                     PGAGIRRSESTTSLSSSTVAFETISVSEKPTMNITVELEGIGISVISRRPDELLYFSL
                     RGLKLGYSDYPQYYDVFVDCKWIQIDNQLFGGLFPIIFYPTVVPKDGKELESHPTLQS
                     SVTVLKDQSHGVIFVKYATILLQSMTIEMDEDFLFALLDFVKFKNASWKEEGQDVLIE
                     HPKDIPEPDISTTKADVFFEALQLQPVALELSFMRTDRVNVDEKVSTRNPFYYALNAL
                     TMTIGNVNAAPLAFRALFLENVRLSIPSLQERVILHYQEQFISQIYRVLGSADFLGNP
                     VGLFNNISSGFSDIFYEPYHGMVMHGNKDIGLGIARGATSFAKKTVFGISDSVTKFTG
                     SIGKGLSAATLDAEFQSKRRMTQRRNKPKHALYGVAAGASAFADSVTSAFEGVASKPM
                     EGAEKGGAAGFAKGVGKGFVGLFTKPAVGVMDFLSASTEGIRNTTTVFDQAELDRVRL
                     PRYIASDGVLRPFSAREALGQSWLKDLDAGAFFHDSYIAHIDLPGDDAISILSNNRIL
                     QVQLRKLRVIWQVPFEELQSLSLEANGINLVNRDGRGGPFLPIPDQKAREWYFKQIGK
                     VVVAYNKAHSQRED"
     gene            complement(651163..653474)
                     /locus_tag="CNC02270"
                     /db_xref="GeneID:3256553"
     mRNA            complement(join(651163..651613,651674..651977,
                     652024..652840,652894..653035,653091..653474))
                     /locus_tag="CNC02270"
                     /product="expressed protein"
                     /transcript_id="XM_569505.2"
                     /db_xref="GeneID:3256553"
     CDS             complement(join(651519..651613,651674..651977,
                     652024..652840,652894..653035,653091..653418))
                     /locus_tag="CNC02270"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569505.1"
                     /db_xref="GeneID:3256553"
                     /translation="MASFHPTRREIVLVLTMTVILGLFFQFGSMGFTDPDSSDSLLRF
                     RMGFGHRCQDDWGENSRGEERGKWIEDVDTEVGFPKAAKIAGMAETKVKWGEQGPPRT
                     QVLAHAPGWTVFDDVYLFNGTWFIVTDHPSSIPLLRLMASTGNEIWNDEESIRGREPT
                     EKDMRIIFPSEAKKLWGQSASLVSGASFVVNDPPQFLDHYYHFAAELLLGLWRTYSSL
                     DPTISAQGVTHLPSPSRMIFPHVSAGKWNDYAKMNSYLSRAIFPSMSYEYQNDFLDRV
                     DTGRAFLLERVVFADRAAAFRGPEFSKTWRTASEAVTLQASKYWWSPIRKNLLEFVGD
                     GYGGDIDLGEMGIGVGVEIPDIEEDIEAFEAEEGAMEEEKEEVREKIMKEKEAEASKP
                     VITYVSRQDWGRRMLKKESHDSLVKELHDLEEKYGWEVNIVSMDKLTREEQIRLSART
                     TIMMGVHGNGLTHLLWMNGQNPRATVIEFFFPGGFAEDYEFTSRALGIKHYGVWDGQT
                     FTAPDTPQVAYPEGFQGNEIPLDGKAVSDLIVKRLLVDRPSRHLNDSDGVHDQ"
     gene            complement(653726..657441)
                     /locus_tag="CNC02290"
                     /db_xref="GeneID:3256736"
     mRNA            complement(join(653726..654492,654545..654618,
                     654682..654830,654895..655069,655120..655187,
                     655245..655287,655344..655409,655468..655601,
                     655647..655952,656004..656023,656078..656152,
                     656213..656250,656303..656357,656421..656495,
                     656561..656567,656613..656636,656700..656709,
                     656761..656798,656863..657441))
                     /locus_tag="CNC02290"
                     /product="expressed protein"
                     /transcript_id="XM_024656724.1"
                     /db_xref="GeneID:3256736"
     CDS             complement(join(654460..654492,654545..654618,
                     654682..654830,654895..655069,655120..655187,
                     655245..655287,655344..655409,655468..655601,
                     655647..655952,656004..656023,656078..656152,
                     656213..656250,656303..656357,656421..656495,
                     656561..656567,656613..656636,656700..656709,
                     656761..656798,656863..657020))
                     /locus_tag="CNC02290"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512591.1"
                     /db_xref="GeneID:3256736"
                     /translation="MMVVQQSTVIFLLCFSLPIVNALSEYQYLSSVNNFATSFLSPYN
                     VEVVKSINSTLFSEDVTGTADVSTNFDGRELSTEYLFGLFVKTADDSHDPSPFGSPIS
                     YNVTGLLIENEFVSASIKFEFYYPVLNKTFPIQIDISLMLNEQGQIQQYDASFRRWAW
                     ATDVIIPQLLPYMASRNNLTMDNTTLVLREYLSRKICDTAVTYCTNENQQYSNHDACM
                     DFLNTRDIGKWYRMGEDNLLCRHLHVPMLSLRPGTHCPHIGPSGGDMCIDRVYEQVVL
                     DSHFPAGWLAPKKVTPENVEEVGHIQAISGQPLDPLLEIALSAGQSHSWDPTLYATAL
                     LGYFLFFYVCSHSIWFLFARFSVVFPSLGIEHQKNIVMYIMNIIFTTIALALQLVSTP
                     AFRQDYHLWEVQCLRTAGVTVSALYVFELIYRLKMRIPLIIHHFLTIIAISFTVAVFE
                     YTMSTTYLNSACIWLFQATLEQPTFLGLLGYRLGWNPKQVARLLKFAAVQTFLFKSAS
                     ALTLIIY"
     gene            656004..657194
                     /locus_tag="CNC02300"
                     /pseudo
                     /db_xref="GeneID:3256795"
     gene            659454..663669
                     /locus_tag="CNC02310"
                     /db_xref="GeneID:3256484"
     mRNA            join(659454..659613,659666..659773,659833..659923,
                     659980..660063,660122..660218,660275..660359,
                     660409..660524,660574..660652,660704..661057,
                     661113..661243,661296..661398,661450..661944,
                     661994..662892,662953..663082,663136..663235,
                     663284..663370,663436..663669)
                     /locus_tag="CNC02310"
                     /product="transcriptional elongation regulator, putative"
                     /transcript_id="XM_569507.2"
                     /db_xref="GeneID:3256484"
     CDS             join(659545..659613,659666..659773,659833..659923,
                     659980..660063,660122..660218,660275..660359,
                     660409..660524,660574..660652,660704..661057,
                     661113..661243,661296..661398,661450..661944,
                     661994..662892,662953..663082,663136..663235,
                     663284..663370,663436..663515)
                     /locus_tag="CNC02310"
                     /codon_start=1
                     /product="transcriptional elongation regulator, putative"
                     /protein_id="XP_569507.1"
                     /db_xref="GeneID:3256484"
                     /translation="MSDIRLDSATFFKRAAKIFDSWEKPSGDTQALEDINSIAIILGD
                     PNDEVASYTKTTALQLWLLGYEFPSTLMVFEKSPRKVTFVCGSSKAKLIRQLQPSDGI
                     EIDVKVRSKDATAAKETMEEVVASLNGKFGSLPKDRPIGKLVDEWNSAVESKGDLEVV
                     DVAIPISAVLAEKDGEELKTIITSAKLTSTVMINYFKSKMESIIDRGTKMSHEALAQL
                     VEEKIGNEEKGPDMKLWNKNPSLGEIDFASSEFVYSPVIQSGGKYDLKVTAASNNDNL
                     KPGIILANMGIRYKNYCSNMGRTFLISPSKKQETQYTTLLEVRKEALALLKTGAVASD
                     VYNSVHQSLETKNATLADSFLKNLGFATGMEYRDSSFLLNAKNNRELKENMVLVLTIG
                     VADLPDAKNKGKTYSLLLSDTVKIGQNGAVVLTEGCTRLSDVVMDMEEEEEEDVKPQI
                     DKKPKINNSPKKPRSSTVGGRVLNAKTRGANREQATQTTAEKIKTNQQRLHAQLNADG
                     VKRWEADAGGKNGAQQKVVKRYESYRREEQLPRAVEDRRIYVDEQRQSVVLPINGYAV
                     PYHISTIKNVTKTEESNHMVLRINFQSPGQIAGKKEDMPFEDPDANFIRSVSFRSQDQ
                     RHMLKVYEAITALKKAAVKRETERKELADVIEQEKLIEVKGRHPYVLKNVFPRPGPEG
                     KKTDGNVEIHQNGIRFRPDGPASKIDILFSNIKHLFFQPSEKELIVIIHVHLKAPIML
                     GKKKTSDVQFYREVADMSFDETGGKKRRARYGDEDEIEQEQEDRKRRAELDKLFHDFA
                     RRIETAAQAQQFELEVDVPFRELGFNGVPHKSIVALLPTTNCLIHISELPFTVITLSE
                     VEIVHLERVQFGLKNFDMVFVLQDLKKPPVHINSIPVAHLDNVKEWLDSCDVPISEGP
                     VNLSWPAIMKTVNEDPHAFYAEGGWNFLTGSGSDDGSEESEEGSEFEGDSDVFDESSG
                     SDEDSESAFEGDSDSASAESLSDEGEDWDELERKAKRADEKHRTDRGGDSDDDGKKKK
                     KGSRR"
     gene            663795..666405
                     /locus_tag="CNC02320"
                     /db_xref="GeneID:3256505"
     mRNA            join(663795..664015,664070..664124,664186..664439,
                     664493..664904,664964..665760,665814..666080,
                     666136..666405)
                     /locus_tag="CNC02320"
                     /product="heat shock protein 70, putative"
                     /transcript_id="XM_569509.2"
                     /db_xref="GeneID:3256505"
     CDS             join(663989..664015,664070..664124,664186..664439,
                     664493..664904,664964..665760,665814..666080,
                     666136..666246)
                     /locus_tag="CNC02320"
                     /codon_start=1
                     /product="heat shock protein 70, putative"
                     /protein_id="XP_569509.1"
                     /db_xref="GeneID:3256505"
                     /translation="MVKAVGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFND
                     SERLIGDAAKNQVAMNPYNTVFDAKRLIGRKFEDAEVQADMKHWPFKVIDRAGKPAIQ
                     VEYRGEEKVFTPEEISSMVLIKMKETAEAYLGGTVSKAVVTVPAYFNDSQRQATKDAG
                     AIAGLDVLRIINEPTAAAIAYGLDKKSEGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK
                     ATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLSSNARALRRLRTACERAKRTLSSAA
                     QTSIEIDSLFDGIDFYTSITRARFEELCQDLFRSTMDPVEKVLRDSKIDKSSVNEIVL
                     VGGSTRIPKIQKLVSDMFSGREPNRSINPDEAVAYGAAVQAAILTGDTSEATQDLLLL
                     DVAPLSMGIETAGGIMTPLIKRNTTVPTKKSEVFSTYSDNQPGVLIQVFEGERAKTKD
                     CNLLGKFDLSGIPPAPRGVPQIEVSFDVDANGILNVNAADKSTGKSSKITITNDKGRL
                     SKEEIERMLAEAEKFKAEDEAAAATVQAKNGLESYSYSLKTTLSDNQDKFDAADHETL
                     SKKVDEVISSLDTMQSASKEEFESLQKELEAVANPIMTKFYGAQGGAPGGAPGGFPGA
                     GGAPAQEEGPSVEEVD"
     gene            666506..667805
                     /locus_tag="CNC02330"
                     /db_xref="GeneID:3256228"
     mRNA            join(666506..666566,666615..667070,667120..667189,
                     667256..667461,667517..667583,667644..667805)
                     /locus_tag="CNC02330"
                     /product="expressed protein"
                     /transcript_id="XM_024656725.1"
                     /db_xref="GeneID:3256228"
     CDS             join(666537..666566,666615..667070,667120..667189,
                     667256..667461,667517..667583,667644..667711)
                     /locus_tag="CNC02330"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512385.1"
                     /db_xref="GeneID:3256228"
                     /translation="MFTNLSPEDKDAFFSLLDEYFASRPHNLPSPPAIDSSSHPARSN
                     AALSPSPSAGYASPSYSSARHPMPPPERTEQPDSAQRFISSSIKYGTAGTKSSMNAVS
                     KNKDAMDLLGKVGMSSMVGRANERMNKPAEAGVKEEAGRKAAPPPIAAKKGGVSGLVS
                     SRSFGHVDTSNKMSAFTSMWRDPQKSKPPAVEQTISPTLSYSNTALPPPIRRDGSGSY
                     QSSSPNPASSAAAEVGPELANGDEGQAQALYDYTGNDKGDLSVQANQVVNIIEKTSSD
                     WWTCEDGNGQRGLVPATYLQAI"
     gene            668755..673160
                     /locus_tag="CNC02340"
                     /db_xref="GeneID:3256474"
     mRNA            join(668755..669002,669061..669480,669537..670461,
                     670511..671188,671247..671396,671447..672267,
                     672320..672436,672493..673160)
                     /locus_tag="CNC02340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656726.1"
                     /db_xref="GeneID:3256474"
     CDS             join(668793..669002,669061..669480,669537..670461,
                     670511..671188,671247..671396,671447..672267,
                     672320..672436,672493..673047)
                     /locus_tag="CNC02340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512553.1"
                     /db_xref="GeneID:3256474"
                     /translation="MAGPPVRQRYNAKARGSVAGGSSHKKRKNLSKERTEEDAQDNET
                     DQHAAVFEDPTAGMSSKKRKRFESYMAKKLKSEQRLETFKLLQSLAPSSSTSASLLSA
                     STLGQNPMNPTSAKERQEKREDRLVRRGIDRLSRRFGEGDDHSGESENDASSRKGKGK
                     AKEVTVEVIRDGQAEETEEVKTTVIPSKGERKAEIKAAEKGKGKGKLPKKAGWNPNLL
                     STQAPNSSSSEFDSSDSGNDNSDDEEPKKAAEPSPRLEVGPEPVSETIKPPVSAPSAP
                     TVLGGALKKSTDGQVVKPRVEVRRKKGFVYGMFGRRGIEHREDSDDEDEDDEDEDDAD
                     DDDEEEEDDDEMDSDEEASDEEDGEDSEEEGSEEDEEEEVAPPKKKRSLGFKDWALKQ
                     MGQTSQPSAPDLLAAEPTTTLYKSQPLLAARVGEYIGPLGQELVIPTTSLLDQSKDSD
                     KSKVRPNISRRPSVSETRMGLPILAEEQSIIESILMHPVVIICGETGSGKTTQVPQML
                     YEAGFGYKGSDNPGMVAVTQPRRVAAVSLAERVRSELNLPPNSSLVAHQIRYSSTTSP
                     DTAIKFMTDGVLLRELASDFLLSRYSVVVVDEAHERGVNTDVLVGVLSRVAKLREKLW
                     REGKQDVKPLRIVVMSATLRVSDFAENPTLFSKPPPVIHIAARQHPVTVHFSRRTVSD
                     YVTEAYKKVSKIHARLPPGGILVFMTGQGEIQALCRKLEKKYGAKKSSQKTQVINDNS
                     LPPEEREAEEVEFGKDEDLAADVDDGAAESDPEALDTDDEIEGIPGLEFDEPADAPLH
                     VLPLYSLLPNDQQMLVFKPPPEGHRLVIISTNVAETSLTIPGIRYVVDSGRAKERHYD
                     PINGVQSFQVSWISKASASQRAGRAGRTGPGHCYRLYSSALFEDHFEQFSKPEILRMP
                     IEGVVLQMKSMNIDAVINFPFPTPPDRAALRRAENLLTNLGALSLPTLTKMINGVQHK
                     GSGGGQITDLGKAMAGFPVSPRFAKMLAIGTQHDCMSYIIAIVAGMSVGDPFIHEQSL
                     EVDEEEDKVAEISHIKSEDIREKEQRKETRRRFFKAQQQFLALGQGTSDMFKLLAAIG
                     AYEFDPSPAFCAKTFIRLKAMQEIHQLRAQISSIAKVPLSKLLPPSDTQLKVLRQILA
                     AGFIDQVAVREDLVLKKGVSYESTRGVAYRAVGLGSEPVFIHPSSALFHCAPPDFVVF
                     SEIVRTSKPWMKGVTKINPIWLPSLGKGLCTFSKPMEMPTKGFARKSGLKDDEREVFV
                     TPHFKDLGIDLPVMKKKQRREGTRWILVD"
     STS             669920..670123
                     /locus_tag="CNC02340"
                     /standard_name="AG27"
                     /db_xref="UniSTS:470882"
     gene            complement(673131..675060)
                     /locus_tag="CNC02350"
                     /db_xref="GeneID:3256750"
     mRNA            complement(join(673131..673398,673456..673848,
                     673902..674026,674117..674238,674289..674443,
                     674494..675060))
                     /locus_tag="CNC02350"
                     /product="MAP kinase kinase, putative"
                     /transcript_id="XM_024656727.1"
                     /db_xref="GeneID:3256750"
     CDS             complement(join(673312..673398,673456..673848,
                     673902..674026,674117..674238,674289..674443,
                     674494..675000))
                     /locus_tag="CNC02350"
                     /codon_start=1
                     /product="MAP kinase kinase, putative"
                     /protein_id="XP_024512386.1"
                     /db_xref="GeneID:3256750"
                     /translation="MHPQNSSTPSTNSPSTFSLPKSSISRKKPPGLDISKSILRPTRT
                     APVLPANGSSPSNFVSEADRLRDDIANLQLSSRSTGSNHSPEALDSPRAFQSDSSVAS
                     GLAKKEKSRDGKERGDKEKRKKKHKDKDGEDLVKDEDLEILHDLGAGNGGTVTKVWNK
                     KRKCVMARKLILVDAKPSIRKQILRELQIMNDCDSPYIVGYYGCFPVDVHVGIVMEFM
                     DAGSLDYIYRHHGAIDIDIVGKVAQAVLEGLIYLYDKHRIIHRDIKPSNVLANTRGEI
                     KICDFGVSGELINSIANTFVGTSTYMSPERIQGAPYTIKSDIWSLGISLIELAVGRFP
                     FSDSPDSEELSPSVSDFDPDPTLPRSVRRPKIESNSRHNGVSQSGGPHAMSILDLLQH
                     IVNEPAPRLASRRRRFPQEAVAFVEGCLIKDPDQRRSPKELLSSSWITNLKTTKEDLQ
                     TWAQSMVGPREE"
     gene            complement(675161..676362)
                     /locus_tag="CNC02355"
                     /db_xref="GeneID:36392783"
     mRNA            complement(join(675161..675361,675447..675483,
                     675604..675682,675790..675802,675874..675881,
                     675969..675989,676060..676362))
                     /locus_tag="CNC02355"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658936.1"
                     /db_xref="GeneID:36392783"
     CDS             complement(join(675349..675361,675447..675483,
                     675604..675682,675790..675802,675874..675881,
                     675969..675989,676060..676173))
                     /locus_tag="CNC02355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514274.1"
                     /db_xref="GeneID:36392783"
                     /translation="MQAPSPDHSAADGINGPLNPFVVTPPPPDGKDDEIPGYVTRFGA
                     YHTLIKDRPSSRYVASKGGKLCNAVNDRFWIALSRKAQRFPADSFFLCPL"
     gene            complement(676391..678895)
                     /locus_tag="CNC02360"
                     /db_xref="GeneID:3256348"
     mRNA            complement(join(676391..676435,676499..676650,
                     676731..678542,678596..678730,678778..678895))
                     /locus_tag="CNC02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656728.1"
                     /db_xref="GeneID:3256348"
     CDS             complement(join(676743..678542,678596..678730,
                     678778..678873))
                     /locus_tag="CNC02360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512387.1"
                     /db_xref="GeneID:3256348"
                     /translation="MNNQQLVQQHYDIALKFMQAANYLDAWKNFDKAINFGGKNPVLL
                     DCKAAAMSKLPEWRNHALEVTKDMIAKWPKDFRGYYRQASVLYAMKAYDHAFKVISKA
                     VDIGPTRSQDERKYKAIQQLRATIIIQKTEADRLRAANDETEAQRQAIARQAAKKARI
                     NYTHLLSRDILLIIAEQGMADHPGFIFRMAGVCKSWRETLLSQPSLWDTIVLGRKRKD
                     QKVTLFIERSRGRIKEVKIACHLDQFLAGKIGLSLAPYMPNVERLTVHAPYRINLNLL
                     TQWRGLLRNVEYLSLSHDDGGATLRKNFTHDLLPPGPSRLRHLAIANFQTGPESDSTY
                     TPLKQVETVSIRSTDLFLPLDSAEETLLSTFPAATSIELINNRYFDSSRGALPIVAEL
                     PNLRSYTNNKASSNVFKTIRVPSLQDLSVDSLRASSLKTWLSAPGLATCLTTLRSLSI
                     SCTSFTDTDVLSALAFLPGLQFLNVSACPLTNTFLEGLVRRPADSDQENLCPKLTALS
                     ISINDNITGGPLTRFVRSRVASSAGLASSSSDLDLNTQAQGKSTQTELKKNMSSSFRP
                     SARSAFGRPTKPPSVRTDSDQSISSTLPQSQTCAPSQPSSSSSSTLPEITWLNLFHCG
                     GIDPSAISYIRQYVKFVGHSLAAHGGDRNEGKGRWKWNVEWKDVVEGRAGLD"
     gene            679081..681692
                     /locus_tag="CNC02370"
                     /db_xref="GeneID:3256137"
     mRNA            join(679081..679110,679154..679371,679415..679712,
                     679761..680702,680756..681007,681087..681216,
                     681306..681692)
                     /locus_tag="CNC02370"
                     /product="ER-associated protein catabolism-related
                     protein, putative"
                     /transcript_id="XM_569518.2"
                     /db_xref="GeneID:3256137"
     CDS             join(679108..679110,679154..679371,679415..679712,
                     679761..680702,680756..681007,681087..681216,
                     681306..681544)
                     /locus_tag="CNC02370"
                     /codon_start=1
                     /product="ER-associated protein catabolism-related
                     protein, putative"
                     /protein_id="XP_569518.1"
                     /db_xref="GeneID:3256137"
                     /translation="MLLRIRSPAGTARLTVQPETTGEDFAEAILNTIPAADPQPDPAT
                     LALSNQPGAAGESVPFHALSGRTVGDMGFSHGDLLFLSYKPRAADPDSHPAMQATAPH
                     PQPAQPDPSHPKTHTDPPMPNTIPLRDLSSVQEPEIDQYWEKQTGKIERKRDPAFCRH
                     GDKAMCDYCMPLEPYDPKFQSEHQIKHLSYHAYLRKLLSSRPPTASSATDLPPLSPTS
                     LSVITPCPTGAHPSFPDGICSTCQPSAVTLQSQPFRMVDHIEFASPSIIEGLLSAWRR
                     TGTQRIAFLIGREDKYEKVPMGIKVIVEAVWEPKQEGELDGLTVETPWSDESRVQEIA
                     KWCDKGLSVVGMIYTDLTPSPDDITKTLYKRHAQSYTASSLEMLLSAAYQLSHPLSTR
                     MSPTGHYSSRFVTCCLTGDKDGGVDILAWQASEHAEAMVKAGIVEASVDPAVVRVRKP
                     GEGEYVPEVFYSYKNEYGLQVKMPAKPTFPVEYLYVNITHGFPLAPSPLFLSNAFPTE
                     NRPGLHDQSMQVVITQLAAILKTSDAEIGDAGTWPGRIKKDVEKWLSDWHLVTFLCMQ
                     GLFSLKEQQILCRAATAHAHPNDTHALEELFASGGWQTLLTIVDSEASANARSNPPPT
                     SSFNNLGIDSPAFAGPSTESSAPPSGPDSVGAGAGAGAGGGRERVCPHCTFVNEHGGS
                     DCEICGLPLDG"
     gene            complement(681688..683747)
                     /locus_tag="CNC02380"
                     /db_xref="GeneID:3256476"
     mRNA            complement(join(681688..682885,682939..683076,
                     683150..683236,683289..683418,683470..683538,
                     683585..683668,683709..683747))
                     /locus_tag="CNC02380"
                     /product="nuclear matrix protein NMP200, putative"
                     /transcript_id="XM_569520.2"
                     /db_xref="GeneID:3256476"
     CDS             complement(join(681886..682885,682939..683076,
                     683150..683236,683289..683418,683470..683538,
                     683585..683668,683709..683724))
                     /locus_tag="CNC02380"
                     /codon_start=1
                     /product="nuclear matrix protein NMP200, putative"
                     /protein_id="XP_569520.1"
                     /db_xref="GeneID:3256476"
                     /translation="MFFCAISGSPPTVPVVSKTSGAVYEKALIERYIEENGTDPISGE
                     ALTKDDLVDVKAKPSTIPPRPANQTSIPALLTALQSEYDSIMLESLEIKKAFQSSRQE
                     LANALYREDAATRVIARLMKERDEARQALSSIQSTIGFQPPAAAEEPAADVEMAQEGA
                     LPADVEAKVMETNQALSSVRKKRKPAPGYKKVDDIKSYTQINHVPSLHATKPAGITAL
                     DLAQDGNTVVTGGADKAVQVFDLEASKVLGTLKGHTKAVTHVAFREHEGEPRLAISAS
                     ADKTVRVWGEDDGKWGARATLSGHKGEINGLAVHPSGSYVAAGSADSTWSLYDLSTAK
                     EVTKYTAIPGIDGSFAYTSFAVHPDGVLHGGGTKDGAVRVWDARQSNSLAATLSSHAK
                     DLSTLSFSENGYYLATSSISGPPTVKIFDLRKLDILSSWTLPEENTIREVKFDPSAQF
                     LSVVGTDARVYANKTWQELVTFEENAGDLVGARFGKLGSEIVLAGMDRTLRVLGKKE"
     gene            683894..688609
                     /locus_tag="CNC02390"
                     /db_xref="GeneID:3256412"
     mRNA            join(683894..683949,683998..684046,684097..685248,
                     685318..685763,685829..685931,686015..686307,
                     686381..686890,686978..687313,687369..687555,
                     687621..688609)
                     /locus_tag="CNC02390"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_569522.2"
                     /db_xref="GeneID:3256412"
     CDS             join(683911..683949,683998..684046,684097..685248,
                     685318..685763,685829..685931,686015..686307,
                     686381..686890,686978..687313,687369..687555,
                     687621..687733)
                     /locus_tag="CNC02390"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_569522.1"
                     /db_xref="GeneID:3256412"
                     /translation="MDLKNFISDNVVRILGSSDSATVDYVQSLAISSKTPGDLYNSLL
                     STGMASTPETQAFAAQVHSLVPRKNKTKAPKADKAASGQRFTLLMDEDAESSGSRKEK
                     KKKKEKEKEKEGSRERDVVGVKKARHSRKRDTEGNWDSDEEDKEIKRLRTRSPLPDGD
                     DQAELPLEPEETEEERLERERLEDLRQRDEFAERMKEKDRDRTKRIVEDRTSKALGGV
                     DASRRANLMDDPAAREAAIADLRNRSRQEYLSKRELQQLDLLKMEVEDEKILFRNQKL
                     SRKEERELERKKELIKLMEERKKIDDGTNGYMLPDDYITEQGRLDQKKKKDALYKRYE
                     ESKPVEGQFVTDVDQWEAAQQERTDLTTGALDKEILVEDYDYVFDESQEIKFLKEGKM
                     DGTLTAEAQALLDQVDKLEKNAQSIQETRNSLPIYEFRDELLEAIAEHQVLVVVAETG
                     SGKTTQLPQYLYEAGYCKNGMKVGCTQPRRVAAMSVAARVAEEMGVRLGQEVGYSIRF
                     EDMTSDKTALKYMTDGMLLREFLTDPELSTYSALVIDEAHERTLSTDILFGLVKDIAR
                     FRPDLRLLISSATLNAQKFADFFDQAPIFDVPGRRFPVDMFYTQQPEANYMHAAVTTI
                     LQIHTTQPKGDILLFLTGQDEIEAAEESLKETMYALGDKVPELIIAPIYANLPSEMQS
                     KIFEPTPEGARKVVLATNIAETSITIDGVVYVIDPGFVKQNNYNPKTGMSSLVVEPIS
                     RASAQQRAGRAGRVGPGKAFRLYTKWAFKNELLQDTIPEIQRTNLSMVVLMLKSLGIN
                     DVLNFDFLDKPPADTIIRSFELLYALGALNHKGELTRLGRRMAEFPVDPMLSKAIINS
                     ENYKCTHEVLTIISMLQESGSLLYRPKDKRVHADKAHKNFIKSGGDHFTLLNIFEQWA
                     ESNYSQQFCYENFVQFKSLCRVRDIRDQLAQLCDRVEVVIESTPNDVVPVQKAITAGY
                     FYNTARIDRGGGYRTTKNNHSVYLHPSSCLIGMQPPPRFILYYELVLTSKEYMRQCMP
                     IEGSWLSELAPHYFNKSEIDQLMGSASKVKMPKRIEPPKVGPVNS"
     gene            complement(687887..688645)
                     /locus_tag="CNC02400"
                     /db_xref="GeneID:3256330"
     mRNA            complement(join(687887..688045,688105..688189,
                     688254..688645))
                     /locus_tag="CNC02400"
                     /product="expressed protein"
                     /transcript_id="XM_569524.2"
                     /db_xref="GeneID:3256330"
     CDS             complement(join(687994..688045,688105..688189,
                     688254..688326))
                     /locus_tag="CNC02400"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569524.1"
                     /db_xref="GeneID:3256330"
                     /translation="MAEQTQGQPGGTGIAGSTGQQDYLDKGVDTALNKAGHGQSHSTT
                     EKISDGIRNVFKKATGKDVPIKDKQ"
     gene            complement(689345..689893)
                     /locus_tag="CNC02405"
                     /db_xref="GeneID:36392784"
     mRNA            complement(join(689345..689388,689442..689614,
                     689692..689736,689793..689893))
                     /locus_tag="CNC02405"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658937.1"
                     /db_xref="GeneID:36392784"
     CDS             complement(join(689501..689614,689692..689736,
                     689793..689852))
                     /locus_tag="CNC02405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514275.1"
                     /db_xref="GeneID:36392784"
                     /translation="MENPHEAEQAVLLERIIKNVDKSNEAIIELNHCLKEYLDSAGAI
                     HITSQLFSNYSRNVLYNLETVNKLPKPV"
     gene            690097..691506
                     /locus_tag="CNC02410"
                     /db_xref="GeneID:3256813"
     mRNA            join(690097..690331,690386..690463,690514..690804,
                     690859..691158,691228..691506)
                     /locus_tag="CNC02410"
                     /product="C-4 methyl sterol oxidase, putative"
                     /transcript_id="XM_569526.2"
                     /db_xref="GeneID:3256813"
     CDS             join(690116..690331,690386..690463,690514..690804,
                     690859..691158,691228..691374)
                     /locus_tag="CNC02410"
                     /codon_start=1
                     /product="C-4 methyl sterol oxidase, putative"
                     /protein_id="XP_569526.1"
                     /db_xref="GeneID:3256813"
                     /translation="MAAAAAFDLLDKYIPGASDSLTIVNATTAQNTLYPGVDFAALNW
                     LERLWASYYVWVGNPIIATGLMSFLLHEIVYFGRCIPWLIIDAMPYFQKWKLQPNKHV
                     SRAQILKCTKVVLLTHFTCEAPLILAFHPICCLFGMKTYEIPFSSIGLMAAQIAFFFV
                     FEDTFHYWAHRALHYGPLYKHIHKLHHEFSAPIGIAAEYAHPLEVLILAQGTISGPFL
                     YAVFRNDLHILTVYVWITLRLWQAVDAHSGYDFPWSLRHFLPFWAGADHHDFHHATFT
                     SCFSTSFRWWDYYFGTDVKYHAYKARVAAAGVKERAAVEKREMEKLEKEGIIEERAAA
                     SHSKRGKKE"
     gene            complement(691742..694945)
                     /locus_tag="CNC02420"
                     /db_xref="GeneID:3256219"
     mRNA            complement(join(691742..693645,693701..694945))
                     /locus_tag="CNC02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656729.1"
                     /db_xref="GeneID:3256219"
     CDS             complement(join(692020..693645,693701..694933))
                     /locus_tag="CNC02420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512390.1"
                     /db_xref="GeneID:3256219"
                     /translation="MEHPPLPLDVLSNVAALIPPPYYPWPHPAAQTTATTPAPDVIRN
                     LDPAPAPLQTDLQAISAITRASSRLLEAARPWLWEDVDVKTGRGWLAIVNALTEEVIE
                     QDVESLTPIAGSAPASDGTGSGRATPVPPQEPPRQPGTIPQATHAYTSSSSSALPFPI
                     ASGPGHVASGSSAYPQMSTSPPQPTHIHQLLTPPTSRNTSPRARTSPALPPILTNPQP
                     RAEQSPSPGPPAPPGPSAPPGPPGPSTGPGPSNGVSPSAVARTKLRGRSRSPRRSVGF
                     DTEGIQAVLERSRSASSHRSNGPSGSVRGAFMHRRTSLSRSRTWHDGPRDEEEDEDED
                     EVMPLTGPPARYKAGVITPRLLPAERETANADLLPPPGPYIRHLNFTNFRTIGSRRSQ
                     EEAVRGRFVTAGRLEGVIKNAPNLVSLCMTEYVDSSLSYPVIEEIFFRGSRRPRYRSP
                     SLTRTRSLSIGQPPSVTSTAHDQLDPPRPEYVPYEDETEDQKWNRRAMFTPLEALDLT
                     GCVSQAFTEAMQKFYNTWLAPDDETEDEEEERGRGRWRGRGKRAHSPDATEDDSDTHS
                     HSVSRDRQSHRRPPRFRAMRRLCLRMCTSLDSQIIASLVWSFPCLTHLDLSNTRVPDE
                     LLNYLTDYCPRAFRLTSLSLARCPRLNSYAVVDFLCRSPAVRDLVDLNLYVNPTQGKA
                     IESDALMRLITEAPCMRSGRLRYLDLSSAKFTPAHLAADVFPPQASLISLGLSHIPTL
                     GLTPIADFLLSVAFNVEILTLVGTATTSSLDPSRSPLQITLELHSRLINPLTTIPFSL
                     SSLYLSPGSGTPANLNPGPTRLRVIELIGPVRRSIAPDGNGEWKVVKSKGSRGWYVDQ
                     SAGWRRVQPPLSPSPLSPASESGAMDEGDTEAQWEFVRHLPKAHPRRAWLNKLSEASG
                     RVGSNVGWHSRKMEVVRGMGMMGREEGMAGAGAFAFEE"
     gene            695146..698071
                     /locus_tag="CNC02430"
                     /db_xref="GeneID:3256652"
     mRNA            join(695146..695361,695413..695807,695871..695904,
                     695962..696087,696144..696320,696383..697704,
                     697811..697897,697952..698071)
                     /locus_tag="CNC02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656730.1"
                     /db_xref="GeneID:3256652"
     mRNA            join(695146..695361,695413..695807,695871..695904,
                     695962..696087,696144..696299,696383..697704,
                     697811..697897,697952..698071)
                     /locus_tag="CNC02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_569530.2"
                     /db_xref="GeneID:3256652"
     CDS             join(695158..695361,695413..695807,695871..695904,
                     695962..696087,696144..696320,696383..697704,
                     697811..697897,697952..697985)
                     /locus_tag="CNC02430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512392.1"
                     /db_xref="GeneID:3256652"
                     /translation="MPLLAQLGNRASLLLHRLVYAFPAAPPPSHSPTPASDASPNFDP
                     APAPEPTPALSFVGSGYGVTLILMGILLNRIHHTVRRPRQPPPDDHPRPINPSYFYRL
                     RASVSDFFTSPDAARYIRLPGIVCLLRAWILFTVLLIQVIGLWPEFQHDRTTAMWRRA
                     TSRLGNWAGEMEMNDICWQVFVSVCVGLLCSGIANGLDTIRRRDVAASFNLTGYSFMM
                     HLYSSPLTHQHTERAVAHGRPDAHALFQLWLSLTELTWLQILELSLTLRDNVLLPTSV
                     CGIVGVVHFAYVLFSSPLRFPSFTFLTHMVSPTWYFLALFLSVVILSTVILRAITFIF
                     SYGYIPSLTSLLPHEGVIPDRRDDFGVTLLKIGTACIEATSLSGLRNELANIDKPEAP
                     WVEITSDGSEFHHGLLQHSPTPGFCTEISNIKVSEAEDSERLNPQWREVRAFARALFT
                     AILSALIRFIMSTRVGRSMFRLGAKIWRARWWYGPRSWKFWRRDAWREPPENIRARER
                     ARLRARASAIIEQISGSGESSHQLAHTANLHRTGYTRGTSTSVSLRDHGGSTATIQRN
                     RQPRREMWTYADYLLKDVDGEIEDDEEWIQEMSDDSDSEQMSIADANEEEEEEEDLFD
                     EGMDVEEEEMKQRGMLYGDLVSQTTESDGRQSSDDFQPVLLAHLTSRTAAPLTRQRYT
                     SLMTLYSSDSLHTPALPSLVSMHNENVLGLRDVMHERRQAMKGYEEEDEETKRTCVVC
                     MVSMRDTILWPCRCLAVCNDCRESLAARLPAQNHMCPCCRKKVEGYSRIYIP"
     CDS             join(695158..695361,695413..695807,695871..695904,
                     695962..696087,696144..696299,696383..697704,
                     697811..697897,697952..697985)
                     /locus_tag="CNC02430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569530.1"
                     /db_xref="GeneID:3256652"
                     /translation="MPLLAQLGNRASLLLHRLVYAFPAAPPPSHSPTPASDASPNFDP
                     APAPEPTPALSFVGSGYGVTLILMGILLNRIHHTVRRPRQPPPDDHPRPINPSYFYRL
                     RASVSDFFTSPDAARYIRLPGIVCLLRAWILFTVLLIQVIGLWPEFQHDRTTAMWRRA
                     TSRLGNWAGEMEMNDICWQVFVSVCVGLLCSGIANGLDTIRRRDVAASFNLTGYSFMM
                     HLYSSPLTHQHTERAVAHGRPDAHALFQLWLSLTELTWLQILELSLTLRDNVLLPTSV
                     CGIVGVVHFAYVLFSSPLRFPSFTFLTHMLALFLSVVILSTVILRAITFIFSYGYIPS
                     LTSLLPHEGVIPDRRDDFGVTLLKIGTACIEATSLSGLRNELANIDKPEAPWVEITSD
                     GSEFHHGLLQHSPTPGFCTEISNIKVSEAEDSERLNPQWREVRAFARALFTAILSALI
                     RFIMSTRVGRSMFRLGAKIWRARWWYGPRSWKFWRRDAWREPPENIRARERARLRARA
                     SAIIEQISGSGESSHQLAHTANLHRTGYTRGTSTSVSLRDHGGSTATIQRNRQPRREM
                     WTYADYLLKDVDGEIEDDEEWIQEMSDDSDSEQMSIADANEEEEEEEDLFDEGMDVEE
                     EEMKQRGMLYGDLVSQTTESDGRQSSDDFQPVLLAHLTSRTAAPLTRQRYTSLMTLYS
                     SDSLHTPALPSLVSMHNENVLGLRDVMHERRQAMKGYEEEDEETKRTCVVCMVSMRDT
                     ILWPCRCLAVCNDCRESLAARLPAQNHMCPCCRKKVEGYSRIYIP"
     STS             697512..697814
                     /locus_tag="CNC02430"
                     /standard_name="AAG30"
                     /db_xref="UniSTS:470774"
     gene            complement(698028..700018)
                     /locus_tag="CNC02440"
                     /db_xref="GeneID:3256688"
     mRNA            complement(join(698028..698374,698425..698493,
                     698541..698800,698850..699045,699095..699212,
                     699266..699532,699585..699666,699748..699799,
                     699854..699866,699931..700018))
                     /locus_tag="CNC02440"
                     /product="cytokinesis-related protein, putative"
                     /transcript_id="XM_569532.2"
                     /db_xref="GeneID:3256688"
     CDS             complement(join(698315..698374,698425..698493,
                     698541..698800,698850..699045,699095..699212,
                     699266..699532,699585..699666,699748..699799,
                     699854..699866,699931..699956))
                     /locus_tag="CNC02440"
                     /codon_start=1
                     /product="cytokinesis-related protein, putative"
                     /protein_id="XP_569532.1"
                     /db_xref="GeneID:3256688"
                     /translation="MSDGIGIANLPNQRHKITSQRGAHFTIMVVGQSGLGKTTLINTL
                     FATEICSPRNYRQRFAKQLDKTTEVEILKADLEERGFNIKLTVIDTPGFGDYVNNRDS
                     WGPIVDFIDDQHESYMRQEQQPFRKEKQDLRIHACLYFIKPTGTTLKPLDVEIMKKLG
                     TRVNLIPVIAKADTMTPEDLHNFKTIVRETVIAQNISVYTPPVDLDDEAAAEHARAMQ
                     AVMPFSIIGSTQDVTTPDGRVVKGREYLWGVAEVENEDHCDFKKLRSLLIRTYMLDLI
                     TSTEEKHYEAYRLAQMETRKFGEPKVKKLDNPKYREEEETLRKRFTEQVKLEEARFRQ
                     WEQHLIAERDRLNKDLEQAHSAIKALEAELDQVAAYHRQGGTVGRR"
     gene            700276..701644
                     /locus_tag="CNC02445"
                     /db_xref="GeneID:36392785"
     mRNA            join(700276..700371,700416..700524,700582..700884,
                     700935..701470,701530..701644)
                     /locus_tag="CNC02445"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658938.1"
                     /db_xref="GeneID:36392785"
     CDS             join(700349..700371,700416..700524,700582..700884,
                     700935..701447)
                     /locus_tag="CNC02445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514276.1"
                     /db_xref="GeneID:36392785"
                     /translation="MPRLQILQHKSYHPYLEKNKERVRQDEARAQEEEIAKEQKRVDN
                     EAEHRLTLLRRRANSPSVHDQQEEDLPSTSSSYAVDSTPDLLEKHRQKKIKEEKRERK
                     KRERLDFDFPSQSDRRREKSDVIDHADLQEGGHFNFFAQFEKGESSRKPELTLAEVAK
                     KKKEQEKDPFTVYLSRPERETNPWYTDRDMKRYEEKEVGEEAEARRDRERRKDARAKS
                     RNDPLTNIDALFASHSSASRKGTSISKSASLSSARNSRKGDVNQSERQRALAMMAKSK
                     QRVENWTDTPSTAYSGSHNWADDWERAKDQAGRRFFDPK"
     gene            complement(701544..703322)
                     /locus_tag="CNC02450"
                     /db_xref="GeneID:3256154"
     mRNA            complement(join(701544..701771,701830..702155,
                     702221..702317,702364..702448,702514..702626,
                     702679..702853,702906..702971,703036..703105,
                     703166..703322))
                     /locus_tag="CNC02450"
                     /product="water channel, putative"
                     /transcript_id="XM_569534.1"
                     /db_xref="GeneID:3256154"
     CDS             complement(join(701670..701771,701830..702155,
                     702221..702317,702364..702448,702514..702626,
                     702679..702853,702906..702971,703036..703105,
                     703166..703247))
                     /locus_tag="CNC02450"
                     /codon_start=1
                     /product="water channel, putative"
                     /protein_id="XP_569534.1"
                     /db_xref="GeneID:3256154"
                     /translation="MPDLVVTTQELRPSSPVYGHARTIIKNNFVAMAGEYVGTTLFML
                     CCLGGTHVALLPEKSVTGDLSQPLNTSSLFYISLSIGLSLTVNVWIFFRVSGGLFNPA
                     VSLGMVLAGCLPPMKGALLTVAQVLGGITGAAIINVLLPGELNAGTTLGGGASIAQGL
                     FIEAILTALLMLTVFFTAAEKNEATFLSPLAIGMALFIAEMVGVPYSGGALNPVRSLG
                     PAVVTHNFPGYHWIYWVGPALGSVLATCFYSLLKYLEYESVPGPGEAPHVPPFWRLPA
                     RGYLSTLSHPFAKRASTGTYSHEDDPEKGLRSGKDSQANTDNPTRVNRRGSGDAEIQS
                     PVEDTTMANARLDRIEMLLTQLMQVRTSEGTQKSPAV"
     gene            704599..705249
                     /locus_tag="CNC02460"
                     /db_xref="GeneID:3256429"
     mRNA            join(704599..704855,704925..705031,705104..705249)
                     /locus_tag="CNC02460"
                     /product="expressed protein"
                     /transcript_id="XM_569536.2"
                     /db_xref="GeneID:3256429"
     CDS             join(704756..704855,704925..705031,705104..705142)
                     /locus_tag="CNC02460"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569536.1"
                     /db_xref="GeneID:3256429"
                     /translation="MDVNENIHATEQPDSAPSVNTRVQQVGTQQDTLDKGVAQVIKEF
                     ISPSQAQDPSVVEKASDAVRSGFKQSTGKDFPVQDKQ"
     gene            complement(705805..707581)
                     /locus_tag="CNC02470"
                     /db_xref="GeneID:3256120"
     mRNA            complement(join(705805..706609,706662..706811,
                     706862..707104,707159..707459,707530..707581))
                     /locus_tag="CNC02470"
                     /product="phosphatase, putative"
                     /transcript_id="XM_569538.1"
                     /db_xref="GeneID:3256120"
     CDS             complement(join(706047..706609,706662..706811,
                     706862..707104,707159..707438))
                     /locus_tag="CNC02470"
                     /codon_start=1
                     /product="phosphatase, putative"
                     /protein_id="XP_569538.1"
                     /db_xref="GeneID:3256120"
                     /translation="MSVFTKSAFTMSALPSPNTSQPPSAAPSRRGSFANGLASGQLTP
                     VTDPHIVSINVESVLFDMDGTLINSSPAVVKAWELFAEKYPLDLDDILRSAHGMRTID
                     VLKKWCKITDPELLASEVIRFETAILNAAEDIAKNSGKAGIEVLPGVAKLLADLGEEA
                     DKRDGEEKWAICTSSTYFYAGKAIPIAGLPTPKVFVTADSVTRGKPFPDPYLLGASGC
                     NASPFESLVVEDAPTGIRSGKASGALVLATCTSHEREELERERPDFLVDDLSHVKATW
                     DAATNTFNLIIEQPIDRYTPRPTPDVTPVITPAMSRSNSFSGVGQDRPSVRTSQAIMK
                     GSDDLTGNDSVVGSPAASRPGSPGADDSIEKRAEMEFHRRASQSGQAGVTLDAFRRAL
                     AGNAAKRRAQSQGEMSQDE"
     gene            708333..710498
                     /locus_tag="CNC02480"
                     /db_xref="GeneID:3256593"
     mRNA            join(708333..708595,708659..708849,708938..709277,
                     709325..709607,709657..710498)
                     /locus_tag="CNC02480"
                     /product="glycerol-3-phosphate dehydrogenase (NAD+),
                     putative"
                     /transcript_id="XM_569542.2"
                     /db_xref="GeneID:3256593"
     CDS             join(708508..708595,708659..708849,708938..709277,
                     709325..709607,709657..709936)
                     /locus_tag="CNC02480"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase (NAD+),
                     putative"
                     /protein_id="XP_569542.1"
                     /db_xref="GeneID:3256593"
                     /translation="MSAASTAPSSPEVVQQFSDLDIGSTVTTPAVTRPSSPSPPSLPP
                     SPLSSGKHKIAVIGSGSWGTALAKIAAENAWRRKEDFHSEVRMWVREKIVNGKPLTHV
                     INKTHLNSRYLPDVVLPRNLVAVPHLKDVVKDATLIVFVVPHQFLHTVLNELARPGVL
                     LRGAKAVTAIKGVEVNGTDIQTFASLIEAKVGLPCSALSGANIALEVAMGQFCETTIG
                     CPTPDQSLLWHAVFNSPSFRVNTVEDVSGVSLAGALKNVVALAAGMVDGLGLGGNTKA
                     AIMRIGLKEMTQFCLEFFEGVRPETFSNESAGVADLTVTCFSGRNRKCAEEFVRSGQP
                     FDVVEKKLLNGQKLQGTATAEEVNAFLFARKRAHAYPLFEKVYKIAFEGMPPKNLVVG
                     L"
     gene            complement(710023..712720)
                     /locus_tag="CNC02490"
                     /db_xref="GeneID:3256574"
     mRNA            complement(join(710023..710278,710335..710801,
                     710861..711571,711621..711791,711845..712296,
                     712365..712720))
                     /locus_tag="CNC02490"
                     /product="regulation of translational termination-related
                     protein, putative"
                     /transcript_id="XM_569938.2"
                     /db_xref="GeneID:3256574"
     CDS             complement(join(710567..710801,710861..711571,
                     711621..711791,711845..712296,712365..712442))
                     /locus_tag="CNC02490"
                     /codon_start=1
                     /product="regulation of translational termination-related
                     protein, putative"
                     /protein_id="XP_569938.1"
                     /db_xref="GeneID:3256574"
                     /translation="MYHDMDHHEIRQQCESMQEDELTVLESIYPGQIKIHPNPNNRPG
                     RILTLTLPVKLSSPTKVSISTASNNGESSIPSLTLSHLPALSLCVALPETYPLLVPPA
                     PISLRAPLFKGHDDKLGSWLFQNDLREIESRLRRMWDDDKEAWDQGQGVLWRWWDWVV
                     NGDFLRETQRLIHDSLTLTVPPPLSPATFFTALKSYDSYQIQNEFEQTAFPCSICWEN
                     RKGGRCVEMPGCGCVFCTECLGECWTLAISEGTLEAVACPSVACVKQRATNEKASRLD
                     QGVTAPLVEKVVGKELRERWEVFKDRRIVEIDPSFCICPQPKCQAAVPPPTPSGTCGN
                     SSAPKAIRLADLTKPSSGSLHVPADVPRGSGQSVPLTEDRWAAYRLCPKCNFSFCLYC
                     SSTWHGPHTVCSLPQASQLVLEYLKYPEGSEGRLAMERQRGKANLERMVSKWREDEMN
                     TQWLHSRTKACPSCSVRVEKSVGCNHMQCGRCSAHFCYLCGQSIKPTDPYKHFNTPGQ
                     PCYGKLFEAMDFEDVLDPVLNLEQFTEDDLLDWDFGAARI"
     gene            712892..716903
                     /locus_tag="CNC02500"
                     /db_xref="GeneID:3256282"
     mRNA            join(712892..712945,713029..713073,713128..713241,
                     713291..713377,713426..713640,713694..713899,
                     713950..714111,714169..714368,714418..714497,
                     714553..716045,716097..716272,716325..716476,
                     716536..716571,716628..716903)
                     /locus_tag="CNC02500"
                     /product="ATPase, putative"
                     /transcript_id="XM_024656731.1"
                     /db_xref="GeneID:3256282"
     CDS             join(713055..713073,713128..713241,713291..713377,
                     713426..713640,713694..713899,713950..714111,
                     714169..714368,714418..714497,714553..716045,
                     716097..716272,716325..716476,716536..716571,
                     716628..716744)
                     /locus_tag="CNC02500"
                     /codon_start=1
                     /product="ATPase, putative"
                     /protein_id="XP_024512397.1"
                     /db_xref="GeneID:3256282"
                     /translation="MIGGIKAIDTSLIHRIHSGQVVLDLQSAIKELLENSLDAGATAI
                     DVRIKDNGLDSIEVVDNGSGIAEADWESIALRHHTSKLPSLEDLHKVTTFGFRGEALS
                     ALAALCDSITVVTATKETAPMGAVIKLGKDGRTIETSGRVARPRGTTVTLSGLFNPLP
                     VRRKEFERNAKKEVSKALVLLTAYALVPASASVQDARNGVRLKVELTAGGGRASKRSI
                     HLMTDGRGQLRSSVGAVWGPSALDNVEDINLRLEVEIDRVMARREGITERKQTVEVKG
                     LISSAQWGCGFSTSSRQFFYINGRPCNLTKVARAINEVYKSFNTNQLPLAILDFKIPT
                     ESVDINVSPDKRTIFVHSEDCLIDSLKTALESFFAPSRNTFTVEGASRTIKSIRRDHS
                     HPSLKQSQRSQAINQTQQEDASLEEQGGERQVASDTEAFDNVIARRPLSRRCSQTTGS
                     IPSSPHEEQMKGSITSAATLTSSLCELNEARLSSPSSQASLRQRSLSTSKPSLNPAQT
                     VSAIQALNNCEAVSKDRMSKLRENSQGSTSQKATAKHESDDETQISVVEEQEVMEDMP
                     EDANQDEGRNTEIVSPNHETPKISEGEAAVEAIEIEDQTIETASGVQDHTIKHSTHAN
                     RPILEIESSTDENLLLSTRHSASAVWCGVDQQLSEQTSASPQHILSGSGRDLSIRTDP
                     PPENRKIDFSTSCDPQRTSASSSSSPIVKPRVSQRLKPDKAYRDEIISTAPQGEVIMR
                     FDLSRLRKRFANAGNRQAGAQSKRVSQLVKQGDLEEAAGIKNKDSELAEETLSRVISK
                     ADFEKMEVKGQFNKGFIIARLQSTDNGTDDLFIIDQHASDEKYNFETLQQTTKIKAQA
                     LIKPRALHLTAGDEIVAMENIDILNANGFDVHVDESKPAGKGERISLLAMPVSKETVF
                     DFKDLEQLLHLLSDDSRPSGQMVRCMKARAMFASRACRKSVMIGKTLTKGQMSQLLRN
                     MGTIDQPWNCPHGRPTMRHLTKLNPAPESSKIKGRFDWTRWKEALA"
     gene            717602..720710
                     /locus_tag="CNC02510"
                     /db_xref="GeneID:3256463"
     mRNA            join(717602..718358,718413..718625,718675..719202,
                     719256..720173,720224..720710)
                     /locus_tag="CNC02510"
                     /product="beta-glucosidase, putative"
                     /transcript_id="XM_569544.2"
                     /db_xref="GeneID:3256463"
     CDS             join(717880..718358,718413..718625,718675..719202,
                     719256..720173,720224..720545)
                     /locus_tag="CNC02510"
                     /codon_start=1
                     /product="beta-glucosidase, putative"
                     /protein_id="XP_569544.1"
                     /db_xref="GeneID:3256463"
                     /translation="MLALPVTLLWLSTGFPLLTYASPVTSDADNHTISATEANSSSST
                     SFLPHNTSRHHESSSQSPITYISPQIAAPINATYVNPSHKWEKAYRKAKKYLDDWTLE
                     EKVQLTTGVGWENGRCVGNIGAIPSRNFSGLCLQDSPLGVRLADFVSAFPAGINAAAT
                     FDKDLIYARGYALGQEFKGKGVHVALGPMTNMGRVAAGGRNWEGFGGDPYLSGWATEM
                     TVRGIQDAGVQACVKHYVGNEQERNRTTESSNIDDRTLREIYTHPFLRAVQADVASVM
                     CSYNLINGSWACENPKTLNGVLKTDFGFQGYVLSDWGAQHSGVVSANNGLDMSMPGDI
                     VLGSLTSYWGSNLTESVKNGSVSEERLDDMAERIMAAYFLVDQDKDYPEVNFDSFRLS
                     GSNNSHVDVRGDHWKIIRQMGAASTVLLKNVDHALPLRKPRSMTLIGSDLGPSLRGPN
                     GFSDRGGLSGTLAMGWGSGTAEFPYLVDPLSSISLQAREDGTILNWWLDDWNLSNASY
                     WASVAEVAIVGINSDSGEGYITVDDNEGDRNNLTAWNNGDELVKAVASANNNTIVIVH
                     SVGPMIIEDWIDHPNITAVLWAGLPGQESGNSLVDVLYGAYNPSARLPYTIAKKREDY
                     SADIDYVTSDIPAITQVNYTEGLFIDYRHFLAKDITPRYEFGFGMSYTSFEFGDVSLE
                     EIKEEGAGDDIYNFQEVDDGTVKAGRFLLDYLHKAQWTVTIDITNTGGVNGCEVPQLY
                     LAYPADSGEPPKVMRDFARINLDPGASQTVTFNLSRYDVSIWDVESQKWTIPDGTFVV
                     EVGKSSMDKDAKTASFCPGSC"
     gene            complement(720697..721861)
                     /locus_tag="CNC02515"
                     /db_xref="GeneID:36392786"
     mRNA            complement(join(720697..720977,721072..721220,
                     721282..721402,721469..721861))
                     /locus_tag="CNC02515"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658939.1"
                     /db_xref="GeneID:36392786"
     CDS             complement(join(721100..721220,721282..721402,
                     721469..721652))
                     /locus_tag="CNC02515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514277.1"
                     /db_xref="GeneID:36392786"
                     /translation="MPRKQAPQQSYAPPLPHSHNLVQLGAPQGSNNFLCKDALGEERL
                     VEISKSLKRMKGLIVMRGDYAVIRLFPTAPEESVRLVGEIVYILEKGDVKEWKRAGEW
                     PPGFSADVLPSHPTEEKQATLETGEGEEADQSDDGRQSE"
     gene            complement(722372..724946)
                     /locus_tag="CNC02520"
                     /db_xref="GeneID:3256537"
     mRNA            complement(join(722372..722668,722730..722996,
                     723057..723853,723912..724323,724383..724636,
                     724691..724946))
                     /locus_tag="CNC02520"
                     /product="chaperone, putative"
                     /transcript_id="XM_569545.2"
                     /db_xref="GeneID:3256537"
     CDS             complement(join(722546..722668,722730..722996,
                     723057..723853,723912..724323,724383..724636,
                     724691..724772))
                     /locus_tag="CNC02520"
                     /codon_start=1
                     /product="chaperone, putative"
                     /protein_id="XP_569545.1"
                     /db_xref="GeneID:3256537"
                     /translation="MTKAIGIDLGTTYSCVAVWQNDRVEIIANDQGNRTTPSYVAFND
                     SERLIGDAAKNQVAMNPYNTVFDAKRLIGRKFNDAEVQADMKHWPFKVVEKGGKPVIK
                     VEYKGEEKTFTPEEISSMVLTKMKETAEAYLGGTVSKAVVTVPAYFNDSQRQATKDAG
                     AIAGLDVLRIINEPTAAAIAYGLDKKSEGEKNVLIFDLGGGTFDVSLLTIEEGIFEVK
                     ATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLSSNARALRRLRTACERAKRTLSSAA
                     QTSIEIDSLFDGIDFYTSITRARFEELCQDLFRSTMDPVEKVLRDSKIDKSSVNEIVL
                     VGGSTRIPKIQKLVSDMFSGREPNRSINPDEAVAYGAAVQAAILTGDTSEATQDLLLL
                     DVAPLSMGIETAGGIMTPLIKRNTTVPTKKSEVFSTYSDNQPGVLIQVFEGERAKTKD
                     CNLLGKFELSGIPPAPRGVPQIEVSFDIDANGILNVNAADKSTGKTSKITITNDKGRL
                     SKEEIERMLAEAERFKAEDEAAAATVQAKNGLESYAYSLKTTLSDNKDKFDSADHETL
                     SKKVEEVINALDTMQSASKEEFESLQKELEGIANPIMTKFYGASGGMPGGAGAPGGFP
                     GGGAGGGAAQEEGPSVEEVD"
     gene            727219..728083
                     /locus_tag="CNC02530"
                     /db_xref="GeneID:3256257"
     mRNA            join(727219..727434,727490..727511,727572..727652,
                     727712..727725,727807..727979,728043..728083)
                     /locus_tag="CNC02530"
                     /product="expressed protein"
                     /transcript_id="XM_024656732.1"
                     /db_xref="GeneID:3256257"
     CDS             join(727267..727434,727490..727511,727572..727652,
                     727712..727725,727807..727854)
                     /locus_tag="CNC02530"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512398.1"
                     /db_xref="GeneID:3256257"
                     /translation="MYTTAFLRSTVTGLRPALHRPASVVDSSQTLLTSSRLGRVAKRF
                     NSSGPRTDKPKLVFRFGLRDIPVELYPILFVTGAACVGGGVALGRQLYLGDLRFKPTG
                     PASAQGQQ"
     gene            complement(728162..729772)
                     /locus_tag="CNC02540"
                     /db_xref="GeneID:3256393"
     mRNA            complement(join(728162..728260,728311..728423,
                     728472..728517,728572..728650,728704..728761,
                     728816..729080,729135..729202,729250..729353,
                     729413..729429,729483..729524,729638..729772))
                     /locus_tag="CNC02540"
                     /product="organic acid transporter, putative"
                     /transcript_id="XM_569547.2"
                     /db_xref="GeneID:3256393"
     CDS             complement(join(728205..728260,728311..728423,
                     728472..728517,728572..728650,728704..728761,
                     728816..729080,729135..729202,729250..729353,
                     729413..729429,729483..729524,729638..729665))
                     /locus_tag="CNC02540"
                     /codon_start=1
                     /product="organic acid transporter, putative"
                     /protein_id="XP_569547.1"
                     /db_xref="GeneID:3256393"
                     /translation="MSTELKTPLPLPFIYTFASGAIAGCTELLLLYPLDVVKTRQQLD
                     TGKQGANMVQVFKNIVAQEGPRRLYRGILPPLMLEAPKRAVKFAANGSWGAFFTNNGQ
                     RKNTQAIAILTGCFAGATESVVVTPFELVKIRMQDKSSTFKGPMDVVKQALAKSGPLG
                     LYQGMESTFWRHWWWNGGYFGAIFAVRNLLPKATSKKQELSNNLIAGTVGGFIGTSLN
                     TPFDVVKSRIQLHGTGEWAYPALLKVAKQEGMAGLYKGFAPKVLRLAPGGGVLLLVVE
                     ALSTVFRNYLGPPYV"
     gene            730125..731389
                     /locus_tag="CNC02550"
                     /db_xref="GeneID:3256400"
     mRNA            join(730125..730272,730326..730429,730486..730549,
                     730605..730732,730807..731389)
                     /locus_tag="CNC02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_569548.1"
                     /db_xref="GeneID:3256400"
     CDS             join(730215..730272,730326..730429,730486..730549,
                     730605..730732,730807..731253)
                     /locus_tag="CNC02550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569548.1"
                     /db_xref="GeneID:3256400"
                     /translation="MGIFGTSDPVKQTEKALAKEAKAEEKNIKQNVKSLSHAEKAESK
                     AAKAEQKAEKHHLKASKFEEKTAGVLNKATNKHEEAYHKENVAASEVVQKQHAHGTLS
                     NAVEQKKAQLEALQKKHEVNEQSRESKLHEVSGPAASNDNKVGAASQHHPSSQAGSQP
                     AGTTVGGQNSGAGAPATSGAGGNVGTADYQQQGNGAGGAFSQSQQGVPAGNLAAQSDS
                     YGAAQGVTSQGNASQSTANANRGYGGITAGDNQRMGQEEKVTEAVRRM"
     gene            complement(732036..735338)
                     /locus_tag="CNC02560"
                     /db_xref="GeneID:3256345"
     mRNA            complement(join(732036..732404,732455..732673,
                     732723..732961,733012..733179,733231..733504,
                     733554..733674,733714..733795,733849..734075,
                     734130..734289,734338..734850,734914..734943,
                     734999..735168,735225..735338))
                     /locus_tag="CNC02560"
                     /product="expressed protein"
                     /transcript_id="XM_024656733.1"
                     /db_xref="GeneID:3256345"
     mRNA            complement(join(732036..732404,732455..732673,
                     732723..732961,733012..733179,733231..733504,
                     733554..733674,733714..733795,733849..734078,
                     734130..734289,734338..734850,734914..734943,
                     734999..735168,735225..735338))
                     /locus_tag="CNC02560"
                     /product="expressed protein"
                     /transcript_id="XM_024658941.1"
                     /db_xref="GeneID:3256345"
     CDS             complement(join(732095..732404,732455..732673,
                     732723..732961,733012..733179,733231..733504,
                     733554..733674,733714..733795,733849..734075,
                     734130..734289,734338..734850,734914..734943,
                     734999..735168,735225..735246))
                     /locus_tag="CNC02560"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512399.1"
                     /db_xref="GeneID:3256345"
                     /translation="MPTDIFLDHKPFLSDSFDVHSYTNAILQGRQYTPDQSQQNNNKE
                     DNDKADLDVGAELARLNYGIEDVTKQLRQEITASHLLLLNHLTTSLSLSSHLSPIRSS
                     LISLSASIDRLHSKIHTPYTNLSTLVRRQQNLRQIKDIARRASRFVIVARRLENQLER
                     MGNAPEEDGEKGKTERRAELAKAALSCAELDSLLRDESNERGDDTTSIALLDIDFVKA
                     YSPLISRARDTVIEEMETMVFAGLQELNQTVLSSALQTAHNLRLLPDLVSNLLDDLND
                     AVTLRVTKAFDVTAIGKEVAVKDANSSHGTIKFPSRSRPPTEPTSSTTHLWVSILWKR
                     LERVIDDVANCCIKVYTLEKVLRIKRDTLTQVEFFDEVMKRLDEKPSFTYWTTLAKAF
                     ETQTKEAAKTSSWLQQALSVGYPRLLRLFHDFFSRIAVHTDTVYTQEHQSPEAVLVLR
                     SISSFETLYLTRSTNRMSDVVASAVEQYLSARGNPPGPSDGVSIARTVINELDSARFD
                     PLLVRTVARNAAKILDGFIQTVDGMLIEDFTATSLIGPNATSAQQVNAQLVGCLYHCW
                     LNLAYVEHDLTGKVWDILSPSVNSLETTYRRITKSLDAAFRKEITSTLSRIHRVNFDT
                     PVDPLAMGMDARGGSPYMQDLVDKIGFVRNQILGRMSLGEYMKAWVLDLSKFIVRTFL
                     LHASIARPMGESGALKLTGDMTELEMGVTNLLSTGKVQGAKDSVKVEQVGDDYFALRT
                     FRTLLFANLESLVNPVETVHIPPLIVLHHIIVRSPLRLPHEVHGWSESEYVLWIDKHK
                     DAKEQWELVEKTVEDQDVTNSEEETKVDIYVKLIKEVLAHARHDEQ"
     CDS             complement(join(732095..732404,732455..732673,
                     732723..732961,733012..733179,733231..733504,
                     733554..733674,733714..733795,733849..734078,
                     734130..734289,734338..734850,734914..734943,
                     734999..735168,735225..735246))
                     /locus_tag="CNC02560"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514278.1"
                     /db_xref="GeneID:3256345"
                     /translation="MPTDIFLDHKPFLSDSFDVHSYTNAILQGRQYTPDQSQQNNNKE
                     DNDKADLDVGAELARLNYGIEDVTKQLRQEITASHLLLLNHLTTSLSLSSHLSPIRSS
                     LISLSASIDRLHSKIHTPYTNLSTLVRRQQNLRQIKDIARRASRFVIVARRLENQLER
                     MGNAPEEDGEKGKTERRAELAKAALSCAELDSLLRDESNERGDDTTSIALLDIDFVKA
                     YSPLISRARDTVIEEMETMVFAGLQELNQTVLSSALQTAHNLRLLPDLVSNLLDDLND
                     AVTLRVTKAFDVTAIGKEVAVKVDANSSHGTIKFPSRSRPPTEPTSSTTHLWVSILWK
                     RLERVIDDVANCCIKVYTLEKVLRIKRDTLTQVEFFDEVMKRLDEKPSFTYWTTLAKA
                     FETQTKEAAKTSSWLQQALSVGYPRLLRLFHDFFSRIAVHTDTVYTQEHQSPEAVLVL
                     RSISSFETLYLTRSTNRMSDVVASAVEQYLSARGNPPGPSDGVSIARTVINELDSARF
                     DPLLVRTVARNAAKILDGFIQTVDGMLIEDFTATSLIGPNATSAQQVNAQLVGCLYHC
                     WLNLAYVEHDLTGKVWDILSPSVNSLETTYRRITKSLDAAFRKEITSTLSRIHRVNFD
                     TPVDPLAMGMDARGGSPYMQDLVDKIGFVRNQILGRMSLGEYMKAWVLDLSKFIVRTF
                     LLHASIARPMGESGALKLTGDMTELEMGVTNLLSTGKVQGAKDSVKVEQVGDDYFALR
                     TFRTLLFANLESLVNPVETVHIPPLIVLHHIIVRSPLRLPHEVHGWSESEYVLWIDKH
                     KDAKEQWELVEKTVEDQDVTNSEEETKVDIYVKLIKEVLAHARHDEQ"
     gene            735494..738326
                     /locus_tag="CNC02570"
                     /db_xref="GeneID:3256543"
     mRNA            join(735494..735886,735953..736191,736259..737075,
                     737132..737211,737273..737353,737416..737651,
                     737711..737927,737983..738326)
                     /locus_tag="CNC02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656734.1"
                     /db_xref="GeneID:3256543"
     CDS             join(735520..735886,735953..736191,736259..737075,
                     737132..737211,737273..737353,737416..737651,
                     737711..737927,737983..738276)
                     /locus_tag="CNC02570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512400.1"
                     /db_xref="GeneID:3256543"
                     /translation="MPKEHIRKRGKRKTKANDDPPLQPTTDVSEPEPSVSTGIHPARA
                     AMLAGQSIPVQTHSPSQDTQLEDSEREEADQTQWIRGPRMESEFPFGVLDPDVKAYFK
                     SIEEQIKDWEGVSSAGEEREDRQNFLSSVLSELRGHELSAATDPETSIILERIMPSLS
                     DWGRRVIGDSFGDKWEELIRHRFGSHVVQTWMTLAADTLDRESKDIWPPQQAKQDPLA
                     GRLPTMTLLFSSVITTLLPSVHLLISSPYASPPIRLLLLILTPRRVLPALGSERSANE
                     GLIRSKKSDKWRKNQEVKGKSILGDDQSTAQSSNRALPEDLRLCRKEIRQALMEGLGE
                     AEWKAMGVDAVGSPTVQLILEFEVDEGDAEKQGSLFDVLTEGIVTQICSNDQSVFEAR
                     PYLLSLITTQTGTRLSECILSLAPQKVFDAIWSTYFEGKLGKLAGHPYANFVVAKGVS
                     RLELDKIEKLIEEVLGNSGGRGLIKAARTSVVQALVDRSLVLTDSQRAVFDLIKSCLE
                     LPHDKHAFLVPCLMVLKTFPMYQAILAGEKTTSPEPADENMADDDVQAEASFAAAARL
                     SAWQNRRSAKPKDDLAPNMQGCLILQAMVGMEQVNEILLESLISLPIDSIIAYAKSPI
                     ASHLLDKVFLERSVPLKYKKKMMMMFMKSYKELVEDRLGSRVMDTIWEQADGYMKEKI
                     ARSLIPFVTELGGSQYGKFFIRRADIVLLNRRPDEWREKVLSVRHHFAHQKEASTPFV
                     GPRDDVIKRKKEKDENDEIDRLFDSMDTKKKRRIQK"
     gene            complement(738288..739247)
                     /locus_tag="CNC02580"
                     /db_xref="GeneID:3256470"
     mRNA            complement(join(738288..738368,738423..738583,
                     738636..738841,738895..739247))
                     /locus_tag="CNC02580"
                     /product="import inner membrane translocase subunit tim22,
                     putative"
                     /transcript_id="XM_569551.2"
                     /db_xref="GeneID:3256470"
     CDS             complement(join(738359..738368,738423..738583,
                     738636..738841,738895..739081))
                     /locus_tag="CNC02580"
                     /codon_start=1
                     /product="import inner membrane translocase subunit tim22,
                     putative"
                     /protein_id="XP_569551.1"
                     /db_xref="GeneID:3256470"
                     /translation="MSIPLPSAMPLLPPIYLPGQEPLPAGTSDWERQEMQTALKYQRY
                     MGMVMESCPLKVTIAGVGGLAIGGFFSLMSATFAYEDPLSRASNKLTTTRAQTMFVFK
                     EMGRNMWSSGRGFAKVGMVYSGVECCIEGYRAKNDIYNGVSAGFLTGAILARNAGPTA
                     MLGGGVAFAAFSGAIDWWLRSAPADEI"
     gene            complement(739654..742003)
                     /locus_tag="CNC02590"
                     /db_xref="GeneID:3256355"
     mRNA            complement(join(739654..739992,740044..740097,
                     740173..740289,740343..740440,740505..740638,
                     740695..740733,740797..740984,741054..741302,
                     741361..742003))
                     /locus_tag="CNC02590"
                     /product="polygalacturonase, putative"
                     /transcript_id="XM_569552.2"
                     /db_xref="GeneID:3256355"
     CDS             complement(join(739743..739992,740044..740097,
                     740173..740289,740343..740440,740505..740638,
                     740695..740733,740797..740984,741054..741302,
                     741361..741668))
                     /locus_tag="CNC02590"
                     /codon_start=1
                     /product="polygalacturonase, putative"
                     /protein_id="XP_569552.1"
                     /db_xref="GeneID:3256355"
                     /translation="MRFLCLFACVLSSAVVQGSLFVLSESQDQKIIPEILEKDNSIWP
                     YHHEVFEFHPEHKDLSTGLVRPLCVLHTLGEGADDSYNFEKAVHQCGRGGIVRLPDAN
                     YTISRPLDIYLSNSVLDLHGWLSFSANVSSWIENRMPLGFQNQSLAFVVRGNDYILEG
                     NDKGGINGNGQAWYDYAKDYGNKFGRPMSLAIKNSKNVIIKNFSIVQPQFWASLIWGS
                     ENVYIKDFYVNATSFNPESSSDQKNWLQNTDGSDTYQSHNVTYENMIYQGGDDCVALK
                     PNSTSITLRNVTCYGGTGIAFGSIAQYAGVKDVIEDVFMEDIRLYPSNQCPAYQGVYF
                     KSWLGYSIGQPPNGGGGGYGYCRNVTVKDVYMEDIWHPLVVQSDLTYLTLDREKFTDS
                     GLFEWYDIHLKNFTGKALGNRIAWMSCSKLTPCHDWTFEGMDIMPGKQDHPEIHYTCN
                     NFVLGGNDGLNQCHPSNSKLETENGGTL"
     gene            742162..744149
                     /locus_tag="CNC02600"
                     /db_xref="GeneID:3256485"
     mRNA            join(742162..742362,742444..742670,742729..742913,
                     742965..743329,743394..743447,743520..743632,
                     743695..744149)
                     /locus_tag="CNC02600"
                     /product="vacuolar membrane protein, putative"
                     /transcript_id="XM_024656735.1"
                     /db_xref="GeneID:3256485"
     CDS             join(742464..742670,742729..742913,742965..743329,
                     743394..743447,743520..743632,743695..744102)
                     /locus_tag="CNC02600"
                     /codon_start=1
                     /product="vacuolar membrane protein, putative"
                     /protein_id="XP_024512534.1"
                     /db_xref="GeneID:3256485"
                     /translation="MVLPRFLNTGVLCPMVLSTCWAVLHIMQYGFAITSLNGIQQSVT
                     CQKAENHTGILQIPIATPVDCIPMTTSSFGLVVSIFTLGGLLGSLAASTTTLRYGQVA
                     TLRLSAAMVLAGSTCIGFAGGTSSMLIGRVFVGIGCGLSTVTVPVFVAQLAPPSMKRS
                     LGISNQISIVIGMLAAQSLSFPFAHPDRWRFVFIAPAMLALIQLAGSLLVNNPVVESQ
                     EAPEIEALLETSQEAETLTIKDLFLSREPDVIKGFHVVLATQMSQQLCGVAPVMYFST
                     RILTPVFQGDSRLMALIVVLIKLPITVLPIFLRLGSRRLLVLPTSIMSFAALLLAFGI
                     NTNAAGLSIVGIILFVVAFSVGLGPVTWVVLPEVMPSHAVNAAGSVGLALNWVLNFAM
                     GATFLPIQQTLSGGVESKEGNVFFILSVTCAIAAFAIRLTFKRYDRRITLA"
     gene            complement(746729..749378)
                     /locus_tag="CNC02610"
                     /db_xref="GeneID:3256717"
     mRNA            complement(join(746729..747696,747758..748000,
                     748058..748151,748208..748455,748505..748577,
                     748636..748943,749012..749098,749158..749378))
                     /locus_tag="CNC02610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656736.1"
                     /db_xref="GeneID:3256717"
     CDS             complement(join(746774..747696,747758..748000,
                     748058..748151,748208..748455,748505..748577,
                     748636..748943,749012..749087))
                     /locus_tag="CNC02610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512537.1"
                     /db_xref="GeneID:3256717"
                     /translation="MVALASNFLGNPFITRDDVERGCIALLDPLSHHTSPGGAIIDIG
                     NTATHYDQKAVALETFARPLWGLAPLLLGGGKYIGVERWIKGLASGTDPNSFEYWGAS
                     ADKDQRMVEMSPLSFAVAIAPEVFYAGHTDAVKENICHFLRSCIGKQMPDTNWLWFRV
                     FANLALRTVGSAFYNPVQMEKDLERLEEFQLTGHPACGHESSSAGWSRDGPEEVKQLD
                     YYSSSFAIQVAQMIYAKLAIETDPERCKRYKQRARDFIQDFYYYFSDEGAAIPFGRSM
                     VYRFAAIATASAMPFADVEPPKPLQWGHIKGLVLRHLRYWNDAKDIFRSDGTLNIGYR
                     FDCMNMTENYNAPGSPYWCMKAFLCLGVPPDHPFWTSEELCWPSDLFPPIKSLPDPMH
                     IMCRQGGHTFLLSSGQKPHYAMRHGVAKYCKFSYSSAFGFSCPTGDMDLGQLAGDSMI
                     ALYDNSDSAKGGDGETWRVRREPFDCSIVGRGTAQVHLRSKWKPWNDVLVETWLIPPQ
                     ATSPNWYLRVHKITSERKLKSAEGGWTNYGQGINGRALIQSFSGLTSPGGDQEVGWAR
                     AVTEGGAVGILDLSNCSSSGRRLGQLVQIDPNANVIFSRGILPSLVGDIAKGETWLAT
                     AVFGLPSLTGKPLDWQKGWDEPPQIPSWIS"
     gene            complement(750042..750912)
                     /locus_tag="CNC02620"
                     /db_xref="GeneID:3256524"
     mRNA            complement(join(750042..750256,750315..750767,
                     750835..750912))
                     /locus_tag="CNC02620"
                     /product="expressed protein"
                     /transcript_id="XM_569554.2"
                     /db_xref="GeneID:3256524"
     CDS             complement(join(750138..750256,750315..750767,
                     750835..750856))
                     /locus_tag="CNC02620"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569554.1"
                     /db_xref="GeneID:3256524"
                     /translation="MSPPTDPEATAPHRRFSVRTLFSSTRHIFYVVLFTLWICIDIAL
                     LGLVSEQIHKYGRYRENYPTAQYQNALGLLLFSTIIGLLFGIFHWALGLTMYLPIFLA
                     FGVWFGTGAGILEPTPFGHGFQCRHTWDLSRFPANWQPYVGECSRVTAIEGLAWAMFA
                     LSVFGLFWVIADKYNFTSKRSSVYELAEQGEPIAEKH"
     gene            752244..756352
                     /locus_tag="CNC02630"
                     /db_xref="GeneID:3256438"
     mRNA            join(752244..752595,752701..752718,752803..752810,
                     752880..753010,753064..753167,753214..753733,
                     753784..753846,753884..753954,754016..754066,
                     754105..754158,754227..754268,754321..754463,
                     754521..754540,754590..754729,754782..754916,
                     754970..755011,755059..755083,755136..755277,
                     755329..755350,755399..755413,755454..755573,
                     755626..755969,756014..756101,756153..756352)
                     /locus_tag="CNC02630"
                     /product="expressed protein"
                     /transcript_id="XM_024656737.1"
                     /db_xref="GeneID:3256438"
     CDS             join(752466..752595,752701..752718,752803..752810,
                     752880..753010,753064..753167,753214..753733,
                     753784..753846,753884..753954,754016..754066,
                     754105..754158,754227..754268,754321..754463,
                     754521..754540,754590..754729,754782..754916,
                     754970..755011,755059..755083,755136..755277,
                     755329..755350,755399..755413,755454..755573,
                     755626..755969,756014..756101,756153..756199)
                     /locus_tag="CNC02630"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512401.1"
                     /db_xref="GeneID:3256438"
                     /translation="MEKRNFNDLPLFENGRQSSTCTPDPSQPSRSNENYEPVQSDANR
                     SVTVNRACDECHRLKMRCTKDKDSQSCTRCLQGSRPCTFEGPRKSKTSKVEDRLRVVE
                     GQITSIQGSIEELLRLQRDAACKSSSVENSHPFVQKPHGQEFETKYFQKSSSHTQQDP
                     LHCQSEASTLALSRTQNHPHRKAWTTESERGLQEDCPSDLDVDVFAADQTTAPMGNML
                     SLAEAARLKADAHIVRQETPESVRTPMTLSIDTHIERPLKKARFEGGADDKTKSELRI
                     VQRGNHSFPDPVDLGWCSISKGKELFRLFFDRCAPYVPCFDPNYDTWDSLRCRSSFAI
                     TTIIYVALRCVDAGGPVSDLQMKTRDYAEKIAMSTLFTPVARNEIVQSMILLASWGET
                     FWRPGGHAVRMAMDLGLHHCLPYLTDRDTDIHKSHEELAQERHIVVGARIWLTLFKID
                     TEMSFAYCRPAIFSPEGAINNARRFLEHPLSIPTDIRLVSTCENLTFRMPLHQHFALS
                     LGRRQSVGAAVDVDQLLRRCNCALKDWFQYWDRYCAQRGISADHFLRETLVTGRAGTF
                     LNANSHVLHDVRNRRDLMRLSEERRRWFQEAGEMAHQLVNTCLRGQQYTENFQYANRL
                     THYNMVYAARFMIRMASLLPEACDLHQVGRDVEQVAVMLTQVPGFQLAHFLREIMSKA
                     RQDHVLPPSLSVSRAPSPCAAANSAWSAADHSGSQNYHLNELGYKSRDCSTNFIPNWE
                     MMTTGTEQTPYGDDVSYLNFLYADQLFSHYENPADIGQSFALLQGNSRTETTSNSVFN
                     FDTTWFPFPPLDDDMQTGQAVGTNFE"
     gene            complement(756422..758876)
                     /locus_tag="CNC02640"
                     /db_xref="GeneID:3256260"
     mRNA            complement(join(756422..756912,756964..757000,
                     757062..757206,757266..757469,757536..757693,
                     757747..757816,757874..758179,758233..758239,
                     758288..758373,758430..758687,758744..758876))
                     /locus_tag="CNC02640"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569558.2"
                     /db_xref="GeneID:3256260"
     CDS             complement(join(756482..756912,756964..757000,
                     757062..757206,757266..757469,757536..757693,
                     757747..757816,757874..758179,758233..758239,
                     758288..758373,758430..758687,758744..758790))
                     /locus_tag="CNC02640"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569558.1"
                     /db_xref="GeneID:3256260"
                     /translation="MQTTPKGYDPITLSLFSNRFMCIAEAMGRSLKQTAISTNIKERL
                     DFSCAVFSPTGDLVANAPFVPVHLGSMSWSVKYQLELHGKSLKDGDVLLTNSPLAGGS
                     HLPDLTVITPCFDENDPNKIIFFTASRGHHSDIGGILPGSMPPTSTNINEEGANILSL
                     KIVSDGVYDHEGLYRVMVEEPSKYPGCSGCRNFRDVESDIKAQIAANNKGSSLLRALV
                     EEYDLKTVHEYMDHIRNNAEQAVRNMLRKAAANAKTNILHGIDYLDDGSPIALEITID
                     TDSGSAIFDFEGTGPELRGNLNAPICVVHAAVIYCLRSMIGEDIPLNAGCLVPIEVRI
                     PEGSLLSPSPESAVCGGNVMTSQRITDVVLLAFRACAASQGCCNNLTFGAGGKDFETG
                     EVIDGWGYYETIAGGSGAGDGWHGTSGVHCHMTNTRITDPEILERRYPVILREFGLRS
                     NSGGSGKYNGGEGCVRSLQFLQPLQVSILSERRARGPYGLNGGACGAPGLNLWIKQAH
                     GGSAKGKPRVINIGGKGTMQFETGDLIVLHTPGGGGWGKLEDTDSKLKQEDEPLLQAI
                     KWEARGSWADMAKVDF"
     gene            759010..762242
                     /locus_tag="CNC02650"
                     /db_xref="GeneID:3256364"
     mRNA            join(759010..759146,759224..759422,759478..759681,
                     759744..759914,759964..760298,760349..760449,
                     760508..760625,760681..760841,760905..761031,
                     761091..761234,761285..761361,761419..761713,
                     761768..762012,762069..762242)
                     /locus_tag="CNC02650"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569561.2"
                     /db_xref="GeneID:3256364"
     CDS             join(759099..759146,759224..759422,759478..759681,
                     759744..759914,759964..760298,760349..760449,
                     760508..760625,760681..760841,760905..761031,
                     761091..761234,761285..761361,761419..761713,
                     761768..762012,762069..762135)
                     /locus_tag="CNC02650"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569561.1"
                     /db_xref="GeneID:3256364"
                     /translation="MSRSIPDHSIRISIDRGGTFTDVHASIPAANHSETREEFIFKLL
                     SQDPSNYKDAPTEGIRRVLEKVTGQGIERGKPLPVDKLEYVRLSTTVATNALLERKGQ
                     KHALMITKGFKDLLEIGNQARPNIFDLNIKRAKPLYSRTVEVDERVTLVGFSSDPNYE
                     KHAVKFNDDGSIGESYSGVGADEQKIVIPGRIVRGLSGEAVNILREPNLEAIKVDLQN
                     LYDDGYSSIAVCLAHSYTFPDHELAIGKIATEVGFPHVSLSSQLLPMIKMTPRGQSTT
                     ADAYLTPILRDYLEGFYSGFEGGKNGSLHVEFMGSDGGLVDLKNFSGLKSILSGPAGG
                     VVGCALTSWDKDEKIPIIGLDVGGTSTDVSRYAGHYESVYETTTAGISINTLQLDINT
                     VAAGGGSCLTYKNGLFRAGPESAGAHPGPACYRKGGPLALTDGNLFLGRLIPKYFPRC
                     FGPNEDQDLDPEASHKKFEQLAEMIRKESGTEKSLDEIVYGFVKVANETMARPIRTLT
                     EARGFKTEKHILASFGGAGGQHACEIAELLGIQRVLIHKYSSILSAYGLALADRVFEL
                     QEPAAVIFSQENKAGLNARLDKLERDVFKTLLDAGFADDKIGINRILNMRYDGSDTAL
                     MISNEGSGDYEKEFKRAYKEEFGFLLNKNIVVDDVKVRGVGKTFDSLGPPPTQEVKSL
                     ELSVVSPEHADCSQNCYVWYGKSGKREEVPVFKIESLSVGNMVIGPAMVIDETQTIFV
                     NQGWKAISTNSHLLMVQEKKKGD"
     gene            complement(762273..765511)
                     /locus_tag="CNC02660"
                     /db_xref="GeneID:3256610"
     mRNA            complement(join(762273..762465,762548..763046,
                     763100..764034,764082..764158,764218..764353,
                     764399..765511))
                     /locus_tag="CNC02660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656738.1"
                     /db_xref="GeneID:3256610"
     CDS             complement(join(763102..764034,764082..764158,
                     764218..764353,764399..765055))
                     /locus_tag="CNC02660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512592.1"
                     /db_xref="GeneID:3256610"
                     /translation="MSCPSPGSSPSTSATVPLAVHRQNDYQTASPISLPPSLSPSASP
                     VAIFRRAIVLHDHSDAEKNFPGESNTQENVGPIMSSVPFAASPLIAATTFSLAPNLEQ
                     QRGKRKRRRSGSDSDYSPPYSLRGGGRPQKSKTRRNANNGSHSGQCQNVRSSRRTTRS
                     KARRANSPSSLIITSLEDIKLEDAAVKSEISRLGLTLRDVQGDGNCLFRCLSDQLYGT
                     EKRHAEIRKIVCDYLDSHKETMEGFVVPFMKEGERYEGYVQRMRQSKQFGSHIEIQAA
                     ARIFQRDIRVVMSTASFTIPWRAESSCFFGDRKYDAKLDLPEGLAITLRDGIPPIQEG
                     RTMLWLALFSQAEHFQSIRRQGDKDNGSANIDDHLAVPHAKDTSEAARRERGEIVGNK
                     VESRSPISSHVAQLLASLPPGHGISSTYAEGVLSRVKGDLGEAIEILLEDIQSEADKE
                     SESSSDQRVEELLHELAPSNTACPSDSSAIEHCSLSSEGVSYRPRSPALSSTTGTRSR
                     SESVSERSSNGSVTSDLAQSQSSRSTTVSSGQDAPRVTPEIISDSKLRTKSDKLGKDL
                     QGMVLRSRESSREPKRSHDEPQKRRASLRLKNRL"
     gene            765665..769179
                     /locus_tag="CNC02670"
                     /db_xref="GeneID:3256445"
     mRNA            join(765665..765773,765836..766267,766347..766493,
                     766558..767307,767369..767588,767659..768779,
                     768831..769179)
                     /locus_tag="CNC02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656739.1"
                     /db_xref="GeneID:3256445"
     CDS             join(766403..766493,766558..767307,767369..767588,
                     767659..768775)
                     /locus_tag="CNC02670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512535.1"
                     /db_xref="GeneID:3256445"
                     /translation="MLTAAVIPDSIGVNQTELISQEKNDQLSMDRTMPGIILLSTAGF
                     LAFCMIIDHPRFLARLFASFFDPNKTKVKQAPKPGFHTSLGSQGSSAEKVIGGGDLCE
                     GWLLKKKTNRHIEILSPRTPASDRRGHFLPSVGEDESQEVRPVSSPLLHPPPHIAPLI
                     SYMPFSASLLCTPFNRLPGPFKSIITVKQVYIIVGYVVLIAFALFWRSKLSPAEKTSG
                     YGSDFKRSGDVAIAQLPVVVALGVRGNVLGLCVGQGYEKLKLLHKVIGRILFVAASIH
                     VIGYTYKWLAAGNFVSSSSQRFVVCGYLSYAAMLLIIISSLPYIRRAYYGLFKMCHLV
                     GMMVMLFGLAWHVDEAVPFCITGLVFYFVSFAGSLAKTRLAKAHLRALPSSNTTIVTV
                     PALKSGWRPGQHVRIRIPALGSRHGFEGHPFTISSAPNCEGMVLMCKDAGDWTKRLFD
                     YSRALEASTTEPESGAGRNVKIIIEGPYGGTGNTMLSSFSSLVLIAGGSGITHALAVA
                     HDLVMRAPTGAVRARIVDLVWIVKTEQEAKPLMATLLELVSDAKSWEAASIEGQRRQA
                     NYASPTALRIQIFVTRCPASSPLALIPDATALSSFNVETSAEKSGMVGHMSGTNTEKV
                     AYLSRNLSAASTMSTMRDKYVQLSGITARPARPNLNIIISKIVDETIAHHRQNLTEAN
                     GMYITACGPEGLVYSTMQAVKALQAYKRTAVGGVEFEEERFGF"
     gene            770155..772848
                     /locus_tag="CNC02680"
                     /db_xref="GeneID:3256370"
     mRNA            join(770155..770647,770750..770813,770872..770883,
                     770968..771037,771101..771174,771241..771360,
                     771424..771653,771709..771835,771887..771932,
                     771989..772114,772176..772450,772506..772848)
                     /locus_tag="CNC02680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569563.2"
                     /db_xref="GeneID:3256370"
     CDS             join(770575..770647,770750..770813,770872..770883,
                     770968..771037,771101..771174,771241..771360,
                     771424..771653,771709..771835,771887..771932,
                     771989..772114,772176..772450,772506..772725)
                     /locus_tag="CNC02680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569563.1"
                     /db_xref="GeneID:3256370"
                     /translation="MATSVIPPQTACSLTDSNPVRKYSFFRSVTFQIAIACAVSFTAP
                     GMWDALGGLGAGGAAEPYAVSAANALVYGLFAIVCVAAGAINNRIGLKWGLALGSIGY
                     PLYGAGLYVNNHTSHTAFMLWGSAMCGISAGFFWAAEAAIIIGYPSPKDRGFYLAVWQ
                     TAKAVGPIVGGAINLGLNANRETAGSVGSATYIVFIVIMCLGLPFAICLSPAQKVHRK
                     DGTRVIVHKQPSWTKEFKAVLDLALTRRIALLLPSFFISYFYNGFLSTWLTTYFTVRS
                     RAFSSFFTNFAGIFSSFIVGTLLDSQKINIKTRGKIAFASIVIILTGTWIWAIILQKQ
                     FYDADVAPVYDWFKGGFGKAYGVVFFWTFAGQAYQQFLYWVVGQYATDISSLSHHTGI
                     LRGVEALGQTVAWAMQSEGNANHFVSIGINFGITLLSIVPTWIVLSELEGSHEIVVVE
                     SDQESNNEGKESTEGPSAKSSVKDLPLA"
     gene            complement(772856..773385)
                     /locus_tag="CNC02685"
                     /db_xref="GeneID:36392787"
     mRNA            complement(join(772856..773016,773072..773159,
                     773217..773385))
                     /locus_tag="CNC02685"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658942.1"
                     /db_xref="GeneID:36392787"
     CDS             complement(join(772954..773016,773072..773159,
                     773217..773263))
                     /locus_tag="CNC02685"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514279.1"
                     /db_xref="GeneID:36392787"
                     /translation="MVNEAIVQEGWPYEFGTSGFCETWPVAQDIQHSYCGIHEEIRLF
                     LWLTSCIYRRWWLTLAGEDKE"
     gene            complement(773837..777447)
                     /locus_tag="CNC02690"
                     /db_xref="GeneID:3256579"
     mRNA            complement(join(773837..774153,774191..774215,
                     774277..774395,774451..774545,774614..774629,
                     774680..774699,774755..774767,774829..774851,
                     774904..774996,775049..775074,775127..775145,
                     775207..775471,775526..775557,775609..775734,
                     775780..775872,775921..776048,776096..776104,
                     776168..776401,776457..776525,776579..776652,
                     776700..776740,776799..776809,776875..776943,
                     776996..777081,777169..777447))
                     /locus_tag="CNC02690"
                     /product="mitochondrial inner membrane protein, putative"
                     /transcript_id="XM_569565.2"
                     /db_xref="GeneID:3256579"
     CDS             complement(join(773904..774153,774191..774215,
                     774277..774395,774451..774545,774614..774629,
                     774680..774699,774755..774767,774829..774851,
                     774904..774996,775049..775074,775127..775145,
                     775207..775471,775526..775557,775609..775734,
                     775780..775872,775921..776048,776096..776104,
                     776168..776401,776457..776525,776579..776652,
                     776700..776740,776799..776809,776875..776943,
                     776996..777081,777169..777329))
                     /locus_tag="CNC02690"
                     /codon_start=1
                     /product="mitochondrial inner membrane protein, putative"
                     /protein_id="XP_569565.1"
                     /db_xref="GeneID:3256579"
                     /translation="MAQNPQEPLSSRLSSTLKATAGSLTSSVKPAESELGRWRRTFDK
                     FAKEEVDGQKFLNPSQFIDAIAPTDEGFSKIKREQYANLFRVADSARRGLVSFEDFVV
                     FETLLKRPDADYQLAFQVFDVDASGTIDFDEFKAVLSANTAASGIPFDFDCAWMKLYV
                     GKRGDRHVLGYHEFTQLIKGYQGERLRQAFHFFDADGDGYINPEEFQRIIVEIAGHKL
                     SDSVLGRLPTLCTLNPGRRISYSEVIAFHNIIREMDTVERIIEHAVKKSKDGRIDISD
                     FLDEAAGSMRYGMFTPMEANIIWHFASRGNAGTGQRLALADFQALLDAKWQPPETASI
                     KQPSTVSGGFLAEAAQSTYNFVQGGIAGGLGAYAVYPIDLVKTRLQNQRSTVVGEVLY
                     RNAFDCVKKVYTNEGGIRAFYRGVLPQLVGVAPEKAIKLTVNELVRKKATDPETGRIP
                     LLMEIVAGGSAGGCQVVVTNPLEIIKIRLQMAGEITRAEGGTAAPRGAFHVIKQLGLI
                     GLYKGATACFARDIPFSMIYFTSYAHLKKDVFHEGHHGKVLSFGELLAAAGIAGMPAA
                     YLTTPADVVKTRLQSQARAGQTVYKGIIDGLSKIFREEGLRTLFKGGLARVIRSSPQF
                     AVTLACYELLHKHFPYPYAPTPVVHRPVLQVHQEISRIRARNALRILLDCSSRFGMVD
                     SSTASKRMQLIPKSFR"
     gene            complement(777908..780404)
                     /locus_tag="CNC02700"
                     /db_xref="GeneID:3256817"
     mRNA            complement(join(777908..778295,778348..778650,
                     778703..778810,778875..779129,779181..779384,
                     779433..779564,779615..779758,779814..780404))
                     /locus_tag="CNC02700"
                     /product="mitochondrion organization and
                     biogenesis-related protein, putative"
                     /transcript_id="XM_569566.2"
                     /db_xref="GeneID:3256817"
     CDS             complement(join(778083..778295,778348..778650,
                     778703..778810,778875..779129,779181..779384,
                     779433..779564,779615..779758,779814..780374))
                     /locus_tag="CNC02700"
                     /codon_start=1
                     /product="mitochondrion organization and
                     biogenesis-related protein, putative"
                     /protein_id="XP_569566.1"
                     /db_xref="GeneID:3256817"
                     /translation="MSAGTTVTYARLPPPHALLRGAPLPLRAYIRSPQAFTASAPIPL
                     ATRARLPQLIPLASLRFVSTQPQPSSPPPPYPPPVHSPAPAAHRINSAEPAIGTPPPL
                     PPAPQGSLPPKVTDLAAAHEKALEKKDEKKKPTGPLPARVWASVKKEAAHYWAGTKLL
                     GQEIKISGKLQWKVLNGGTLTRRERRQLRRTTIDLLRLLPFSVFLVVPFMELLLPVAL
                     KLFPNMLPSTFEGEFAANEKQRKLLRVRIEMAKFLQETVRESGLKADSVVRSDEFKEF
                     FRKVRSTGETPNQTDVVRVAKLFHDDITLDNLSRSQLVSMCRYMNINAFGTDNFLKHQ
                     IRSKLEKFRVDDMMIHAEGVDSLSTKELQHACQSRGIRFLGVSPARLREELEKWIELH
                     YINGISGVLLVLSRAFNFEQKGDDIMESLVITLSSLPENLLNEAELHVLDEASYKQKL
                     EVLQQQQELIEDEAEQEKEEQDALKEEQEKKEAEETARREQEEADKAVEVSPAAKEEE
                     TSKEQVEESVQPAPDQKDARMSEEQLSEIAEALSVLTARSSIMKERDELKSLLEDNLL
                     SEAESKERQEGASPTVAVSKRVRAMIKKIDTQLEKYDERVDSSLNVIKTTPLGQIPLE
                     DLKKALKEMKHRPAD"
     gene            780539..781539
                     /locus_tag="CNC02710"
                     /db_xref="GeneID:3256745"
     mRNA            join(780539..780843,780933..781001,781064..781124,
                     781201..781279,781343..781539)
                     /locus_tag="CNC02710"
                     /product="sterol metabolism-related protein, putative"
                     /transcript_id="XM_569567.2"
                     /db_xref="GeneID:3256745"
     CDS             join(780546..780843,780933..781001,781064..781124,
                     781201..781273)
                     /locus_tag="CNC02710"
                     /codon_start=1
                     /product="sterol metabolism-related protein, putative"
                     /protein_id="XP_569567.1"
                     /db_xref="GeneID:3256745"
                     /translation="MSLSNPLNLLLVPPLLFLAYRILVPPPPHTPPEYNSLPAEHPHV
                     ICHSTFTPAQLAQYDGTNGDRILLAIMRVAPDGKIDPNGERTVFDVTAGRTFYGPDGV
                     YGNFAGRDASRGMAKQSFEPEVLTSIDEPLDDLSDLTPSEIENMRGWHQHFEGKYIVC
                     GELVNG"
     gene            complement(781514..783292)
                     /locus_tag="CNC02720"
                     /db_xref="GeneID:3256503"
     mRNA            complement(join(781514..781762,781831..781899,
                     781961..782045,782115..782201,782287..782371,
                     782422..782444,782518..782671,782731..782798,
                     782862..782953,783014..783108,783173..783292))
                     /locus_tag="CNC02720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569569.2"
                     /db_xref="GeneID:3256503"
     CDS             complement(join(781548..781762,781831..781899,
                     781961..782045,782115..782201,782287..782371,
                     782422..782444,782518..782671,782731..782798,
                     782862..782953,783014..783108,783173..783237))
                     /locus_tag="CNC02720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569569.1"
                     /db_xref="GeneID:3256503"
                     /translation="MVNLADLSNSLASQDFTSIPVIDLSDAQSPSLQKRKAVAAEIRN
                     ACLNAGFFYVKNHGVPLQVVDRTFEQSKEFFNQPDGLKKSVDISKSGGNFRGYMGLLS
                     ENNDPKNKGDMHEAFNMGLDPSVDASAFIQDVKEGELRHSENLWPDKKDWQGADVFKQ
                     ANLDYYKEVLGLGQSLFPLFALALDLPEDFFSDKIEHPAAIMRILFYPALGERQVDEL
                     MPGIGAHTDFECFTILRQDDVPSALQVQNRKGQWIDAPYMPDTFVINIGDQFARWTND
                     IFVSTRHRVLPALSKDRYSIPFFFGCDHDVPLIPPDTCVTADRPAKYETMTAGAYVHM
                     RLSDIYKVKET"
     STS             782680..783157
                     /standard_name="Eco19"
                     /db_xref="UniSTS:470772"
     gene            783516..785467
                     /locus_tag="CNC02730"
                     /db_xref="GeneID:3256443"
     mRNA            join(783516..783577,783622..784367,784421..784738,
                     784792..785007,785061..785467)
                     /locus_tag="CNC02730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569570.2"
                     /db_xref="GeneID:3256443"
     CDS             join(783542..783577,783622..784367,784421..784738,
                     784792..785007,785061..785343)
                     /locus_tag="CNC02730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569570.1"
                     /db_xref="GeneID:3256443"
                     /translation="MPPAQLCQRCNQPMQLDPSVAEITPAQYSLIVSSLPPPSPATSS
                     SSSTPRDLTHKLADLPPFTREAAKIWRDANDPPLSGDSSIQTGLRSVAESFILLSDSA
                     LHPKSSKSPSKSLPPHDLDLSAQLHQILSSNTPVSHPLCTECTALLTAEFQRMAEELG
                     KERDAYIWFEQAIRKNKELLETAESSRRTVSTRHVDGLAKYDVEGTEEEWGALLKRKE
                     QLEIEEEQLKRLLELTEKELEAVLEEERLVELEAKAVEQEENDFLTSHSALSIHLTQL
                     ASTLNTAHTSLLLSRSLLAHLESTNVYNDAFHIGHVPLLPLASSSITVGTINGLRLGG
                     RPVVEWDEINAAWGLAALCLHRIAEKVGCVFETYKIVPLGSYSRVEELPPSKSTYELY
                     ASSDMTPARLLQNRRFNHAMVAFLECLRQLLEFGKKHGKQWAQANIDICKDKISNHSI
                     RLPGISSMPLGLPSMAIMSLAGNGPNHPGTNGSNGKSQSGSSTGDSTAEEGWTRACRT
                     VLGVLKRVLIMESETDRGNINEQS"
     gene            complement(785344..789738)
                     /locus_tag="CNC02740"
                     /db_xref="GeneID:3256222"
     mRNA            complement(join(785344..787264,787313..788674,
                     788722..789738))
                     /locus_tag="CNC02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656740.1"
                     /db_xref="GeneID:3256222"
     CDS             complement(join(785427..787264,787313..788674,
                     788722..789574))
                     /locus_tag="CNC02740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512403.1"
                     /db_xref="GeneID:3256222"
                     /translation="MGPLSLLKGQAAISQAENWDDDFEFSLSFPIDYNNSTATLKENK
                     YQNMYDRNGDIPSSVRPKSLSLSPTKPGRSGAPSCPKITAPLHTPCPQSPRHSPSYPS
                     DFTSFPSKTKPSSSNPDPVSPPLLSTRSNAYLPQRHGRGFRSRAGSTTAINGDVAPKK
                     LTKRCPSASFIPIPSSHSSRSLRRNDSATSLSCSLHRSATCPDLVYPCTPPSTTDIPR
                     SASGEPTPPQFLSEKVASGVTDLLRKKSRTKPRPQVPLLPSSDNIVGKEHGKRFWNRF
                     SGNPASNKDHTATPMRRRSSSVGTFFAEVDVSARSSPEPPLPPLPINLNSRSPTTTSS
                     MRSQMQHNTISPISSTLQCPSNSLAEAKMGTKEGALPIPYIHPGNNAWREVAIDGEDS
                     PLSDCRNSFKTPDEPQSYSRGFHLPSPSLGSPYRRARKSLHIPEHPLPESSSLHIMAP
                     GQTPGGNASICFSMRSESPSEAKIIDVKAPRKRVKEPHSFFPASSVEMAEKLRNDNEA
                     VAMANTRPYTTGDCPTAGSPDNLNAVTAHPTLVRFGRKTSGNGHTGAGSSGASFTSTV
                     RRLGSISKKHGRRISGGWKFGAQPSSSSASLTLQEVKPTGAVFDQSRAEEEARLGTVM
                     GSPVKEDVTKLADDELVKQAMGSECTKNCGTRQDRRSPPSEQWDQDFPLESEFQHIGP
                     SINGSSLIRPESKRREDKNRRRQSWNDFVIPRNVMEKQREVKEGIGAIKMFARGVESL
                     KSLIAAHASLSNQLHSHKSSSPDSLRFDALHAEFAQWWEMAIVLVEVGSTGRDDNSHG
                     PIDGSKRERRVTLATEEARIAEDAPRHVSGSITSTEMSSVPSEGGLMASGHRNISLPE
                     TVEHLPSLRSPPRASPPPEHWRASTGRQNLSKRQLEVLRTMLRTPVSESSKGVDMTGH
                     QESTQRADYEAVNATKTKKGGNASKAITSMAPKSQNDLPIGVDLLQERRAEPLNATIK
                     SRRRYTSKVGLAGLKEFLRSLRMERSTGKADEQNLSLTTIKSQAHGVEDIAAVIRSRS
                     SATNPSTATEGSALLEHPSSFRSASPTGHSCEVSHNSISVRNLQIEPSSSKQVLMPDK
                     SRSKSSSRVRQIPSTASPSVLSKSTQNPRLEPKRPSIRNIFRTSSGNWSELISLNSGS
                     PAPSSTKNSSPALRKSDSMRRTFGQVSEAKDRPERGEKVDNDSAEAKAAKMGSFKGHD
                     ELSVDGRGLILIGDPPPGTYIRSKPPTETSATVKQLGVEEEMTLKPSKKTRATGLGWP
                     ERKAEGGDIKDFISPVFSGISNTTQVSSTPMMGQREDSEGNVVVALTPDNLPTLLEYM
                     KQCEVKLHEWKKKVQMEGLDKELIMNSVKA"
     gene            792790..794012
                     /locus_tag="CNC02750"
                     /db_xref="GeneID:3256304"
     mRNA            join(792790..792931,793001..793106,793175..793303,
                     793374..793593,793642..793758,793822..794012)
                     /locus_tag="CNC02750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569572.2"
                     /db_xref="GeneID:3256304"
     CDS             join(792864..792931,793001..793106,793175..793303,
                     793374..793593,793642..793758,793822..793973)
                     /locus_tag="CNC02750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569572.1"
                     /db_xref="GeneID:3256304"
                     /translation="MESKTFLKNALAQKKPGLGFWCTLPGAATVATALSAGGFNWTLI
                     DAEHGMITDKDYFELVTTVTSLGASPIIRIPWNEEWMIKRALDAGAQGVMTPMCHSAE
                     DAKRIVSYSKYPPTGSRGYGPMFCPPVFGCKGSDYDAGADKNLLVIVQIESRKGVENV
                     EEIAKVEGLDCLFIGPFDLSKQMNVPFGGEEHEAAIEKTLQAAHSAGKIAAIFCSNGE
                     IARKRLAQGFDMVSIAVDSSCLAAEMERQLSLVTGEAGKGDRSYS"
     gene            complement(794011..795861)
                     /locus_tag="CNC02760"
                     /db_xref="GeneID:3256455"
     mRNA            complement(join(794011..794317,794369..794431,
                     794490..794619,794675..795049,795116..795195,
                     795261..795335,795388..795623,795727..795861))
                     /locus_tag="CNC02760"
                     /product="glyoxylate reductase, putative"
                     /transcript_id="XM_569573.2"
                     /db_xref="GeneID:3256455"
     CDS             complement(join(794256..794317,794369..794431,
                     794490..794619,794675..795049,795116..795195,
                     795261..795335,795388..795623,795727..795743))
                     /locus_tag="CNC02760"
                     /codon_start=1
                     /product="glyoxylate reductase, putative"
                     /protein_id="XP_569573.1"
                     /db_xref="GeneID:3256455"
                     /translation="MPKILVTRNLGEHAMTILRQSGYDLIVNPDDAPPSREWVLNHLA
                     DPQVYAACIMHSQPSDKVDKELIATANDNLRCISSFSVGYDHIDVKAANARGIKIGHT
                     PGVLSDAVADIAVILVLSTLRRIGEGINLVKSGNWKQQPWAPFVNCGLSIGHPSLTIG
                     FLGFGRISQATVQRLLAFTNKEQPPRILYTSSYRRDNQDEIDAGFSKTFGVEVRREER
                     ETLASQADILIVLCDLNPSTKDLVNKNFLQKMKKSAILVNVARGPIVNSEDLHEALVS
                     GQIFGAGLDVLTGEPDIPADHPLLTLDNCLVLPHLGSADYDTRNAMAERCVRNAIAAA
                     NGEPLVAEVKV"
     gene            796013..797549
                     /locus_tag="CNC02770"
                     /db_xref="GeneID:3256777"
     mRNA            join(796013..796165,796232..796404,796466..796545,
                     796599..796719,796786..796848,796916..797549)
                     /locus_tag="CNC02770"
                     /product="expressed protein"
                     /transcript_id="XM_024656741.1"
                     /db_xref="GeneID:3256777"
     CDS             join(796250..796404,796466..796545,796599..796719,
                     796786..796848,796916..797456)
                     /locus_tag="CNC02770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512536.1"
                     /db_xref="GeneID:3256777"
                     /translation="MFDFIFTFFLATAILAAVMALSVAITLPFAGALVRWRANYNPLA
                     VGLDQESRVGPTLTTLFGTMKRIKRLEGWQGLWKGMYPTLMYSTLLSVLSIVFVGGSA
                     TKGPKNAYSVPEAGGVLMAIFTILLTIISLPMTILINRAIITPYKLPNSVKGSLRILL
                     TPLELSKPYTLYLTPGLLATTMTHVVCATLLARTTRIFFLGVSSVTNDETVGNIAWWR
                     WILYLAWQCLSTLWFTPLEVIATRLSVQPNNSGDALSTEEEAPEGVSFCGAGEDVIGL
                     RPSTEPYLGMADCAKKIIEEEGWASLYRGFLFTMLGSVFGSTV"
     STS             797343..798145
                     /standard_name="Eco23"
                     /db_xref="UniSTS:470773"
     gene            complement(797479..799164)
                     /locus_tag="CNC02780"
                     /db_xref="GeneID:3256320"
     mRNA            complement(join(797479..798199,798256..798509,
                     798558..799164))
                     /locus_tag="CNC02780"
                     /product="expressed protein"
                     /transcript_id="XM_569936.2"
                     /db_xref="GeneID:3256320"
     STS             797621..798379
                     /standard_name="Pvu1"
                     /db_xref="UniSTS:470770"
     CDS             complement(join(797681..798199,798256..798509,
                     798558..799026))
                     /locus_tag="CNC02780"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569936.1"
                     /db_xref="GeneID:3256320"
                     /translation="MAHPLTQQPSSSLPFPFAARPSPLTFGFGLPSTAPSETCTQTSN
                     AHSPYRMAGPAHSSPPKNSFARPRPNQAFTPPTGSLKRTRRSRSPSTSPTGSIQSPRS
                     RSPTPMASRLGHLPPPKNMRTDPSYASKTVKRSKLQNSTSDERSAEGMDVGIMLAALP
                     PSAHLPILLQLLQRDPSLSSTVLGIMPKLEFRSCLKEMEKLFAEIEKLAGPVVNVSFY
                     PGALAESRRWDRVSNNIEVYCRTVATYIKCFTSANQQPAIDCPTLFLFLESHTRHLLT
                     ILSYIPSSSQLDGSSPPPASLVLDLAKLSLTIWTSWVSDLSSDVNDRGGMYPHSAVAH
                     WNDTLEQLVGGIPSPSIPSASNAPGTGSHWSSSTPLTAGNPSPAKLLVSSFQEAFIPI
                     RDQFVSQVGWLIGRQPAMEYH"
     gene            799522..801551
                     /locus_tag="CNC02790"
                     /db_xref="GeneID:3256672"
     mRNA            join(799522..799618,799696..799731,799799..799815,
                     799870..799892,799947..800074,800127..800155,
                     800209..800312,800372..800577,800638..800789,
                     800838..800913,800967..801058,801119..801243,
                     801303..801357,801411..801431,801483..801551)
                     /locus_tag="CNC02790"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569574.2"
                     /db_xref="GeneID:3256672"
     CDS             join(799601..799618,799696..799731,799799..799815,
                     799870..799892,799947..800074,800127..800155,
                     800209..800312,800372..800577,800638..800789,
                     800838..800913,800967..801058,801119..801243,
                     801303..801357,801411..801431,801483..801507)
                     /locus_tag="CNC02790"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569574.1"
                     /db_xref="GeneID:3256672"
                     /translation="MTTIQKIKDIEDEMARTQRNKNTEYHLGQLKAKLAKLRRELIAP
                     SGGGGGGPGIGFDVARSGQATVTVIGFPSVGKSTFMSKLTGTHSEAASYEFTTLTTVP
                     GQMTYNGARIQILDLPGIIEGAKDGKGRGRQVIAVARTCNLIFIVLDVLKPLNDLAIL
                     TNELEGFGIRLNKKPPAITVKKKESGGVAITNTVPLTKIDAQEIRAVLQEYRMSNAAV
                     SIHQPDATIEDFIDVVEGNRVYIPAIFVLNKIDAISIEELDLLYKIPNSVPISSKLWL
                     NIDELLEVMWDKLNLVRIYTKPRGQQPDYSSPVVLQRGKCTVEDFCNAIHKEIVKQFK
                     NAMVWGTSAKHARGQKVGLDHVLEDEDIICIFKK"
     STS             804229..805071
                     /standard_name="Sal1"
                     /db_xref="UniSTS:470803"
     STS             901598..901724
                     /standard_name="Taq3"
                     /db_xref="UniSTS:470771"
     gene            complement(911800..913265)
                     /locus_tag="CNC02800"
                     /db_xref="GeneID:3256589"
     mRNA            complement(join(911800..912202,912263..912348,
                     912408..912577,912643..912687,912738..912869,
                     912926..913265))
                     /locus_tag="CNC02800"
                     /product="tRNA guanylyltransferase, putative"
                     /transcript_id="XM_569939.2"
                     /db_xref="GeneID:3256589"
     CDS             complement(join(911882..912202,912263..912348,
                     912408..912577,912643..912687,912738..912869,
                     912926..913029))
                     /locus_tag="CNC02800"
                     /codon_start=1
                     /product="tRNA guanylyltransferase, putative"
                     /protein_id="XP_569939.1"
                     /db_xref="GeneID:3256589"
                     /translation="MAKSRFEYVKKFELPDPLVPNTYIIVRIDGKGFHKFSDVHSFDK
                     PNDIRALKLMNTAAKAVLNEYKDVVMAFGESDEYSFLLRRTTTLYNRRRSKINSSIVS
                     LFTSAYVFHWASFFPNTPLLYPPSFDARVVLYPNVKEVRDYFSWRQADTHINNLYNTT
                     FWALVHDGLTTAEANKALQGTNSKDKNEILFTKFGINYNTLPEMFRKGSVCVRSLSLE
                     EPQGSLAEQQAAHGIMTLSIVPSTSGNSNTILSQKEKVYQGTEGSPMVLHMDIINDIF
                     WSERPWLLS"
     STS             912488..913277
                     /standard_name="Hind2"
                     /db_xref="UniSTS:470767"
     gene            913413..914202
                     /locus_tag="CNC02805"
                     /db_xref="GeneID:36392788"
     mRNA            913413..914202
                     /locus_tag="CNC02805"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658943.1"
                     /db_xref="GeneID:36392788"
     CDS             913493..914005
                     /locus_tag="CNC02805"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514280.1"
                     /db_xref="GeneID:36392788"
                     /translation="MSSTLFRSSSSALPTTIVTRVRTKTTRASPPSLWLSRTHLKPQP
                     VVPPPIPPTYPMRVILSDGSSFTAYTTAPTPSTKKLTRDVNNNPLWSPASEKKGLGEG
                     EEGRVTRFRKRFEGLSGDIIGGIGVEGETRTDAFALEDLDWMSEGVQEEKISDRQRNP
                     IKSKGKGKKK"
     gene            complement(914076..915628)
                     /locus_tag="CNC02810"
                     /db_xref="GeneID:3256468"
     mRNA            complement(join(914076..914383,914445..914618,
                     914688..915058,915114..915201,915274..915335,
                     915403..915628))
                     /locus_tag="CNC02810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569575.2"
                     /db_xref="GeneID:3256468"
     CDS             complement(join(914332..914383,914445..914618,
                     914688..915058,915114..915201,915274..915335,
                     915403..915414))
                     /locus_tag="CNC02810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569575.1"
                     /db_xref="GeneID:3256468"
                     /translation="MAKQLVQRLSPLIEELLQASDLSTVSAKAIRKELIARGADKYEI
                     KNFRAEIDDKITEIYNSLGSKEAPAPKIEGSVSPSAKAPSSPHSLIEPKTVTRKRKAP
                     TSENEETDEQMARRLQGEYGGSRTRKQRSSRSARPAKKTRPKSHAHIDNETEKNGDKK
                     DDTKTKRGGAFNKELLLSDSLAELVGSHSLSRPQVVKHIWAYVKERNLQDSNDRRYIL
                     CDDKLREVFHTDRLHMFTMNKILVNHLRDPDDIA"
     gene            complement(916100..918177)
                     /locus_tag="CNC02820"
                     /db_xref="GeneID:3256542"
     mRNA            complement(join(916100..916419,916481..916796,
                     916848..916998,917056..917083,917144..917226,
                     917279..917864,917919..918177))
                     /locus_tag="CNC02820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569576.2"
                     /db_xref="GeneID:3256542"
     CDS             complement(join(916381..916419,916481..916796,
                     916848..916998,917056..917083,917144..917226,
                     917279..917864,917919..918020))
                     /locus_tag="CNC02820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569576.1"
                     /db_xref="GeneID:3256542"
                     /translation="MPKDKKIQNAFKRSEVHRKTKREKEQAKLQRRLEIKKAEKDKVT
                     GAALRAERLSKNIPVTLDNTRVYDSSSYLTANPASLQNLAQEAKEASALINENDLMGK
                     QPSKELSNREDSAVLTSGPSSDQEEDADGSSEMSDKEIEEKLDGEDQEASAMRDITTQ
                     SPPRILITTSPSPCKQTYQFCDDLKNVFPGGEFFKRPKGRGFEIGRVSRWASKRGYRA
                     LIVVNEDHKIPNAITLINLPSGPTAYFKLSSITLSSNIYGHARPTPHSPELILNNFTT
                     LLGNSVGRLFGSLFPPQPQFRGRQVVTLHNQRDFLFFRRHRYMFPSATSAKLQEIGPR
                     FTLKLRWLRKGLPSVTAPDGHASIGGDPADEIYGTEVGPSKEEIAQDELDEEDEALKE
                     IGQPAQKKNVYEGTEVPPLDEEQEYEWKWKPKMEVSRRTFFL"
     gene            918296..921268
                     /locus_tag="CNC02830"
                     /db_xref="GeneID:3256361"
     mRNA            join(918296..918346,918419..918756,918807..919148,
                     919199..919374,919419..919670,919725..919958,
                     920008..920627,920694..920864,920919..921268)
                     /locus_tag="CNC02830"
                     /product="DNA repair and recombination protein pif1,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_024656742.1"
                     /db_xref="GeneID:3256361"
     CDS             join(918605..918756,918807..919148,919199..919374,
                     919419..919670,919725..919958,920008..920627,
                     920694..920864,920919..920981)
                     /locus_tag="CNC02830"
                     /codon_start=1
                     /product="DNA repair and recombination protein pif1,
                     mitochondrial precursor, putative"
                     /protein_id="XP_024512404.1"
                     /db_xref="GeneID:3256361"
                     /translation="MPILTARTLSSSNPNNTSKGTLSRVTSFKRSWGEEDGPESSQLD
                     WSPSPEIVQRKGNILPSSGPLQSTTTSPSLPESAAKEIASQRRRKAILAALNQNKETV
                     YASPVLDWRSGQTSSTFASPQDINCDISVPSVATHCPGSSIRHVNQTLPSLPKRPLPW
                     EGDQKARKKVYTQTSLTPKENAQPKSTSSALNIKQRVTLSEEQQKVLSLVVQQQKNVF
                     FTGSAGTGKSVLLREIIHSLRNKYARNPDAVAVTASTGIAACNIGGVTLHSFGGVGLA
                     TDTPEILLRKLKMNKKASGRWTKTKVLIIDEVSMVDGAMFDKFCKLGQLIRKNSKPWG
                     GIQIIVTGDFFQLPPVTKNGGMPKFAFEAEMWDETIHLSVNLTKVFRQKDQRFVDMLN
                     EMRFGRLSNESIIAFKSLARPLKFNDGIEPTALFPRREDVDRANLSRLNQLDSVGFTY
                     HSIDGGSAEANQREKLLSNFMAPKIIELKENAQVMLVKNLDETLVNGSMGKVIGFTYK
                     NMFQCDDLGKWTPDADLKDLEEEDKMKSLAVRQALRDKYQAKGANPLPVVRFKVPGGG
                     TRDVLMEMDVFKAELPNGEVQASRSQLPLILAWAMSIHKSQGQTLDRVRVDLGKVFEK
                     GQAYVALSRATSLEGLQVTGFTAEKVMAHKKVAVWSSTLKDLNLV"
     gene            923336..925816
                     /locus_tag="CNC02840"
                     /db_xref="GeneID:3256808"
     mRNA            join(923336..924762,924819..925084,925144..925816)
                     /locus_tag="CNC02840"
                     /product="expressed protein"
                     /transcript_id="XM_569578.2"
                     /db_xref="GeneID:3256808"
     mRNA            join(923336..923348,923409..924762,924819..925084,
                     925144..925816)
                     /locus_tag="CNC02840"
                     /product="expressed protein"
                     /transcript_id="XM_024658944.1"
                     /db_xref="GeneID:3256808"
     CDS             join(923396..924762,924819..925084,925144..925523)
                     /locus_tag="CNC02840"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569578.1"
                     /db_xref="GeneID:3256808"
                     /translation="MILPEDTKAPISSDDEFDDDFASLPPSPYLPSRLLPAQDANQQY
                     PFEYPASPSSAVTQPLFLPESDDIELGPAPPYTPNDPFQSQLQRRNERKSYLRGKAGK
                     RFILGIVWGMGLWVGMMGMGALGWRFLGPGSQPRHRGPRQPQSVFPETPPAKDPWLRQ
                     SIECVPFSSTGWAPFSPSDLVGFSDPLEQIKEEQRSLNATFYLPLDSEVFVEMWQGPA
                     AIGPIIFSSYDAHSEEEWKGIDDQGSIVAHDGQGRKPGQGEYVRVIVETIIDVELGAR
                     DELDGQNSAGWEMLAASSVCLNRRGPTINVTLSEEDLDDTVGDGSQNEEHNRFIWDRP
                     TKNGYGVEIVTNHPLESLYPDRKGNPLQFRVHVALPSLATQEHKHDIAPSSSFVRSLD
                     VRAGNSAIYVDGLQDVRIGELSLFSEFGEVTLQKPRLENLMVRTTGKVVGEVAVSNDM
                     TIDTPIGEIHLNISLAAPPRFNLINCPTSESVHQSASDVPHLLTPGPPPFMSTLPPVN
                     VNVRSGGDRVIVHYADWEVPCRDLRMDVFSLIGDVQIFPHPLFQGPFRLMTSKGPINV
                     DLGNALIPDPEGLGRWRNITLEERDRMGSHFYLGNVAWQAESVANHLDQSTHEVISVS
                     LPVDGQGIVDRKMHPSSAEDHGSRPDSKTERGIHVRTSVGAINVTF"
     CDS             join(923729..924762,924819..925084,925144..925523)
                     /locus_tag="CNC02840"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514281.1"
                     /db_xref="GeneID:3256808"
                     /translation="MGLWVGMMGMGALGWRFLGPGSQPRHRGPRQPQSVFPETPPAKD
                     PWLRQSIECVPFSSTGWAPFSPSDLVGFSDPLEQIKEEQRSLNATFYLPLDSEVFVEM
                     WQGPAAIGPIIFSSYDAHSEEEWKGIDDQGSIVAHDGQGRKPGQGEYVRVIVETIIDV
                     ELGARDELDGQNSAGWEMLAASSVCLNRRGPTINVTLSEEDLDDTVGDGSQNEEHNRF
                     IWDRPTKNGYGVEIVTNHPLESLYPDRKGNPLQFRVHVALPSLATQEHKHDIAPSSSF
                     VRSLDVRAGNSAIYVDGLQDVRIGELSLFSEFGEVTLQKPRLENLMVRTTGKVVGEVA
                     VSNDMTIDTPIGEIHLNISLAAPPRFNLINCPTSESVHQSASDVPHLLTPGPPPFMST
                     LPPVNVNVRSGGDRVIVHYADWEVPCRDLRMDVFSLIGDVQIFPHPLFQGPFRLMTSK
                     GPINVDLGNALIPDPEGLGRWRNITLEERDRMGSHFYLGNVAWQAESVANHLDQSTHE
                     VISVSLPVDGQGIVDRKMHPSSAEDHGSRPDSKTERGIHVRTSVGAINVTF"
     gene            926375..928083
                     /locus_tag="CNC02850"
                     /db_xref="GeneID:3256800"
     mRNA            join(926375..926499,926570..926643,926707..926896,
                     926947..927458,927515..927637,927695..928083)
                     /locus_tag="CNC02850"
                     /product="2-hydroxyacid dehydrogenase, putative"
                     /transcript_id="XM_569579.2"
                     /db_xref="GeneID:3256800"
     CDS             join(926472..926499,926570..926643,926707..926896,
                     926947..927458,927515..927637,927695..927775)
                     /locus_tag="CNC02850"
                     /codon_start=1
                     /product="2-hydroxyacid dehydrogenase, putative"
                     /protein_id="XP_569579.1"
                     /db_xref="GeneID:3256800"
                     /translation="MSKPQVLIAANPKTGIVWSKEEQSSKLGAVAEVLELASASRSEF
                     FQDLAPNGKYANIVAIYRHNDSVSAIGLFDEELINKLPASVKYICHNGAGYDQIDVAA
                     CTARGIQVSHTPQAVDDATATVGAFLAISAMRQFWRAEVNVRSGKWKAGLSPARDPEG
                     KTLGIIGMGGIGSALARRLLAFDMKVIYYNRRPIQPPPNFPCTYVSSIEELLKQADVV
                     SLNLPLNEKTKGSFGRQEFGLMKDGSVLINTARGAVIDEEAFIEALESGKLYSAGIDV
                     YPDEPNVNPKLLAMDNITLLPHMGTETRDSQKKMELLVLDNMISALAGKGLLNQVPEQ
                     K"
     gene            complement(928116..931479)
                     /locus_tag="CNC02860"
                     /db_xref="GeneID:3256590"
     mRNA            complement(join(928116..929665,929730..930699,
                     930757..931159,931222..931479))
                     /locus_tag="CNC02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_569581.2"
                     /db_xref="GeneID:3256590"
     CDS             complement(join(928323..929665,929730..930699,
                     930757..931159,931222..931448))
                     /locus_tag="CNC02860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569581.1"
                     /db_xref="GeneID:3256590"
                     /translation="MHRRQATRISPTATPSSLLSPIVSHFPALSVISPFKALRQSPSS
                     DHHHPTLASPPRLELTKAVWQEADLGDGKGIVPLLLLTSPTSALQIFSVPTPVASQDP
                     RSSESFSDPEEVFAMSTITYDSSLYQCSLSGVNDGDPLPFSAHNETVLDMALMEGGRV
                     ALVTCHSNKTFIGPLALVVVNLKSGRAEARVDLGAGSTADVHVSHKVIVITVSHPTPS
                     IHFLDPASFTPLFPPIVDAAPNALTQLPTIALSGRILAYVTSTPANISTPSDMGSLVT
                     SSSLRASHSRNRQGPSSQVESHQGALISSAVEIGGGVARGVWAGIKLGAKAASAATRA
                     RSDRLAQSAPDDTTAFGRDQEAAILGDTESRSLDEGSMLDEALPISAANAKSIDKGEW
                     IHVIDLFSRHPSSTRQVSPPGNVTSKSTPSFTTVAHFRLPPSSVVPIDTSHSSQYHSL
                     PVQHLSFSPSGTALLAAPADGRSFHIMEFHPAGPMKGNTRTGTQSQAWHLYELKRGHT
                     IANVRWTSWDRMGNWVGVGTDRGTIHIYPIHPSGGQPSAFTHVAGCRNAQRLFALSIP
                     VSPIARIRPPRLAMDTSHLDGSLDSDLTYSENSVFGFLPYRQHQKLDQKHIQDIGIFR
                     WPSGVLELIRMAVRGCREDDSEAGVAKYSSRSPPHRTRSALTELMLSRAVRERNSFAA
                     EKAAQARWVLPSAVAMSAPTLLSSTIAEKSQPSRVGALAAAEIRTHHFNPHVLPSSIY
                     LSRQIEFFSARPIDDYSPLSILDLEARTDKLVFRQEVEARSPPNEDTEAPLSFDRPLL
                     SALHDLIESPSDRQIPGLPNGHGRTGIWTGDPIQTVKYGFNEGVDRVRREYVRAQLVK
                     EHKLTKQNKETSGLSLSFEDDAVLAVSSSDLRLDNLSLDQSEPAAVSGRSSSIHTSEN
                     LTSPPGSGDLPPTKVDSSDGDSQWGEVWEEEYRKAVEDDGGPDDLVLGLLDEEEDERR
                     QWEARQKL"
     STS             929141..929661
                     /standard_name="Bam11"
                     /db_xref="UniSTS:470768"
     gene            932038..934374
                     /locus_tag="CNC02870"
                     /db_xref="GeneID:3256174"
     mRNA            join(932038..932144,932856..932990,933046..933240,
                     933294..933395,933446..933615,933674..933764,
                     933816..934031,934087..934158,934212..934374)
                     /locus_tag="CNC02870"
                     /product="expressed protein"
                     /transcript_id="XM_024656743.1"
                     /db_xref="GeneID:3256174"
     CDS             join(932118..932144,932856..932990,933046..933240,
                     933294..933395,933446..933615,933674..933764,
                     933816..934031,934087..934137)
                     /locus_tag="CNC02870"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512406.1"
                     /db_xref="GeneID:3256174"
                     /translation="MSATEQVNQAPAETANALVAEATPPSQEAKEIFKAQEPVSEVAA
                     PNITEPLVKEQPTVANTEAGTAQPGPELGNKVDNTEADKLVEGTTTGEGAKTTEEVPK
                     PSEIKEGKKEVKKSAVKERTEKTKAEGKGFFAKFFGNRDKSPKKEKKKTPKAEKADPV
                     TAAAPVETEGDDAAPPSVPTTSEPVIGTSAPIEAVEPTVKSPDTGALKGIDTATSADA
                     PAEVAPAPEENKIEDKKDEAKDQAAKSNLKAHRRLSARIGDIFKPKKKEGIPTSTEET
                     SKEEATKPLNEAPVVASEAPKLEQPVATAPLELEEEPKATQPPAAAPVAASA"
     gene            complement(932737..935432)
                     /locus_tag="CNC02880"
                     /db_xref="GeneID:3256597"
     mRNA            complement(join(932737..933005,933054..933366,
                     933433..933762,933814..934019,934074..934658,
                     934717..935054,935130..935432))
                     /locus_tag="CNC02880"
                     /product="expressed protein"
                     /transcript_id="XM_024656744.1"
                     /db_xref="GeneID:3256597"
     CDS             complement(join(934452..934658,934717..935054,
                     935130..935388))
                     /locus_tag="CNC02880"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512560.1"
                     /db_xref="GeneID:3256597"
                     /translation="MSLSAPTRILRKPTLSRQFSTSLPVLASRGSSKPEGLGARSRPW
                     SVQNVPKFAFDDATSLGWMRMFRIQEGEGLVRKIEEDREALRTANQTKFTPPTAPIRL
                     TSTIDLARPDSRYHTKCVLLVPIAALPLSTPEAVHRFKLLAGPRWTPGKPGRNEFIKD
                     ENSDGENGWIKVSEERFESARQNRRSASDILERLVNAANDRESPLPADLPIDTRHLLA
                     RHRKKRSRQNTFKWAPGQEFLSRHQEVGGVRGFPVSWLPEELRERVSKK"
     gene            935619..936858
                     /locus_tag="CNC02885"
                     /db_xref="GeneID:36392789"
     mRNA            join(935619..935883,935933..936858)
                     /locus_tag="CNC02885"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658945.1"
                     /db_xref="GeneID:36392789"
     CDS             935965..936759
                     /locus_tag="CNC02885"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514282.1"
                     /db_xref="GeneID:36392789"
                     /translation="MPVKATLKASLTSVFPFDKGTTNKKDRRFSGISWKSSSSQSSSN
                     DSVTPKNHDTELVGQHHGHGTGAHTCPTSTGSCAYNSSPILGSDTIGNKMSLSGSCSH
                     SFHQTSSSRASVSVPSLTSFSLPEESALATLSQVVQNGHFPGIISLDSSHPLPPTTNC
                     TSNLHCRKHQDWHDRWHYNNDCAADSKVGCHNECQSKHGPRCSCALQYLIADRHDMLA
                     DPWATYELVQRSTPTVIQTLPGSDHTTIKSMLAGGRTGWRMWHAVV"
     gene            937103..938546
                     /locus_tag="CNC02890"
                     /db_xref="GeneID:3256129"
     mRNA            join(937103..937460,937561..937952,938014..938206,
                     938268..938387,938456..938546)
                     /locus_tag="CNC02890"
                     /product="phosphatase activator, putative"
                     /transcript_id="XM_024656745.1"
                     /db_xref="GeneID:3256129"
     CDS             join(937170..937460,937561..937952,938014..938206,
                     938268..938387,938456..938461)
                     /locus_tag="CNC02890"
                     /codon_start=1
                     /product="phosphatase activator, putative"
                     /protein_id="XP_024512408.1"
                     /db_xref="GeneID:3256129"
                     /translation="MAIPASSNPITSVSPNSSPITSVSPNNYAASPLYPSATNPQLLS
                     RLNLDLRGTIFPVEREMLMLLPESVLLGLFPQGLILSKPASWEGADDGIFTVDFDPNC
                     FRYIIDFWSKAQDTFYGSPTTSGFYHAQQRIPTIDALSDHSQNPLLSKQAIIVLREEL
                     EYFSITKPGAAARTDIATGLANEDLRVLKRNCGRALEEKKAIFAALERNVNNSANLAE
                     RHLIDMLCVSGFNRDDEWGYRACEPQRNVISSMALVLLKTGINHREDDKEGPPEIDPV
                     QMGTAQKLLLFWRKPARKCWWDSVEIDVPSSLDTKSDETISVKVWARRVWTLELSLI"
     gene            complement(938807..939697)
                     /locus_tag="CNC02900"
                     /db_xref="GeneID:3256495"
     mRNA            complement(join(938807..939062,939153..939266,
                     939322..939376,939574..939584,939637..939697))
                     /locus_tag="CNC02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656746.1"
                     /db_xref="GeneID:3256495"
     CDS             complement(join(938923..939062,939153..939266,
                     939322..939376,939574..939584,939637..939676))
                     /locus_tag="CNC02900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512559.1"
                     /db_xref="GeneID:3256495"
                     /translation="MRPTAPAHSGMPGPKNYIGWWGDMGGPKQKGIKTYGLSPYRQRP
                     LAGMLRAYVFNGSKRTMQQLPYVAPPLIFFYGVYYWAKTKYDYYNSKQGHYDHLIEEG
                     VIKPGQYERPTVGPVVH"
     gene            939853..941427
                     /locus_tag="CNC02910"
                     /db_xref="GeneID:3256182"
     mRNA            join(939853..939956,939994..940069,940117..941427)
                     /locus_tag="CNC02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656747.1"
                     /db_xref="GeneID:3256182"
     CDS             join(939863..939956,939994..940069,940117..940216)
                     /locus_tag="CNC02910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512409.1"
                     /db_xref="GeneID:3256182"
                     /translation="MSLLTSILGFSAFGFGARCLQLGLQKRPIFEAFHGHAYAAIGFG
                     VLGAGAYHVDQKQTALLAKKKKAMLEQREIENREWAARKGEAHAV"
     gene            complement(941336..943250)
                     /locus_tag="CNC02920"
                     /db_xref="GeneID:3256235"
     mRNA            complement(join(941336..941725,941794..942522,
                     942579..943250))
                     /locus_tag="CNC02920"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569590.2"
                     /db_xref="GeneID:3256235"
     CDS             complement(join(941667..941725,941794..942522,
                     942579..942756))
                     /locus_tag="CNC02920"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569590.1"
                     /db_xref="GeneID:3256235"
                     /translation="MPAPVPPTAFAQPSGPATQLVLGSMQRAPEYQALLTSLKSAAPP
                     SSSVQGEMVDRILDNATTLPPPPLTIHLVLPLPLPSNLLSAIPPSTQIFIHIPADSES
                     QLGALHSALASHSFTPVLPTPSPSTLAYTSPSAPSLPAVASEPSPAPSSSTPVTLSGA
                     RPLQLRRNGDKARKAALWAIDSPLIPDGGKSLLTPADRTRPDCVFPAENGKPVKRRRA
                     CKDCTCGLKELEQEEEAQTSAAVQEAQKAFFLEGDDDIPENLKKATEGMEGIWPADKR
                     AEAKKTSSCGSCYLGDAFRCSSCPYLGLPPFKPGEQVQVSIGDDI"
     gene            944113..944878
                     /locus_tag="CNC02930"
                     /db_xref="GeneID:3256775"
     mRNA            join(944113..944627,944690..944878)
                     /locus_tag="CNC02930"
                     /product="expressed protein"
                     /transcript_id="XM_569940.2"
                     /db_xref="GeneID:3256775"
     CDS             944296..944523
                     /locus_tag="CNC02930"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569940.1"
                     /db_xref="GeneID:3256775"
                     /translation="MTSIAQPINFPSRPSYSTTASPSNSPSRSNSYDLSSSPKMGSSP
                     GQHPCPHLSEFVQSLYKAWGSKSDIQERRRW"
     gene            complement(946047..951133)
                     /locus_tag="CNC02940"
                     /pseudo
                     /db_xref="GeneID:36392790"
     gene            946646..951110
                     /locus_tag="CNC02950"
                     /db_xref="GeneID:3256486"
     mRNA            join(946646..946808,947067..947210,947279..947418,
                     947472..947531,947929..948099,948331..949306,
                     949361..949466,949529..949728,949781..950160,
                     950218..951110)
                     /locus_tag="CNC02950"
                     /product="expressed protein"
                     /transcript_id="XM_024656748.1"
                     /db_xref="GeneID:3256486"
     CDS             join(948350..949306,949361..949466,949529..949728,
                     949781..950160,950218..950752)
                     /locus_tag="CNC02950"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512411.1"
                     /db_xref="GeneID:3256486"
                     /translation="MTSMIHTQSFDGGRTQGGLHTSPAASPRSDRPHSQSSLHIAPQS
                     TYSPPLPTQSPHPISAYPVQAYRPYPQGVSLQLPNLMNSTYPSTAPALPFYPAGPTPM
                     YDSRGPQQMIRTISHAHPMNSATEQTISSRYSSSPHSVHEHLGDAPSITGGDQPNPWG
                     HPAFHVQTEDDRSINPSMFGPGGDYSMSRSTSGASDSGHDTMRLLTPSLDYRPDRRSP
                     HELDLRKVSDSLGDKKHFSQVAFTPHFDLQSHSLGLGPHPQPENMFFGDRGYSNTSFN
                     LSSERIAGKDTDLTGETEYERERAEQIVNNRKLLEDVGLGSHSLSFGSRHMSGTKGSD
                     SKKNRKVSTPAKKRLQLEGPVRASPRIRSMGRNISYANLDGGSASDNDEYSSEQDPEE
                     EEEFRPSKRSRGQMGFRQKSSSYSQSSNKASSKPQLSLWGLLQVYPEIPHLFPLFYYT
                     LNNDLTINSDSVPLIGSIPSNCTPVAKAETLQAYFHRGRRVLSQLDAFTSRCDRKYEG
                     PEVRWPELDYHTRIAIRDVRRKVVERCENYKYTRRDILDKHVGKGKWQSIEQGMIEWR
                     AGMTVNDPANDLANVTLTLPTPPPNAYGHQIRQQPTPALYSDRVFKPFPQGRRPTSIA
                     PRTVSVMMAEPDEQAPFTYPPTANSAVEFYGYAPQQPPIPPMYGEDQVPMSVQMPESV
                     TAGPTGASLDQANKEASASWGESRGLKRARDDDQVGVSNDNEG"
     gene            951294..955573
                     /locus_tag="CNC02960"
                     /db_xref="GeneID:3256515"
     mRNA            join(951294..951411,951489..951709,951764..951800,
                     951857..951995,952046..952127,952177..952431,
                     952480..952814,952866..953032,953089..953698,
                     953755..954464,954533..954710,954787..955573)
                     /locus_tag="CNC02960"
                     /product="ATP dependent helicase, putative"
                     /transcript_id="XM_024656749.1"
                     /db_xref="GeneID:3256515"
     CDS             join(951379..951411,951489..951709,951764..951800,
                     951857..951995,952046..952127,952177..952431,
                     952480..952814,952866..953032,953089..953698,
                     953755..954464,954533..954710,954787..955325)
                     /locus_tag="CNC02960"
                     /codon_start=1
                     /product="ATP dependent helicase, putative"
                     /protein_id="XP_024512413.1"
                     /db_xref="GeneID:3256515"
                     /translation="MEFSNFEGASQYGPDIDDNTSLYSSIPPSVVTAPTISGDIASQL
                     GDLNLGETTSGHAAAGQVYIDDFDEEIERNSFGEGVEHACSYCGIHNPQCVVKCLHCN
                     KWFCNSRGNTSASHIVNHLVKAKHKEVILHKESALGDTIPECYNCGSKNVFMLGFIPA
                     KSDTVVVLLCRQPCAALTSSRDINWDTSQWSAIIDDRQFLSWLVKVPSEAEQLRARQI
                     SLAQISKLEELWRENPNAKLEDAEAQSGEEEMQPILLKYEDAYQYQNILGPLVKVEAD
                     YDKRMKESQTENDITIRWDMGLNQKRLAWFCMPKLESGEVRLAVGDELKLKFAGTTSS
                     VGIKGLQAFNKAGWGSSGDAVWEGVGSVVKIPNNASDEICLELRRNDGVPFDCTHGFS
                     VDFIWKSTSFDRMQAAMKTFAIDEKSVSGYIYHKLLGHEVEPQVLRTQMPKRFAAPNL
                     PELNHSQMSAVKAVLQKPLSLIQGPPGTGKTVTSASIVYHLAKMNPGQVLVCAPSNVA
                     VDHLCEKIHQTGLKVVRLAAKSREALDSSVDFLSLHSQVANADTHHELQKLIQLRNDQ
                     GELSQSDERKYKALVKACEKDILNAADVICTTCVGAGDPRLAKFKFRTVLIDEATQSA
                     EPECMIPLVMGCKQAVLVGDHQQLGPVIMNKKAARAGLSQSLFERLVILGNHPIRLQV
                     QYRMHPCLSEFSSNLFYEGTLQNGVTAPERLRKHVDFPWPVADTPMFFHQNLGTEEIS
                     SSGTSFLNRTEASNVEKMVTKFFKSGVLPNQIGVITPYEGQRSYIASYMQLHGSLKKD
                     LYKEVEVASVDAFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGVVILG
                     NPKVLSKHPLWLYLLSHYKEKGCFVEGPLSNLQPSMVQFSRPKKSLAAAMDPFKRRET
                     SAVEFLSKNMGHGQAQSAAANRFDPAYYRTHNPLSFIPSDAQSVVSQAMTSSAFPLFG
                     GVGGGVGGGGGGGKNKTYTGYASSVVSQQPIDGGNASAFAPPRAGQSQFDRFASIVGS
                     AGSAGSAGAGGAGVGAGGGGGGGGGNVMMGKGRRLSIGSEAASASMYAYGYKAGEDDT
                     QSIAPSQAGMTEF"
     gene            complement(955686..957363)
                     /locus_tag="CNC02970"
                     /db_xref="GeneID:3256306"
     mRNA            complement(join(955686..955888,955950..956011,
                     956091..956204,956290..956311,956370..956519,
                     956579..956760,956815..956950,957006..957017,
                     957077..957237,957281..957363))
                     /locus_tag="CNC02970"
                     /product="oxaloacetate carrier, putative"
                     /transcript_id="XM_024656750.1"
                     /db_xref="GeneID:3256306"
     CDS             complement(join(955853..955888,955950..956011,
                     956091..956204,956290..956311,956370..956519,
                     956579..956760,956815..956950,957006..957017,
                     957077..957237,957281..957362))
                     /locus_tag="CNC02970"
                     /codon_start=1
                     /product="oxaloacetate carrier, putative"
                     /protein_id="XP_024512539.1"
                     /db_xref="GeneID:3256306"
                     /translation="MTQPQQPLSLLESFLCGGLAGCGAVTITNIPETMKTRLQLQGEL
                     QRNDPSAPRVYRNVLDVFRKTWQHEGIRGLQRGLVPAYGYQTLLNGSRLGLYEPCRRL
                     FNRAIGKDPNEGVFITAITAGAVTGCIGASLGSPLFLIKARMQAYSPHIPVGAQHYYK
                     NSYDALRTILKSDGFFGLWRGVSTAILRTAMGSSVQLPSYNLSKYYLVSSAGMASDSF
                     WTFLAASSVSGVCVCIAMQPPDTALTRMYNQNTIKDPITGKVRGALYTNPFDCLWKTF
                     KAEGIAGWYKGTTAHFLRITPHTIFTLVFNELIMAEYTKWRG"
     gene            957614..959349
                     /locus_tag="CNC02980"
                     /db_xref="GeneID:3256140"
     mRNA            join(957614..958213,958261..958775,958833..959349)
                     /locus_tag="CNC02980"
                     /product="small nuclear ribonucleoprotein hPrp3, putative"
                     /transcript_id="XM_569946.2"
                     /db_xref="GeneID:3256140"
     CDS             join(957809..958213,958261..958775,958833..959286)
                     /locus_tag="CNC02980"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein hPrp3, putative"
                     /protein_id="XP_569946.2"
                     /db_xref="GeneID:3256140"
                     /translation="MGGDAQQPAAQADRNEKRAMRDRYKTMAPKFTSVRANASAAASQ
                     APSRASPAVTAAPVLNPYASASAANSPAPDEERAPTRKSKKLQFSRAGKYVEQGEQLR
                     NEQKMEALRQRIAEASRKAGLDSEFDTLERSLKRQPPPAVEWWDEAILPKGVTYEDDL
                     ESAYNNLSTSSDSLITHLVLHPIPIPAPMDRRQPERGLMLTKKEQKKMRRQRRQAELE
                     DKRDRQKMGLLPPDPPKVRLANLMKVLTSDAVQDPTKVEAKVRKEVAMRAYKHEKDNQ
                     ERKLTAEERKEKEYSQMVARERNGIRGAVFKIKYLTNGRHKFKVRETAKADLLSGICI
                     FHPSFALVMVEGVEKSIKHFKRLMLSRIDWTEQARPMADGDGGEDAPGSDEDMDGRTN
                     SKEGEQDLADNKCELIWEGELPERVFKMFRARHVETDSKAKEWLTPRFEAMWDLAKRW
                     QWAGEDL"
     STS             958938..959603
                     /standard_name="Xba11"
                     /db_xref="UniSTS:470765"
     gene            complement(959321..960256)
                     /locus_tag="CNC02990"
                     /db_xref="GeneID:3256285"
     mRNA            complement(join(959321..959474,959540..959635,
                     959720..959847,959933..960256))
                     /locus_tag="CNC02990"
                     /product="DNA-directed RNA polymerase i 13.7 kda
                     polypeptide, putative"
                     /transcript_id="XM_024656751.1"
                     /db_xref="GeneID:3256285"
     CDS             complement(join(959436..959474,959540..959635,
                     959720..959847,959933..960071))
                     /locus_tag="CNC02990"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase i 13.7 kda
                     polypeptide, putative"
                     /protein_id="XP_024512538.1"
                     /db_xref="GeneID:3256285"
                     /translation="MAPTRVSAHRIGSLLFCPACGTLLDLPKDDQNEIACSQCGRLEP
                     ASSYENLPTKTYSSPNAFPSSLRSKRALVQNKLDAGEAAKGRDPVAQEKCQKCGHIGL
                     SYKEMQLRSADEGSTIFYKCLNCGDQTSTNN"
     gene            960361..961852
                     /locus_tag="CNC03000"
                     /db_xref="GeneID:3256679"
     mRNA            join(960361..960614,960689..960755,960812..960862,
                     960927..961222,961291..961320,961379..961441,
                     961503..961572,961637..961852)
                     /locus_tag="CNC03000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569596.2"
                     /db_xref="GeneID:3256679"
     CDS             join(960552..960614,960689..960755,960812..960862,
                     960927..961222,961291..961320,961379..961441,
                     961503..961572,961637..961740)
                     /locus_tag="CNC03000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569596.1"
                     /db_xref="GeneID:3256679"
                     /translation="MAPKGGNAKKESGRAKKAENEEKKKTAAEKSKEAKEADEWKSGS
                     KGASKTDAAAAKAAEAARKKAEREALLAAEEASLQSKSKAAPKAGAKKKPADKLVATG
                     TGVAGYSVSDPLNLRKAKGPDGEPEEVKELSAKGIDEMLEALELVNQKTDKATVGSKA
                     EIMVDPHPERRFKAAFEAYLDREMPILKQEHPGLRQNQMRDMLYKQFQKAPENPFNQA
                     KIAYNATKDEKVEAYKKIMESREAKFSRA"
     gene            complement(961866..962671)
                     /locus_tag="CNC03010"
                     /db_xref="GeneID:3256149"
     mRNA            complement(join(961866..962195,962257..962393,
                     962450..962671))
                     /locus_tag="CNC03010"
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /transcript_id="XM_569598.2"
                     /db_xref="GeneID:3256149"
     CDS             complement(join(961925..962195,962257..962393,
                     962450..962644))
                     /locus_tag="CNC03010"
                     /codon_start=1
                     /product="ribosomal large subunit biogenesis-related
                     protein, putative"
                     /protein_id="XP_569598.1"
                     /db_xref="GeneID:3256149"
                     /translation="MRIEKCYFCSANVYPGHGTMFVRNDAKCFRFCSSKCHKNFKMKR
                     NPRKVRWTKAFRRANGKEMVVDTTFEFEKRRNVPVRYDRELVATTLKAMERVAEIRQK
                     REKAFWKNRMSGNTAKNMRDSALEIERHIELVQPRSATAVSTSKASEALEQREKVREK
                     IKVRAAGRKAMALQQMGQGKKQKESRLIPAEGSGMGMSLD"
     gene            962961..964821
                     /locus_tag="CNC03020"
                     /db_xref="GeneID:3256248"
     mRNA            join(962961..962995,963049..963096,963143..963181,
                     963232..963239,963346..963373,963425..963554,
                     963603..963705,963760..963958,964010..964234,
                     964285..964554,964613..964649,964703..964821)
                     /locus_tag="CNC03020"
                     /product="mannose-1-phosphate guanylyltransferase,
                     putative"
                     /transcript_id="XM_569600.1"
                     /db_xref="GeneID:3256248"
     CDS             join(962990..962995,963049..963096,963143..963181,
                     963232..963239,963346..963373,963425..963554,
                     963603..963705,963760..963958,964010..964234,
                     964285..964554,964613..964649,964703..964704)
                     /locus_tag="CNC03020"
                     /codon_start=1
                     /product="mannose-1-phosphate guanylyltransferase,
                     putative"
                     /protein_id="XP_569600.1"
                     /db_xref="GeneID:3256248"
                     /translation="MKALILVGGFGTRLRPLTLSWPKPLVEFCNKAMILHQIEALVKA
                     GVKDIVLAVNYRPEVMVSVLKKTEEEFGINIHFSVETEPLGTAGPLALAREILGKDDS
                     PFFVLNSDVTCVYPFEAFRDFHIAHKCEGSIMVTKVAEPSAYGVVVTKPNSTVIDRFV
                     EKPVEFVGNRINAGIYIFNPSVLDRIELRPTSIEKEIFPAIAADQQLHSFDLQGFWMD
                     VGQPKDFLAGTCLYLSHLTSQHSPLLTDPSQNKWVYGGNVMVDPSAEIDPTAVIGPNV
                     VIGPDAKIGPGVRLQRCVIMSNATVRDHSWIANSIVGWNSTVGRWTRVENITVLGDDV
                     TIKDELYVNGASVLPHKSISTSITEPRIVM"
     gene            964941..966971
                     /locus_tag="CNC03030"
                     /db_xref="GeneID:3256236"
     mRNA            join(964941..965306,965371..966971)
                     /locus_tag="CNC03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_569941.2"
                     /db_xref="GeneID:3256236"
     CDS             join(965052..965306,965371..966507)
                     /locus_tag="CNC03030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569941.1"
                     /db_xref="GeneID:3256236"
                     /translation="MAHPPRPTPAPNRHTLPLHKRQSYVTVSVVANDTDTSSTTPANS
                     SSGSSFPVAIAIPALVGGMAVAIAVFGFWWWWSKRSKRVKRERWEAAQRRKNKRHAAE
                     KDKPTTHPGQSQKSPTGEKAFNPILPPLSTAQPYYPPPQTNGYGYAPSQQGYAAWQTQ
                     PGIEQVQYGQQASPSPQQGYYSPPAYAQGSAPPLSRDYSSESTIPLTQNTTPPATSPT
                     SPTSSRSSSNSSSTGGGRKPSGNIPPPRRSSSDEKKSSTPSSPSPSSSPSKKSSKNSK
                     NSRATARMAVAESAAANASMNRMFRHKPSKPSPLAIKAQQEREALAATTDPLSRISAD
                     ETSNPFNTESEGLYPTAADSSRANAPSGEWGVALGSPDEEDTFADSQAAVLDSGLYHG
                     AKSSYSEDPYIEKKAQTKSGMYSQDPYALYHEQEEEKEEEVEDADRYHNAAESMGLGS
                     ASKNKKRDVGKWV"
     gene            complement(966806..970274)
                     /locus_tag="CNC03040"
                     /db_xref="GeneID:3256517"
     mRNA            complement(join(966806..968445,968506..969396,
                     969451..970062,970102..970274))
                     /locus_tag="CNC03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_569602.2"
                     /db_xref="GeneID:3256517"
     CDS             complement(join(967105..968445,968506..969396,
                     969451..970062,970102..970266))
                     /locus_tag="CNC03040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569602.1"
                     /db_xref="GeneID:3256517"
                     /translation="MGLATPPPHLVALLANTRTPANYATDALEEWIAHRRAKGDSLFN
                     ISLALAHLEDITPPHTAHLFDRARYLTNVPQPQDLTPPVGPFPLARSASLATILNHLL
                     ATPPPSIQHSREVILEYVLARESKLKEKKPGRAGKGTMGREGFEDIAKRMSELEDSLR
                     ENSASSPPTSPSRDVYPSPRRSTRASQGQLLNENQQIGLTLILSLRMSLSYFALQELA
                     NQLMLVTLGDAERMLIQHIRRRVPGEGRWGVGKELEYVEGLTLSRRPALRPAFRSAKA
                     RTLLPPKPLYPIQLPAPSKSQCIKQIQALAKEIEAGGPAAGQEFLHAHEPSGISAPVF
                     NTPNSEKYFLGRRSANASPTVKAIFAREGSPQTPLSNLPPALGTPAGSPAQVSQPDPN
                     ILANFTMELISEFITREKREQMLKSKWAKTGRAQVSKDLGEIEAALCLVSKNNASSIA
                     PLLLPTFLLLRRTFALPPSPLPQAITEPYIDILPAPPDPDDVPFREPTVSSTTAALYV
                     NPRLNDDKAYDALEELAEFEKEKVDAAGGTRQQMIDWAFSQIEAVQKRFPDGSYKQVF
                     NRMKDNLLQQRRPEEHYQSISFAKSPSIHRRVKSNAFPSGLSDSEAGSPVAVDPLKAQ
                     HTRSLSMPDRKAPYDSDSDSEEDVSLVQRSTPADQPPLTPATSVPSSKPLPDVERSFP
                     QLPPLIVTPMNIGDRRSSAASASAAPSSGGGGGGGGWWDVVSAVAKEDSSSNTAPWDT
                     TPEKRSNEPTSHVSQLSTDSRRDGLALNINDPARNIAAPLPPGAEPAQALDFTRPMMS
                     LDLNSPVSQAKPPFSAPVSPQREAQYLPGQTVRLVETTGLGFAPSSPPYGYTQRQDED
                     GILPPPPPLRFDQSRGGHTLGSSTTPSAHSSSLTAEPTPTSTALNHSALSSGPSYPAP
                     SNASPTVAQGPAPHPAGPFVSSSTTTKSKLGSFGRSMSLVRRKSKKEKEKEKDGEKEG
                     KDKNKKERVLNDPGKWNRDLVANIMGPPAR"
     gene            970415..971350
                     /locus_tag="CNC03045"
                     /db_xref="GeneID:36392791"
     mRNA            join(970415..970598,970651..971350)
                     /locus_tag="CNC03045"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658946.1"
                     /db_xref="GeneID:36392791"
     CDS             join(970445..970598,970651..971279)
                     /locus_tag="CNC03045"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514283.1"
                     /db_xref="GeneID:36392791"
                     /translation="MPSHLSRLPRPAHTQPAHSPLKPGLPLDKSKAKHVSLISSKLVT
                     GPRTSRCSNIDHAQSIRDTTTPTRIPSHARLSNGICAPATPIFASCSLAGTPKLPEIP
                     KKTLLSQDPNDDDELLKELELTFVEDDDEAGAEHIINGRKGHDGRRSETRGRNYESFV
                     AATEHKRHTHHHQLPRSTLPSSSHLRKSLVESKRQLELTKKQRSELDSRIVKLERERM
                     ESAWAEVERMASAELEEVCKAKELLLQLKSDIDSEDYDAYTC"
     gene            complement(971229..973906)
                     /locus_tag="CNC03050"
                     /db_xref="GeneID:3256588"
     mRNA            complement(join(971229..971475,971535..971803,
                     971867..972843,972913..973103,973154..973375,
                     973437..973636,973688..973906))
                     /locus_tag="CNC03050"
                     /product="signal recognition particle binding protein,
                     putative"
                     /transcript_id="XM_569604.2"
                     /db_xref="GeneID:3256588"
     CDS             complement(join(971341..971475,971535..971803,
                     971867..972843,972913..973103,973154..973375,
                     973437..973636,973688..973718))
                     /locus_tag="CNC03050"
                     /codon_start=1
                     /product="signal recognition particle binding protein,
                     putative"
                     /protein_id="XP_569604.1"
                     /db_xref="GeneID:3256588"
                     /translation="MLDHISISHQSGLVLWSRAFTPAFETLANTPNSPINALVKSTFI
                     EGKAMTNGEEQGLEKDGYSVRWSVDNGLGLVFVVVFPALLPLTYVPALLERTKALFLA
                     LFQPYVTSLIESLSSGGASAGSALKQLKEKIVEERWDEVWDRCFRSCEGEKKSRSTLV
                     KQRVSDRTNPAISSADTSDVDVGSQSALSAEEIAKNVQSLKAKMKGGKRRGVRDGLSP
                     SPSPSPSRKPPSNATSKLMRRWGDTPVTAEDMAALDYSTPAPDSSANDTAHVDKESLI
                     SSEALGTRNDTGAYQVADWDFRRAPASSHESLPSEEEIIARGTSRLSLNRPTDDGSNQ
                     SSWTSMFSRLTGSKILTRNDLEPVLIEMEKHLMSKNVAKDIAEKLCNSVGAALVGKKL
                     GGLNSVKSEVQSVLSTSLTRVLTPKTSTDILLEIQRKRSSHLATLSTTSSPLDSGPDP
                     YTLTFVGVNGVGKSTNLSKVCFWLLQNGLRVLIAACDTFRSGAVEQLRVHVRNLGALG
                     EEMGQGQGKRIELFERGYGKDAAGIAKDAIAYAKEHAFDVVLIDTAGRMQDNEPLMRA
                     LAKLVTVNNPDKIVFVGEALVGNEAVDQLTKFDRALRDFSGAGVGGVARKRGIDGIIL
                     TKFDTIDDKVGAALSMTYITGQPILFVGCGQTYTDLRQLRVNHIVQALLS"
     gene            974043..975251
                     /locus_tag="CNC03060"
                     /db_xref="GeneID:3256444"
     mRNA            join(974043..974282,974331..974542,974591..974885,
                     974939..975082,975139..975251)
                     /locus_tag="CNC03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_569606.2"
                     /db_xref="GeneID:3256444"
     CDS             join(974126..974282,974331..974542,974591..974885,
                     974939..975082,975139..975209)
                     /locus_tag="CNC03060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569606.1"
                     /db_xref="GeneID:3256444"
                     /translation="MASLRISARPVLAALMPVPRIYRPAAVCARTFSTSFARWAVVKD
                     GPPVTQTNRAEQTLRRFWKTVNISATPSDGYLITLDHRALKTPFGAKLEIPKERGLLA
                     ALIANEWENQDEVLKQHALPVTSLASRAIDGLSEGPTRPAVIEALLQYLETDTILYPD
                     DAPPPLVRLQKKHWDPLYEWLKEDFGVELQLAQGFDAVKQSDDNMEKLKRVVETMDGW
                     ELAAFERAVYATKSFVIALALCRGRLTAHEAAQASHVEVSSQIERWGEVEDTHDVDYQ
                     DIRRALGSAACLLIKS"
     gene            complement(975219..976506)
                     /locus_tag="CNC03070"
                     /db_xref="GeneID:3256179"
     mRNA            complement(join(975219..975314,975380..975956,
                     976008..976139,976189..976506))
                     /locus_tag="CNC03070"
                     /product="ribosomal protein L1, putative"
                     /transcript_id="XM_024656752.1"
                     /db_xref="GeneID:3256179"
     CDS             complement(join(975244..975314,975380..975956,
                     976008..976139,976189..976239))
                     /locus_tag="CNC03070"
                     /codon_start=1
                     /product="ribosomal protein L1, putative"
                     /protein_id="XP_024512419.1"
                     /db_xref="GeneID:3256179"
                     /translation="MISSSIRVSGRSLAQVIRPAVASASFSTTATAGARVQKKQSKKK
                     VASPDALSASEAARVLRALEVAHPTSTYSLTLHTKSHKSALPIRGSFTLPLDPRRTSE
                     TILVFAEPSSPSATLAKEAGAAYVGGDELFEPVLSGKIHPTRCLATPGMMPAVTRTLA
                     RFLGPKGLMPVAKRGGVAEGEELAERIRDAAGKMEYRADKQGTVKVNVARVDFGIPSV
                     ENNIKSFIQTVRDNQATANQTDDPLAAAGKSKKKKGSSITSVILESTNGPSIELNDVL
                     "
     gene            976842..979581
                     /locus_tag="CNC03080"
                     /db_xref="GeneID:3256275"
     mRNA            join(976842..976984,977259..977355,977481..977562,
                     977609..977769,977817..977906,977962..978601,
                     978660..978893,978943..979066,979116..979206,
                     979261..979283,979338..979489,979551..979581)
                     /locus_tag="CNC03080"
                     /product="pyruvate kinase, putative"
                     /transcript_id="XM_024656754.1"
                     /db_xref="GeneID:3256275"
     mRNA            join(977116..977355,977481..977562,977609..977769,
                     977817..977906,977962..978601,978660..978893,
                     978943..979066,979116..979206,979261..979283,
                     979338..979489,979551..979581)
                     /locus_tag="CNC03080"
                     /product="pyruvate kinase, putative"
                     /transcript_id="XM_024656753.1"
                     /db_xref="GeneID:3256275"
     CDS             join(977134..977355,977481..977562,977609..977769,
                     977817..977906,977962..978601,978660..978893,
                     978943..979066,979116..979206,979261..979283,
                     979338..979389)
                     /locus_tag="CNC03080"
                     /codon_start=1
                     /product="pyruvate kinase, putative"
                     /protein_id="XP_024512421.1"
                     /db_xref="GeneID:3256275"
                     /translation="MVLGHFSPQTNTTVPPPPHPSAFVPLFQTNTSVVSGKPNAFSTM
                     AGTPSSQLAWLSGLSTNFNEMSADQKFLRKTSIIATIGPKTNNVETLVQLADAGMNIV
                     RMNFSHGSYEYHQSVIDNARAAAAKSPSGRPIAIALDTKGPEIRTGLMKDDTDVPISA
                     GHEFWVTTDKAYAEAGTAEHIYIDYTNIVKVTAPGKLIYVDDGILSLQVISIQGEKIR
                     VKSLNSGVLSSRKGVNLPKTAVDLPALSEKDKSDLAFGVKNGVDMIFASFIRSANDVK
                     EIRKVLGPEGADIKIIVKIENEQGVMNFDEILRETDGVMVARGDLGIEIPASQVFMAQ
                     KMMIAKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVIDGADCIMLSGETAKG
                     KYPIEAVKMMAETAFLAESSIAYPPLFDQLRALTPRPTETAETLALSAVAAAIEQDAG
                     AIIVLSTSGVSARLISKYRPACPIICVTRNEQTARQLHLSRGVYPVWFPEPRGIPAEK
                     WQIDVDNRIRYGLRMALGLGIIKPEATVMAVQGWKGGLGHTNTLRILSVPSDPADLDL
                     HSIERD"
     CDS             join(977263..977355,977481..977562,977609..977769,
                     977817..977906,977962..978601,978660..978893,
                     978943..979066,979116..979206,979261..979283,
                     979338..979389)
                     /locus_tag="CNC03080"
                     /codon_start=1
                     /product="pyruvate kinase, putative"
                     /protein_id="XP_024512422.1"
                     /db_xref="GeneID:3256275"
                     /translation="MAGTPSSQLAWLSGLSTNFNEMSADQKFLRKTSIIATIGPKTNN
                     VETLVQLADAGMNIVRMNFSHGSYEYHQSVIDNARAAAAKSPSGRPIAIALDTKGPEI
                     RTGLMKDDTDVPISAGHEFWVTTDKAYAEAGTAEHIYIDYTNIVKVTAPGKLIYVDDG
                     ILSLQVISIQGEKIRVKSLNSGVLSSRKGVNLPKTAVDLPALSEKDKSDLAFGVKNGV
                     DMIFASFIRSANDVKEIRKVLGPEGADIKIIVKIENEQGVMNFDEILRETDGVMVARG
                     DLGIEIPASQVFMAQKMMIAKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVI
                     DGADCIMLSGETAKGKYPIEAVKMMAETAFLAESSIAYPPLFDQLRALTPRPTETAET
                     LALSAVAAAIEQDAGAIIVLSTSGVSARLISKYRPACPIICVTRNEQTARQLHLSRGV
                     YPVWFPEPRGIPAEKWQIDVDNRIRYGLRMALGLGIIKPEATVMAVQGWKGGLGHTNT
                     LRILSVPSDPADLDLHSIERD"
     gene            980382..981659
                     /locus_tag="CNC03090"
                     /db_xref="GeneID:3256642"
     mRNA            join(980382..980659,980749..980875,980933..981071,
                     981134..981199,981334..981659)
                     /locus_tag="CNC03090"
                     /product="expressed protein"
                     /transcript_id="XM_569942.2"
                     /db_xref="GeneID:3256642"
     CDS             join(980537..980659,980749..980875,980933..981071,
                     981134..981199,981334..981559)
                     /locus_tag="CNC03090"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569942.1"
                     /db_xref="GeneID:3256642"
                     /translation="MPSIAGKLVNKVLKDHISKQAPEDPLYTVTVNSKGKSKRQVRPL
                     PEGLSKRDRKALKKIRKRAHYLDKGMNICGFRVGWTFFIGIIPGLGDAVDAGLNYCLV
                     VKPAKKLDIPDSLVHKMLFNNAISAGLGLVPIAGDIFLAAWKANSRNAALLEAYLTIR
                     GQEYIAALRREPGVIDPAEAIAHGVPPEDLRDQFGPGAGMDHPVEDEESNRGFFGGRK
                     SKKEVTKK"
     gene            982596..983428
                     /locus_tag="CNC03100"
                     /db_xref="GeneID:3256550"
     mRNA            join(982596..982673,982730..982914,983000..983056,
                     983111..983428)
                     /locus_tag="CNC03100"
                     /product="expressed protein"
                     /transcript_id="XM_569943.2"
                     /db_xref="GeneID:3256550"
     CDS             join(982655..982673,982730..982914,983000..983056,
                     983111..983179)
                     /locus_tag="CNC03100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569943.1"
                     /db_xref="GeneID:3256550"
                     /translation="MTIIHVVAFKTATPSTIGPLTTSIKALKDNCINPRTGKPYILDL
                     RGGKQISTEGLDRGMQVVFVLEFENDDDLQYYIDEDPAHEQFKKSAKGEWEAIDVLAL
                     DFSNGKF"
     gene            complement(984016..985975)
                     /locus_tag="CNC03110"
                     /db_xref="GeneID:3256352"
     mRNA            complement(join(984016..984243,984288..984331,
                     984390..984480,984532..984552,984610..984625,
                     984676..984849,984911..985008,985068..985163,
                     985212..985236,985306..985309,985377..985432,
                     985515..985591,985652..985735,985823..985975))
                     /locus_tag="CNC03110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656755.1"
                     /db_xref="GeneID:3256352"
     CDS             complement(join(984061..984243,984288..984331,
                     984390..984480,984532..984552,984610..984625,
                     984676..984849,984911..985008,985068..985163,
                     985212..985236,985306..985309,985377..985432,
                     985515..985591,985652..985735,985823..985885))
                     /locus_tag="CNC03110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512423.1"
                     /db_xref="GeneID:3256352"
                     /translation="MMPIELDLDSILQFAIKLALDAGQIIREGQEKRFASESAQEDEK
                     LNSVDLVTEVDKAVEKFIVERIREAYPSHKFIGEESYEGQQITDEPTWIVDPIDGTTN
                     FVHGFPMVATSIGLAHKGIPVVGVIYNPFLDQLWSAAKGRGAYLNQKRKLPITGSSKP
                     LASLGQALIGVEYGMSRSPPALPRKLAAFEKLTAHTDVGGKMCHSLRSMGSAALNIVL
                     VASGGLDIYWEVGCWPWDVCAGICILEESGGRCFGAKTADLSGEVDAKLMAGRKYAMI
                     RSIRATDRLSFCRKRRPWINKRNLSKSFTIVLRISTLEFATSTGENNIMTCSDDRPRA
                     STMVVAVFS"
     gene            987668..993819
                     /locus_tag="CNC03120"
                     /db_xref="GeneID:3256328"
     mRNA            join(987668..988059,988133..988259,988311..988414,
                     988467..988520,988573..988655,988713..988755,
                     988806..989032,989090..989193,989259..989270,
                     989319..989355,989425..989613,989667..991537,
                     991590..991861,991922..992039,992090..992163,
                     992222..992280,992336..992429,992479..992626,
                     992678..993224,993272..993333,993392..993819)
                     /locus_tag="CNC03120"
                     /product="transmembrane protein, putative"
                     /transcript_id="XM_024656756.1"
                     /db_xref="GeneID:3256328"
     CDS             join(987901..988059,988133..988259,988311..988414,
                     988467..988520,988573..988655,988713..988755,
                     988806..989032,989090..989193,989259..989270,
                     989319..989355,989425..989613,989667..991537,
                     991590..991861,991922..992039,992090..992163,
                     992222..992280,992336..992429,992479..992626,
                     992678..993224,993272..993333,993392..993657)
                     /locus_tag="CNC03120"
                     /codon_start=1
                     /product="transmembrane protein, putative"
                     /protein_id="XP_024512424.1"
                     /db_xref="GeneID:3256328"
                     /translation="MPFIKALDHAIPNGQTFNNLAKAPGAVAGGLTSAVGSVGNMVGV
                     EQVRGAAVHMFDPDASPAVKAAAAAKAKASLGLPSRDKVREGISGDGGGARAVIIDSS
                     TSANAPKPTVTLADIDKASQAEGQREGSDDMPGSIPSNTAPSIPTWVMAGWKQAAGLG
                     KTATAREEATVLQTYLTETMYGAWYHNAAVILFAILSTRLLTVLHLDWGWIIVVLAFC
                     SSYYSISISRTRQRVRDDIQRELVKTRLVTETESADWINSFLERFWLIYEPVLSQTII
                     ASTDAALAGVAPPGVDSIRMTTFTLGTKAPRIDYVRTFPKTPEDVVIMDWALSFTPND
                     LEDITPRQAAKQVNPKVVLSIRVGKGALSKALPVLLEDMSFSGKMRIKLKLMTNFPHV
                     QTVDISFIEKPTFDYVLKPIGGETLGFDINSIPGLAPFIRDQVHSNLGPMMYDPNVFT
                     IDLQQLLSGTPLDAAIGVLRVTVLDARNLKATKFGGGDPDPYVSFSIGAKPAIAQTKT
                     IRSSSNPSFHETQFLLINSLADVLNLNVFDFNDHRPDSLLGTVSHELGTLADDAEQEG
                     IVGQILGGGKDRGTLRYDLSYFPVLKPEKNADGTLEPLPDTQTGIVRLTIHQAKDLDV
                     SHALLGGGALSPFASVFLGSGKNEVHRTKVLKHANQPIWEDACEFLVPEKHNSVVTVA
                     ITDSKDFAVDPSLGMVTIRLADLLEAKERHQDWFPLKGSRQGKVRMTAEWKAVAMTGS
                     IGGANSYIPPIGILRVWLKRAVDVKNVEAALGGKSDPYVRIMGNNRIMARTEVINNNL
                     NPEWDQIIYVPVHSIREHFMLEVMDYQNIGKDRSLGHVDLAARDYIDESGEQKYPYIS
                     KGSQDRRDRIKLDKANHFKGELHYEVDFKPAVSLRGGVSFDAQKNELEIAAEAAEAQS
                     AAEGASSSVTATVTPEANGSIKAASVPSGIVGVDDVTAGDANGHANQSVVDASIAAAA
                     LTAEEEDAQPETAAEDPREGVIMSTEEILSCQSGVIVFQVISGKLARRGSLEVMFDDG
                     YWPAFTSGKARSNHPTWDQVGEGFIRELDFSRVWLRINAADENSKEDVVAEFKCDTKD
                     FLERSINAPYDFVLTEPDGSNRSIVQIAARFVPVDIVLQPRESINNMGILRVDVIDAK
                     ALHGADRSGKSDPYVVFSLNDMKVFKSETKKKTLHPVWNESFETMVPSRVAAKFAFEI
                     FDWDRVGTATSLGGNIIDLAVLEPFEATEVSLPVITEKRGEKGTFTFRLLFTPEIIAR
                     VRHNTSSFVSAGRAITQIGGVPLGVGKGVIHGGGAVAGGVAHGLGSVGGFAGRRIGLI
                     KKKDKLTGKEVVIDPVTGTSVPVAPGTEITPAIGESSDVAAGQTSAPVGANLDGAVPG
                     HHATTLPVGESASPQQPGTLGVTVISAKDLKSNREGSVKPYVQIKAGGKTVKTEHVKG
                     SAPEWNESFSFNLTPNIKSFSVTVCDHHTLGKDPELGEAEVDIWRHIRPAVPDADVWV
                     ELSNGTGLLRLKLDWNTGFANPTPMRLGSRIRTPSVSSKSLPDSPGRFSMKKSKE"
     gene            complement(993819..994888)
                     /locus_tag="CNC03125"
                     /db_xref="GeneID:36392792"
     mRNA            complement(join(993819..994630,994689..994888))
                     /locus_tag="CNC03125"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658947.1"
                     /db_xref="GeneID:36392792"
     CDS             complement(join(993925..994630,994689..994861))
                     /locus_tag="CNC03125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514284.1"
                     /db_xref="GeneID:36392792"
                     /translation="MQHQHRPPQEIYHPPQPPSIPLPTINTLIPRLTTTINDIDSLKT
                     LVANGAHNDTIPSWDVLLQRYSLLLGRINALSATITAPPARPNVTGYSQKPPPQTPIL
                     SRYLVHPLTPLPSTDSAGSEITPLVQDAFFQAINTIPLVAAPADDRVEGMGPNVSFSH
                     TQDQLRALSEMDLEDLRRRILLIMERDGMKAKAMKEEIDRRAEEVDWAMRVDEVEEGD
                     DYEDDEIAVAPTKGNDETRDDDDLFGSDDESMEAVPAADTASTRHSKEQQTSMSCATW
                     KPTDFVKFMDSGAQPL"
     gene            complement(995249..998091)
                     /locus_tag="CNC03130"
                     /db_xref="GeneID:3256272"
     mRNA            complement(join(995249..995488,995549..995793,
                     995849..996224,996279..996318,996370..996473,
                     996530..996615,996678..996822,996881..997120,
                     997182..997657,997714..998091))
                     /locus_tag="CNC03130"
                     /product="expressed protein"
                     /transcript_id="XM_569617.2"
                     /db_xref="GeneID:3256272"
     CDS             complement(join(995417..995488,995549..995793,
                     995849..996224,996279..996318,996370..996473,
                     996530..996615,996678..996822,996881..997120,
                     997182..997657,997714..997864))
                     /locus_tag="CNC03130"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569617.1"
                     /db_xref="GeneID:3256272"
                     /translation="MTGESSAIRKYDVDFKKTPGTLSITSTHIIWVPKVKDAMDRQSQ
                     AMNRAINMLASKPENERVSLKIIFKENVPPGGLHFVFTNANTRGDDRKAVQDILIPFV
                     AANKNPTASAPGTPGSSTTPNTPSAATSAVMSDVAKGKRKMNEVTPAGLSTVSTESSP
                     LPPAVRSQRRKYNTLRQRVLEKNDALRMLHRDLVLGRQITEEEFWEGREALIQAEEMA
                     YAQKPGRPSRLLDDRFDLDAGRRGKTTGGTGVGIKQADNGPVILKLSKELTREIFEEF
                     PVVQDAYAKYVPGISETEFWSRYFTSQLWERHRASVRKSANDEISRKKDDIFDQYLEE
                     PDWNLQPRQPMPDRDGVERYLDLAATEEDHGEATSIRDVTMQAGRERSALPLIRRFND
                     HSKKLLRAASAGQTVRNSAFGGDIGIYEEINLEDLHDPSATPAIILDVENAAALDEGD
                     DKLAPTGVLPGYSDSELLAMATESASILLDSMPDFSSVCLANPGPFIDDDESQRNPAY
                     EAFAKQRDSQAAALATVKDMWSRANAENAVLPVFPEMLFEQIRSCHNSATEFLRQYWS
                     AILPSVPGALGGQTPSAKDAKAAKMASYLKNTSNKIEAIVQTAQITGFDPERVRKALA
                     PTLGAVEVALERERKRVKGK"
     gene            complement(998398..1001559)
                     /locus_tag="CNC03140"
                     /db_xref="GeneID:3256622"
     mRNA            complement(join(998398..998586,998643..998717,
                     998766..998863,998915..998931,998991..999046,
                     999097..999282,999341..999384,999441..999515,
                     999589..999640,999712..999758,999807..999884,
                     999940..1000018,1000074..1000240,1000316..1000537,
                     1000592..1001075,1001126..1001559))
                     /locus_tag="CNC03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656757.1"
                     /db_xref="GeneID:3256622"
     CDS             complement(join(998660..998717,998766..998863,
                     998915..998931,998991..999046,999097..999282,
                     999341..999384,999441..999515,999589..999640,
                     999712..999758,999807..999839))
                     /locus_tag="CNC03140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512428.1"
                     /db_xref="GeneID:3256622"
                     /translation="MQTGARRLWREYLEKCRQARNSDIFQKVNREMVGRWADLACANE
                     HGSISVQQVFEVFGSLELMIPCFQEILEDIAHISNNQFGHFAITKLVSYPNFYKQTCE
                     AIINSYPPVATTHHGVNLAKIALTEGGRASFIKYVEAICRQDDGRTPGIVTIATSSIG
                     KAHLTFLMSCLTPSEHVRVRSTCRAYSTSLRNCQSGNDLLRALGIMHSTSAKHRNTGI
                     NNV"
     STS             1001019..1001689
                     /standard_name="Xba25"
                     /db_xref="UniSTS:470763"
     gene            1001758..1003811
                     /locus_tag="CNC03150"
                     /db_xref="GeneID:3256647"
     mRNA            join(1001758..1001810,1001859..1002063,1002114..1002440,
                     1002492..1002591,1002637..1002701,1002754..1003015,
                     1003073..1003231,1003281..1003811)
                     /locus_tag="CNC03150"
                     /product="transcriptional activator, putative"
                     /transcript_id="XM_569633.2"
                     /db_xref="GeneID:3256647"
     CDS             join(1001795..1001810,1001859..1002063,1002114..1002440,
                     1002492..1002591,1002637..1002701,1002754..1003015,
                     1003073..1003231,1003281..1003646)
                     /locus_tag="CNC03150"
                     /codon_start=1
                     /product="transcriptional activator, putative"
                     /protein_id="XP_569633.1"
                     /db_xref="GeneID:3256647"
                     /translation="MQQLLNPFAQKYPDAVDSTLFTQGVCLAFNRSGPFAGHYLAVGN
                     SHGTVEIWDVETRGVVRILEGHVKAVEGLSWSRNNRYLLSASSDGTAIVWDLSVLPHP
                     LLSPRTPLTGEPHAGPSSARLHTVRFDSPVISASFHPRNSRIILAVLSCGEAVIVDMR
                     KGGGKYRLEDVSDEDETAVNRKRISMTCGDFSPCGSRVYVGTSNGMLIVIDPMTRQIL
                     QRAKLANSGIRQLSFDTSGFHLLTSATDRALRLLHIDPLTLSLSPLHRFQDLINRTPW
                     NSIGFSGDAEYVMGGAAHKMAHNVFIWDRESGVLVKVLEGPKEPLIACTWHPTKPIIA
                     SITTSGDVHVWQTSSPDNWAAFAPGFEELEENVEYDEREDEFDIEDETELNRRKDLEE
                     DIIIDLLTPQEDAFPRRARPIISLPSNIIFANDDEQLEAMRFIESISNVAKWADREAA
                     VYEDALVSGDGEQEELGEAANGAADGDDWEGFYLSQDLLSDIRSDDAGT"
     gene            complement(1003655..1005823)
                     /locus_tag="CNC03160"
                     /db_xref="GeneID:3256805"
     mRNA            complement(join(1003655..1003763,1003827..1004034,
                     1004091..1004423,1004481..1004562,1004612..1004894,
                     1004946..1005135,1005200..1005229,1005285..1005498,
                     1005577..1005823))
                     /locus_tag="CNC03160"
                     /product="chaperone regulator, putative"
                     /transcript_id="XM_569635.2"
                     /db_xref="GeneID:3256805"
     CDS             complement(join(1003735..1003763,1003827..1004034,
                     1004091..1004423,1004481..1004562,1004612..1004894,
                     1004946..1005135,1005200..1005229,1005285..1005498,
                     1005577..1005704))
                     /locus_tag="CNC03160"
                     /codon_start=1
                     /product="chaperone regulator, putative"
                     /protein_id="XP_569635.1"
                     /db_xref="GeneID:3256805"
                     /translation="MSTIVDSRPRGTYIPADCPSCRSEQEYMIPPTFIGGLRVRCSAC
                     KQLFTHPQPKPSGSSSSSTSKAAPRTRSIGTDKDPLDLAYYDVLGLDSQCTTEEVKKA
                     YRRLAIKLHPDKNRDDPDAEEKFKEISVAYQVLSDPELRHKYNEFGQKNGGGMSEPAG
                     GFHDPEEVFGKMFGGDRFEVLIGNISIGKDMKEAFQQQHEEDPSDFTIGPNGKPILTP
                     AGAQKKWSREKKVAEEKARQRQARVDQLATHLINKLNIYTEAAKGPQDEMVGASFKEI
                     CRLEADDLKDENYGVELLHAIGKTYQAKSSQHLASSQFAPLGWFHGAKSSFNVVSDTV
                     STLRSAMELKAVFERLQRAEQSGMSADELRKLEEQAAEQGMRTMWKGVKLEVESVVRD
                     TCEKVLSDPTLPKEKLHSRAVALGLMGEAFLAIRKEGETHGEDFVRVETPASKQREAS
                     HTTTHAPPPVPPRPENTTSATQDAQLKEKEETLKAAYRAYESKRQGNP"
     gene            complement(1005988..1007460)
                     /locus_tag="CNC03170"
                     /db_xref="GeneID:3256460"
     mRNA            complement(join(1005988..1006424,1006476..1006635,
                     1006700..1006754,1006822..1006837,1006898..1006976,
                     1007046..1007104,1007158..1007174,1007230..1007258,
                     1007336..1007460))
                     /locus_tag="CNC03170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656758.1"
                     /db_xref="GeneID:3256460"
     CDS             complement(join(1006150..1006424,1006476..1006635,
                     1006700..1006754,1006822..1006837,1006898..1006976,
                     1007046..1007104,1007158..1007174,1007230..1007258,
                     1007336..1007395))
                     /locus_tag="CNC03170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512597.1"
                     /db_xref="GeneID:3256460"
                     /translation="MPWLMKAEPDSRIVKGKDVKFSVDDFERVGVSPWDGVRNHEAKK
                     IMREKMKLGDKVLFYHSNCKVPGVFAVAEISKEGYPDFTAWDPDHPYFDPKSKQDSPT
                     WFMVDVRFKRRLDYPPTLALIKHLATLSNLPKEVSYIGDRGLEAIKNMSLVNRGRLSV
                     QPVDDAAYNAIVELGTKGGWDSFVSVSSQASKSRKAKASESSSELVKAKDNDTLEEKP
                     HKGKKFLPGEDGIFESGQGQRRSKRLKRSLP"
     gene            1007598..1010426
                     /locus_tag="CNC03180"
                     /db_xref="GeneID:3256709"
     mRNA            join(1007598..1007765,1007822..1008503,1008553..1008803,
                     1008857..1008927,1008975..1009284,1009335..1009765,
                     1009820..1010090,1010142..1010426)
                     /locus_tag="CNC03180"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_569637.2"
                     /db_xref="GeneID:3256709"
     CDS             join(1007667..1007765,1007822..1008503,1008553..1008803,
                     1008857..1008927,1008975..1009284,1009335..1009765,
                     1009820..1010090,1010142..1010183)
                     /locus_tag="CNC03180"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_569637.2"
                     /db_xref="GeneID:3256709"
                     /translation="MSDSHLMSTSNLQPLQSMAAGIDVATPLKKKNKPESQKRRDKKK
                     NKKKRKIQKAKRAAAPKNKDWKPDPVLEALKQSTTFRKIDSVKGPKGDRTFEEYDTGT
                     ESGGQTTAQVPGDKEKKQQEKREKREKRQRKEERRARREAAITKMGVDMGPGEGTMVV
                     EGIPEPDQVEEQEKNKSMPSLERSPTPPPLVAFPLPRLAPAPDASVLARQGLPKGLED
                     ATFIDQSLRVEVEGLSVEGRDEALSVNMRRRLNEIGIEDFFAVQAAMLPRLLPLQLIP
                     SPYCPLPDYLISAPTGSGKTLAYTIPILEILSQRTICRLRALIVLPTRDLVFQVRETM
                     EALSKGTGLTIGTVTGQHSFAQERKQLVADLDTPLLGGSSKLDILIATPGRLMDHLAS
                     TPNFTLQHLRFLVIDEADRLLNQSFQDWLTQVLAYTRPPVEPIAPSFKRKPYDTVSSA
                     FMEACGLVDKRGEWCDSSPSICQKLLFSATLTRDPSKVAALSLHHPQYYIVQSSSVPA
                     LPTSVGEQFALPSSLSEKMLILPPALKPLNLIHLIHHSEFNVDRALVFTKSVESAARL
                     VKLLEFFEDAYVLGGGGGKRLVVEQYSGETRAKDKKQLLAEFGEGKVNLIVCSDLIAR
                     GIDLPSVSHVVSYDIPLDIRKYVHRVGRTARAGRQGTAWTLVEKQEALHFKGMLQNAG
                     HLKAVKKVKVKEDDLSPYRESYEIAMKRLKDYYHHD"
     gene            complement(1010160..1011351)
                     /locus_tag="CNC03190"
                     /db_xref="GeneID:3256290"
     mRNA            complement(join(1010160..1010534,1010598..1010829,
                     1010878..1010933,1010981..1011076,1011128..1011291,
                     1011344..1011351))
                     /locus_tag="CNC03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656759.1"
                     /db_xref="GeneID:3256290"
     CDS             complement(join(1010392..1010534,1010598..1010829,
                     1010878..1010933,1010981..1011076,1011128..1011290))
                     /locus_tag="CNC03190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512596.1"
                     /db_xref="GeneID:3256290"
                     /translation="MAQTTDGQTPSPNSAKSTLEQRRARREQFRNFYGLKSDAAAKIE
                     GVNDSKLVDIDSPTFKPAAYYEDLIAKSTLSGLMRTTASLSSDIGRLQGTRHSLVYNH
                     HHQLFAAGDTISQLNARTPQLLSVVTNLQQSFSSISQLVDSINIPRIEEQIVVDPEEA
                     TTISRRKTQRQLERLRLMVQANESSDRINEFYKIHYEALHSLATEDDLAKKHLEDCEA
                     AIQLTSRIVPA"
     gene            1011495..1013033
                     /locus_tag="CNC03200"
                     /db_xref="GeneID:3256729"
     mRNA            join(1011495..1011767,1011824..1012048,1012096..1012212,
                     1012270..1012385,1012447..1013033)
                     /locus_tag="CNC03200"
                     /product="cap binding protein, putative"
                     /transcript_id="XM_569639.2"
                     /db_xref="GeneID:3256729"
     CDS             join(1011549..1011767,1011824..1012048,1012096..1012212,
                     1012270..1012385,1012447..1012669)
                     /locus_tag="CNC03200"
                     /codon_start=1
                     /product="cap binding protein, putative"
                     /protein_id="XP_569639.1"
                     /db_xref="GeneID:3256729"
                     /translation="MTSTAIPPAAVAANNNTLNSALAAEQISSPASPVDKPVDEKKQL
                     EEGEIEENPSEGDSQTKTIFDDASKFNVKHPLFSTWTLYFDSPQSKSLPKTPQTTPAM
                     PQGSHGWMADIRKVVSFDSVEEFWGLYNNIIPPSQLPGKANYYLFKNGIIPAWEDPQN
                     KNGGKWSIQVPKNSESKSSIDRMWLYTMLAAIGETFETASTDSENAPSPTQSDLITGV
                     IVSPRPAFYRISIWTREASDVNVLDTDAIKARLLNIGKHFKTSVLGYELEQKLTEGGF
                     QTELTFDAHKDSEKKVNKNKFTV"
     gene            complement(1012801..1014712)
                     /locus_tag="CNC03210"
                     /db_xref="GeneID:3256778"
     mRNA            complement(join(1012801..1013035,1013234..1013410,
                     1013469..1013578,1013634..1013716,1013774..1013779,
                     1013833..1013876,1013928..1014239,1014299..1014712))
                     /locus_tag="CNC03210"
                     /product="expressed protein"
                     /transcript_id="XM_024656760.1"
                     /db_xref="GeneID:3256778"
     mRNA            complement(join(1012801..1013035,1013234..1013716,
                     1013774..1013779,1013833..1013876,1013928..1014239,
                     1014299..1014712))
                     /locus_tag="CNC03210"
                     /product="expressed protein"
                     /transcript_id="XM_024658948.1"
                     /db_xref="GeneID:3256778"
     CDS             complement(join(1013634..1013716,1013774..1013779,
                     1013833..1013876,1013928..1014239,1014299..1014588))
                     /locus_tag="CNC03210"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512430.1"
                     /db_xref="GeneID:3256778"
                     /translation="MEAELQTYRDQLAYVNLSLESDPSNDDLLKLKAELNELIDLTQQ
                     AMGHTAAAKGVDAGKEKAKAKGKEKEKEVTNWQDQGPYKAGMDCMAKYKDGKWYPARI
                     NAVVGSQESPLYAVTFKGYTSSTNLPLSSLKPHDPNAPIPQPQKRRADELTEKEKEKK
                     KKKGEKWMETQKQRAEEVKEKKNAWEKFGKKAQKKGIHISGLEGRSVFRTPDNPYGRV
                     GVVGSGRGVTEYERMGKHKFNEEEDD"
     CDS             complement(join(1013634..1013716,1013774..1013779,
                     1013833..1013876,1013928..1014239,1014299..1014588))
                     /locus_tag="CNC03210"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514285.1"
                     /db_xref="GeneID:3256778"
                     /translation="MEAELQTYRDQLAYVNLSLESDPSNDDLLKLKAELNELIDLTQQ
                     AMGHTAAAKGVDAGKEKAKAKGKEKEKEVTNWQDQGPYKAGMDCMAKYKDGKWYPARI
                     NAVVGSQESPLYAVTFKGYTSSTNLPLSSLKPHDPNAPIPQPQKRRADELTEKEKEKK
                     KKKGEKWMETQKQRAEEVKEKKNAWEKFGKKAQKKGIHISGLEGRSVFRTPDNPYGRV
                     GVVGSGRGVTEYERMGKHKFNEEEDD"
     gene            complement(1015050..1018523)
                     /locus_tag="CNC03220"
                     /db_xref="GeneID:3256199"
     mRNA            complement(join(1015050..1015280,1015353..1015700,
                     1015752..1015860,1015915..1015926,1015980..1016046,
                     1016106..1016166,1016219..1016343,1016393..1016471,
                     1016522..1016536,1016590..1016607,1016654..1016666,
                     1016736..1016828,1016894..1017020,1017076..1017197,
                     1017251..1017310,1017365..1017388,1017450..1017640,
                     1017695..1017726,1017774..1017804,1017848..1017855,
                     1017914..1017938,1017993..1018003,1018066..1018077,
                     1018131..1018523))
                     /locus_tag="CNC03220"
                     /product="receptor, putative"
                     /transcript_id="XM_569994.2"
                     /db_xref="GeneID:3256199"
     CDS             complement(join(1015363..1015700,1015752..1015860,
                     1015915..1015926,1015980..1016046,1016106..1016166,
                     1016219..1016343,1016393..1016471,1016522..1016536,
                     1016590..1016607,1016654..1016666,1016736..1016828,
                     1016894..1017020,1017076..1017197,1017251..1017310,
                     1017365..1017388,1017450..1017640,1017695..1017726,
                     1017774..1017804,1017848..1017855,1017914..1017938,
                     1017993..1018003,1018066..1018077,1018131..1018243))
                     /locus_tag="CNC03220"
                     /codon_start=1
                     /product="receptor, putative"
                     /protein_id="XP_569994.1"
                     /db_xref="GeneID:3256199"
                     /translation="MPDPSIPVVGHKTQRKLVGHNLLYSVSVFLSIGVWLFGYDQGVM
                     SGIITGPYFKAYFNQPTSTQIGNMVAVLEIGAFITSLAAAHIADNYGRRMTLRTGAIV
                     FTIGGAIQTFCVGYNSMVLGRIVSGFGVGMLSMVVPIYQSEISPADHRGLLGSVEFTG
                     NIIGYASSVWIDYACSFFQSDWSWRLPLSVQCIGGSVLFIGSFVTPESPRYLVDTDQE
                     VEGLAVIADFQGKALDDISVQAEYKEIRDAVLADRAVGDRSYRALWRRYKGRVLIAMS
                     SQLFAQLNGINVISYYAPLVFEQAGWIGRDAILMTGINALFYVASSLPPWYLMDRAGR
                     RPILLSGAVAMAIALTATGWWIYIDQAITPNAVVICVVIYNSAFGMSWGPVPWLYPPE
                     IMPLSFRAKGVSLSTATNWISNWWVGVSTPLFQELIGWRLYPMHAFFCALSFILVYFL
                     YPETRGVPLEEMDKLFGDESDEDEVDSDFDEVEEAESEISSLVSNPRHRRRSASSSLG
                     PSLPTSRKPSPIPSREASSSRGLFGRITDSVNGLIGSTKQQSRSVGYTAVNEE"
     gene            1018792..1021192
                     /locus_tag="CNC03230"
                     /db_xref="GeneID:3256311"
     mRNA            join(1018792..1018818,1018886..1019843,1019913..1020428,
                     1020485..1020862,1020915..1021046,1021109..1021192)
                     /locus_tag="CNC03230"
                     /product="long-chain acyl-CoA synthetase, putative"
                     /transcript_id="XM_024656761.1"
                     /db_xref="GeneID:3256311"
     CDS             join(1019313..1019843,1019913..1020428,1020485..1020862,
                     1020915..1021046,1021109..1021162)
                     /locus_tag="CNC03230"
                     /codon_start=1
                     /product="long-chain acyl-CoA synthetase, putative"
                     /protein_id="XP_024512431.1"
                     /db_xref="GeneID:3256311"
                     /translation="MTSLNSFPLLERIIARAQSAPASEAIVDVPHSLTVTYSELCGDI
                     LSLGSILTSFLSVPETRVVVLCDKGYLVPLSMLSIWTAGGLSVPVLPSLPLPEQAYMA
                     TNSDASLVICDANNKPRADELKADMEKEGIKTTVLEISLNGVRKAAYDKSGVETLSKM
                     SELHSERRAMMLFTSGTTGRPKGVVTRHSALGAQVSAVVQFWRWTSTDNLLHILPLNH
                     LHGIVVALLPALWAGATVELWEKFDARGIWMRWINNEGKTPITMFFGVPTLYSRLIQS
                     HPMLPKELQPIASEASSKLRLQVSGSAPLPESIKKTWEKEGGIGGGQVLLERYGMTET
                     GIIASTGWENDKRVKGHVGYALPGTGIRLWNEDLNQSITAFDTQGEIQVRGPSITTEY
                     WRLPEATAKEFVDGWFKTGDIGVWSSDTAAQNQLKVLGRKSTDIIKSGGEKISAVEIE
                     RAILELPGMKDCAVMGVEDEEWGQIVSVCLVTSRPSVTVNEIRNELRSVLAPYKLPKL
                     LKLYEGEIPRNNMGKVNKKKLVLEAFPK"
     gene            complement(1021537..1024896)
                     /locus_tag="CNC03240"
                     /db_xref="GeneID:3256155"
     mRNA            complement(join(1021537..1021809,1021861..1022151,
                     1022195..1023125,1023176..1023321,1023366..1024170,
                     1024214..1024420,1024476..1024896))
                     /locus_tag="CNC03240"
                     /product="protein-Golgi retention-related protein,
                     putative"
                     /transcript_id="XM_569646.2"
                     /db_xref="GeneID:3256155"
     CDS             complement(join(1021645..1021809,1021861..1022151,
                     1022195..1023125,1023176..1023321,1023366..1024170,
                     1024214..1024420,1024476..1024747))
                     /locus_tag="CNC03240"
                     /codon_start=1
                     /product="protein-Golgi retention-related protein,
                     putative"
                     /protein_id="XP_569646.1"
                     /db_xref="GeneID:3256155"
                     /translation="MDEAKLLSDALANVKVQTVQLKRCLDQDEIMEALKAASSMLAEL
                     RTSSLSPKQYYELYMSVFDSLRFLSNYLYEAHTEGKHHLADLYELVQYAGNIVPRLYL
                     MITVGSVYMSVPDAPVKEIMKDMLEMSRGVQHPTRGLFLRHYLSGQTRDFLPVGNSDG
                     PGGNLQDSIGFVLTNFIEMNKLWVRLQHQGHSREREKREMERRDLRILVGTNLVRLSQ
                     LDGVDLDMYRKIILPSVLEQVVNCRDVIAQEYLMEVVIQVFTDDFHLHTLTPFLGACA
                     QLHPRVNIKGIVIALIDRLAAYAVREAESEDPEEKRRDEEEAARRLAEKVKGARGKGK
                     NVEEGEKNAPSPVAKPAEADVWGATTDTTSTTPVTENLSGESSKSPVEGEKLGESPAP
                     TPAQMEKEETAKKFRGIPEDVKLFEVFWQQVVELIKARPDLSIMDITALCVSLTNLSL
                     SCYPDRLEYVDQVLSFTHGKVHDYSQNPDLHSSQTVSNLLALLLAPISSYVSILTLLA
                     IPSYLPLLSVQPYSTRLSIGQAVVSSVLKNNTHIETSDDVTGVLGLCAVLVKDQKDHT
                     IGGGAPQRRGQAIDWREMAEEQGWVARMVHLFRADDLGVQFELLQTARRHFTEGGERI
                     RFTFPPLIASSIQLARRFKTRESVEDEWETRVSALFKFIHQLISILYHKVEAPETCLR
                     LFLLAAQVADDCRLEELTYEFFVQAFVIYEESISESRAQLQAITGIISSLQTSRVFGT
                     DNYDTLITKAALHGSRLLKKSHQATTVLYASHMWWQGDVPGREKNDKPPFRDGKRVLE
                     CLQKSLRIASSCIDEITSVQLYVDALDRYVYYFEQGVEAVTPKYVNSLVELITSNIDS
                     VNSGGDVHPSSAGGGLVEGVSGGDMIIKHFRNTLLYIRGRQRQAQTDVVDQGDEREGG
                     EEKKKVDWESVDVAGGCLKMGLTH"
     gene            complement(1025553..1026597)
                     /locus_tag="CNC03250"
                     /db_xref="GeneID:3256124"
     mRNA            complement(join(1025553..1025735,1025799..1025993,
                     1026044..1026303,1026358..1026597))
                     /locus_tag="CNC03250"
                     /product="transcriptional elongation regulator, putative"
                     /transcript_id="XM_024656762.1"
                     /db_xref="GeneID:3256124"
     CDS             complement(join(1025649..1025735,1025799..1025993,
                     1026044..1026298))
                     /locus_tag="CNC03250"
                     /codon_start=1
                     /product="transcriptional elongation regulator, putative"
                     /protein_id="XP_024512433.1"
                     /db_xref="GeneID:3256124"
                     /translation="MSSTGWEIRFSNSRQIPYFYNSERSISTWEPPSELSAEQIQQLP
                     GAAKYMNVQLAQPAGGKEGQVRASHILAKHAGSRRPASWRNDKITITSDEAQAIIEQH
                     IAYLQSLPPADLPKEFAKIASTESDCSSARKGGDLGWFGRGQMQKPFEDATFNTPVGQ
                     LSGIVKTDSGIHVILRTG"
     gene            1026871..1029068
                     /locus_tag="CNC03260"
                     /db_xref="GeneID:3256397"
     mRNA            join(1026871..1026954,1027150..1027210,1027261..1027467,
                     1027518..1027770,1027820..1028221,1028274..1028410,
                     1028467..1028629,1028682..1029068)
                     /locus_tag="CNC03260"
                     /product="beta1-tubulin, putative"
                     /transcript_id="XM_569650.1"
                     /db_xref="GeneID:3256397"
     CDS             join(1026954,1027150..1027210,1027261..1027467,
                     1027518..1027770,1027820..1028221,1028274..1028410,
                     1028467..1028629,1028682..1028801)
                     /locus_tag="CNC03260"
                     /codon_start=1
                     /product="beta1-tubulin, putative"
                     /protein_id="XP_569650.1"
                     /db_xref="GeneID:3256397"
                     /translation="MREIVHLQTGQCGNQIGAKFWEVVSEEHGIQADGSYKGTTDTQL
                     ERINVYYNEAAAGKYVPRAVLIDLEPGTMDSIRGGPLGSLFRPDNFVFGQSGAGNNWA
                     KGHYTEGAELVDSVLDVVRREAEGCDCLQGFQITHSLGGGTGAGMGTLLISKIREEFP
                     DRMMCTFSVVPSPKVSDTVVEPYNATLSVHQLVENSDETFCIDNEALYDICLRTLKLS
                     TPTYGDLNHLVSVVMSGVTTCLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTAR
                     GSASYRAVTVPELTQQMFDAKNMMAASDPRHGRYLTVACYYRGKVSMKEVEDQIQSVQ
                     AKNSAYFVEWIPGNISAAQCDIPPRGLKMSSTFICNSTSIQSLFKRIGEQFSAMYRRK
                     AFVHWYTGEGMDELEFSEAESNLQDLVSEYMQYQEAGADDEIYGDEEIPIEEEEM"
     gene            1029574..1031381
                     /locus_tag="CNC03265"
                     /db_xref="GeneID:36392793"
     mRNA            join(1029574..1029868,1029913..1030518,1030575..1031381)
                     /locus_tag="CNC03265"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658949.1"
                     /db_xref="GeneID:36392793"
     CDS             join(1030057..1030518,1030575..1031024)
                     /locus_tag="CNC03265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514286.1"
                     /db_xref="GeneID:36392793"
                     /translation="MIPEDHQSLPSRSPSLSPELKPLISLSPEPEPLSPPLRTVTPSQ
                     AQQSIKTVAMHRKNASINQGSRFPSRTDQNDRQCTNCGETDTPQWRGTLCNACALWKR
                     SRGTDRPLPLLFPIRKRSISCCDDEEGERERGPEILESWKPMNHVTGHRGTLPIQPRP
                     VTTNGRPRPGYALARPTAYYPSKVDAQIVHLPSSTEQGMPSRIASKTQTHPYTRGRQL
                     GRNIERGRPEVGEAEVPFPKFTKFPSSFQAEPRMINFERGHPTLRYNKYAMSREEFMR
                     GAEWLFDVLQQTSKLLEDMDNAEERAP"
     gene            complement(1031213..1036325)
                     /locus_tag="CNC03270"
                     /db_xref="GeneID:3256609"
     mRNA            complement(join(1031213..1034058,1034118..1034741,
                     1034804..1035958,1036004..1036129,1036182..1036325))
                     /locus_tag="CNC03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656763.1"
                     /db_xref="GeneID:3256609"
     CDS             complement(join(1031312..1034058,1034118..1034741,
                     1034804..1035958,1036004..1036129,1036182..1036239))
                     /locus_tag="CNC03270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512434.1"
                     /db_xref="GeneID:3256609"
                     /translation="MPQVTVHRAHSPIVWHGKLKQHRSLAEWVARLAPRLQLDASPQQ
                     LRIAHVRDGGREVDIWDDYDFDAFKSRAAAQSAPLVVKVYPPGASSEPGASPATAAPA
                     RKPRKKAVPSDDQPAPGTPPSTKKDKGKSKASPQSQNLAAPVLQPQQPSTPTAAPKSK
                     KRKRDSTSSAAEPLPTRALPVQPTPTGPGRQSTSPQQPKKRRKRGAKSDAALAPAPPP
                     ANPSAPAIASPSRPFTFSLPLQGSAAFINRYKPAKPSPLGRIDGPPVLAGETASTSSS
                     PAAKETLQPLTESGKKSRKPRKRKEKKEEGVGGVPASPAASSVAPSPAPSSSKKQKSR
                     PSVTEEIMRKQREKMAAEEAKKQAENADKANAKGKDKEKATDKPTAMPAASTSIPLTP
                     SKESTTQPSTPELSTQSPLTKTKKEKSPKTPKVNRASEIMRMFREKQAAEAAAKAAEQ
                     SIPPVVQTVQPEQPSVSSAQPSTEHLSSTPATPASALESKKPSSAKPKAAPRPSITLE
                     IMRKQREKMAAAETQAAENVEQENAGEAMDVDQPREKAHIPLVEQSKQGQAEQNTLQL
                     EPQSEIQTESGPVAPPLVSHGFATVPQTPTQSSVQPSNTSSTTKKTKSGRPSITSEIM
                     RKQREAMAQQAEKEKEQEEQIATRDDGDKEASQTASKPKQPQCLICHGSSHPQKDCPV
                     VKAGVPRLQQVLLERKEEDESPEAAVAAIEMWIDRLGRVTSALMGTPVTKGKGRPSSA
                     GLTTQAKQTPSQAASAPAVETESSASESSKSPSPTLPKAASPVPTFPPIYHKALSRKA
                     GSTSGLSVSDAVIETGSSGSSASESSEDEGGSVGSGSGYGSESETESESSASIQGQNA
                     MSRSGSTSTSSSPPPSSSSPSPPPPDLSKLDPQAALRHFLTAPLSQKQRRAARDSAAH
                     MQVVDTQDVEIEEASEVESDEDGTNASFARIRMDDEESLVGEFEDDEKEEDEVEDVEE
                     EPRDEQPPALPQVQQSESDDEMQLDVEGSQPVLEQESALQPRAGQEEEEIRIDVTNTE
                     AEPMDVDQRQTPLKTTQSPPESSPLSFHEGSRQSFNDLAALASPSTQHRELPGDAAVR
                     EAIAEDEAPVRDAMRQDDDVHPKQRIPNGVQEPVLTQQLMSPPSSVAEREDEIEPLPA
                     TQLVQRFEDEEGQGEATPIAKSKAPVRRSTRQPSRQPSVARDDIPSPPRRRLRSASRE
                     PALVPEPPRTRMTRSSSQQRVVPPSPHVPIRRSTRRTVSSQSDVSQLSSSQLEPSSPV
                     QLHATLTPATLRRSSRRQTTPLRSSQVDELDPSSPPPASQQPIEESPLFIPETQLQHS
                     QPQSSQSQSLNSQRFWRISGEEENPLFMSQGSQIPQTQAYNLYPNIDSSSDVGETPRG
                     AKIGIEGSSPSNDKQGEGKRANYLSVSSPILEEDEEEQNALVDTEKHEQTSESGVDEH
                     DDQSVDASEASSDDEGSSISIPIPRSQPIYPSLPRSSLSFSQPVAASQPSTGFPTLSS
                     LPREALRRMKSTFGFSSSQPETSKEKTSRHMNGAGDESESETSGDSSDEEPASLRGRF
                     AGTRARKVKSQGAVKGW"
     gene            1036319..1038560
                     /locus_tag="CNC03280"
                     /db_xref="GeneID:3256685"
     mRNA            1036319..1038560
                     /locus_tag="CNC03280"
                     /product="elongation factor ts (ef-ts), putative"
                     /transcript_id="XM_569654.2"
                     /db_xref="GeneID:3256685"
     CDS             1036380..1037492
                     /locus_tag="CNC03280"
                     /codon_start=1
                     /product="elongation factor ts (ef-ts), putative"
                     /protein_id="XP_569654.1"
                     /db_xref="GeneID:3256685"
                     /translation="MALLSAAPRALRLPRRLPLGAALPALRALATPAAAQKVPVSLIA
                     ALRKQHPVPLAQAREALERSGLDLAAALDYLRTSTSASAEKKAAKVSGRDTNEGLIAI
                     SLLGGKRVGMIHLACETDFVARNQVFLDTARGVAETTAFLDVPGDHEKPQIASSPYAF
                     DPILDFPTESLLSAPLISLPAADTADGSLSPLPTSEPTTIKQSLLSSLAQTGENLKLL
                     RAVSFAAPFPSTPDVRFVPGGYAHGGITDKEGKVGGIVVLSVTSADPEKPIASIIHGP
                     GGDDLEKAAESLARTVARQVVGFPTKVIDRGDRAVDDEEVLMEQPFMMFNGDSRSVKD
                     VLAEWGKERGVVLRVVGMRRWAVGDEIEIKEKETDA"
     gene            complement(1037552..1040206)
                     /locus_tag="CNC03290"
                     /db_xref="GeneID:3256325"
     mRNA            complement(join(1037552..1037835,1037913..1038441,
                     1038521..1038889,1038936..1039069,1039131..1039209,
                     1039261..1039371,1039426..1039516,1039567..1040206))
                     /locus_tag="CNC03290"
                     /product="tetracycline efflux protein, putative"
                     /transcript_id="XM_024656764.1"
                     /db_xref="GeneID:3256325"
     CDS             complement(join(1037564..1037835,1037913..1038441,
                     1038521..1038889,1038936..1039069,1039131..1039209,
                     1039261..1039371,1039426..1039516,1039567..1040180))
                     /locus_tag="CNC03290"
                     /codon_start=1
                     /product="tetracycline efflux protein, putative"
                     /protein_id="XP_024512562.1"
                     /db_xref="GeneID:3256325"
                     /translation="MDAKRLASHSSTMTLVNLSDNHDPQSGPATAGAKDNNDSSFFPS
                     ISRTSDMADYSIAPSPTSPSEVQAPTQNAPLVRASTSGSYHAKNALRRMTTHETGEFV
                     EDQDGKAEDDGLHTHDEEHEHGHEEGDQEHLEQSHKTLRSEKGKEDNREQGKDEEAEI
                     EGKKSGQKKTFELQDQTNLLPTKQVIFVFVGLTCALFCSLLDQTIVTTALPTLGQVFG
                     RADISPWVGTAYLLTSTATQPVYGRLSDIFGRKFTLLGCLFIFLMGSLACALAQTMIQ
                     LIIFRAIQGLGGGGILTLAMIIISDVVSLKERGKYQGITGCVVALANSCGPIVGGAFT
                     ENASWRWCFYINLPLTSISMIIIVFLLPLRRVRGSMVAKIKKLDFYGSILTLAWAAPF
                     LIALSWAGSQYAWDSAAVLVPLLVGLALLGLFIFVEAKVVSLPLVPMHIFKNASVSAC
                     FFTTFMNGLSFYATLYYLPQYFQIVRGASAIRSGVLTLPLMLVQTVTSFTSGIIQSKT
                     GDYWWNLVVGYTIWTIGLGLISSITSTTSIAKLSGYQIIVGIGAGQTFQTSLVAIQAG
                     VERKDMATATGLRNFLRQLGGTIALAACNSIVNNCVRRNLSGVLPGTAYKAILEDPTR
                     ATSLGLSASELSAVTDAYARGINEVFWFCAPCVGICIPITIFLIKKVTLNRSDDAVKK
                     AEAKAWVESKKAKRAKKRKGSEETVVDSGASTMVSGEEKKRDGRRIGKEQ"
     gene            complement(1040544..1044641)
                     /locus_tag="CNC03300"
                     /db_xref="GeneID:3256744"
     mRNA            complement(join(1040544..1040812,1040867..1041127,
                     1041181..1041369,1041423..1041801,1041851..1042328,
                     1042449..1042601,1042654..1042786,1042833..1043098,
                     1043145..1043705,1043762..1044028,1044082..1044502,
                     1044579..1044641))
                     /locus_tag="CNC03300"
                     /product="protein kinase C, putative"
                     /transcript_id="XM_024658950.1"
                     /db_xref="GeneID:3256744"
     mRNA            complement(join(1040544..1040812,1040867..1041127,
                     1041181..1041369,1041423..1041801,1041851..1042601,
                     1042654..1042786,1042833..1043098,1043145..1043705,
                     1043762..1044028,1044082..1044502,1044579..1044641))
                     /locus_tag="CNC03300"
                     /product="protein kinase C, putative"
                     /transcript_id="XM_569656.2"
                     /db_xref="GeneID:3256744"
     CDS             complement(join(1040783..1040812,1040867..1041127,
                     1041181..1041369,1041423..1041801,1041851..1042328,
                     1042449..1042601,1042654..1042786,1042833..1043098,
                     1043145..1043705,1043762..1044028,1044082..1044502,
                     1044579..1044581))
                     /locus_tag="CNC03300"
                     /codon_start=1
                     /product="protein kinase C, putative"
                     /protein_id="XP_024514287.1"
                     /db_xref="GeneID:3256744"
                     /translation="MASNDPKAKVILQSIATEKRNIEGARAVIRAFEASSKNETVIQQ
                     AQNEIRTATMSIKFLEDELAKLQVGGSGGASGTPGRGEPSGGTGAGVPGKQGPQGVVA
                     SSPGGRGMAGDRERPLPPPPPGAEQDSAKKPETKNYSQLDLLRYDAPLTGAKITRMLN
                     QLQFKLQVEEQYKTGIEKMAQAYRAEGDKRLKSETDAKKSESEGKIQLLRKAKKRYES
                     LAKFGGAVEDDEDLMSDGKRKEALRKPISGKLVISLRSARDLNHRALPRRSSKTYSET
                     TVVIKVEGNERAVSHPSRNDKWHEDFHIPVEKANEVEITIYDTVAPGDSAPIGMLWLR
                     VSDLVEALRRQKVGIEGQGAGWVTAATAATMGPRSSGNAPDSVTLHSAGTLRGKPDAE
                     GKGPDGIDGWWSVEPAGAISLRMDFVKDTVAGARRPYEALGRQGAVRMRKGDVYEMNG
                     HKFVQRQFYQPIMCALCQEFLLTGEGYQCEDCRYACHKKCYPKVVTKCISKSNADGEG
                     DEEKINHRIPHRFTPYTNMSANWCCHCGYMLPFGRKNAVKCSECALTCHQTCSHLVPD
                     FCGMTMEMANLLLKNLRDIKTTQHRKPVPSTSTSSNQRPIQPQVQNQQTGAYDNLRPA
                     GGRAMPQLPPVAVPSNKISFEGDRLQEPHGQIPPVMPAAQPQPQTLPPSAQSVQSPVK
                     PQYVPQPAVQQQVAQRLPPQQPLMARKRKVGLDDFNFLAVLGKGNFGKVMLAEEKTSS
                     NLYAIKVLKKEFIIENDEVESTQSEKRVFLAAAQERHPFLLGLHSCFQTETRVYFVME
                     YISGGDLMLHIQKKQFTLRQAKFYACEVLLALQYFHSKGIIYRDLKLDNILLTLDGHV
                     KVADYGLCKEEMWFGKTTSTFCGTPEFMAPEILLEQRYGRAVDWWAFGVLTYEMLLGQ
                     SPFRGEDEDEIFDAILEDEPLYPITMPRDAVSLLQRLLTRDPTRRLGAGEGDAEEIKQ
                     HLFFRDVNFDDVYHKRIPPPYFPVIGNATDTSNFDQEFTREQPTLTPVHTQLSEADQK
                     EFAGFSWIAPWAAAQT"
     CDS             complement(join(1040783..1040812,1040867..1041127,
                     1041181..1041369,1041423..1041801,1041851..1042601,
                     1042654..1042786,1042833..1043098,1043145..1043705,
                     1043762..1044028,1044082..1044502,1044579..1044581))
                     /locus_tag="CNC03300"
                     /codon_start=1
                     /product="protein kinase C, putative"
                     /protein_id="XP_569656.1"
                     /db_xref="GeneID:3256744"
                     /translation="MASNDPKAKVILQSIATEKRNIEGARAVIRAFEASSKNETVIQQ
                     AQNEIRTATMSIKFLEDELAKLQVGGSGGASGTPGRGEPSGGTGAGVPGKQGPQGVVA
                     SSPGGRGMAGDRERPLPPPPPGAEQDSAKKPETKNYSQLDLLRYDAPLTGAKITRMLN
                     QLQFKLQVEEQYKTGIEKMAQAYRAEGDKRLKSETDAKKSESEGKIQLLRKAKKRYES
                     LAKFGGAVEDDEDLMSDGKRKEALRKPISGKLVISLRSARDLNHRALPRRSSKTYSET
                     TVVIKVEGNERAVSHPSRNDKWHEDFHIPVEKANEVEITIYDTVAPGDSAPIGMLWLR
                     VSDLVEALRRQKVGIEGQGAGWVTAATAATMGPRSSGNAPDSVTLHSAGTLRGKPDAE
                     GKGPDGIDGWWSVEPAGAISLRMDFVKDTVAGARRPYEALGRQGAVRMRKGDVYEMNG
                     HKFVQRQFYQPIMCALCQEFLLTGEGYQCEDCRYACHKKCYPKVVTKCISKSNADGEG
                     DEEKINHRIPHRFTPYTNMSANWCCHCGYMLPFGRKNAVKCSECALTCHQTCSHLVPD
                     FCGMTMEMANLLLKNLRDIKTTQHRKPVPSTSTSSSVSTLPSYHSQESRSHPVQSAAP
                     QQPAPSSRPPAGALPSTDQRPIQPQVQNQQTGAYDNLRPAGGRAMPQLPPVAVPSNKI
                     SFEGDRLQEPHGQIPPVMPAAQPQPQTLPPSAQSVQSPVKPQYVPQPAVQQQVAQRLP
                     PQQPLMARKRKVGLDDFNFLAVLGKGNFGKVMLAEEKTSSNLYAIKVLKKEFIIENDE
                     VESTQSEKRVFLAAAQERHPFLLGLHSCFQTETRVYFVMEYISGGDLMLHIQKKQFTL
                     RQAKFYACEVLLALQYFHSKGIIYRDLKLDNILLTLDGHVKVADYGLCKEEMWFGKTT
                     STFCGTPEFMAPEILLEQRYGRAVDWWAFGVLTYEMLLGQSPFRGEDEDEIFDAILED
                     EPLYPITMPRDAVSLLQRLLTRDPTRRLGAGEGDAEEIKQHLFFRDVNFDDVYHKRIP
                     PPYFPVIGNATDTSNFDQEFTREQPTLTPVHTQLSEADQKEFAGFSWIAPWAAAQT"
     gene            1046969..1050134
                     /locus_tag="CNC03310"
                     /db_xref="GeneID:3256153"
     mRNA            join(1046969..1047232,1047288..1047345,1047405..1047431,
                     1047489..1047507,1047562..1047609,1047669..1047925,
                     1047976..1048034,1048091..1048193,1048256..1048603,
                     1048655..1048718,1048771..1049042,1049091..1049249,
                     1049311..1049631,1049688..1049764,1049819..1050134)
                     /locus_tag="CNC03310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656765.1"
                     /db_xref="GeneID:3256153"
     CDS             join(1047066..1047232,1047288..1047345,1047405..1047431,
                     1047489..1047507,1047562..1047609,1047669..1047925,
                     1047976..1048034,1048091..1048193,1048256..1048603,
                     1048655..1048718,1048771..1049042,1049091..1049249,
                     1049311..1049487)
                     /locus_tag="CNC03310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512435.1"
                     /db_xref="GeneID:3256153"
                     /translation="MFLSRLAARQTRVQSYLPRQIAYRSFSSTIAIGMSMNDDILTKA
                     VLPDNELKNGEKKAVDFGEGKVLLSKINGRVYATSAFCTHYGAPLEKGVLSHDGRLVC
                     PWHGACFNVCSGDVEDAPGLDSLWSFSANVKNGQIEVTASKKEVTSKVGRIVARKRTK
                     DQMQNQGQVSEETVVIVGGGSGGIHTLESLRMNGFGGKIVLISAENYAPIDRTKMSKS
                     LLDDVEKLQWRTPDELRDSFGVDFHPGTTVTKVDFEAQTVTDSSGVLYKYNHLVLSPG
                     GRPKKIPIPGADLKGVVTLRHVEDTKTITSSITKDSDVVLIGTSFISMEASVAVLKKG
                     PKSVTLVGMDDVPFQGLLGKEFGSALMESMKEQGIKFRMSAQIEKITASDSNPDHAGM
                     LHVKGSDPIPANLIIMGTGVSPATSFLEGSVKLEEDGGVLVDEYLHLKGYKNVYAIGD
                     IAHYIQYPDKFPRRVEHWNVASNHGREVGHNITHPDNPVIYTKVPIFWSSIGKGLRYL
                     GTGAGYDDMYVDGNFKELKFAAYQAKGGKVTAVATMQRDPIVSKASELMRLDLMPPLE
                     EIKKGKDILQIELINKGQK"
     gene            complement(1050072..1053110)
                     /locus_tag="CNC03320"
                     /db_xref="GeneID:3256789"
     mRNA            complement(join(1050072..1050541,1050613..1051010,
                     1051063..1051202,1051258..1052282,1052340..1052455,
                     1052520..1052531,1052591..1053110))
                     /locus_tag="CNC03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656766.1"
                     /db_xref="GeneID:3256789"
     CDS             complement(join(1050297..1050541,1050613..1051010,
                     1051063..1051202,1051258..1052282,1052340..1052455,
                     1052520..1052531,1052591..1052730))
                     /locus_tag="CNC03320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512595.1"
                     /db_xref="GeneID:3256789"
                     /translation="MADTGLLEAYAEPMLGPEDELDREYRKSPRKKPRITLPRGHACV
                     ACRQRKLKCQEGIRPCITCVKANIDCRDEEIPRKKPRHVVLEERVAELEGLLGLQKGQ
                     PVPRKSNPSSTTFSGYSASPSPSEHFFSEYPQVSSSHTVNPYLDHPPLSVTGRPTASS
                     QIEIPPGSAIELSLIQFILPYTPYLLLPLHPQRFLASLSLPPEDNSRPHPALLYTLFS
                     HAVSHLERGIPPPYPPDKPMGLFPSSPPPPFPIPTLSTGFILSHLRGTSGPLLARARL
                     ELDQGIRGVDRLFDLTRAAIGIAHALYRRGNFVEGWTMPVANLVVACGLHRISGNCVP
                     PPTSSKGIQGLPQPYAHPDYYLHAHTPSQVIPDRQELRMRPVLIPPARDEIEIAERVM
                     TFWASKHQMWISSGGWGWSDPLSDAECTTEWPWGWGHVELRAVLPLERYTLNDIHDPD
                     SNIHTGAYADTTHTLAMKSMALLCRAGRLFDLPKITHPTSLSNEGSFPFFPHIPPIED
                     VESVEICLALFRQHIPLPFIFPPPVSTANGPAMASAPLDTEIYDGPSDPWWILFHFNL
                     YAAEMLMWREMAFHRPESSGAALQCARALVNLTRSIPDEKWANVDMMVAFSISLAARL
                     LVKEAARFQASGALTAAAHALADADILQNCLDGPFNRYMEVAGGMFSRIVDNVREGRT
                     EKNGEYERV"
     gene            complement(1054351..1059302)
                     /locus_tag="CNC03330"
                     /db_xref="GeneID:3256643"
     mRNA            complement(join(1054351..1054486,1054534..1054845,
                     1054895..1055537,1055592..1055682,1055736..1058500,
                     1058562..1058900,1058972..1059302))
                     /locus_tag="CNC03330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569992.2"
                     /db_xref="GeneID:3256643"
     CDS             complement(join(1054441..1054486,1054534..1054845,
                     1054895..1055537,1055592..1055682,1055736..1058500,
                     1058562..1058900,1058972..1059185))
                     /locus_tag="CNC03330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569992.1"
                     /db_xref="GeneID:3256643"
                     /translation="MTQKQSFADFLASGSPYGGKNRGRGSSSRGRGGGGRGGFYGNAS
                     KKAYNADYSNVPFDYDRINSQHYKKLEPASVAPYGNRDINRFHNGPDKNVSSSSYHVP
                     RLAHTPGTATPNKIHGLGFQTSSQLSQSDSVHPSVEMTKNKTASESSRGLSGSRWGGG
                     LAPLFIKAGELFKDGEVDVITQEEDKGIDVGHYYKPEASETRMADTESQANTQLLQAE
                     DGDNTSDAVIDGKSEQLKVDSQSGSSLPPTAGDDSNIFQVVQYTGELSIGPSIGNSHQ
                     DPVEGGYSRNGGIMGIPVPNEHQFTGSNTFTKTCPDIMSSFDRHEHVDGLVSEADLQP
                     HQEDTLFFIDTNPDPDSTPSQTPQYNTVAAPPIGSSSPDSDEEDIVFVPRAYNQQKAI
                     GPHVSSLHQRHGMRCLGQGSSKYQSYIEIVDDLNAQPLLDSTRQIQNFVEDANPNPQP
                     PSVPASLRTEELPDSISGYINAPAASYTDEKMVKHQKKRANKNAKRLARRAAARGVPR
                     DDSDIEWGSDGPPNLAGGEQDQMSVDDLIGGGKGKESEAILRDYLEGVKLSQKADEDE
                     DKYEDDDDMAALSKWANRINVLGKEVDSDEDSDEESSPPSVQASASKIYHGPEDRRDE
                     LRQDEKDDDELRELETLHNFANRINALDEGQNLSEGEEITLVQPQAPKISLKLQEKRR
                     EQHEKLEHGDGDVMDEELMELEALQEFADRINGQGIENESSGDDMGEIQMQKIQSPPK
                     ARVKQVKFSSYNQEITHAQWEADEEKLALDKWALSINTFGGDDYGDDDDDENMGVLLP
                     TQQDNKLQPRFMECFEPDSEQDEEDAELDALDAWISRVNSHSQGQDLSDDELDTAYTS
                     SKPKLKKPALPKMRQRQSSPSSQPSLNQQSKHMSPEELSQPTELGDNEGWPISEAEAT
                     EDNPWAFDPKEAEKDNPWAAKDPKEEHNLRSGEVVYEEQNFTQSTSLHADISSDSPPE
                     QPDVVVFSTSEERLAEQRRESEGGDWSNGKIASKVFNEVYSEEEDLEAEGDDSSSSST
                     GKWKKYEAKQEEGMFNGVNHWSDDDESEDDSDEGRDEISGENDGDSDSHYESEEDEED
                     DMEVDDYDQTEWFINAMEDALGGKEINFNDPRAKMFNAIKEDSYEFSSAPAKKGKKNK
                     QLKGIPMELQVQWEKDRQTKAEKKRQRELARHAEEFDSTIISGSSRNGKNKRYSKKGG
                     QSKDSKQIYQASVAHLISGSAADVADMFSEEEGLSDSEHEEYFGHSDRYETIGNDPFN
                     LSLKPKNARFSMGFKKNKKRGLEKKTVAGPEWKTLDWVDDLIQAFLKDKKSESMSLPA
                     MDKEGRKKIHMLAECYGVGSTSRGSGKKKSISLYKTKRSGVDVKEEKRERLLTAAPFS
                     GSMFHKTLYTKSSHGGVKSKGRDWASGATAKPREGELVGYGADKIGIDNVGHKLLSKM
                     GWAEGNKIGIGSGSGIDAPIVAVVKNTKSGLGA"
     gene            complement(1059661..1065320)
                     /locus_tag="CNC03340"
                     /db_xref="GeneID:3256127"
     mRNA            complement(join(1059661..1060395,1060449..1060916,
                     1060968..1061692,1061748..1062157,1062210..1062424,
                     1062477..1062756,1062806..1062846,1062903..1063043,
                     1063102..1063194,1063247..1063444,1063502..1063561,
                     1063610..1063681,1063726..1064981,1065110..1065320))
                     /locus_tag="CNC03340"
                     /product="protein-histidine kinase, putative"
                     /transcript_id="XM_024656767.1"
                     /db_xref="GeneID:3256127"
     CDS             complement(join(1060108..1060395,1060449..1060916,
                     1060968..1061692,1061748..1062157,1062210..1062424,
                     1062477..1062756,1062806..1062846,1062903..1063043,
                     1063102..1063194,1063247..1063444,1063502..1063561,
                     1063610..1063681,1063726..1064886))
                     /locus_tag="CNC03340"
                     /codon_start=1
                     /product="protein-histidine kinase, putative"
                     /protein_id="XP_024512436.1"
                     /db_xref="GeneID:3256127"
                     /translation="MSLPDAYPPVIATEGSTAFQSHILSLLSVISQHPSPDYPFPSSG
                     DSTLQDNASVTAKKNATLSTFPGKKTPAEDAIERAIIALGDRVWTSERTQAHLVKDVK
                     RDVPAQPGSDLLTPDWTPPVPTLNDSSPDPVCPTCTRPVSSSETSSFTPQQIASFYHP
                     FTAALSTPPPPLPEQMFFPQSVLAAYVSATSDSESAGDSGMSAEKELELLKAQVQDIA
                     RVCKAVATGDLTQKIIVPVKGQTMTELKNIINAMVDRLQTFAVEVERVSLEVGTEGKL
                     GGQAVVPNVEGTWKVLTAVVNKLAANLTNQVRSIAKVTKAVAKGDLSETIDVEASGEI
                     AELKTTVNGMVMSLRTLADEVSRVSLEVGSQGKLGGQANVPDVEGVWKDLTVNVNRMC
                     ESLTTQVRSIGSVTTAVARGDLSKMIEIEAEGEMAVLKNTVNSMVRQLTVFAKEVTRV
                     ALEVGTHGQLGGQAVVPGVEGVWDDLTTNVNKMARNLTDQVREIAMVTKAVARGDLSK
                     TVNADVQGEILDLKCTVNEMVAQLTVFAAEVTRVSLEVGTEGKLGGQAVVPNVEGTWM
                     VLTDNVNLMALNLTTQVRSVAEVTTAVAAGDLSKKINVAAFGEILELKNTVNNMVDSL
                     RSFSSEVTRVAREVGTDGRLGGQAKVPGVAGTWKDLTDCVNIMAANLTEQVRTIAHAT
                     TAVARGDLTQKVVGVKVSGEILDLVNTINNMIDQLAIFAAEVTRVAREVGTEGKLGVQ
                     AEVENIEGTWQEITSNVNTMASNLTSQVRAFAQISAAATDGDFTRFITVEASGEMDSL
                     KTKINQMVYNLRESIEKNTKARQEAEMANRSKSEFLANMSHEIRTPMNGIIGMTVLTL
                     ESELTRQQRENLMIVSSLAGSLLTIIDDILDISKIEAGRMTMEQIPFSLRVAVFSVLK
                     TLCVKAAQNKLDLIFDVDPTMPDQLIGDPLRLRQVITNLIGNAVKFTTKGQVALSCRV
                     KRYVTVADAVELEFCVADTGIGIKQDKLDVIFDTFAQADGSTTRKYGGTGLGLTISKR
                     LVNLMSGDLWVESEYGQGSRFYFTTVAEMTSVPRDQIIERLSPWSGRSVLFIDTLGDQ
                     TGIVEMLQELGLKPIVIHSVNDVYLLQDQGLTVFDTMIVDSLKAAGELRGIEYLRYIP
                     IVLLAPSNKPSGPSNPSFISLPESRRRLLALPSASEQLLSPIPVKDCLEMGINTYYTT
                     PLSLQELSNAIVPALESHQIQPGDTVKDTILSVLLAEDNLVNQKLAVKLMEVAGHKIE
                     VADNGEIALEKYKRRQLARTPFDVILMDVSMPVMGGMEATGLIREFEANEGVPRTPII
                     ALTAHAMIGDKERCLAAGMDEYVTKPLRRGDLLASIAKVLAPKQSASGLEMPAVPIPA
                     NIYGR"
     gene            1066137..1068316
                     /locus_tag="CNC03350"
                     /db_xref="GeneID:3256530"
     mRNA            join(1066137..1067029,1067090..1067126,1067180..1067500,
                     1067557..1067952,1068016..1068316)
                     /locus_tag="CNC03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656768.1"
                     /db_xref="GeneID:3256530"
     gene            complement(1066172..1070039)
                     /locus_tag="CNC03360"
                     /db_xref="GeneID:3256570"
     mRNA            complement(join(1066172..1068752,1068798..1069007,
                     1069059..1069429,1069482..1069777,1069847..1070039))
                     /locus_tag="CNC03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_569664.2"
                     /db_xref="GeneID:3256570"
     CDS             join(1066828..1067029,1067090..1067126,1067180..1067500,
                     1067557..1067952,1068016..1068070)
                     /locus_tag="CNC03350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512437.1"
                     /db_xref="GeneID:3256530"
                     /translation="MITLKKTFNHPLISQPFLSLGLTSLALLLLVLVLLSVPGPIKGM
                     YWFSVEGHGITDGPLSAGVLGWCLQGTSNCTYAPLSENAYLSTLINTGEALTVRIMLP
                     LACYWMIVVMVLWVLLTVLVPFGYRIRDLDSITRHLRFAIVEACVLCVSLFGNVLCWL
                     AFGLGRSAYLSVQNGGGDPKSGRAMETTAVAALLSLLSLGTAIRGLDLRLRGAQTHWR
                     EEAVMVRRRSMALLASGAARPEDAATLGVTGDFWERKDSQRWSTNSSDVPSYTANNGA
                     LQHRDNELKTGYRPDIERGEEEEIDVKLEEAKRNSVDQIRRTSIHDSPYDVANGTVPP
                     PN"
     CDS             complement(join(1068401..1068752,1068798..1069007,
                     1069059..1069429,1069482..1069777,1069847..1069952))
                     /locus_tag="CNC03360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569664.1"
                     /db_xref="GeneID:3256570"
                     /translation="MFYATAGQQATQQPPTSRIAGYPRNGPPGFSVRSSDPNDFPALG
                     SHNQHNSSYIAQNQGGQSSANASHQNSQLQQQQHLYMQQQQQQQQQQLGVTPAPPPGI
                     SGPTASAPSQSNGGLTEEFPALGASSESKDGRMANFFRNPSSVHQPIPSSPSPLPNGT
                     SNASASQSADATPSTNPPHPQSGIGGPASTTDSWQRQSPRHTEPVVRPVQQILSSPVD
                     RWGLKALLFEIQMHMNKTDRGMMVFGEDLEELGVDINSEEALYPTFVTPWAEPNSLPP
                     PQIEESFHIPQCYYVHAPPVESKLQNFAEDTLFLAFYMSPQDVLQLRVAEELYARGWR
                     YHTELQTWLTSPTLASIDLSKADRSSGQPNWIRGPFAYLDTRTWVRQRTAEDFTIDAN
                     VLELTKLADDVIREEAARKEAQKSPGGVPVNGQNQAQSQGQQNQGQALSYQR"
     gene            1070186..1071486
                     /locus_tag="CNC03370"
                     /db_xref="GeneID:3256743"
     mRNA            join(1070186..1070209,1070265..1070307,1070367..1070412,
                     1070461..1070584,1070637..1070902,1070962..1071486)
                     /locus_tag="CNC03370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656769.1"
                     /db_xref="GeneID:3256743"
     CDS             join(1070207..1070209,1070265..1070307,1070367..1070412,
                     1070461..1070584,1070637..1070684)
                     /locus_tag="CNC03370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512593.1"
                     /db_xref="GeneID:3256743"
                     /translation="MSSELRYTANTQLEQLHARYTGTGHADTTKYEWLTHQHRDTLAS
                     IVGHPPLLAYLSVADGECQARERFEVTEKMLQPCGKPPGKTEE"
     STS             1070640..1071396
                     /locus_tag="CNC03370"
                     /standard_name="Pst3"
                     /db_xref="UniSTS:470764"
     gene            complement(1071353..1074984)
                     /locus_tag="CNC03380"
                     /db_xref="GeneID:3256635"
     mRNA            complement(join(1071353..1072264,1072327..1073537,
                     1073588..1073977,1074035..1074408,1074708..1074984))
                     /locus_tag="CNC03380"
                     /product="expressed protein"
                     /transcript_id="XM_569666.1"
                     /db_xref="GeneID:3256635"
     CDS             complement(join(1071841..1072264,1072327..1073537,
                     1073588..1073977,1074035..1074408,1074708..1074840))
                     /locus_tag="CNC03380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569666.1"
                     /db_xref="GeneID:3256635"
                     /translation="MAHYQQAPYSDSAGYGNSYGGPTPNYGGYSDNPRGAAGGDYGNN
                     SYLMSSANPNAAAGSGGYAGSAGGFQPKKKRNKWLWIGLPVLLICIILAAVLGGVLGS
                     RASSDNNDSSTSSDDSSSATTGASNANTALPSGVSSANTAATNTGANGEQYLAVATDT
                     YMLPVYATGTATSGYSAPTVISDPASTDSWPDDPSPPSNSTEGMRAHPRLAPGYKWDA
                     LTHGGLIQNNPYLKYWNATIVQNASDTIGDDPTPYIPDGGLDGSGVLDVAREIKLKVK
                     NWAYAYKVTNETKYADRVWLELTTAAGNNSDVSFGADGTRWNPAHFLDLAEFCAAFAI
                     GYDWLYDFWTDDQRDALMWSMLNLGLSFGHAVLSGNTSASSYNWWAGTGVGSSEVNGN
                     WNCVCNGGLIQAAVAIVDRDPTGIAQQVIDLAVPDAWNNCFQGAYSDGTWAETANYWY
                     FGTTGAAELVNALQSSYGDDRGLPESNPGWNLTSLFHIYVQGMTSLFNYGDHGPNKYS
                     STANSLLLWANTFNEPRYALYQRDHYDASEPWSMFWYNPALSGTWWDGLPLDRYFDDE
                     NGRWATARSNWATNEGSYWAMKASKLTDHQTHGDLDIGDFVFDAMGQRWAGELGSGQY
                     LADGYFSSEEQNSERWLYYRKRTEGQNTLLINDQNQNVNATPTGNWGSSGTAQGAAPS
                     FQLESDDTAYFWTDMSTAYNYTVKRGIRYLNARQQVLIQDDVTDVPNLQWRMHTNATI
                     TTNNATATLTLSEQTLIASIVQGPSGASFSTAEPTRSSSDPALPTGTMDADQPNDGVT
                     VLVVDVPNGGTFSLQVLLTPQWGSNFTAIDSVNNVALDDWSLTSH"
     gene            1075256..1076443
                     /locus_tag="CNC03390"
                     /db_xref="GeneID:3256680"
     mRNA            join(1075256..1075578,1075635..1075969,1076023..1076078,
                     1076125..1076443)
                     /locus_tag="CNC03390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569668.2"
                     /db_xref="GeneID:3256680"
     CDS             join(1075354..1075578,1075635..1075969,1076023..1076078,
                     1076125..1076324)
                     /locus_tag="CNC03390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569668.2"
                     /db_xref="GeneID:3256680"
                     /translation="MPPINPAVLSNVSGYMSIALWVVVYSPQMWENYQLKSGEGLSVP
                     FIILWLLGDITNLFGGMMAHLLPTVIILAVYYTICDLVLLFQVYYYRRFPSPSAHQHI
                     TSDESTPLLPEPRQPKPLLPPLIEYPVLLGFVLLAGAGAWFLTDRDEVHVPEDPEVTI
                     EWKSQALGWASAVLYLGSRIPQIVHNYKTRCAGLSLAMFFFAISGNITYVLSILLKSL
                     NPRWILANAPWLAGSGLTVFLDLFVLAQFAIFSWQDERRKKTSGEVDNEEEDG"
     gene            1076626..1079215
                     /locus_tag="CNC03400"
                     /db_xref="GeneID:3256728"
     mRNA            join(1076626..1076937,1077097..1078517,1078567..1079215)
                     /locus_tag="CNC03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656770.1"
                     /db_xref="GeneID:3256728"
     CDS             join(1076796..1076937,1077097..1078517,1078567..1079133)
                     /locus_tag="CNC03400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512440.1"
                     /db_xref="GeneID:3256728"
                     /translation="MLAAESLRPVYQHAATSHANIGPSSSFSSMDNIASGWNGQIMPA
                     LKKRLETESAYLTHRLSAAQSDKRPTSSGFGDPAEEGATFSEHSRESLFPEYNTQVNV
                     LPEMAGRTGLPSRPQSQSSPKSRARSGTMVSPNEVRKIYLDRPPVPITSPTSLSEISG
                     LQLSPVASKSTSSGDGSPVIPPPSRIPIRASSKSRGGSDPYSFLRSDGPRSMLGLSFS
                     STIPATAGRMSRSPQLQREVSIAHVKELAEGPSAKKSRGQFSGELKQRDFGEDSPTLD
                     AAQITEGFIKNELPPFIMSPEEALRIAERGHNLESDDDAQMQDWQHLELDPYAASGPS
                     QEIGLAEGKREKRKRATTMKTSGRNRHVAARSVNKDCQPDFGLPVFENPSLKASKSRI
                     QTGSTPSATATSYPISQTSRSVSMKAFSSTPRTLHPYNTLPNSSSRLGVAAHLIPPAS
                     TYTPPKGANWDEVVLPAVAKKLGIGEARTADKIDTGPDAEDLAVEWDKNGTPIKWVKK
                     KMEDRTSLDKQTDLETKSPNSKLMELPFNPILEPLPDSPFCQSNYGAQHPDTIGLGPQ
                     REAPGLHIIPPPLSKTISQTSINLKPSFLRKTSMQDVTKPSSQRSLQAQRCDDEESEP
                     FVGNDLVPGQSHWGVPPVQPSAPGTTHRITGAVYEKRMNKQRGVASVQANLLGVGNVQ
                     SGKAVDSKPNKKAKQDGHSKGCGCAIM"
     STS             1078467..1079847
                     /standard_name="ha3373"
                     /db_xref="UniSTS:515697"
     gene            complement(1079176..1080723)
                     /locus_tag="CNC03410"
                     /db_xref="GeneID:3256319"
     mRNA            complement(join(1079176..1080353,1080415..1080508,
                     1080574..1080643,1080681..1080723))
                     /locus_tag="CNC03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656771.1"
                     /db_xref="GeneID:3256319"
     CDS             complement(join(1079628..1080353,1080415..1080508,
                     1080574..1080643,1080681..1080690))
                     /locus_tag="CNC03410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512442.1"
                     /db_xref="GeneID:3256319"
                     /translation="MSTYYRRFGRFASASTSESHQRQLGAPVSKWKREWVAPEGLPAE
                     SSYKIFKWVRTDVKAQFSGIDEPSEAADYTPAPEGHGEDEGEVLEEDDEGVQEIDDEG
                     EAEDGENKPLELERSSPQSRAGSDGRSKSQRKPTGSPEAQLTPQSVQLPPDSSHASPK
                     HAEDIHEASEAPSESVLEHNVSQREESFAGPSATTDEVSHDAPIPPHHQIPVNAVEVA
                     NIPPNENEVGKGSLGEAGRSGIEVRQAEHSDSAGTLMGEEKMDVDGPVAKEDEGLVHG
                     EMEPPVPELAVEGVDEPVEVEQE"
     gene            1080929..1082048
                     /locus_tag="CNC03420"
                     /db_xref="GeneID:3256723"
     mRNA            join(1080929..1081020,1081247..1081296,1081359..1081784,
                     1081839..1082048)
                     /locus_tag="CNC03420"
                     /product="elongation factor 1-beta (ef-1-beta), putative"
                     /transcript_id="XM_569674.2"
                     /db_xref="GeneID:3256723"
     CDS             join(1080956..1081020,1081247..1081296,1081359..1081784,
                     1081839..1081969)
                     /locus_tag="CNC03420"
                     /codon_start=1
                     /product="elongation factor 1-beta (ef-1-beta), putative"
                     /protein_id="XP_569674.1"
                     /db_xref="GeneID:3256723"
                     /translation="MASTIDLKQLEQHLATRSYIDGFKPTTADVEIYKSLGSAPEATF
                     PHCHRWYIHIASFADEFDSLPAGANPLSSTSAGAAAAAGEEEDDEVDLFGSDDEEADE
                     EAERIKAERIAKYNEAKEAKKQEKLAAGKTLEVAKSVVTLQVKPWDDETDMQALEDGV
                     RAIEKDGLVWGASKLVPVGYGIKMLQINLVIEDAKISLDELQEEIAELEDYVQSSDVA
                     AMQKL"
     gene            complement(1082052..1084158)
                     /locus_tag="CNC03430"
                     /db_xref="GeneID:3256667"
     mRNA            complement(join(1082052..1082714,1082763..1083148,
                     1083214..1083441,1083510..1083683,1083735..1083873,
                     1083924..1084158))
                     /locus_tag="CNC03430"
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /transcript_id="XM_569991.2"
                     /db_xref="GeneID:3256667"
     CDS             complement(join(1082097..1082714,1082763..1083148,
                     1083214..1083441,1083510..1083683,1083735..1083873,
                     1083924..1084124))
                     /locus_tag="CNC03430"
                     /codon_start=1
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /protein_id="XP_569991.1"
                     /db_xref="GeneID:3256667"
                     /translation="MAQAPPMSPSLSPTRTRCLNIVLCLLPFLVTFAHVFLSPYTKVE
                     ESFTLHAVHDVLAYGFNPHNLQLWDHVTFPGAVPRSFIPPALLGILAYPFSVVSVASG
                     AIKTKFGVQILIRLVLASFFSYSFNKLACSLQKAFNVSVRVWFTLLSLSSFHIPYYAG
                     RTLPNFMALPGVLWSISHIMTAQIATSEADRIASLRKAVIALTALATIVRLELALFVI
                     PLALSLLINRQVGFGQVLKWGILGGVGSLSISSAVDYHLWLPTLSHPSFPFKSHFQLF
                     WPELSGLIYNAVEGHSAEWGVMPWHYYLSGSLPKLLAGNSLLVGIATGGWLLDKMGLD
                     MMAKKAGGWDRLTGVRGVNKVMKVWALSVVTVIGALSFLGHKEWRFILPVLPILHIIS
                     ALSASSLWSLRPSKLRNLMRLFVLVALGLNSLATIATTFLSVGNYPGGEVWKVMEDIP
                     GLQRQNASIYFPSYPLQTGATLFTFVHAHSVNGTGRGLGPWSAFPETKEPRWIYNKSE
                     DKMMENPIRVWESGIDFVVTGDYDQFLALPDKWVEVASVEGLDSVGRAPGTYRVQAKW
                     DRKLAVLQRRENIQR"
     gene            complement(1084526..1089593)
                     /locus_tag="CNC03440"
                     /db_xref="GeneID:3256645"
     mRNA            complement(join(1084526..1084641,1084708..1085972,
                     1086039..1086299,1086355..1086418,1086477..1086569,
                     1086626..1087314,1087369..1088383,1088430..1088598,
                     1088645..1089593))
                     /locus_tag="CNC03440"
                     /product="expressed protein"
                     /transcript_id="XM_024656772.1"
                     /db_xref="GeneID:3256645"
     CDS             complement(join(1085700..1085972,1086039..1086299,
                     1086355..1086418,1086477..1086569,1086626..1087314,
                     1087369..1088383,1088430..1088598,1088645..1089539))
                     /locus_tag="CNC03440"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512594.1"
                     /db_xref="GeneID:3256645"
                     /translation="MSNPLSPSSSRLSKPNASRTPPVKNARHSRSKSSLPQPKILPFP
                     DLSELRSSRDTSRANSPLSTPAGDRLDITFDQLIMVRGNSSDSGTHARHRSSGSGGRT
                     TPVSVSGTSTFLRPTSPPISSPLAVTSSRARAFTAPTRPPLSPASRSMLVSSSAITTS
                     RDTQDPHLASSSPPRPSTSAPSAPSVAIAPPIAPILLTPSSSGPATSTHAVDFAHGPT
                     TPVKTSHHHNHGYGRSHALNHSTSSLLSAPTTSVTPVPSFQSISEHLYKAFLSGTCAD
                     VRLVVKKWGVYYNVHKMILSQSSFFSSLFLGGFSEATATPKSSYKGKGKARVDVQAED
                     WHGESIDLQFDDPNITRAAFEICLSRLYCPFPSLHFPTTLLPTSSHPLTPSFPYITSP
                     PCYPSLQSSLLPNAQLATPRLLLSLLATSVYIGHGHLLREVLAMILRTVGPLTVNQYL
                     SFAVGDGIGDEEWEGQTAEGANGLQDIAKRISDAPESRSSAMTPMEEEDEETFETSQK
                     SSGSRLSSDSNTKIGQRDPFIQLNGVPFEPSPTSPAASARSQNNEFSFVSADMLDLPH
                     FYGTVGNKIGEACVCWLARWGMDLLRAELETPNVCYRIWAHGGLPARFVRALLSSDFF
                     FVKDEMERYEITRDVLELRRTGWQQELDGRGDLSLANPEVAEQHGWEEWEEDEKEIKL
                     VFAEGIRYCHMTFNDLSSIASNIDPQTALPYTPMSVLQAAHWSAADLRARVTAHERDG
                     NVSVESEDDKNEVGLTQTTSSIVEGLRKRRRPAPRSRVPSPASWGPSTTSLAATINSI
                     SSATEASFSPLLSHSNSVWYPVPSDETHRIGASGLLSAGSLSTANLSGVPDFGPDLVD
                     VLPQEGSKSQPPHGEKNFFGLVSGKATEEEIEEKWVNEGGAFAMSHLGLMGNGNAKED
                     KWTKIEPFRFSVEFWDVDKLGEKERYYSATHFYAGSLFNCYVQMIKRKEKGVQLGIYL
                     HRQSPNESFPTPSAPQMADRNPLMRTVTSLSTAPAPSTPAVHGQSLAPSPVIPGSPPS
                     ATTRFFPGGANQERGNALATDVPYHDTRAVTKAFFSISCASALGTALIRFTSGPDTFA
                     HSQSWGWKSSALKSEEYLSSPPAVERGENLDEGVMGWTGEVDTEGIGKGNGRSTLRAT
                     VVVGIV"
     gene            1089763..1092010
                     /locus_tag="CNC03450"
                     /db_xref="GeneID:3256406"
     mRNA            join(1089763..1090052,1090116..1090158,1090214..1090224,
                     1090282..1090297,1090352..1090432,1090484..1090495,
                     1090547..1090733,1090788..1090892,1090944..1091002,
                     1091054..1091085,1091133..1091233,1091292..1091389,
                     1091447..1091637,1091700..1091763,1091829..1092010)
                     /locus_tag="CNC03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658430.1"
                     /db_xref="GeneID:3256406"
     CDS             join(1090025..1090052,1090116..1090158,1090214..1090224,
                     1090282..1090297,1090352..1090432,1090484..1090495,
                     1090547..1090733,1090788..1090892,1090944..1091002,
                     1091054..1091085,1091133..1091233,1091292..1091389,
                     1091447..1091637,1091700..1091763,1091829..1091931)
                     /locus_tag="CNC03450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514288.1"
                     /db_xref="GeneID:3256406"
                     /translation="MASDTKMQYVRLGNSGLKVSKIILGCMSYGDPEWSEWVLKEKEA
                     IEHIKYAYEQGINTFDTADMYSCGASEEILGKAIKEIGCPRESVVILTKVYMPINHNS
                     HKRPPNMPDLDKSGYVNQYGLSRKHIFDSVQASLKRLDLEYIDVFQCHRFDYNTPIEE
                     TMQALHDVVQRGWVRYIGMSSCWAYQFHAMQNYAINNRLTPFISMQNFYNACYREEER
                     EMIPTLKMFGVGCIPWSPLGRGFLTRPWKDASSTRASSDDYFKTVGFASPEESKKRVN
                     EGVQKVADNRGISMAQVALAWNLSRDFITAPIVGTTSLDKLKDLLDAININLTDEEKK
                     LIEGPYVPQLVIPKYVNECRQVNLLTVCHLPSHDAAESLRGL"
     gene            complement(1091751..1094369)
                     /locus_tag="CNC03460"
                     /db_xref="GeneID:3256200"
     mRNA            complement(join(1091751..1092274,1092324..1092334,
                     1092393..1092486,1092551..1092661,1092710..1092758,
                     1092820..1092877,1092938..1092989,1093039..1093317,
                     1093379..1093589,1093661..1093682,1093811..1093871,
                     1093991..1094369))
                     /locus_tag="CNC03460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569676.2"
                     /db_xref="GeneID:3256200"
     CDS             complement(join(1092016..1092274,1092324..1092334,
                     1092393..1092486,1092551..1092661,1092710..1092758,
                     1092820..1092877,1092938..1092989,1093039..1093317,
                     1093379..1093589,1093661..1093682,1093811..1093871,
                     1093991..1094127))
                     /locus_tag="CNC03460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569676.1"
                     /db_xref="GeneID:3256200"
                     /translation="MFPRTKTLFTGMGAKIPSRTQRITLLERSTARGALLRGSRSMSI
                     LSNDKAIQNGDDFHALMIGGGFAMFGTPEGPWNISSRLEKRLGPRLKVDAVIEINGPR
                     AETALTEKRKSFVHEAYADTMVLPDVEEFKRRVSTGEAQEPRAIFVATPPLFRGGLGP
                     QNNLEIKLNELFPNAAIFLEKPVATGVPAEQSVGEAKAVGAMFATQHNAPVAVGYVLR
                     YLNAVREMKKIIDDNNLTVMATNARYVTAYELAIKTDWWNKSIMQGPIIEQGTHICDL
                     SRYFGGDVNIETICAHALEAHEKPGRLSKLNFDESVIPDNLRIPRATSASWKYESGAV
                     GTMLHATALHGKDYAIELEVYADGFQLILSDPFGTPALHVRKPGSDVVEVYPTPGDDP
                     FQSEIDAFIDVVEGKPNAKILSGYEDAAKTYEMTWAIRNSAEEWTRRLSQRQGRT"
     gene            complement(1095029..1098373)
                     /locus_tag="CNC03470"
                     /pseudo
                     /db_xref="GeneID:3256689"
     gene            complement(1098710..1101088)
                     /locus_tag="CNC03480"
                     /db_xref="GeneID:3256324"
     mRNA            complement(join(1098710..1099203,1099255..1099500,
                     1099548..1099675,1099732..1100668,1100720..1100802,
                     1100862..1100972,1101031..1101088))
                     /locus_tag="CNC03480"
                     /product="GTP-binding protein, putative"
                     /transcript_id="XM_569678.2"
                     /db_xref="GeneID:3256324"
     CDS             complement(join(1098799..1099203,1099255..1099500,
                     1099548..1099675,1099732..1100668,1100720..1100802,
                     1100862..1100972,1101031..1101049))
                     /locus_tag="CNC03480"
                     /codon_start=1
                     /product="GTP-binding protein, putative"
                     /protein_id="XP_569678.1"
                     /db_xref="GeneID:3256324"
                     /translation="MPRIRKKTSNRQNTRDRAKITKKAAEQKRKDRKASKKDQTWKSK
                     KKADPGVPNSFPFKDQVLAEIAEEKRKSEEGKIARREAAKAQKSTGAEDEADTPGVSS
                     LGRTVLNRVPLTATSAAVVTPTEDSDIPELIDTALPTLQEALDRADVICEVVDARDVL
                     GGRSGYIERLVKEAEGRIILIINKIDLVPREVLQSWVSQLDIPTFLFKSALPVPPTPS
                     SSRNPGPSFFLEPSVILGREQLIAAAKKWSAEKKKSRKSDEPLVLALMGLPSVGKTSI
                     LNSLLPSTANKSRHVVAPLIPSGQSAKSLQPTTKSPVEVEIDVDGLKIKVIDTPGWEP
                     VEDEKDEDEDEEEDEQIPEKWDRLEAKLSGDLLRRNLGRVDRVKDVFPLVSYIVERSN
                     HQDLMLAYNIPFFEKGDLEAFLTGLARAQQRIRKHGEPDLEGAARVLLRDWAHNNFPY
                     YSLPSSTSASKMDVDASKAIDKYDMTAILEKCRGKKEMKKESSKGMIRFKGGEIDERE
                     IILDDDYTAMMTVTSDDEEQEEIDDEEDIDDEDEDEDEDGIELASASDDEPVIIGSDE
                     GEVLELSEGKEPSESESSPEPEPRLPSPSSSKPKKRRISEASVAPAKKAKRVSFARNV
                     PDGEERNIRGGKKGKGRK"
     gene            1101292..1106583
                     /locus_tag="CNC03490"
                     /db_xref="GeneID:3256159"
     mRNA            join(1101292..1102911,1102965..1104503,1104559..1104910,
                     1104972..1105126,1105177..1105416,1105481..1106057,
                     1106114..1106583)
                     /locus_tag="CNC03490"
                     /product="leucine repeat containing protein, putative"
                     /transcript_id="XM_024656773.1"
                     /db_xref="GeneID:3256159"
     mRNA            join(1101292..1102911,1102965..1103471,1103601..1104503,
                     1104559..1104910,1104972..1105126,1105177..1105416,
                     1105481..1106057,1106114..1106583)
                     /locus_tag="CNC03490"
                     /product="leucine repeat containing protein, putative"
                     /transcript_id="XM_024658431.1"
                     /db_xref="GeneID:3256159"
     CDS             join(1101387..1102911,1102965..1104503,1104559..1104910,
                     1104972..1105126,1105177..1105416,1105481..1106057,
                     1106114..1106447)
                     /locus_tag="CNC03490"
                     /codon_start=1
                     /product="leucine repeat containing protein, putative"
                     /protein_id="XP_024512561.1"
                     /db_xref="GeneID:3256159"
                     /translation="MTASVPGWATDELLEEWPESSPSPPLAPSKLPSIPQPQVNLDSV
                     RAKRGSLRMLGQAAARPLPSSRSNSNVSVSNIGEPGRIVSGHVDGGRGHVSGTGIDVG
                     VISPPSSVSSSDGRETLPTGTFVVKDGVEDDRGAHLAKNRMGPKDKDIFSALPLERMF
                     DPPSPSVAAPVTYTPQPSSSHTVSTELSSSTTAPKTSEPPRKTSHQYAPLNPSRLSKS
                     VTPSSNDSFTTTTSSAPSIRVSSSFVGSKELEFDDSLLQNSTVSRREGDDSAISNAVA
                     IVQQNHGAQSTLAVMQEVPSQSERISSKPSIIQLQDCSNYSFTFESPRQSSYRSGDHL
                     SPMRSPFNPEAEAAVEGPSHSTLNFRSRSCQPELTSKDLSPPNPPLRLFRNTYDTYTR
                     EHLSALVDSIAVEPSPSPTGTLSVRLNDWSPSVDRSTSRSQSVSSTHFNSTLSSPSDA
                     RSSKRLRLSPASPPLQKRPLKDWGAQGREMMDRLRNVEESIDGISLSKFSGSDDQGAI
                     GGPIHSDYVNHSPSPPLNDGPIIYSAQHAEADPPRHRSNPSTSSSGYLRAAEDIMARI
                     KLRKVSESASDSPAFCNDQQVLSPFDDNRVWEEQADQYAKYAKSKGRNRTASSPRRML
                     RHLSASEEIRRVADEDSASDDEQIHDEENPSLPRWPEQRRPIDQVVQANTNGSGGQSI
                     SHLPRFTADDINRYMSSSTHATSTTASASFVKHRGPRVAHSSSAMRMIRPDEVEGVVP
                     DKIGKMRYDRIQMRWVRELGPVDEAGESRLTGSEESVDVFAGMESLPNHLEDPSGSSG
                     QMPTTHRLDESLREHEQEIQENADDEQSGVERHDTRSSVSITSHKDDNRVEDCPDLSS
                     IEPEAEAISEPVRIEEFKKRSTSLSVTSASHEGTIHIMPSAPLLMTPTPSAFARNPIR
                     SALRNAATPGDKPKKRQGWSDETTPGLIARGTTPASSGKRSVSFSDGKKTGKIIDLDV
                     EMRTTRWQTSAKEECADIFKRESTDSDRSFLPSARTRRIQGLLDDMGELTLNDETPCK
                     PSSRQIEDTDRPFSRASLTSSPDSHSTIPTRSPHVCRSSTYPSRHAGNATFLTECSFG
                     IAHDKLVEIITDIEPFNPHWDQLKMIDLRGKKADSVARLKEFLPNLDEINLDDNAIGY
                     LSGIPTTVRTLHVAGNLLTSLTAVNHLRNLQYLDISRNKLDSVAQLGCLIHLRELKVD
                     DNAICDLEGIMEMDCLIKLSCVNNKLDMLDLSAAKWSKLESLNLSNNNISIIKDLHRL
                     SSVASINLEGNRLCTLTPQIPMPSVRILRFSDNHIASFDISLFPKIRTLYADNNLLSH
                     LGRSEHSSPSRLENLSLRNQRTAPLHLTYIDLENVRRLYISGNALTEDFFPSRPLYSL
                     VYLEAAACKMSQWPQDFAINAPHLKMLNLNYNYFTDLNGVKGMNNMRKLTLVGGRLGG
                     EEAGKGDGRDVMAGLRGLRNLEELDLRMNPFTLSYYFPLLLPSSSPSSVLDPSTPTRN
                     NEDRNRMDQPLAVAPAAWSTYDTRFRKNLPDEWYSKRLVYRGLIMQNCIKMRKLDGIV
                     VEDGERKRANQLLEAALGIRK"
     CDS             join(1101387..1102911,1102965..1103471,1103601..1104503,
                     1104559..1104910,1104972..1105126,1105177..1105416,
                     1105481..1106057,1106114..1106447)
                     /locus_tag="CNC03490"
                     /codon_start=1
                     /product="leucine repeat containing protein, putative"
                     /protein_id="XP_024514289.1"
                     /db_xref="GeneID:3256159"
                     /translation="MTASVPGWATDELLEEWPESSPSPPLAPSKLPSIPQPQVNLDSV
                     RAKRGSLRMLGQAAARPLPSSRSNSNVSVSNIGEPGRIVSGHVDGGRGHVSGTGIDVG
                     VISPPSSVSSSDGRETLPTGTFVVKDGVEDDRGAHLAKNRMGPKDKDIFSALPLERMF
                     DPPSPSVAAPVTYTPQPSSSHTVSTELSSSTTAPKTSEPPRKTSHQYAPLNPSRLSKS
                     VTPSSNDSFTTTTSSAPSIRVSSSFVGSKELEFDDSLLQNSTVSRREGDDSAISNAVA
                     IVQQNHGAQSTLAVMQEVPSQSERISSKPSIIQLQDCSNYSFTFESPRQSSYRSGDHL
                     SPMRSPFNPEAEAAVEGPSHSTLNFRSRSCQPELTSKDLSPPNPPLRLFRNTYDTYTR
                     EHLSALVDSIAVEPSPSPTGTLSVRLNDWSPSVDRSTSRSQSVSSTHFNSTLSSPSDA
                     RSSKRLRLSPASPPLQKRPLKDWGAQGREMMDRLRNVEESIDGISLSKFSGSDDQGAI
                     GGPIHSDYVNHSPSPPLNDGPIIYSAQHAEADPPRHRSNPSTSSSGYLRAAEDIMARI
                     KLRKVSESASDSPAFCNDQQVLSPFDDNRVWEEQADQYAKYAKSKGRNRTASSPRRML
                     RHLSASEEIRRVADEDSASDDEQIHDEENPSLPRWPEQRRPIDQVVQANTNGSAHSSS
                     AMRMIRPDEVEGVVPDKIGKMRYDRIQMRWVRELGPVDEAGESRLTGSEESVDVFAGM
                     ESLPNHLEDPSGSSGQMPTTHRLDESLREHEQEIQENADDEQSGVERHDTRSSVSITS
                     HKDDNRVEDCPDLSSIEPEAEAISEPVRIEEFKKRSTSLSVTSASHEGTIHIMPSAPL
                     LMTPTPSAFARNPIRSALRNAATPGDKPKKRQGWSDETTPGLIARGTTPASSGKRSVS
                     FSDGKKTGKIIDLDVEMRTTRWQTSAKEECADIFKRESTDSDRSFLPSARTRRIQGLL
                     DDMGELTLNDETPCKPSSRQIEDTDRPFSRASLTSSPDSHSTIPTRSPHVCRSSTYPS
                     RHAGNATFLTECSFGIAHDKLVEIITDIEPFNPHWDQLKMIDLRGKKADSVARLKEFL
                     PNLDEINLDDNAIGYLSGIPTTVRTLHVAGNLLTSLTAVNHLRNLQYLDISRNKLDSV
                     AQLGCLIHLRELKVDDNAICDLEGIMEMDCLIKLSCVNNKLDMLDLSAAKWSKLESLN
                     LSNNNISIIKDLHRLSSVASINLEGNRLCTLTPQIPMPSVRILRFSDNHIASFDISLF
                     PKIRTLYADNNLLSHLGRSEHSSPSRLENLSLRNQRTAPLHLTYIDLENVRRLYISGN
                     ALTEDFFPSRPLYSLVYLEAAACKMSQWPQDFAINAPHLKMLNLNYNYFTDLNGVKGM
                     NNMRKLTLVGGRLGGEEAGKGDGRDVMAGLRGLRNLEELDLRMNPFTLSYYFPLLLPS
                     SSPSSVLDPSTPTRNNEDRNRMDQPLAVAPAAWSTYDTRFRKNLPDEWYSKRLVYRGL
                     IMQNCIKMRKLDGIVVEDGERKRANQLLEAALGIRK"
     gene            complement(1106521..1108325)
                     /locus_tag="CNC03500"
                     /db_xref="GeneID:3256382"
     mRNA            complement(join(1106521..1106751,1106810..1107177,
                     1107237..1107500,1107553..1108156,1108240..1108325))
                     /locus_tag="CNC03500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569680.2"
                     /db_xref="GeneID:3256382"
     CDS             complement(join(1106677..1106751,1106810..1107177,
                     1107237..1107500,1107553..1107787))
                     /locus_tag="CNC03500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569680.1"
                     /db_xref="GeneID:3256382"
                     /translation="MTLTFKLSDGKDIPFLAWGSGTGGIGKELQLAIGAGIHALKSGI
                     RHIDTAQGYDTEEATGESFRASGLKREDVWITTKISDKIPTDKEAIRKNVLASIARLQ
                     TKPDLLLIHNPFIVQDGNISQFWTYLEDLVLDGTLEGVSLGVSNFRPQDLEAILRVAR
                     IKPVANQLEYHPYVLVHLEPVLKIAAEHGILIEAFGPLTPVLRHPDGGPLKPVLERIA
                     QRISKDNGQKLDSTTVLLLWTRQKGVVAVTTSKNEQRIKGLADVEHLPDLTAEEMEEI
                     EKIGRSHHYRYYIEHMTEDFPNPDLPSVPSTREKSDH"
     gene            1109756..1113107
                     /locus_tag="CNC03510"
                     /db_xref="GeneID:3256344"
     mRNA            join(1109756..1110214,1110286..1110564,1110629..1110997,
                     1111050..1111175,1111243..1111395,1111451..1111534,
                     1111588..1111748,1111815..1111907,1111962..1112135,
                     1112190..1112336,1112392..1112450,1112507..1112594,
                     1112656..1112671,1112731..1112857,1112952..1113107)
                     /locus_tag="CNC03510"
                     /product="expressed protein"
                     /transcript_id="XM_024656774.1"
                     /db_xref="GeneID:3256344"
     CDS             join(1109930..1110214,1110286..1110564,1110629..1110997,
                     1111050..1111175,1111243..1111395,1111451..1111534,
                     1111588..1111748,1111815..1111907,1111962..1112135,
                     1112190..1112336,1112392..1112450,1112507..1112594,
                     1112656..1112671,1112731..1112857,1112952..1112998)
                     /locus_tag="CNC03510"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512445.1"
                     /db_xref="GeneID:3256344"
                     /translation="MPEHAPLSMSGQSDSIASSQQERSRAFEPSDLATANDEAPLRLN
                     PGFTQRTTVLEILNARQPPSCDACRTRKLGCSGRPSSIEITTEGLAASPCNHCREWNL
                     ECSYTYKRKRRGRKNKAVEQLAVQQKARKLSQATRPSATTQLDDQAGDARDHAESSSV
                     GYPIDHNLSTQYNSVSVVGPSSNIGTCHQRPPNLPSHVQARADRPIPWYSHPSVPSQS
                     AILGDIGLNRSTLTSDDRGTNSHIQQPAVHLSIDHHENIAEAHITPPDVGASPYHGVS
                     PSTTLSNVSLPISTNIESVLPRHLALHIISLYFEHVYCIIPVIHYPSFEKDLSAYEEL
                     RRPTFFALIMSIIAATLIHLPKSYFPIPAHKVRSLSDRCLKACCAVTKSEMDNCDVDL
                     ICIKYFLFVVHNKHGNIGLEASTFGEAQYLAVTMGLHREDTYCDLDPINAERGRRVWF
                     LIYNADKFEAVSRQKPVLLRVDEFMGPESTEFPAEVDDESITSEGILPSRTPAPLIAG
                     FNTLTRIVTVLGDILISERDLRRQQITDPENLLSALREMRKLGQRIRYISDTLPRPFQ
                     LEADQGNSLPEPGWEDAVRGELDMFFSDPLPPETAKDGYLVLKGNIHVTLAMTRLRLI
                     LLRENLLNCSGQPGTSSRNAAELVAADIGENTVNWRQSVYQDLYNVVHCLPIRALAAN
                     GPSLVTKIRVVAVTLLDTLQAQDEAIDPNIQGMTTYLLSFLDIMSSIESQFAD"
     gene            1113335..1116348
                     /locus_tag="CNC03520"
                     /db_xref="GeneID:3256322"
     mRNA            join(1113335..1113915,1113999..1114455,1114502..1114684,
                     1114751..1115633,1115684..1116348)
                     /locus_tag="CNC03520"
                     /product="expressed protein"
                     /transcript_id="XM_569990.2"
                     /db_xref="GeneID:3256322"
     CDS             join(1113397..1113915,1113999..1114455,1114502..1114684,
                     1114751..1115633,1115684..1115978)
                     /locus_tag="CNC03520"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569990.1"
                     /db_xref="GeneID:3256322"
                     /translation="MDPLPIPPSYYDLERRHLEHTIDHDLHSLSLSSLHSSTSSSSSP
                     FHPHDYSNSFISSSSDLSLEYPRAQFSGISTQPTQDVGHGHSYGPSGTPRAARGTNPH
                     SNNFGGGHSTSAGISPVSTTGHHASAITLGTGAFKGRIPKTNSGDQGDGGFDPERSLG
                     RLVGELGRIIGDEKLPKIPNSPFRPRSRSPLPSAANQTIDPSYLAHCNKHLDSRGSGG
                     KTRPKSSNVLHEQAQESGEQSRKKPLGSSTSYNISRTPVTRKTIAKDKVDRLRMLQNE
                     GKKAANASVRKNPDASADVTGMTALMATPAKGLIFDSLENNDDVGGEPAVNIPHTLAT
                     LHARLRALEMESSVSRRRVKELEAEVEKANREVDAARRNGEKKTRKSENEKSALEDLV
                     GSLRADLARITLELEQHKALIVELRQANLSNLKNGDRSFSDPSMNHEIAALRREIERL
                     TEEVCRLGCIVAEGIEVRRRTRGESTMNMEKVEMERLAKKLIEENSDFQRVKADVEKR
                     KAAVDQLKKHEAPIHVPLDSANALFTSIPEPQEAKLVMAHNRSHTSPKTPSLSHAKQH
                     DHVQPSPLASKKSSTPSTPRRHKQEREESSRSRRSKPISSSKALDRSVHSPFPSIMGE
                     DLEREFFSPLPNGIEGMNQNAEIKQVTDEMEPGKLPPQTVLARVVAELEGDFQHYKMV
                     YSELADQYKLLDPASVSAKRHVLADHLREVIDLLELKAGQISDLYDLLAFKDKPIHAN
                     RRKIDGRKAKSVDDVMRMVKASLGHEVWERLYIDLKKG"
     gene            complement(1117850..1119332)
                     /locus_tag="CNC03530"
                     /db_xref="GeneID:3256595"
     mRNA            complement(join(1117850..1118188,1118237..1118371,
                     1118418..1118592,1118644..1118717,1118782..1118815,
                     1118862..1118920,1118995..1119128,1119180..1119332))
                     /locus_tag="CNC03530"
                     /product="proteasome subunit, beta type, 7, putative"
                     /transcript_id="XM_569684.2"
                     /db_xref="GeneID:3256595"
     CDS             complement(join(1117985..1118188,1118237..1118371,
                     1118418..1118592,1118644..1118717,1118782..1118815,
                     1118862..1118920,1118995..1119128,1119180..1119276))
                     /locus_tag="CNC03530"
                     /codon_start=1
                     /product="proteasome subunit, beta type, 7, putative"
                     /protein_id="XP_569684.1"
                     /db_xref="GeneID:3256595"
                     /translation="MAKLAETPSVGFDFSNYARNQFLGQRLQGIPKATSTGTTIVGVI
                     YGGGSSGEEPGVCLGADTRATGGPIVADKNCEKIHYLAPHIRCCGAGTAADTEFVTNL
                     ISSNLELHALSQGRQARIVTAMTMLKQYLFRYQGHVGAHLVLGGVDSTGPHLFTVHAH
                     GSTDKLPYVTMGSGSLAAMAVFESSFKEHMTRQEAIDLVARAIRSGVFNDLGSGSNVD
                     VAVITKNGTEMLRNYQTPNERGLKSRNYKFRRGTTAWTKESVRSLIVTEEVKSTTGAG
                     KAQGAAEAVPVAVGAGPGGAEGMDIDG"
     gene            1119456..1121340
                     /locus_tag="CNC03540"
                     /db_xref="GeneID:3256746"
     mRNA            join(1119456..1119582,1119634..1119672,1119734..1119833,
                     1119890..1119982,1120036..1120203,1120260..1120411,
                     1120471..1120509,1120560..1120641,1120702..1121340)
                     /locus_tag="CNC03540"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569686.2"
                     /db_xref="GeneID:3256746"
     CDS             join(1119482..1119582,1119634..1119672,1119734..1119833,
                     1119890..1119982,1120036..1120203,1120260..1120411,
                     1120471..1120509,1120560..1120641,1120702..1120851)
                     /locus_tag="CNC03540"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569686.1"
                     /db_xref="GeneID:3256746"
                     /translation="MQAFRNFQAQIPALPSVDVTAVSKSFRQTVQATRERIGNVGPEG
                     ITELPAEYRQLEARVDALRDVHNKMLKITKVHERESYDYPSDVTEGISEVGHQAASAW
                     NTFANKNLKNTNLPIPIPSPTAPTPHQPKTLSHALSRAAKSGATELGAEDRLGVSLGI
                     YGAALEKIGDARISQDQVITERFVTPWQATLSTSIGLAMKARQNVKTSRLELDAARAA
                     LKSAAPAKQEQARLHVEEAEDKLVQNTETAIGLMKAVLENPEPLQNLSNLVKAQLIYY
                     STAAETLSGIQGQIEEAATVAEGDYRQSRGA"
     gene            complement(1120986..1122594)
                     /locus_tag="CNC03545"
                     /db_xref="GeneID:36392794"
     mRNA            complement(join(1120986..1122137,1122188..1122351,
                     1122402..1122594))
                     /locus_tag="CNC03545"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658432.1"
                     /db_xref="GeneID:36392794"
     CDS             complement(join(1121094..1122137,1122188..1122351,
                     1122402..1122531))
                     /locus_tag="CNC03545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514290.1"
                     /db_xref="GeneID:36392794"
                     /translation="MSRMSRISSTSATPLATSSHFNTPPPKLHVVRNPASRVRQAVRD
                     NNVSLLQRLQHKTDLRNTDENRLTSLSWAAMEGNIEVFEWLLLDYGHDDQELSRDSDN
                     NTILHLLAAVPSRSLSPHTQILNSSSSFPPRPNPRPLAEQSAISLRMTHLYVELFPFL
                     LDWSNTGGKTALHVAAQAGNAPFINFLCDLGADLDLTDLQGNTPLHYAAAWGYLDTIK
                     VLLERGCQFSSRNFEGFTASEFAYSDRVQNALQTMARELFEERRNRRKEARDRQDARE
                     NQRARSGSVSTSASMGSGAASYSSNPAKFLDNYQPNQSASQQLHPNEHTGFSPVSRSS
                     DQTSLLSGSFSSRHITSGVLSKRPSASRLGASPPLMMPEPAPPTPQLGQLLQPSYNRN
                     PVPFSTHPAMPTLSAVTRQPDSTDSKATADKGDVVVDGRSEGISMGANSAHEW"
     gene            1122709..1124201
                     /locus_tag="CNC03550"
                     /db_xref="GeneID:3256121"
     mRNA            join(1122709..1122968,1123026..1123234,1123284..1123931,
                     1123985..1124201)
                     /locus_tag="CNC03550"
                     /product="peroxisomal membrane protein pex13 (peroxin-13),
                     putative"
                     /transcript_id="XM_024656775.1"
                     /db_xref="GeneID:3256121"
     CDS             join(1122788..1122968,1123026..1123234,1123284..1123931,
                     1123985..1124032)
                     /locus_tag="CNC03550"
                     /codon_start=1
                     /product="peroxisomal membrane protein pex13 (peroxin-13),
                     putative"
                     /protein_id="XP_024512447.1"
                     /db_xref="GeneID:3256121"
                     /translation="MASIPPRPKPWESSSPVAGPSKSAASQPSAFDTAIQTSTSNSVS
                     NAPALPEKPTGLGSSAAYGGYSSSMQPYSQRYNGSYGMSPYNNMSGYGSYGGYGAMGG
                     MNRFGGGYGGYNYGMGGYGVGGMGGPGEGYPTLASSLQASTAPAFAVVESLVTAFTSL
                     AQLVESTYLATHSSFFAMVGVADQLGSLKTYLGQVLGVFSILRLGRKILSWLKGKKVK
                     TGPWGEEWDRIGSSGLPPNGQGGRPSIKPLVIFLLSALGLPYLMSRLVKVLVAHQTNQ
                     KSILSPDGTIDPTKLEFVRAKWEFTPTEEWELGLGRDEIVAVLEKRGEGMNSWWRGRT
                     RDGRTGWFPANYVEVIRRDTRSATDKR"
     gene            1124422..1126702
                     /locus_tag="CNC03555"
                     /db_xref="GeneID:36392795"
     mRNA            join(1124422..1125750,1125797..1125873,1125933..1125969,
                     1126024..1126104,1126156..1126702)
                     /locus_tag="CNC03555"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658433.1"
                     /db_xref="GeneID:36392795"
     CDS             join(1124442..1125750,1125797..1125873,1125933..1125969,
                     1126024..1126104,1126156..1126550)
                     /locus_tag="CNC03555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514291.1"
                     /db_xref="GeneID:36392795"
                     /translation="MSYPTSPYQRQLYWPDTTASPSNSRNAHRPSPYHPPTSHHRGPQ
                     YHPPTFYSPSQSSPQSKLAAQALRSRGNEYLLSLTTSVNNLQLHDGVKPSNRSSKVSD
                     HSSKTHRDTPRPSSASPDCNKQLPPLPRPDIVPPNHHNLGLPNVTASQCSFPSQTIPA
                     ADSLHSGHVSGFAVSRDGSAPAVMERPSSNTCSNVELSSSVINKPVFSKTPPHARHPP
                     VTASVKEKVVKATRVNNKEEVNPSSKSSTSKSKSLQTSKSFSTLEDAQHDLVIDLTQI
                     SDSSASPPSGLAKGNVTPPSSATPMKATSDLRRSFLTSPSFSTSPARRGSSNTPSTTP
                     SGKTKKSSSPHKPYRSNSSSVQCSGFTRTGQPCKRLVKVKAPYLSARDASVASVSLDE
                     DGGDARSEKVMGRYCKDHAGMICTIKGFYWRRERDSSGVWIEFDDYIPQALGQQTQTL
                     LRMTMETKLTPKECAGFLYAYELKDLETSELSFYKVGRTDNVPRRIGQWTNQCQSKRP
                     TLLDIFPRPSGRSRHDVTTSSLHRSDTLTTSFLPGATTHRTPPLLAMKRWERLVHLEL
                     SERCASHPLSEQAYERVRMKCKDCGTVHREIFPLVKAHQGRKGAYEQIVECIERWGKF
                     IRVISEEI"
     gene            complement(1126685..1129096)
                     /locus_tag="CNC03560"
                     /db_xref="GeneID:3256123"
     mRNA            complement(join(1126685..1127312,1127371..1127523,
                     1127582..1127989,1128042..1128461,1128511..1128780,
                     1128828..1129096))
                     /locus_tag="CNC03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_569690.2"
                     /db_xref="GeneID:3256123"
     CDS             complement(join(1126980..1127312,1127371..1127523,
                     1127582..1127989,1128042..1128461,1128511..1128780,
                     1128828..1128983))
                     /locus_tag="CNC03560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569690.2"
                     /db_xref="GeneID:3256123"
                     /translation="MGATVPGPKPKTGYCCSIDKDISAGEQVHIVDALKTTEGGTASY
                     ITYVIRLGTHTVRRRYSAFLSLHQSLTGLYPVLIIPPIPSKQSLTDYAVKGQSKARED
                     ATIIARRKRLLEDFLQRLIRHPILGGEHVLHRFLEEDVSWSEVLHSPPISLLSKNPLH
                     APSHNPTFQPTTPTSPSEAPATTSYIAHHLLPTPSPSHPLRQPDQRFMDSEAFTEKFQ
                     SHFSGTMEKVNRRVTKRWGERAHDMSELGGIWNGFSLVEQGKLGDAIEKVGRAVDAEY
                     LATAALLQSWEKTTTEPLHIYSQFATLIRARLSFRHQKHVQYELVQEALETQRDKLEI
                     LENAEREARRLEEALERGGSVLASPQLEPEAARDERERAQRRARASQGFGLLSAVKHS
                     LSGMIDMDPEATRRANIAKTRDNISQLEDSYQAAAQDLKYASMTLQADLDRFQRQKVA
                     DLREMAINLSQVHRDWCKQNLEAWKAAQAAVREIDPHPNRPAQTQTQVQSQQSHAGPS
                     TLHAQTEDDVSKLGVDAMKNEIERVEIEIADKPLPKPSLAETGGDGVVPSPQPRQEND
                     TEEQEGHGPLGPL"
     gene            1129382..1133817
                     /locus_tag="CNC03570"
                     /db_xref="GeneID:3256214"
     mRNA            join(1129382..1130096,1130735..1130768,1130827..1131516,
                     1131579..1131687,1131742..1131855,1131930..1132053,
                     1132109..1132175,1132237..1132385,1132451..1132637,
                     1132694..1132755,1132806..1133057,1133121..1133382,
                     1133445..1133817)
                     /locus_tag="CNC03570"
                     /product="AMP deaminase, putative"
                     /transcript_id="XM_024656776.1"
                     /db_xref="GeneID:3256214"
     CDS             join(1129412..1130096,1130735..1130768,1130827..1131516,
                     1131579..1131687,1131742..1131855,1131930..1132053,
                     1132109..1132175,1132237..1132385,1132451..1132637,
                     1132694..1132755,1132806..1133057,1133121..1133382,
                     1133445..1133703)
                     /locus_tag="CNC03570"
                     /codon_start=1
                     /product="AMP deaminase, putative"
                     /protein_id="XP_024512448.1"
                     /db_xref="GeneID:3256214"
                     /translation="MSHSPDDPYTSPSPSPFPSPLPIPAPTYEDHLNGAPHSHSSPSF
                     DYHEERRTHLKDEIWMSHHLPRLPPPSASEAGSSVRTDTGTSFKSRMAPGDYFDTSNP
                     TGPVRQLSPKASFNPSVLRANMSNVEKGGEAMTMREHEVDPDVNDLGTALRQATLRLD
                     KESTMLSPSGPDYGDLDPAPALVHRQEMDAQERLDLEEEKKEKELAMKAFTGENEGQT
                     KVQPQQPSGVQQGIGNELESLYASFSRCLELRDKYIELSNQRLGDNPRDHDGTFHGFN
                     PASAGDVMGLKPEYDPETVEIPAEAKDDIPTWNIYPPPPPPRWHWKTAQDGVHPEPAT
                     IEDNNKRSAPNQRDVEVFKVEDCEIPGKDEGRTFMVNDEGVFTVYVDRVNSPSVSNGQ
                     PPERQANAQISDDKQPLSRVPSLKEYFTDLDFLLGVCSDGPAKSFAFRRLKYLQSKWS
                     LYCLLNEYQELADMKAVPHRDFYNVRKVDTHIHHSASMNQKHLLRFIKSKLKKSPDEI
                     VIHRDDKDLTLKEVFESLNLTAYDLSIDMLDMHAHQEFHRFDRFNDRYNPTGSSRLRE
                     IFLKTDNLLKGKYLAELTHELITDLEQSKYQHSEWRLSIYGRNINEWDNLAKWVVNNK
                     LISHNVRWLIQVPRLYEVFKGQGLVDNFEDVVRNVFQPLFEVTQDPASHPELHIFLQR
                     VVGFDSVDDESKPERRLYRKFPTAKMWNTKQSPPYSYWIYYMYANMASLNAWRRSRSF
                     NTFVLRPHCGEAGDPDHLSSAFLTAHSISHGILLRKVPALQYLFYLKQIGLAMSPLSN
                     NALFLTYERNPFKDFFRTGLNVSLSTDDPLQFHFTASHLLEEYSCAAQIYKLTPADMC
                     ELARNSVLQSGWEMQVKKHWLGQRWYWPGAAGNDIHKTNVPTIRLAYRQATLLEELAL
                     IRHGEHSPSATPTHLKPPTTIKPDKPGLATHSSDIAAAAMAKSSGIPAAHLVGGASEL
                     DRRSLERKRAIGGTDKQAQMSDTAS"
     gene            complement(1133751..1136234)
                     /locus_tag="CNC03580"
                     /db_xref="GeneID:3256183"
     mRNA            complement(join(1133751..1134106,1134160..1134355,
                     1134411..1134732,1134793..1135203,1135272..1135495,
                     1135552..1135643,1135714..1135894,1135946..1136234))
                     /locus_tag="CNC03580"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_569692.2"
                     /db_xref="GeneID:3256183"
     CDS             complement(join(1133917..1134106,1134160..1134355,
                     1134411..1134732,1134793..1135203,1135272..1135495,
                     1135552..1135643,1135714..1135894,1135946..1136117))
                     /locus_tag="CNC03580"
                     /codon_start=1
                     /product="hexose transport-related protein, putative"
                     /protein_id="XP_569692.1"
                     /db_xref="GeneID:3256183"
                     /translation="MFFSKYRGSTGRNKPEHAHAPDRDSIPSLDDLGIQLHPDTARYV
                     TDSQALADAIGGNGLRDMFGNGLVVAAAFSTCMGGLLFGFDQGILSIVLTMPQFLEQF
                     PDVNINVSSSAAFNKGIMTALLELGAFIGALQAGFVADKYSRKKAIALGSVWFVIGAI
                     IQTTSFSFAQLVVGRFIGGLGVGLLSAVAPMYISEVAPPNIRGALLAMEGATIVIGIV
                     VMFYITYGSRFIENDWSFRLPFLIQMAPCILLGFGLWKLPYSPRWLAGAGRDADCLNA
                     LMRLRRLPSTDPRLQAEWISIRAEAIQNREVIIKDHPSLQGRDFMSELKLEVVSWIDM
                     FRPKLIKRTIIGPMLMMFQQFQGVNALIYYSPTLFEQLGLDYEMQLDMSGVLNISQMV
                     ATIVAFFVLDRVGRKPPLIFGSICNTICHIIVAVIMAKYSHDWVKYHNEAWVAVAFIL
                     TFMFTFGVGWSPVPWAMPAEVHSSSRRAKGVAITTCACWLCNFIIGLITPPMLQNIKY
                     GTFLFFGVFALLSGIWVWFFCPEPMGKTLEQMDEIFRSNTAHEDNITKVEIQAAIMDA
                     SPIGSTTSVFRSGEKLGDKDIQQEWVETV"
     gene            1137008..1139755
                     /locus_tag="CNC03590"
                     /db_xref="GeneID:3256190"
     mRNA            join(1137008..1137328,1137410..1137742,1137793..1138207,
                     1138265..1138395,1138445..1138662,1138714..1139276,
                     1139330..1139755)
                     /locus_tag="CNC03590"
                     /product="monooxygenase protein, putative"
                     /transcript_id="XM_569693.2"
                     /db_xref="GeneID:3256190"
     CDS             join(1137436..1137742,1137793..1138207,1138265..1138395,
                     1138445..1138662,1138714..1139276,1139330..1139642)
                     /locus_tag="CNC03590"
                     /codon_start=1
                     /product="monooxygenase protein, putative"
                     /protein_id="XP_569693.1"
                     /db_xref="GeneID:3256190"
                     /translation="MAPIAIQNPLEDAQVAPPPPLKSSKASMGSIKKELPKHPDAVPH
                     DYMYKFKYNHELPLHGKEGIEIPQNVNPKDVADEIASLLSQATSKGDPKAFSELFLEH
                     GVWRDRVALTWDYRTFNWRSAILKAATDLLPENPISKVTVIDPPPTVERPYEDLSFVQ
                     AHIGFQTNKVGATALCNIVLTKDGYKIWTFNSAIESLHGFREVPERDGHMTGPHSWTQ
                     QREIDISMEDSEPEVLIVGGGQNGLMLGARLKALGVNALIVERNKRIGDNWRGRYEAL
                     SLHLPHWADHFAYMPYPEQHWPTFCPAAKLGDWFEWYASAMELNTWTDSSVTGAKQDP
                     DGKWTVEVNRGGQGKRVFHPKQLVMATSLIGIPHVPKVPGDDIFKGTIRHSSQHDSSR
                     EWVGKKVLVVGTSSSGFDTAYDFARRGVDVTLLQRSPTYIMSLTHCIPRLLGVYKPDD
                     NGKRPDIDIADRIAHGMPVGPGEELGRRLGQELTELDHDLLQALEDKGFKTWRGQRNT
                     STQTLGYTKAGGFYFDAGACTQIIEGKIKVEQGYIDHFTEDKVVLNGDREKTYDLVVL
                     ATGFSNTIDSVRRTLGDDVADRCKPVWGMDEEGELNSAWRDTGVPNLWVMVGTLQAAR
                     YHSKKVALNIKARLEGICKEPYLE"
     gene            1140581..1142301
                     /locus_tag="CNC03600"
                     /db_xref="GeneID:3256753"
     mRNA            join(1140581..1140791,1140909..1141041,1141107..1141186,
                     1141257..1141484,1141540..1141741,1141792..1142085,
                     1142154..1142301)
                     /locus_tag="CNC03600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656777.1"
                     /db_xref="GeneID:3256753"
     CDS             join(1141023..1141041,1141107..1141186,1141257..1141484,
                     1141540..1141741,1141792..1142085,1142154..1142182)
                     /locus_tag="CNC03600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512405.1"
                     /db_xref="GeneID:3256753"
                     /translation="MKIEGKSFVITGGLGSIGGSTAKLIAEKGGYPIIFDILSPADGE
                     KKIKELPNSERYVYQQTDIADRAKMEQAIQAALKKVPKGSLAGGVHCAAINPGMPWGP
                     KMADKLDDFEKVMKVNAYGTFCVDAVVADAINSQYPPLDPFHERVEEERGCIVNISSI
                     VAFDPPARCLTYGPSKTTVLGITSAAADFLAPTGIRVNSIAPALVYSALMNSGGRGDY
                     FKDEMNAHSMFPRRMTNASEIGAAILFLIETSMMNAFHLKVDAGWRNVTSWACGRDPR
                     KLSGLIE"
     gene            complement(1142216..1143683)
                     /locus_tag="CNC03605"
                     /db_xref="GeneID:36392796"
     mRNA            complement(join(1142216..1142427,1142479..1143204,
                     1143259..1143328,1143394..1143683))
                     /locus_tag="CNC03605"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658434.1"
                     /db_xref="GeneID:36392796"
     CDS             complement(join(1142518..1143204,1143259..1143328,
                     1143394..1143425))
                     /locus_tag="CNC03605"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514292.1"
                     /db_xref="GeneID:36392796"
                     /translation="MPPVRHQAPNRLVIQRRPIPVVEAECILRSDMEISHRTPVCCRC
                     PGCPPEGRIMQFGSWLSHDGLTYYDSIKEAEKKMPPHQSVSNYPSLSARNQNTPLPSV
                     GIATDNARAYPASSSTKHFVPPFPAALQMPVMKAVSSVKDVGEGDRLLRYLKDVLECL
                     QPNSLKGQQYTPFQPNDFSTVSDLLPALGLRLPQLLSNVQKLDNKTEWLRSILRSLIT
                     AIECHINLLRKKDAEISELKDRMSRVEERLRQIEGKDAEKPVRK"
     gene            1143948..1146014
                     /locus_tag="CNC03610"
                     /db_xref="GeneID:3256446"
     mRNA            join(1143948..1144043,1144124..1144214,1144322..1144603,
                     1144659..1144919,1144973..1145121,1145177..1146014)
                     /locus_tag="CNC03610"
                     /product="t-complex protein 1, theta subunit
                     (tcp-1-theta), putative"
                     /transcript_id="XM_569582.2"
                     /db_xref="GeneID:3256446"
     CDS             join(1143987..1144043,1144124..1144214,1144322..1144603,
                     1144659..1144919,1144973..1145121,1145177..1145980)
                     /locus_tag="CNC03610"
                     /codon_start=1
                     /product="t-complex protein 1, theta subunit
                     (tcp-1-theta), putative"
                     /protein_id="XP_569582.1"
                     /db_xref="GeneID:3256446"
                     /translation="MSLKVPKASGPDLFKSGYKHLSGLEEAVLRNIAAVGELSEIVRT
                     SFGPNGRNKLIINHLGRLFVTSDAATIIREIEVAHPAAKLLVMASTAQEAEMGDATNL
                     VLIFAGELLKRSEHLLTMGLHPSDVIQGYEMALAKGREELETLVAAQITSSPLPSVDN
                     LAAAVSSSLASKQPGCEVLLSKLVAEAALAVMPKNPKDFNVDSVRVVKVLGGGLEASR
                     VVRGMVFGREPEGIVKNATRAKVAVYTCGLDISQTETKGTVLLKKAEDLLNFSRGEEK
                     QLEGYFKEIADSGVKLIIAGSGIGDLALHYLNRMGIAVIKVLSKFDLRRLCRVVGATP
                     LARLGAPTPEEAGMVDVFETIEIGGDRVTVLRQEEGEKTRTATIVLRGATANYLDDLE
                     RSLDDGINTIRILFRDGRLVPGAGASEIELARRISAYGGKTAGLAQHSIKRWAEACEV
                     VPRTLAENAGLNSEDVVSSLYKAHADGQVDAGVDIESEKEGVRSTKDMGVFDPYAAKD
                     WALKLATEAAISVLRVDSIIVAKQAGIAPPKQQGHWDDD"
     gene            complement(1146028..1146689)
                     /locus_tag="CNC03620"
                     /db_xref="GeneID:3256308"
     mRNA            complement(join(1146028..1146315,1146378..1146392,
                     1146461..1146513,1146577..1146689))
                     /locus_tag="CNC03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656778.1"
                     /db_xref="GeneID:3256308"
     CDS             complement(join(1146168..1146315,1146378..1146392,
                     1146461..1146513,1146577..1146669))
                     /locus_tag="CNC03620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512407.1"
                     /db_xref="GeneID:3256308"
                     /translation="MSDRRKLAAPPGVGAGKPDHPFAVTVEDPVPNAIVPDGYGIKYH
                     AYHTITEGVFLPAGTALPGGAVLPMSSVADFPMILPLGTKLPGGVMVPVSCNQRLPRC
                     "
     gene            complement(1146810..1148769)
                     /locus_tag="CNC03630"
                     /db_xref="GeneID:3256814"
     mRNA            complement(join(1146810..1147273,1147349..1147573,
                     1147633..1147803,1147851..1147979,1148043..1148194,
                     1148257..1148374,1148459..1148562,1148614..1148769))
                     /locus_tag="CNC03630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569587.2"
                     /db_xref="GeneID:3256814"
     CDS             complement(join(1147037..1147273,1147349..1147573,
                     1147633..1147803,1147851..1147979,1148043..1148194,
                     1148257..1148374,1148459..1148551))
                     /locus_tag="CNC03630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569587.1"
                     /db_xref="GeneID:3256814"
                     /translation="MASGFSSESPVNILLIGLGSIGSIYAYLLEKSGKARVTAVARSN
                     YTLYTTSGVTLDTERFGEINNWKPYRVFKTQQEALNDGTFYASCIVCTKCLPDVLPNV
                     KLLEDTLASDQIGSYHLMQNGLGIEEDLFTALEGREIPILSSCAWIGIMTSSDGQVVS
                     WSGQDMLVTGIYPPASPETGNQTRAFSLKEAEALNLWVDLLRAGEGIVHPTERIDSIR
                     FSKNVWNCAWASVQGLVRATALAFAPLSLEQAAVVKAYFREIVAVGFEAGLLWKGMIQ
                     YPSGEISAGLEDVVNYCWDKITGMAVARGVGHKYSLLIDVETGRPFELEVIVGSVLRL
                     AQKHNIETPRLEYTYVLLKVLQGEILREKRLRVKERAVVA"
     gene            1152823..1154200
                     /locus_tag="CNC03640"
                     /db_xref="GeneID:3256167"
     mRNA            join(1152823..1153535,1153593..1153903,1153960..1154083,
                     1154136..1154200)
                     /locus_tag="CNC03640"
                     /product="expressed protein"
                     /transcript_id="XM_024656779.1"
                     /db_xref="GeneID:3256167"
     CDS             join(1152859..1153535,1153593..1153866)
                     /locus_tag="CNC03640"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512410.1"
                     /db_xref="GeneID:3256167"
                     /translation="MSFSPPQESPNLPSLAAALADTSGAAQGIQIAPELIGDGGAPPD
                     LPRREELQGQQPSDGVSQAFGSYQNSSTRDDGYRGWSNGPNPPPRAQNPWEEGYRDHS
                     SHPDPTINQQYSYSEQAGPSISTENIEEPQKPPRKRARQSKPRGHEKNGVNSDGLPEE
                     GILDFAHPSGDFKLGPVFVHPPKGVAQACVRCHKIKRKCDNARPRCAGCSRADVACVF
                     ELNPATASYVSSLKSDNVTLSAQMVSAAERISQLEAVLVNTGQEIPPPPQTLKNIDFT
                     AIAGDKFSAKDDDVSTEDAIKRLAESALTTSLHKRRRMSW"
     gene            1154622..1156399
                     /locus_tag="CNC03650"
                     /db_xref="GeneID:3256471"
     mRNA            join(1154622..1154863,1154925..1155142,1155210..1155416,
                     1155477..1155670,1155747..1155826,1155904..1156399)
                     /locus_tag="CNC03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656780.1"
                     /db_xref="GeneID:3256471"
     CDS             join(1154674..1154863,1154925..1155142,1155210..1155416,
                     1155477..1155670,1155747..1155826,1155904..1156073)
                     /locus_tag="CNC03650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512563.1"
                     /db_xref="GeneID:3256471"
                     /translation="MYYDLYLPFPLPPSQEDTHSKKAKKGKGKAPLPPLVVSNADCWD
                     GLETSARESVARRIALTGHLGYSVVGCTIAPGEPSNQVLPSPFQKGLPYPGLDPRFAS
                     PSGASPSSSSYGNASLVQVTRYHIRLDDGKAHCLTAQNTSALRNYDILSVSPTTDKSF
                     QLACTDLSNPGPNQISIITLPLHERAFTFRFNRKQMRQAQRNGVVFELVYSAALFPPA
                     STPLDVARRFRQNFLSNAREVIRITGGKSVIFSSGPGGSENGLRGCLDIVNLGTLIGM
                     PANLARETVDKTPKMVLLRAQARKTFKAIMTMPVLAPPLADADTSMEDASTVDVLNKR
                     AADDGSKDAVVKRSRVGM"
     gene            complement(1156068..1158587)
                     /locus_tag="CNC03660"
                     /db_xref="GeneID:3256482"
     mRNA            complement(join(1156068..1156865,1156932..1158132,
                     1158188..1158587))
                     /locus_tag="CNC03660"
                     /product="mitochondrial intermediate peptidase,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_569591.2"
                     /db_xref="GeneID:3256482"
     CDS             complement(join(1156192..1156865,1156932..1158132,
                     1158188..1158307))
                     /locus_tag="CNC03660"
                     /codon_start=1
                     /product="mitochondrial intermediate peptidase,
                     mitochondrial precursor, putative"
                     /protein_id="XP_569591.2"
                     /db_xref="GeneID:3256482"
                     /translation="MCELVRNVHPDPRWVAAAEKTYETLCSFMNQLNTSTGLYDALVA
                     TVSHTFPGNPLSPAELRVAQTFLSDFERSGIQLPPGVRAKFVRHSDNILSLGRTFLSF
                     AAAGPSADTPIEIPEPEVLLAGLSSKFVASLPRKKRKGPALLAPGSWEAQMIGRYADN
                     EEARRLVYIGSMREDKDRVYVLETMLKERAELAHVLGKETWADVALSDKMAKTPQNVL
                     QFLTSLATHHRPSAAADVAALQRLKALSTVSRTSSQLPTVHAWDRDHYAEQYAASLLP
                     NGSLPSITPYFSVGTAMSGLSHMLSRLYGISFKPVSVAHGEVWHPSVRRLDVMDEHGK
                     RIGVIYCDLFSRPGKPSAGAAHYTVRCSRRVDDDPSEGDGLPPGWDQHLGKGMEVQGE
                     ALHGKEGKYQLPIVVLTTDFGTVEESGPALLGWNDLETLFHEMGHAIHSMIGQTEFHN
                     VSGTRCATDFVELPSILMEHFISSPAVLSTFATHYTTNEPLPIPLIQAHLQLDQSLKA
                     LETHSQILMALLDQKYHSIKHGEQLDSTRVWNELQSQVGVIPPVRGTAWQTQFGHLYG
                     YGATYYSYLFDRAIAGKIWSSLFARGRTGPAAANHDPAAAEDILSREGGEAFKEKVLK
                     WGGGRDPWEMVGDVIGGAEGEQVAKGDEKAMELVGRWMIK"
     gene            1158714..1161945
                     /locus_tag="CNC03670"
                     /db_xref="GeneID:3256520"
     mRNA            join(1158714..1160411,1160467..1160739,1160805..1160880,
                     1160938..1161002,1161070..1161087,1161139..1161327,
                     1161403..1161640,1161709..1161945)
                     /locus_tag="CNC03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656781.1"
                     /db_xref="GeneID:3256520"
     CDS             join(1159008..1160411,1160467..1160739,1160805..1160880,
                     1160938..1161002,1161070..1161087,1161139..1161327,
                     1161403..1161640,1161709..1161890)
                     /locus_tag="CNC03670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512412.1"
                     /db_xref="GeneID:3256520"
                     /translation="MATKSRCNYRWESRKLLIKDELPQGHGSGDYAYRTTPQFWKECP
                     PFAPGERVHAAVLLLSPTAEKTFGHPECRPMCLLTSRPLPLFETHDTVEVNLGVGEQP
                     THRGCVRMTSAGSLEGGLDDVTLGQTLRFTERLMRAELQRLIKADLHRIKWLLLPLTY
                     GYSSARQPGPLAREDIAWEQVEAVANGPLTVPFTLKDEDDLAAQCFDAMASANSELTR
                     RSYITAVRQDLNPDSPHPERPEKTILQVIQGENCLFPQLVHRKQPILQVETACLAKNG
                     SYITTSATPAEQRSTQFLIPEYENRHCIPASIFRALTPFPFFIHQLECMLIAYEMSTK
                     LFGSLLHPELALQALTAPSSQNVTPWTYERLEILGDTLLKFFITIHVYLHGGGANSRE
                     DSLKVWQDRHKLVSNRTLTANAIKLGLVEFVRDKRLKVKEWVPRDWELELLPGQIAPK
                     KAVQTSNDGPEMRKLGDKLLADIVEAIIGASYGRDKNFDNVISTLIHLNVPLDLFSTW
                     EEIKHVLPLSDDEHDTEEHGAADAETETDSFSACEILGYKFKRKRRYEDVISMSNQPH
                     ARRIRENYKMLGNAVLDLHVIEFLLAKYPEEGPGSLSNMKTFRTTEGLRCALATELGL
                     QDLLKDGDERAERELGRATYFMRDAKAQADAGLSDEEQGGIHYWDGVAVNHFTGSIIE
                     VIYGAIFQDSGFSLEHTQRIFDNHIVPFIEKYCKGPSASDLHPKGLLTRWMQAKGCAY
                     WKLDAVGPKLCEGVVTCHDQDVARCKAFTTHVAVRNVCEEAIKRLRDENRIKDICDCP
                     SFKEIVPEDKTFGKWR"
     gene            1162083..1165589
                     /locus_tag="CNC03680"
                     /db_xref="GeneID:3256335"
     mRNA            join(1162083..1164008,1164071..1164337,1164392..1164467,
                     1164518..1164582,1164637..1164654,1164717..1164905,
                     1164994..1165231,1165290..1165589)
                     /locus_tag="CNC03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656782.1"
                     /db_xref="GeneID:3256335"
     CDS             join(1162131..1164008,1164071..1164337,1164392..1164467,
                     1164518..1164582,1164637..1164654,1164717..1164905,
                     1164994..1165231,1165290..1165477)
                     /locus_tag="CNC03680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512414.1"
                     /db_xref="GeneID:3256335"
                     /translation="MTEEPSSIIADNSTAIKSPTTFTSPNGTVLTFQSAGSHLSSWLQ
                     TIGHTPDYSMEDVLPEGYIPPPLSKKAAKKAALGDANVYAGPPPGSMRVCTVNLPFYG
                     PVRSTPWANKALAKQSASFEAVKELHKHGEVDDNFQATPLRPKKKGDTKGTKSRCHDT
                     WEIKKAVIKDQLPRPTGGVGHGQYDYQTTPEFWSTCPPFNPRSLHASILQLSPAGEGK
                     YDHPECRMMCMLTSRPLPVFRKSNQVEVRMAVGEQPPLCATMRVINGGKMDTFYSGKL
                     DQALVFTEKLMRAEVQKVFKTDLRKVKWLLLPLRREYVPPTKEQLVAGKSASLKLDDI
                     SWKEVDAVTDGALTLPFTFDDYDSLKREIVDSLATAPSEMSRRSYIIDVRQDLHPLSP
                     HPDIPEKTICDVLKEGNVTLPQLTDPSQPILEVETVNLAKTGSYISTAAMAAEERPRQ
                     YLVPEFEHRHCIPASVFRTCTVIPYFIFYLESMLIAEEMSAKEFNSILDPELALQAIT
                     AAEGLNVPRWTYERLEILGDTLLKFMTTLHFYLLGGGADSEDDMNKVWQDRHMLISNR
                     TLTANAVKQGLVKYVRNKKFKVKEWTPRDWELDLLPGQFAPKKTMPTSFDGPESRVLG
                     DKVIADIIEAIIGASYMPNKDLDSVIAILHHLMVPLNLFNTWDDVKHVLPPPKAEEPK
                     NPDVPAYINFFKKSSYEVLGYKFKDNKKFEDAFSLAPAQQTRRIRERYKMMGNALLDL
                     YVIELLMDSYPDEGPASLSIMKLSRTTEGLRCALAVELGMSDLIIDGDDHSRSELKRA
                     THFMQKAKAQADEDLNENKEGGVHYWEEVVISRVNGSIVEIVFGAIFEDCNFSLEPTQ
                     KIFTEHIAPFLAKYCRGPNGFDPHPKAMLTRWMQKKGCQSWNLTAEGPKLNQGVVTCH
                     DKEIARECAFTQHVTIRHVCLAALKRLRDENYIEEICNCPSFKKVIPDDERMFGKKRT
                     "
     gene            complement(1165512..1167240)
                     /locus_tag="CNC03690"
                     /db_xref="GeneID:3256385"
     mRNA            complement(join(1165512..1165910,1165973..1166065,
                     1166121..1166412,1166466..1166494,1166552..1166670,
                     1166730..1166843,1166906..1167240))
                     /locus_tag="CNC03690"
                     /product="chaperone protein DNAJ, putative"
                     /transcript_id="XM_024656783.1"
                     /db_xref="GeneID:3256385"
     CDS             complement(join(1165615..1165910,1165973..1166065,
                     1166121..1166412,1166466..1166494,1166552..1166670,
                     1166730..1166843,1166906..1167192))
                     /locus_tag="CNC03690"
                     /codon_start=1
                     /product="chaperone protein DNAJ, putative"
                     /protein_id="XP_024512415.1"
                     /db_xref="GeneID:3256385"
                     /translation="MSYILTSFLASFLPSQITTAILPYLSANLPAIFPPAPRGSPRYL
                     HNYRLAFTGVICIWQGYSFLKDGLGNGDDWYRLLNVQGNADEDALKSAFRTLARKHHP
                     DRAGKDNDDHFILARKAYETLSDPVKRYAYDRFGPKILQWKAASVREYILFGLQNSIG
                     FYIVSGGIMLILALLGKGRSGSYWIHTLFAFLFILELSLILSPSIHAPPILARLFIPS
                     FLLQKPQFIQISLLHRLFASLSVSLPQLLSVWNTDEDEASKARKEDEGWRVVVGLLKN
                     LNEEAVNEFHAEVMPLLSTGDQNATMALIKNAMENVMVDRALVSHPRIHETYRAARLR
                     ASHSTPSKIPLSFPAKRAPSSISSQNPSRELSTAGGCTPSSSVKDVFAEQLLMAVDTP
                     LPPSPPPTPRSGPWRLE"
     gene            complement(1167390..1169622)
                     /locus_tag="CNC03700"
                     /db_xref="GeneID:3256565"
     mRNA            complement(join(1167390..1167842,1167891..1167955,
                     1168008..1168159,1168206..1168480,1168539..1168780,
                     1168839..1169046,1169097..1169173,1169286..1169381,
                     1169487..1169622))
                     /locus_tag="CNC03700"
                     /product="UTP-glucose-1-phosphate uridylyltransferase,
                     putative"
                     /transcript_id="XM_569599.1"
                     /db_xref="GeneID:3256565"
     CDS             complement(join(1167512..1167842,1167891..1167955,
                     1168008..1168159,1168206..1168480,1168539..1168780,
                     1168839..1169046,1169097..1169173,1169286..1169381,
                     1169487..1169552))
                     /locus_tag="CNC03700"
                     /codon_start=1
                     /product="UTP-glucose-1-phosphate uridylyltransferase,
                     putative"
                     /protein_id="XP_569599.1"
                     /db_xref="GeneID:3256565"
                     /translation="MATLEPKQDPQASARQRGHSAMDFKSATTGVAAKTMRNELNRMV
                     ANEQDPAKKKMFEAEMQSFFILFNRFLTERAKGEKLDWDKINPPKPEQVRPYEVLPNV
                     DPSILNKLAVLKLNGGLGTTMGCVGPKSIIEVRDNMTFLDLSVRQIEHLNEKYNVNVP
                     FILMNSFNTDEDTARIIQKYQNHNINILTFNQSRYPRVDKESLLPCPRESSSDKSNWY
                     PPGHGDIFDALTNSGLLDKLIAAGKEYIFISNVDNLGAVVDLNIFQTMIDAQAEYVME
                     VTDKTKADVKGGTIIDYDGKPRLLEVAQVPKDHLDEFCSTRKFKIFNTNNIWCNLRAI
                     KRIMDEDALNLEIIVNNKVTDDGLAVIQLETAIGAAIKHFDSAIGINVPRSRFLPVKS
                     CSDLLLIKSKLYNLEHGVLTMDRSREFGGTPVVKLGGEFKKVANFEKRFKSIPNITEL
                     DHLTVSGDVWFGKSVRLAGTCIIVATEGNKIMIPDGTNLENKLITGNLSIIDH"
     gene            complement(1169889..1173941)
                     /locus_tag="CNC03710"
                     /db_xref="GeneID:3256423"
     mRNA            complement(join(1169889..1170037,1170096..1170488,
                     1170533..1171901,1171969..1172553,1172609..1172630,
                     1172687..1172700,1172755..1172855,1172913..1173357,
                     1173416..1173481,1173520..1173566,1173630..1173941))
                     /locus_tag="CNC03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656784.1"
                     /db_xref="GeneID:3256423"
     CDS             complement(join(1169951..1170037,1170096..1170488,
                     1170533..1171901,1171969..1172553,1172609..1172630,
                     1172687..1172700,1172755..1172855,1172913..1173357,
                     1173416..1173481,1173520..1173566,1173630..1173860))
                     /locus_tag="CNC03710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512416.1"
                     /db_xref="GeneID:3256423"
                     /translation="MSRSTMSRQSNGDSTPARDLLLPHPAEDLSADDDLLSWVLVDQL
                     GCMPNTRLGVHPQQVKFVGPPFKTDEVLNIVRETVTKGDLNGAMKRLQEFWLFQQHLQ
                     SKLTTNQKERFIQHLRRYLLCLQPTSRVEIHLTSRYSFATGHTELAVFATRPLARGLV
                     VQELQGSVVPLPEEWREEMDIGDDFAVEAAEESGSERDEEEEDVRSEAFTSTSGRRGK
                     SKAKEESRRQGQRRSDRTKRRDFSIVWSGLKRCYQLFLGPARFLNHDCNPNVELLRQG
                     NYVTFRVIRPVRIGEELTTFYGENYFGKGNVECLCLTCEKNHHGGFTPKPESSRRTSR
                     HLSRDFTADPPCVRGRSSVSRSRESISTGPTSLKHETAVKQEPFSDDEHEVSIGLSTA
                     PSLSTEEECDTPIDNVSNTPRVASPFGESLASDVDSVIMPPRRERYARKAAQNSKSWL
                     LLKGRGPKTDIDEDLAFVGGDEEFPPDFPRCATCAKPLSDQIWYNGRYFDHCQRCVRH
                     ALVFQLPWPAHKPQEVQEYPPAYLIPPGYIPPKISTVPLPSLSKNRLPPRVNVIATSQ
                     TPPRAGNSMEDRAHRLRKQIEIEEFIVNSLREAAWSVQEAKELAQEAKEEAKRKKKEE
                     KMRLDALRIKGNGIWQRYEYVDEEELKRKQEAMWRVEPGTTRRGTVRKIPQVENSDGK
                     RDKQTGKEAEGTVAVINDEARAKKNEEKKRKRAEEKLKREQKMREEERRKEEKRLKDR
                     ERKRRAKEMKKEEKERAVLTAVSNYTSTSHRDNGYVQPSVDIDEGDNEDLEDEIMVAA
                     APELLAYYSPETSRTTELPSSAVISARPLARRISKSTSQSPLSSGFKILTSSPQTTIS
                     MSAISASNNYAVGVGVPASTPPEAIMLHIPARDLSSKDSASSKLKRKRPPGTVKTMKD
                     QITETAPAKSEEAKSEKGGGGSSTLMGSSQRKEESVLPKEDKGKGKDLASHSPKSTIS
                     TMDFTKQTALISQELPFGRSGGYFPPPFSPLRANDYPPVATRAAPDLAPTLSRLDTSP
                     QDVAIASASSSSDASLSLTTVAAVKDAMDGEPLQEKLQGLVQNFDPSTASKNHKKRLF
                     EHGVEATSQLQLPPAKKRTFFPSTFQHPMEM"
     gene            1174086..1175662
                     /locus_tag="CNC03720"
                     /db_xref="GeneID:3256531"
     mRNA            join(1174086..1174246,1174307..1174421,1174482..1174643,
                     1174725..1175662)
                     /locus_tag="CNC03720"
                     /product="expressed protein"
                     /transcript_id="XM_024656785.1"
                     /db_xref="GeneID:3256531"
     CDS             join(1174111..1174246,1174307..1174421,1174482..1174572)
                     /locus_tag="CNC03720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512417.1"
                     /db_xref="GeneID:3256531"
                     /translation="MKGYPSFCTKQTNIIITLHQAPSSLIMRLSQVNKILLGSCIVVV
                     PLSFYGGLAIKEYYLSKELEKVDDSRPPPHERAMRARIVQLEQERQELLKEGQNLDIK
                     IRDIRKRMTEV"
     gene            1175880..1177766
                     /locus_tag="CNC03730"
                     /db_xref="GeneID:3256796"
     mRNA            join(1175880..1176125,1176191..1176359,1176420..1176608,
                     1176668..1176721,1176770..1176869,1176924..1177106,
                     1177157..1177256,1177313..1177438,1177496..1177553,
                     1177616..1177766)
                     /locus_tag="CNC03730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656786.1"
                     /db_xref="GeneID:3256796"
     CDS             join(1176263..1176359,1176420..1176608,1176668..1176721,
                     1176770..1176869,1176924..1177106,1177157..1177256,
                     1177313..1177438,1177496..1177553,1177616..1177620)
                     /locus_tag="CNC03730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512418.1"
                     /db_xref="GeneID:3256796"
                     /translation="MSDGEHALAKTVFGSDRLSASKLFNVDGWVVLVTGGGTGLGLIT
                     AGALAENGAKVYITGRRLEPLEEAAKTAAPKGGKGTIIPLQADMSKKEDIDKVKETII
                     SKEKWLNALINNHGVAITPPKIDEAEQTAEGLSKFMYDEEKFDNWLDAYRINTASYYF
                     TSFAFLPLLAAAKSVGNYSEPGNIINVASVSGVAVTSQGGQFSYNSSKGATIALTRML
                     ATELARRELGIRVNMICPGYFPSGMTGYTEDDTQPSKEFKDKMGTPLGRTGNAIDYAQ
                     TVFSLLSNQYITGRELVVDGGYLLNQI"
     gene            1178103..1179710
                     /locus_tag="CNC03740"
                     /db_xref="GeneID:3256298"
     mRNA            join(1178103..1178299,1178357..1178545,1178605..1178658,
                     1178706..1178805,1178865..1179047,1179108..1179207,
                     1179275..1179403,1179472..1179529,1179581..1179710)
                     /locus_tag="CNC03740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569607.2"
                     /db_xref="GeneID:3256298"
     CDS             join(1178206..1178299,1178357..1178545,1178605..1178658,
                     1178706..1178805,1178865..1179047,1179108..1179207,
                     1179275..1179403,1179472..1179529,1179581..1179588)
                     /locus_tag="CNC03740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569607.1"
                     /db_xref="GeneID:3256298"
                     /translation="MSSSHSLARSVFGTDALTVNKLFDVSGWVAIVTGGGTGLGLITA
                     GALAQNGCKVYITGRRLEPLQEAAKTAAPSQGPGSIIPVQADMSTKEGIAKLKDVIES
                     NERWINILINNHGVSLPAPQINEAEQTPEGLSKKMFEDETFESWTDGYRINTASYYFT
                     SFAFLPLLSAAKTVGNFPEPGNIVNLSSISGITKTSQRGQFSYNANKAATISLSHQLA
                     TEFARRDIGVRVNVVCPGYFPSGMTPVDNKYHSAANAEFKQKWGTPLARPGNAVDYAQ
                     CIFGLVTNQYVTGAELIIDGGWLLAQPF"
     gene            complement(1179689..1181095)
                     /locus_tag="CNC03750"
                     /db_xref="GeneID:3256819"
     mRNA            complement(join(1179689..1179848,1179935..1180283,
                     1180338..1180544,1180593..1180674,1180736..1180951,
                     1180999..1181095))
                     /locus_tag="CNC03750"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_024656787.1"
                     /db_xref="GeneID:3256819"
     CDS             complement(join(1180016..1180283,1180338..1180544,
                     1180593..1180674,1180736..1180951,1180999..1181062))
                     /locus_tag="CNC03750"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_024512420.1"
                     /db_xref="GeneID:3256819"
                     /translation="MPAIDPHYLWALGHFTVLFSTAYIIFQTVLFRGTPVKTYRLAYS
                     GALLSYFIVVYKSLGRPQLSQPWLRRALVDENCQYALLALFWWISKPVNLTVLPFATF
                     SLFHCLTFLRTNVIPKLVPPPPKPAAGAAPGATASGASAPQPARPPALLDNVSRRIQV
                     WVKTNYDTAMRFVAYAEIFITLRLFAGVLTFRTSFITALFMIHFVRFRYHASPFTRSA
                     VQDITARIDAFVAGKGAGVQNAWATVKRFVVSWGGMPLLPNEGRNGAQGPAAQAQQAA
                     RG"
     gene            1181288..1182865
                     /locus_tag="CNC03760"
                     /db_xref="GeneID:3256734"
     mRNA            join(1181288..1181533,1181594..1181797,1181851..1181894,
                     1182091..1182865)
                     /locus_tag="CNC03760"
                     /product="40S ribosomal protein S12, putative"
                     /transcript_id="XM_569612.2"
                     /db_xref="GeneID:3256734"
     CDS             join(1181308..1181533,1181594..1181797,1181851..1181867)
                     /locus_tag="CNC03760"
                     /codon_start=1
                     /product="40S ribosomal protein S12, putative"
                     /protein_id="XP_569612.1"
                     /db_xref="GeneID:3256734"
                     /translation="MSDAGSETASNHPEVEAQEVEVAAPSGPMSVEDALEQVIKTALV
                     HDGLARGLRECAKALDKKEAHLCVLVETVTEAEYLKLIEALCTEHGIQLIKVSDAKVL
                     GQWAGLAKIDREGKPRKVVGCSCVVITNYGEDSAALQVLLEYFKTR"
     gene            complement(1182201..1184733)
                     /locus_tag="CNC03770"
                     /db_xref="GeneID:3256644"
     mRNA            complement(join(1182201..1182552,1182611..1183120,
                     1183178..1183442,1183496..1183593,1183644..1183774,
                     1183826..1183989,1184039..1184733))
                     /locus_tag="CNC03770"
                     /product="expressed protein"
                     /transcript_id="XM_569614.2"
                     /db_xref="GeneID:3256644"
     CDS             complement(join(1182239..1182552,1182611..1183120,
                     1183178..1183442,1183496..1183593,1183644..1183774,
                     1183826..1183989,1184039..1184350))
                     /locus_tag="CNC03770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569614.1"
                     /db_xref="GeneID:3256644"
                     /translation="MPHPHTSIAPYPQPGDSSPHKTQSQDSLALQTPSSSGSTSTNSL
                     QLLDNDLDDPDDELDLDLDDMDLDEEESDARVDEPLVRGRGGRRRGRRYKEEATERGL
                     LELIPSLILSHPLPLLPLLALLPYNFLPAGVVFFVPVICILALLSVCAHIVIVYLAWY
                     LKVPSFEDVFANVTGKYGKYGLWGGRVATLIAVLGMLVSWLGTLHPLVQPVIETYFPA
                     NAVFSSRVFWTLLLSLTLLPSLLPSRMTRSLHRSPFVLVLLLPIVAFLIIGRTVEIRK
                     ASEIAQPGGDHAGDGGADVASLATDVLVHLGKRRFGLAGGSSAGAGLTTLTIFFSPHV
                     NTLPIHSTLARTKRSSFFMPCLISGAVILILSLPLALVPYYLLPMDATAADTGKGVIS
                     NNTIPSGVFAHLPADDGWVNLARLLMVTLTLGSTNMWILRGRDVILKAMDVDGGNHYK
                     VGRWIGFGWWVVAVGAACLGGWLADKIELVGVLGVIAVGWFLPSLFFIITFHVRSPLS
                     IIFPSRQPPPNPDALASLSTSHNLNRRGHSREDSLNDPSTDVLLARKERQLQKRRLGR
                     RLWQDLIVYVGIMPMGCVTLAWTAGRLVGLW"
     gene            1184436..1186318
                     /locus_tag="CNC03780"
                     /db_xref="GeneID:3256270"
     mRNA            join(1184436..1184583,1184642..1184757,1184817..1184857,
                     1184908..1185047,1185102..1185252,1185300..1185348,
                     1185405..1185601,1185660..1186318)
                     /locus_tag="CNC03780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656788.1"
                     /db_xref="GeneID:3256270"
     CDS             join(1184480..1184583,1184642..1184757,1184817..1184857,
                     1184908..1185047,1185102..1185252,1185300..1185348,
                     1185405..1185601,1185660..1185944)
                     /locus_tag="CNC03780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512425.1"
                     /db_xref="GeneID:3256270"
                     /translation="MHPHQATFKRNAHVNYFVRCLAALPTAAEGHDSNRVTIAYFCLC
                     ALDVLNALGEKTTERQRAEWAEWIWSLQVSSGGFKGATYMDTPNPTTSPAHLPSTYTA
                     LLCLALLRAPLDRLNIPGLLCFLKSCQAEDGSFSPLQAEPYLLEGFQSDARMAYIASV
                     ISHIIQDPSGINMPKLKDWIRTCRTWEGGYASRPGGIEAQGGTTYCSLVALSLMSDFD
                     KSPSPLNDRIFQTDTLRWLVSRQLGGFQGRPGKLEDVCYSFWCGGALSVLGRDDLIDH
                     DANKSFLLSAQSPLGGFGKEPDDYPDPYHSYLALAALSLSLNRFGEDKESNFRLKALN
                     VRWNVSTETAEWLQTEVTRVKEQERS"
     gene            complement(1185977..1188166)
                     /locus_tag="CNC03790"
                     /db_xref="GeneID:3256274"
     mRNA            complement(join(1185977..1187087,1187211..1188166))
                     /locus_tag="CNC03790"
                     /product="expressed protein"
                     /transcript_id="XM_569618.2"
                     /db_xref="GeneID:3256274"
     CDS             complement(join(1186030..1187087,1187211..1188078))
                     /locus_tag="CNC03790"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569618.1"
                     /db_xref="GeneID:3256274"
                     /translation="MSSRKGKARAESPDERTLLLPEPFRPRSQPVPPAEQSPPRRARV
                     RSVLLTVSIVAASLFLSALLFIALLAASFKPSPSELSDLPQTAFKYTSPSSISVVNVT
                     DDGILVNISLSCGIDVDRALGIQNFYQESERQKAAERGDRGMGAVWWESLRRKSANWL
                     IGSLQRKQMSLDISKGVYIFPENDSSPPLGHIDLLGPLSIPLVTGVPPYSPDHPDLSW
                     LEPISFTAFVKPMASSGEIWNFIHQGWLHGGLNVAVGAESIQTGLGDGEERWWGRWVA
                     MKENDVSLQMELPIPQLPGLPRPGHPFDLSALVSLQNYSLSNADDRSLVINAMATIPN
                     FIRHLDFVQNGNFTVPFGLPFALSLPSSEDDVRMATVILQPVTVGQEKMIELRMSGTV
                     IADLDRTTGGNDTSPLSAFLQNYLHGRPSPIIVRGLSHYPNSSFFPVAPRWLLSTLPS
                     LSLDLSFPGPSPPPQIIRSVTIERMTIVEKEGKMKAGGIIVAEVEMPKDMRDVDVDVR
                     AVRPDVLIYDGPAPEDDVYHKGDGEKDEYPPKAFGHIHPAKWLPSTTTRSSDPFTPHR
                     FIVRAPLSDVDLDILPGRDSILSGFVTKIIFKGGALAGVEGVSDVQVQVKGVKGEVEV
                     GDLPVRGEFWVGKKKAL"
     gene            complement(1188179..1190075)
                     /locus_tag="CNC03800"
                     /db_xref="GeneID:3256512"
     mRNA            complement(join(1188179..1188940,1188997..1189150,
                     1189206..1189639,1189688..1189793,1189848..1190075))
                     /locus_tag="CNC03800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656789.1"
                     /db_xref="GeneID:3256512"
     CDS             complement(join(1188312..1188940,1188997..1189150,
                     1189206..1189639,1189688..1189793,1189848..1189925))
                     /locus_tag="CNC03800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512567.1"
                     /db_xref="GeneID:3256512"
                     /translation="MSDPISLITDSLTLPNGIRVPNRLVKAAMAEGIGLGGGPPQPNH
                     LRLYGRWAQGGWGMVISGNVQIDPKHLASPHDLTITPSTADRVAYRRLASVVASNLEP
                     PLLIMQISHPGLQSSSTVNFSRLPYQRAIGPCSARPDMDGGIMGWLWSHAVWPRKSKE
                     INDPEDWLRIVDKFVVGAVLAEEAGWDGVQVHAAHGYLLAEYLSPLTNPNPVQLPGAP
                     DDVPVRLHLLYLVLEGINRKTSKSFIKAVKVNCSDFVQGGLDEIQASELIKTIVSWQL
                     LDIIEISGGTYTQPAFAYPETLSSPSKRQSLFSHFTTSLLPLLPPPPQGPAILLTGGL
                     HNRELIAASLAERACDMVGIGRPACLIPDLPRRIILNRAIADDEAFFGTYSIPHAKVV
                     KFLLGGPSTAKGKGIPLVGAGVSTLWHTWQMCRIGRGVEPDGEMSWFRGLLVEEIWKG
                     MIVRGVTLMLSWKGNV"
     gene            1190340..1191409
                     /locus_tag="CNC03810"
                     /db_xref="GeneID:3256276"
     mRNA            join(1190340..1190539,1190606..1190667,1190784..1190876,
                     1190928..1191005,1191066..1191409)
                     /locus_tag="CNC03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_569619.2"
                     /db_xref="GeneID:3256276"
     CDS             join(1190453..1190539,1190606..1190667,1190784..1190876,
                     1190928..1191005,1191066..1191288)
                     /locus_tag="CNC03810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569619.1"
                     /db_xref="GeneID:3256276"
                     /translation="MSRFLFTFLFVLLSVQFCLAQRLATRIDEDGHTVVITGPNGYNG
                     VGTLPSSTATPMSTSMSASSRMTKSRLDDSTMSSTPFASALDSWHSAANAAWTESPSA
                     SDSSSSTPATTASSTEKSAAVNGAASAATDASATTSQTNTSAVMSHAESSATLSLPLN
                     LGPVIGITLTGVVSLWALIA"
     gene            1191864..1194001
                     /locus_tag="CNC03820"
                     /db_xref="GeneID:3256277"
     mRNA            join(1191864..1192333,1192399..1192822,1192881..1193084,
                     1193135..1193210,1193264..1193495,1193551..1194001)
                     /locus_tag="CNC03820"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_569620.2"
                     /db_xref="GeneID:3256277"
     CDS             join(1191917..1192333,1192399..1192822,1192881..1193084,
                     1193135..1193210,1193264..1193495,1193551..1193871)
                     /locus_tag="CNC03820"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_569620.1"
                     /db_xref="GeneID:3256277"
                     /translation="MPSKKGKSKSNAKANAAANSNSTQRAPNLPNGAPTVPDEAAPQA
                     PPADETIEPKPLQEGEEQTQEQNHEHKDEEPSGPSRGEEQEEQDDVPVDERIRILEDD
                     LETMRQEKEALGNQYRSLLGKLTAMRTTLGDKLKEDAEELDRRETQINNLVTENSELH
                     ETVNTLKSELSSLSQESSHLSAQLAQLRSQSDSSSSDVLSLTREMRELRGEMERLRLE
                     REEWEVEAGRERERRETLEDDLRVFERREQDMCSALEKLAEERDKEKERGDNLQEVLS
                     EFQAAKDSEIQRATVELETQLRTAAESLSEFKLRAANAETRLSEVSSDASKSSALEKE
                     LKDKNQIIGKLRHDTVVSNEHLKEALRRLRKNQSDNNVDRRLVTNILLSFLMTSRGDP
                     KRFEMLSLLATILSWDDAEREKAGLQRQAAAGGGSKGKASASKGKETEKSAEEEAAMN
                     ESFSNLFVEFLLKEASQGQPSQTGTSDHQPHRTLSSLSLDSPPIFSPPRGPAAGSMTF
                     SPPASSPRQRPREMSSSSSVSEWPMMMGGRKGSYALKDVMEGQGQTYNP"
     gene            complement(1193639..1194939)
                     /locus_tag="CNC03830"
                     /db_xref="GeneID:3256279"
     mRNA            complement(join(1193639..1193866,1193935..1194309,
                     1194361..1194384,1194435..1194524,1194580..1194636,
                     1194687..1194796,1194845..1194939))
                     /locus_tag="CNC03830"
                     /product="inorganic phosphate transporter pho88, putative"
                     /transcript_id="XM_024656790.1"
                     /db_xref="GeneID:3256279"
     CDS             complement(join(1194073..1194309,1194361..1194384,
                     1194435..1194524,1194580..1194636,1194687..1194796,
                     1194845..1194896))
                     /locus_tag="CNC03830"
                     /codon_start=1
                     /product="inorganic phosphate transporter pho88, putative"
                     /protein_id="XP_024512426.1"
                     /db_xref="GeneID:3256279"
                     /translation="MNNPAVSNLILSLGAMQVARKIPMEDPQVVNYLRIGYVSAQLIS
                     LAIYYFITLKIRKKNDLTVLKYVNPASPMNPDAKPELVQTTVKDYDLAETGKAIRSLL
                     ISVAIMTFLHGYMKYTQPLFIQSIMGLKGALESNPAKLHLWNKKAEGDLARPFKSSGG
                     MFESLTGKASGPQTDAASIKEAEKAGKAE"
     gene            1195110..1195816
                     /locus_tag="CNC03840"
                     /db_xref="GeneID:3256281"
     mRNA            join(1195110..1195305,1195357..1195556,1195629..1195816)
                     /locus_tag="CNC03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_569622.2"
                     /db_xref="GeneID:3256281"
     CDS             join(1195116..1195305,1195357..1195556,1195629..1195709)
                     /locus_tag="CNC03840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569622.1"
                     /db_xref="GeneID:3256281"
                     /translation="MRPQLFRPARTLGRRLNSSSSSPQANPNVQKAVENAQKAYAQTA
                     ATLKKAAGPVGEKIGGALGGYREPVVYNSKVFASICRQVWQAEKLSPPLDLATWARAY
                     SEIYAKASNGGYWKNVLKTGAWAGLGVAALEAYGIFKIGEIVGRRNLVGYSLKE"
     gene            1196165..1199056
                     /locus_tag="CNC03850"
                     /db_xref="GeneID:3256286"
     mRNA            join(1196165..1196247,1196301..1196355,1196406..1196461,
                     1196527..1196733,1196789..1197058,1197121..1197235,
                     1197284..1197353,1197401..1197460,1197506..1197911,
                     1197958..1198339,1198392..1199056)
                     /locus_tag="CNC03850"
                     /product="phenylalanyl-tRNA synthetase beta chain,
                     putative"
                     /transcript_id="XM_569623.2"
                     /db_xref="GeneID:3256286"
     CDS             join(1196245..1196247,1196301..1196355,1196406..1196461,
                     1196527..1196733,1196789..1197058,1197121..1197235,
                     1197284..1197353,1197401..1197460,1197506..1197911,
                     1197958..1198339,1198392..1198666)
                     /locus_tag="CNC03850"
                     /codon_start=1
                     /product="phenylalanyl-tRNA synthetase beta chain,
                     putative"
                     /protein_id="XP_569623.1"
                     /db_xref="GeneID:3256286"
                     /translation="MPTITVDKAELYRRLEKEYSHEEFDELCFEFGIELDEDTTIQVE
                     EARKRGLPTPPPQLKIEIPANRYDLLCIEGLARALRIFLQKDIPPSYKLDIPEKLQEV
                     YVEASTAPLRPYFASAVLRLARPMNQLEYESFIDLQDKLHQNLCRMRKFVAIGTHDLD
                     TIEGPFRYMCKDPKQIKFAPLNRDTEHTAEELMTIYEADRHLAKHLHLIRDAPAYPII
                     YDSKDRVLSMPPIINSQRSKIVPGKTTNIFIDTTATDKTKLDIVINMVCAMFAEYCRV
                     PFYIEPVRVHMPDGTSHITPPLEPRATTASSSYINAATGLALSRQEICTLLTRMSLSA
                     TPSPSNEDLLDVLVPCTRPDILHECDIMEDAAIAYGFNKLPREMPTTNTVAKAFPVNK
                     LGDIIRKECAMAGWVEALPLILCSHDENFAWLNRPDPGHYAVHLANPKSLEYQVVRTS
                     LLPGMLKTARENKALPLPMKIFEVSDVAIQDSTEERQARNYRRLCAVYMDRKAGFEVA
                     HGLLDRVMQILGVPLLERKENEGNYGYYIASADDPTYLPGRAAHVFYRPKPTVQPSEP
                     TPSAPPSNPIQSFTSDLKAALHAEKGSSWERDIDIGSLGILHPSVLDNFELIRPCSAL
                     EIDVEPLL"
     gene            complement(1198821..1201794)
                     /locus_tag="CNC03860"
                     /db_xref="GeneID:3256288"
     mRNA            complement(join(1198821..1199097,1199147..1199219,
                     1199273..1199562,1199610..1199691,1199748..1199866,
                     1199929..1200055,1200105..1200175,1200224..1200514,
                     1200571..1200615,1200673..1200758,1200808..1201017,
                     1201068..1201211,1201273..1201453,1201507..1201794))
                     /locus_tag="CNC03860"
                     /product="adrenoleukodystrophy protein, putative"
                     /transcript_id="XM_569624.2"
                     /db_xref="GeneID:3256288"
     CDS             complement(join(1198853..1199097,1199147..1199219,
                     1199273..1199562,1199610..1199691,1199748..1199866,
                     1199929..1200055,1200105..1200175,1200224..1200514,
                     1200571..1200615,1200673..1200758,1200808..1201017,
                     1201068..1201211,1201273..1201453,1201507..1201720))
                     /locus_tag="CNC03860"
                     /codon_start=1
                     /product="adrenoleukodystrophy protein, putative"
                     /protein_id="XP_569624.1"
                     /db_xref="GeneID:3256288"
                     /translation="MPSSHIVPLTKDTLRSRFKFILNSYLQHRPIFQRAFTAAFVIYC
                     LISTYGSLTGRGAKGAPGGKGNGKRDKGAKHGITGSIKDPLFHVRLKRLIRIVIPSLK
                     SKEAAMLALHSAFLVGRTGLSLYVADLDGRIVSSLVTANPHAFLMNIARWLLVAIPAT
                     YTNSMLEYLQSELGLAYRTRLTKYALTMYLDPPGVESGGDKDGEQLFYKLANLDDRIK
                     NADQYLAEDIQQLSSKLAEIYSNIAKPVLDVILYNYQLSRNVGAESLVLLTILVQTSA
                     TLLRAITPPFGAYTAHEAKLEGELRFTHSRLLESAEEVALYHGEEFEKNVIERGYFAL
                     VKHINRILKIRVGHGMAEEGVIKWLWGSLGLCICAIPVFGGSALGMKEGDLGSRTEGF
                     VTNRRLLLSSSDAFGRVMYSYKDMAELAGYTSRVSELFETMEHAKKGEYQKKLVSSVS
                     TENNAKILQGRGKIIESDEIEFDQVPLISPNGDVLVKSMSFHVKPGKHLLVIGPNGCG
                     KSSLFRILGGLWPVYGGTVYKPPSNQFTYIPQRPYLCTGTLRDQIIYPHSHADMLSHG
                     KSDEDLSKILEVVEMAGIIEREGGWDAVREWRDTLSGGDKQRIAMARLFYHKPKYAIL
                     DECTSAVTLEIEKTMYDHATSLGITLMTVSHRPSLWKFHTMVLEYDGQGGYTFTHLDA
                     EKRLALQEEKQELEHKLLSVPKLKDRLEELKMIKEQREFTSGI"
     STS             1200933..1201744
                     /standard_name="Hind3"
                     /db_xref="UniSTS:470762"
     gene            complement(1202826..1204360)
                     /locus_tag="CNC03870"
                     /db_xref="GeneID:3256193"
     mRNA            complement(join(1202826..1202951,1203000..1203338,
                     1203392..1203928,1203981..1204170,1204258..1204360))
                     /locus_tag="CNC03870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656791.1"
                     /db_xref="GeneID:3256193"
     CDS             complement(join(1202879..1202951,1203000..1203338,
                     1203392..1203928,1203981..1204170,1204258..1204315))
                     /locus_tag="CNC03870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512566.1"
                     /db_xref="GeneID:3256193"
                     /translation="MPTKLPRIHTTGWIGLGAMGHPMALNLFLKTHQFYQKVSPSVTP
                     TFLFCEHEDSRAESFIRELRNRGGQDLASRAERVGTGKEMVMGASKVFTMLPSTPQVQ
                     AVYLDQDNGILAGLAKLPMDTPPLSETLLLSDTSLLSNTVTQEEGVKKESPSMIDAST
                     PATQPIHVHTMLVDQTTLDPTVSLSISSLIHDSTSRAALMIDAPVSGGTVAAERGELT
                     IMFGSPAPIATRLAMPLLQMMAREGGVIECGGSGTGVGVKVCNNLVLASNQIALSEGL
                     ALGRSLNIDIALLQSVINTSSGSSWSSRVNPPISSIPGTPASRGYSGGFQTRLMLKDV
                     NLALQAANKHNLATPLTSASKSIYEAICSDGDGDWASKDFSVAYEWVQKKQQEAMDMA
                     WKDGLP"
     gene            1204538..1206572
                     /locus_tag="CNC03880"
                     /db_xref="GeneID:3256227"
     mRNA            join(1204538..1206152,1206201..1206572)
                     /locus_tag="CNC03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_569625.2"
                     /db_xref="GeneID:3256227"
     CDS             join(1204578..1206152,1206201..1206392)
                     /locus_tag="CNC03880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569625.1"
                     /db_xref="GeneID:3256227"
                     /translation="MPRSPSPPPRLPRRPFIEDSPQRFRDRDPRDDYRYRGEPSRYRG
                     PAGFDRDRRDPRDRDWRDRDVERDYDRGSRFGGRQSWYARDRDAERMRERDDRDRIRS
                     PLPVRPGISLIDRDERPRDERPRESIEGSTKARSEGTPEEGQITSPVVAPPTISGLPP
                     RPRSPPRSPPRRRSRSPPPFRRFDRESWRDRERDRERDRFYRRRSPSPYSPIRRRRSP
                     SVSSASTPSRSSRFSPIKRGISPAERSRYTRSPMSEKPQRLTSPEPMSPIDHSRPLSR
                     TSVSGPTRPQTPTSLPPTLSTPQQPAPALAHTQPLSTPSVSTFPKRPPPTGPRSERLG
                     LVPPTGPRALAHLYGGRPAAPRVPYATPIAGLSSTNPTPTATVKNDFHASTTPETPTA
                     TFGAHAPPTGPSSGRLSWSERKNVLSQPHPISTSEQTSNFNPYAPLPSYNGQAANRRG
                     DSSSPAPAPHPSSSVSTTPLPRILTPAAEESPNVEESVVAEEELAERKAKEEQARILA
                     ELPPVLIGFGGSAWETELASHMHHYTSLVQNTLRLQAAQRLAAASLADAEAERVAVME
                     RSKICDEQLMSGTLGVGIIGGI"
     gene            complement(1206573..1208116)
                     /locus_tag="CNC03890"
                     /db_xref="GeneID:3256379"
     mRNA            complement(join(1206573..1206691,1206745..1206818,
                     1206870..1207891,1207941..1208116))
                     /locus_tag="CNC03890"
                     /product="transcription initiation factor TFIIE alpha
                     subunit, putative"
                     /transcript_id="XM_569626.2"
                     /db_xref="GeneID:3256379"
     CDS             complement(join(1206665..1206691,1206745..1206818,
                     1206870..1207891,1207941..1208068))
                     /locus_tag="CNC03890"
                     /codon_start=1
                     /product="transcription initiation factor TFIIE alpha
                     subunit, putative"
                     /protein_id="XP_569626.1"
                     /db_xref="GeneID:3256379"
                     /translation="MSNPQLSSDEIQKLCSDLVYQVAYSFYDVPYIIILKMLVQYNVM
                     TEIDLGQRVGLSPNEVRKYMGTLHLHRLVKRHVNREKQILPEWKKSQLSTQAMRQSYS
                     SNKPPIGDSRTRDVHYWYLDYREFANVTKYRLAMMRKGIDERIKSEVGQRGYQCPQDG
                     RVYDTLDVGHLFDPTTSTFRCEDCQAELIEHDPTIDQENNSSLQDMMQRFNIATAPIR
                     DALKAVEVLTLPSTNVIAWIAQNVKTGVVSVNGQEGGEDSKKFEVVIGGEDDEAKEKL
                     AQAQREQNALPEWYTHSTVTGDATTLGINDINQRAKVAERAKHVGDHETEVGDQALAA
                     HYELLDEEDDVEEVGVDINEGVQLDTVERRDEAEVEEVPAGESLGKTVFVNGQMKKIE
                     DVTEDDQELMTSEEYEAYAQAMYG"
     gene            1208385..1209166
                     /locus_tag="CNC03895"
                     /db_xref="GeneID:36392797"
     mRNA            join(1208385..1208557,1208611..1208682,1208739..1209166)
                     /locus_tag="CNC03895"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658435.1"
                     /db_xref="GeneID:36392797"
     CDS             join(1208464..1208557,1208611..1208682,1208739..1209106)
                     /locus_tag="CNC03895"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514293.1"
                     /db_xref="GeneID:36392797"
                     /translation="MSQWARDEPFRWGESRDGWKTKWRQSCFCGKVAFVYNNDPLQVK
                     ACHCGNCQKLHGAPYQQAAIFPKSSVRLDTPPDHIRFLTASSDFHPLSSSPTPLPRKI
                     SCASCGSPFMDEGRNMIMAFPPLFEFPRGDGEAGVPESLRVQSHIFYGQRIADVVDGK
                     DKWEGHKDQSNKMGDHD"
     gene            complement(1208643..1210788)
                     /locus_tag="CNC03900"
                     /db_xref="GeneID:3256456"
     mRNA            complement(join(1208643..1209309,1209361..1210050,
                     1210104..1210788))
                     /locus_tag="CNC03900"
                     /product="cytochrome c oxidase biogenesis-related protein,
                     putative"
                     /transcript_id="XM_569627.2"
                     /db_xref="GeneID:3256456"
     CDS             complement(join(1209190..1209309,1209361..1210050,
                     1210104..1210679))
                     /locus_tag="CNC03900"
                     /codon_start=1
                     /product="cytochrome c oxidase biogenesis-related protein,
                     putative"
                     /protein_id="XP_569627.1"
                     /db_xref="GeneID:3256456"
                     /translation="MFGLRIGTATLSASQAVRSANSMPTSRKLSTLISTFTPRSALVS
                     SIERPSLASSKAVRQNQLRLLSSATITQTAVDSQLASPVDLPLEPLHEPLLQPASTFL
                     DPLIHPLSEALLSIPHPLGYGTTLILLTVIVRTAFTLPVSLWQKKRAKKMQSVVAPEM
                     KVINEQLAETVAKECRKKGVGYAEYLIELRRQLRKAQKAVHKKHNIHPWVTTWAPLVA
                     HIPIFVTLSLTIRRALDLPGSPMASESFLWLDSLGQADGYGILPLVGMAVAFGNAEVV
                     GRRVKDVRDALEGKVSNEKKAGLSATPVPQSRRIPKPESPKGDINARPSPLFARSPPA
                     NTGPTSHNNQTRSLSTSNSLNVQRQARWKAPTNSLIKEKDDGFVEVGPNDKPPTFSLA
                     RQAEFRRSIFANILRFSAIGFAMIASQMPSGVVLYWFTSLCYSFIQNFFLTVLPQLRL
                     EKQRKEEAVSN"
     gene            1210920..1211958
                     /locus_tag="CNC03910"
                     /db_xref="GeneID:3256294"
     mRNA            join(1210920..1211355,1211410..1211497,1211545..1211641,
                     1211695..1211958)
                     /locus_tag="CNC03910"
                     /product="transcription initiation factor tfIID, putative"
                     /transcript_id="XM_024656792.1"
                     /db_xref="GeneID:3256294"
     STS             1210978..1211796
                     /locus_tag="CNC03910"
                     /standard_name="Bgl2"
                     /db_xref="UniSTS:470759"
     CDS             join(1211024..1211355,1211410..1211497,1211545..1211641,
                     1211695..1211858)
                     /locus_tag="CNC03910"
                     /codon_start=1
                     /product="transcription initiation factor tfIID, putative"
                     /protein_id="XP_024512564.1"
                     /db_xref="GeneID:3256294"
                     /translation="MSLALPSRPSFTPKASQALEREALDEEDDVDDSDLLDISHSRKR
                     LVDVDVDPDLEGEKDDDDDEGNDVGVGIGIGTLGVNLAGAVGKGKGKKRDADDEIEKK
                     GKKRRAETFLLRGQMDEEQARRFDTFSTVAINKNAIKRLNRDLFDQHCPPQLSQVVAG
                     MAKVFVADVIEMAKDLQPHSAHPTGPLQPYHLKLARMCLEEQGMVGSRTQGSASGLRK
                     GKALFRRR"
     gene            1212132..1216835
                     /locus_tag="CNC03920"
                     /db_xref="GeneID:3256676"
     mRNA            join(1212132..1212567,1212615..1212640,1212715..1212787,
                     1212837..1212938,1212987..1213391,1213440..1213518,
                     1213570..1213687,1213738..1213768,1213835..1213903,
                     1213952..1214012,1214062..1214106,1214165..1214178,
                     1214232..1214356,1214405..1214589,1214641..1214713,
                     1214760..1214879,1214922..1214956,1215011..1215399,
                     1215450..1215482,1215539..1215580,1215637..1215785,
                     1215847..1215912,1215961..1216130,1216196..1216216,
                     1216272..1216835)
                     /locus_tag="CNC03920"
                     /product="DNA supercoiling, putative"
                     /transcript_id="XM_024656793.1"
                     /db_xref="GeneID:3256676"
     CDS             join(1212230..1212567,1212615..1212640,1212715..1212787,
                     1212837..1212938,1212987..1213391,1213440..1213518,
                     1213570..1213687,1213738..1213768,1213835..1213903,
                     1213952..1214012,1214062..1214106,1214165..1214178,
                     1214232..1214356,1214405..1214589,1214641..1214713,
                     1214760..1214879,1214922..1214956,1215011..1215399,
                     1215450..1215482,1215539..1215580,1215637..1215785,
                     1215847..1215912,1215961..1216130,1216196..1216216,
                     1216272..1216694)
                     /locus_tag="CNC03920"
                     /codon_start=1
                     /product="DNA supercoiling, putative"
                     /protein_id="XP_024512565.1"
                     /db_xref="GeneID:3256676"
                     /translation="MTIGTIKPRRSLGAIIDSIPSQQEYVPDSCSENSGSDSERDAPI
                     PTLKPIPLTPLPPRSARLISELGADPIKIGKKNEREEARAVPGDGKIDTKVHGAVDTL
                     LAPVLYFAVQWRKPQFKKHKTWDGDANIKVEGNRIVMLDEDGNQMAATNVGDKVIKPE
                     AEFKIGGYEIMVDHVLQQDQFKASTSILNRPKVIPTIKSTGYRPASFTKPFRPPIQKA
                     NLTPAKPSTMEIVNNEQHQSPISSSSKRSIPTPAAAQRAVAASSFYTRQSPKPFNERI
                     VLGEKSNKERLQWGGALFNPHAEGAVVMPRPGEKLAKLKGTTIVDVVLDPVLGNLLRD
                     HQKEGVKFMYSCVMGMTGAEGEGCILADEMGLGKTLQTIALIYTMLKQSPFANQTSII
                     GKAIIVCPVTLVDNWRKEFKKWVDRRVNVLVADGTDYRVSSFVNNKHQHVLIIGYERL
                     RKVVKELASCIPPIDLIVCDEGHRLKSKDNKTIKMFDMLKTQRRIILSGTPVQNDLGE
                     YWAMVNFACPGVLGKYSAFAKHYEKPILKSRTPNCSAKDVELGRERANDLAKLSKEFV
                     LRRTAAVLENYLPPKYEYVIFIAPSLLQLSVLSNLLDPNIVGSFIRGYGAQSLALIDL
                     MRKISNSPMLLKRRDDELARANDDLGSATSAAISAIPSDANINDVTTSGKMLMLDKML
                     HSIYQCTEEKVVVVSNWTSTLDLIQGLCKLKRYNYLRLDGSTPPKQRQELVDRFNKDK
                     GRQESFVFLLSAKAGGVGLNLIGGSRLILFDSDWNPSTDLQAMARIHRDGQKRPVYIY
                     RFLTTNAIDEKIYQRQITKTGLSDQMMDQTRTEKQTSKDSFSAAELRDIFTLNVRTDG
                     CQTHDLLGCQCTRKPVGETRDIAEGEHNSKDLPDNASEESDNDENDHPTFVSANKYDP
                     EPTPKMRRKAIQEQKNKLAALKHWAHFDPFEPASFRGIQDSLLYNVLFDSWETDSAPL
                     SQNIKTYGSLAFESPHERHEDDLDSDEEVLVPKKRKSGIVRSGVMLKKARAADEENTG
                     FSQRRHNLRSIAESGGTGRVTFVFEKISKSTIA"
     STS             1212601..1213531
                     /locus_tag="CNC03920"
                     /standard_name="Stu1"
                     /db_xref="UniSTS:470760"
     gene            complement(1216770..1218247)
                     /locus_tag="CNC03925"
                     /db_xref="GeneID:36392798"
     mRNA            complement(join(1216770..1217001,1217061..1217280,
                     1217344..1217580,1217679..1217725,1217793..1217858,
                     1217924..1217990,1218077..1218247))
                     /locus_tag="CNC03925"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658436.1"
                     /db_xref="GeneID:36392798"
     CDS             complement(join(1216829..1217001,1217061..1217280,
                     1217344..1217580,1217679..1217725,1217793..1217858,
                     1217924..1217990,1218077..1218136))
                     /locus_tag="CNC03925"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514294.1"
                     /db_xref="GeneID:36392798"
                     /translation="MKYIYTHLKEFFKVSDWNEDIKGPFGLQPPPGDWAEFKRRIAEL
                     QQQCPEGEGIKVIFAARHGQAQHNTIKEIYQIPDDIGQILHPILDPDLTDLGRSQAAD
                     LGYALQREVKRGMPLPNKWYVSPMKRAGETCGIEWGWLFEENKGKGKSHGVPATVIEN
                     VREHLHVHECDKRSSLSELQRDFPSFTYTPEVKEEDELWQSGEVRNRETEEELVARCG
                     AGIAQVLDMSNDSTYISITSHSGALRGIYKSLGVPSRNLIVGEMNILVLRVKKIEELK
                     RTDKGTGEVTVRA"
     gene            complement(1218654..1222120)
                     /locus_tag="CNC03930"
                     /db_xref="GeneID:3256310"
     mRNA            complement(join(1218654..1219052,1219104..1219244,
                     1219303..1219498,1219559..1219691,1219752..1219926,
                     1219981..1220078,1220128..1220279,1220335..1220431,
                     1220501..1220522,1220574..1221346,1221406..1221448,
                     1221506..1221594,1221653..1221668,1221759..1221770,
                     1221830..1222041,1222095..1222120))
                     /locus_tag="CNC03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656794.1"
                     /db_xref="GeneID:3256310"
     STS             1218659..1219360
                     /standard_name="Pst25"
                     /db_xref="UniSTS:470758"
     CDS             complement(join(1218973..1219052,1219104..1219244,
                     1219303..1219498,1219559..1219691,1219752..1219926,
                     1219981..1220078,1220128..1220279,1220335..1220431,
                     1220501..1220522,1220574..1221346,1221406..1221448,
                     1221506..1221594,1221653..1221668,1221759..1221770,
                     1221830..1222019))
                     /locus_tag="CNC03930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512574.1"
                     /db_xref="GeneID:3256310"
                     /translation="MDFYPPQLAGQSSTTTSLEHLGSSTQANQQPVTPDTVTTENKRK
                     KRTGSSGKDGTKIKKTRQSQSCDACRARKVKCDRPPPGKETDGPIKNMCSHCAQLNLP
                     CTFDYVQRKRGPPNMYLKRIQEDQQVECNENGKSISSTVGSSKFSSEVPATIPRAPPP
                     LQAALRGTPPATSDNTSSEWQPTLGMTMSTTRAAHAGHYPIMSISASSSPSVQAATVP
                     LGLSPLRSRSYLPVSLDPSHSLATSQTPSAQSSPLHLPQHLAYINHTYDPRNPLDSVL
                     PRRLLYHIIDLYFDYIYCLIPCLHRPSFIHDLNTKREENPDQEEWVILVLAVVASTLV
                     QLPRSFVDLPRNEVKDLVLRCHNRIKDYLARDFDTITVTRTIIIYLSLYVYGITGHIV
                     VSHGLFGQNYVFMLALRAHEEGTYATLGNIERVLLRRMFWLMYGGDKTLAFTGAFPVL
                     FHEDDCASVALPDDIDDEYLTEEGYTKQPESYTSVLSGFRYISHLFRVSGEVLDKRRR
                     DKIRSPSGLMLQMRINEINELYNRTMSIMDFCPAPLKLDYRSASASVMSMSPDWDERI
                     KSDIHTIFSDPNEHDMDLVKDFYLVQQANIYVTQQLVRFIIIQYREELLEIQQDEAHH
                     GLDLAQREAMKRSIREQTQDEKDEVVVDMLSILQKIPIQVLAVNSFTIIEKVRSVASS
                     LLDFLDHGEDMGLLPLSSHETRAQKAQRNLWKFLNYLSEIESMYSWHDEKGTGKGF"
     STS             1220242..1220597
                     /standard_name="Tru1"
                     /db_xref="UniSTS:470761"
     gene            complement(1222421..1226531)
                     /locus_tag="CNC03940"
                     /db_xref="GeneID:3256693"
     mRNA            complement(join(1222421..1222631,1222701..1222914,
                     1222973..1224192,1224245..1224719,1224775..1224874,
                     1224931..1225518,1225570..1225656,1225705..1226531))
                     /locus_tag="CNC03940"
                     /product="PM-scl autoantigen, putative"
                     /transcript_id="XM_024656795.1"
                     /db_xref="GeneID:3256693"
     CDS             complement(join(1222817..1222914,1222973..1224192,
                     1224245..1224719,1224775..1224874,1224931..1225518,
                     1225570..1225656,1225705..1226088))
                     /locus_tag="CNC03940"
                     /codon_start=1
                     /product="PM-scl autoantigen, putative"
                     /protein_id="XP_024512573.1"
                     /db_xref="GeneID:3256693"
                     /translation="MSKATSGEASVPSPTQSFSEYLPFLTAALDRLTTNAASLPDKTD
                     LNFHRSLDRRFNKDVEKTSERLLGMTERILDLIERSQKEARQGRDKGKTAKVMIRRRK
                     LEDQDDIIDGYRGAVQGVIDGLLEDADINLDELRGGKGKTSVTVKPALVAQAGKKIPG
                     PFTERLPANIIHASDLTKPQLLFHDAPDNARTSESWKPSLTTKPHAMVPLGFKAPLDY
                     ELTSEEEMDPSKAALRREKEIRARTHPYYYETKHLPYPTSLFIDSKPVPPQSFDETPF
                     EFVDTPEKLHRMVEKLKQAKEIAVDLEHHDMRSYAGFTCLIQISTRESDWVVDTLALR
                     KEIQQDKFGDVFTDPTIVKVFHGADSDIIWLQRDFEIFVVNLFDTYSACVVLEMPQRS
                     LSALLQHYCNFEADKRYQRADWRIRPLPDGMLYYARSDTHFLLFIYDNLRNALLHKSS
                     RPSSPANCGTIVLDSARPNPQEAMREVLGKSADTALKMYERDSYDIVTGRGSGGWLAA
                     GKKWLPKGEIEQESGWVWRHLHDWRDRVAREMDESPFYIMPNNMLRDVSTADNTANLS
                     RIIRRDRAPIAAQYIPEITSIIVAAKEKFKEITAERAANPQVQEMEKIGVKEIGANDV
                     KKVPVAALAVPSVPLASTTSNIWDVAAKPTSTRTNAKSGLFGSAIKFSQPKHASGYIT
                     ASKSGQSALFGVTLDRASNQKSSSAALTLRERELSPGFLKVMESMRMDLHPKGMTSGS
                     SEGDGKMGLNPETVPFIPSNQRKTTATSSLEVRGKRPLGLTSESAHPQSGQKASSSTA
                     YAPTSGIPSTLIKEMSPQKSSKSGTVDEGVVQVKKSKKQKKRERASTTDRAGDDSDSK
                     KAKLGTDGDGEFGAATPPAQAVIPSVELLNTVIVGEGGNANKSTASKNKKKKVKPEDI
                     PAFDYASQPNLLDQPHSVIAQDDAKKKKKKFKEARPSGAGIVEVPTFGARPARDLSQP
                     KQGNKSGTFAR"
     gene            1227662..1229775
                     /locus_tag="CNC03950"
                     /db_xref="GeneID:3256547"
     mRNA            join(1227662..1227795,1227859..1227955,1228011..1228243,
                     1228297..1228739,1228802..1228876,1228942..1229172,
                     1229224..1229249,1229304..1229479,1229528..1229775)
                     /locus_tag="CNC03950"
                     /product="expressed protein"
                     /transcript_id="XM_569628.2"
                     /db_xref="GeneID:3256547"
     CDS             join(1227718..1227795,1227859..1227955,1228011..1228243,
                     1228297..1228545)
                     /locus_tag="CNC03950"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569628.1"
                     /db_xref="GeneID:3256547"
                     /translation="MFALKFILITSFIASTALAHFTLDFPESRGFVSDIEGQFCGGFS
                     TVGPRQPFPLGSGPVHINSHHSLATVVAFISTSSNPTSFDDFNTTSNGTIIPLASNIF
                     QVTQGEKCFNIDLESLNVGLTNGSEVTLQIQYDGGDGDLYQCSDLVLIQGYEVPSNET
                     CTDDASRTSNASSTSSGSATATSAAATSSSSGTSGAIKEVVGLGALSLALGIAGLIIL
                     "
     gene            1232306..1234822
                     /locus_tag="CNC03960"
                     /db_xref="GeneID:3256556"
     mRNA            join(1232306..1232427,1232477..1232769,1232821..1233032,
                     1233085..1233181,1233233..1233349,1233401..1233805,
                     1233859..1233995,1234042..1234224,1234277..1234519,
                     1234570..1234822)
                     /locus_tag="CNC03960"
                     /product="phosphate transporter, putative"
                     /transcript_id="XM_024656796.1"
                     /db_xref="GeneID:3256556"
     CDS             join(1232634..1232769,1232821..1233032,1233085..1233181,
                     1233233..1233349,1233401..1233805,1233859..1233995,
                     1234042..1234224,1234277..1234519,1234570..1234707)
                     /locus_tag="CNC03960"
                     /codon_start=1
                     /product="phosphate transporter, putative"
                     /protein_id="XP_024512427.1"
                     /db_xref="GeneID:3256556"
                     /translation="MSSQFEVEKAHANVPMSAGERRRAALAEIDEASFSWFHAKACIV
                     AGVGFFTDAYDIFSISIAATMIGYVYHNGGSNTSNQDLGIKVAHSIGTFFGQLLFGYL
                     ADHIGRKRMYGVELIIIIIGTLGQAVAGHAPGVNIYGVLIMWRFIMGIGIGGDYPVSS
                     VITSEFAARKIRGRMMAAVFSAQGWGNFTCAIVAVIVVAAYKDSIHSQPLDDLKSVDQ
                     AWRLIIGIGCVPAVIALYFRLTIPETPRYTMDVERNIKQASQDVDAYITTGQYIADPV
                     QINDRAEVPKASWSDFARHFGQWQNGKVLLGTSWSWFALDIAFYGLGLNSSTILSTIG
                     FGSSTDLPTKQENIYQTLYNVAVGNIILAVGGLIPGYYFSMAFIDSWGRKPIQLMGFV
                     LLTIIFVCMGFGYDKMLSTDPGKKAFVFLYCMANFFQNFGPNTTTFIVPGEVFPTRYR
                     STAHGISAASGKLGAIVAQVGFSRLINIGGTNQFLKHILEIFAFFMLTGVFSTLLLPE
                     TKNRSLEDLSQEDQESFVRNSGTATAVPMVQKTGTSSDDERVLAEAL"
     gene            complement(1236273..1237860)
                     /locus_tag="CNC03970"
                     /db_xref="GeneID:3256792"
     mRNA            complement(join(1236273..1236668,1236723..1236983,
                     1237037..1237221,1237282..1237428,1237480..1237535,
                     1237587..1237860))
                     /locus_tag="CNC03970"
                     /product="nicotinate-nucleotide diphosphorylase
                     (carboxylating), putative"
                     /transcript_id="XM_569630.2"
                     /db_xref="GeneID:3256792"
     CDS             complement(join(1236580..1236668,1236723..1236983,
                     1237037..1237221,1237282..1237428,1237480..1237535,
                     1237587..1237754))
                     /locus_tag="CNC03970"
                     /codon_start=1
                     /product="nicotinate-nucleotide diphosphorylase
                     (carboxylating), putative"
                     /protein_id="XP_569630.1"
                     /db_xref="GeneID:3256792"
                     /translation="MSETDLKPGQNLAHLLPPSWSAEVQRWFAEDTPSFDWAGFVVGE
                     EEQEAILWGKSGGVLAGVPFFEEVFKQVDCAVEWLMPEGSVVPPDTKTKVAIVRGKAR
                     QLLLGERVALNTLARCSGIATVSRRFRDLARAEGWKGVVAGTRKTTPGFRLVEKYGMM
                     VGGVDPHRHDLSSMVMLKDNHIWATGSITSAIQTVRRVAGFSLLVNVECQNFKEADEA
                     VTAGANIVMLDNMVGEDLHSAARRLKEKWQGQREFLIETSGGIIEGSLTGRVGPDIDI
                     LSTSAVHQSCPHVDFSLKIQPRKSS"
     STS             1236793..1237599
                     /standard_name="Pst4"
                     /db_xref="UniSTS:470719"
     gene            1238002..1239905
                     /locus_tag="CNC03980"
                     /db_xref="GeneID:3256628"
     mRNA            join(1238002..1238206,1238263..1238359,1238419..1238641,
                     1238691..1238840,1238895..1239079,1239128..1239199,
                     1239249..1239905)
                     /locus_tag="CNC03980"
                     /product="kynureninase, putative"
                     /transcript_id="XM_569632.2"
                     /db_xref="GeneID:3256628"
     CDS             join(1238089..1238206,1238263..1238359,1238419..1238641,
                     1238691..1238840,1238895..1239079,1239128..1239199,
                     1239249..1239765)
                     /locus_tag="CNC03980"
                     /codon_start=1
                     /product="kynureninase, putative"
                     /protein_id="XP_569632.1"
                     /db_xref="GeneID:3256628"
                     /translation="MSNDLPTKKDLVKWDQEDALNWTRGEYEIPNSKACGGEADGKAI
                     YFCGNSLGLLNKKARQHIMEELDVWSTSSVTGHFNHPYQRPWKHVDEPLTPHLAKLVG
                     AREEEVAHTSTLTSNMHNLFTSFYQPTEKRWKIVIEKGSFPSDWYAVHSHPRLHDKVL
                     RPEQIDNAIIALVPREGEDTLRTEDILKVLDDNKDSIAIVWLPLVQYYTGQLFDISSI
                     SPKVHEIGALLGLDMAHGIGNVECKLNEWNVDFAVWCTYKYLNAGPAAIGGFYIRSGL
                     EDGGRRLAGWWGNDARTRFHMSPNFQPTPGAKGYQHSCTPVFSSIPLLATLQLIEAVG
                     FSNMVEKARRLTGTLEALLKASRYHVHPADPKGKIGFKIITPAAPYRGTQLSLVILPE
                     EEHVMPKVFDRMLRKGLVGDERKPSVIRLSPVVLYNTFEEVGRAVEIVEEALEEEEEE
                     RKR"
     gene            1240672..1242139
                     /locus_tag="CNC03990"
                     /db_xref="GeneID:3256675"
     mRNA            join(1240672..1240955,1241007..1241213,1241284..1241473,
                     1241528..1241748,1241798..1242139)
                     /locus_tag="CNC03990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569634.2"
                     /db_xref="GeneID:3256675"
     CDS             join(1240746..1240955,1241007..1241213,1241284..1241473,
                     1241528..1241748,1241798..1242049)
                     /locus_tag="CNC03990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569634.1"
                     /db_xref="GeneID:3256675"
                     /translation="MPAATISPKTLPPGVYCPTITFFEPTAEQNLDVETHVKHMEFLA
                     KSGLAGVVVQGSTAEAVTLDDEERKTLIRTAKEAFKRCGNHGPVIAGTVGAQSSRQAL
                     KLCQDAAEAGADFALVLPPSYYPAAMSADAIQSFFEELASASPIPIIIYSYPGVCSGI
                     NMDTDLICRLARHPNIAGVKHTDHDVGRIGRETAQSMGNAFGSPFTILGGASDYLLGT
                     VAVGGQGAITGMANVAPRVCVKAFELARAGRYEEALQYARVISTAEWGMGKGAILGTK
                     YMTAWANDYAPTAALARKPLPLCPESTKQHVRAVGTEIVALERSLEQQGWAGAAMRGE
                     TQSEKVLAPSKKINGIVNGAEEVAI"
     gene            complement(1242108..1243852)
                     /locus_tag="CNC04000"
                     /db_xref="GeneID:3256700"
     mRNA            complement(join(1242108..1242276,1242327..1242884,
                     1242930..1243084,1243148..1243354,1243401..1243654,
                     1243715..1243852))
                     /locus_tag="CNC04000"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569636.2"
                     /db_xref="GeneID:3256700"
     CDS             complement(join(1242170..1242276,1242327..1242884,
                     1242930..1243084,1243148..1243354,1243401..1243654,
                     1243715..1243801))
                     /locus_tag="CNC04000"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569636.1"
                     /db_xref="GeneID:3256700"
                     /translation="MPPHMTQATELIDWIVSNGGYFHPSAKLQVDESTGLSVFADNTI
                     KPEEKLVSCPFSLAVTSELATQAVCEIAGVEKGQLIWPKGHAKEGKPWNERMRIGAYL
                     GFHWIYQERPETEWPRSLVHKTYLASLPPASNLSTPLYFTESELQLLSGSNLLGAVED
                     RRKEWSAESAALRSVLKEDGLTWERYLATATYMSSRAFPSKLLDLPPDGEMTPQPTRI
                     DGVSKPALLPGVDIFNHARGQPILWLSSLVSIPNGSRGVPSISLVSSSVCESGSQLFN
                     NYGAKPNEELLLGYGFVLDSNPDDIVNLRLGIASLPEPINERLQSKGLDARERFELRR
                     NGEVDKRLLEIMRVLLGGGNVEDEVDDDDEHALHEKEEREMQLELDVLGMLGGMLEDK
                     LEKLRTGSQIKVVDAREEVRRMCAVYRQGQMDILNAAMDKLSDRIERIESLMDEGMGG
                     CPCCS"
     gene            1243999..1244838
                     /locus_tag="CNC04010"
                     /db_xref="GeneID:3256726"
     mRNA            join(1243999..1244142,1244197..1244293,1244352..1244449,
                     1244499..1244838)
                     /locus_tag="CNC04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656797.1"
                     /db_xref="GeneID:3256726"
     CDS             join(1244052..1244142,1244197..1244293,1244352..1244449,
                     1244499..1244722)
                     /locus_tag="CNC04010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512429.1"
                     /db_xref="GeneID:3256726"
                     /translation="MSIPVSSDPSKRSWPQKIFDKCKEQPFVPLGAGATVAALLGASY
                     HLRKGNRTRFNQFLRFRIYAQGVTVVALLIYGSQELAAREKAGVVKRKDDRIVVYPQT
                     SPSPAAPEPFVRSDEPSALPESLSSAVDAKSNAYPLRKEERMKVSEFAKRLKEAEALQ
                     KEEDVSRRR"
     STS             1244345..1245182
                     /standard_name="D1S3695"
                     /db_xref="UniSTS:474273"
     gene            1245066..1247175
                     /locus_tag="CNC04020"
                     /db_xref="GeneID:3256759"
     mRNA            join(1245066..1245234,1245290..1245425,1245480..1245490,
                     1245542..1245622,1245679..1245752,1245800..1246032,
                     1246089..1246189,1246245..1246314,1246367..1246456,
                     1246516..1247175)
                     /locus_tag="CNC04020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569640.2"
                     /db_xref="GeneID:3256759"
     CDS             join(1245155..1245234,1245290..1245425,1245480..1245490,
                     1245542..1245622,1245679..1245752,1245800..1246032,
                     1246089..1246189,1246245..1246314,1246367..1246456,
                     1246516..1247088)
                     /locus_tag="CNC04020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569640.1"
                     /db_xref="GeneID:3256759"
                     /translation="MHQNNPYLKQKPDFARLASRYPKFAPFVSVSEDGYTSINFQDPT
                     ALRELTKCLLKEDWNLDVDLREDRLCPTIPNRLDYIYHVLDLEPHLPSSSLRPLRILD
                     IGTGATAIYPILLARLRPDSRIVATEIDESSYNHAKATLEKNNIPPSSITVLKSPTPD
                     PILFPLLECKGKSEDWDLTICNPPFFASSQEMLQGMELKDRQAHAAPTASDNELITRG
                     GELAFITSMIRESIDIGHKCTWYTTLVGKYSSLQPLIETLREFKIDNYFVINMKQSRT
                     SRWILGWSHTMTRLPDSITRPYAIMENTTFAQLLPSSNTVRFNAPPPVSLTTLKAKVL
                     DVLRTVALDPSKDSPDPSQYEGETQNSVLISPRINTWSRAARRMAARQESKAEPEGQG
                     EASKPLTLFRCRIKYVNSHTRPMDGSPSLEIDWLEGRREDREVWESFCNFLLSKLGLS
                     RKRQAEAESDGRPLKSSGRRFQGNYARGRMAM"
     gene            complement(1247129..1249758)
                     /locus_tag="CNC04030"
                     /db_xref="GeneID:3256496"
     mRNA            complement(join(1247129..1247618,1247667..1248866,
                     1248913..1248986,1249039..1249388,1249458..1249758))
                     /locus_tag="CNC04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656798.1"
                     /db_xref="GeneID:3256496"
     CDS             complement(join(1247180..1247618,1247667..1248866,
                     1248913..1248986,1249039..1249388,1249458..1249698))
                     /locus_tag="CNC04030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512572.1"
                     /db_xref="GeneID:3256496"
                     /translation="MPVSAQNSPARPSIRETIAARRAELRNTPKSQRTGDLQTYGSPA
                     GKRAGTPRGFVHLDGSGADLLEDKTVEGQLKKAAKSGKLDIASLELERIPPKVYISLL
                     GLSTTDLSNPPPPPSPPRESLAASRSRTAIGTSPFAVDDEIDVDNSQQGLAFRTWRKE
                     EDIWSEPEELTTLRIGNNKLVEIDREIGMFGGLKILDLSKNLLKGVPDALSDLLRLSS
                     LDLSHNSLPSIPRSVLLLPQLQVLDISHNSITTLSFDSPIGPSEEGLRYGSGFFTTAI
                     QRQTALKSERPILPVLRHLSLGSNTITQEGLKALASVNLKHMRVLNIENNNVSGVLDV
                     QSLGISEKAMPELSHLVLSGNINIRGLIGTIASAAKVDTIGCNLRQATPSFNHEDTST
                     VEDNQDKASSAVETGPAANDEHTLPIPEPDLTIVYRTFPAATFDSEPLAVDFDLYLPS
                     TPAGPSGHPLVIWFHGGGLLQGNKENLPPHFRRLPSHAYTRGDGRPDESVAIISPNYR
                     LAPQVSILDILSEVTVLFDYIQTRLNDRLVKDGKGDHKIDVSRICLSGGSAGGYLALI
                     AGLRVPDEVGDEEIGAYRGLKNEAIKCLAPFYPITDLTDKFWATETNPVPWMNGNSIS
                     HAQAKPHIDTKAAPVCSAVSGGPRSILYPYMLQHSLFPSLLFLTQRSVGQGLDAFRPS
                     PLSLSIPHRLEIASKSSKAKYHVPIFFVYGTIDDKVQPMEKTIEALGRASGDLVIERV
                     EGADHAFDEDPKVECQAFQEWLGKTLL"
     gene            complement(1249770..1252407)
                     /locus_tag="CNC04040"
                     /db_xref="GeneID:3256788"
     mRNA            complement(join(1249770..1250969,1251028..1251272,
                     1251324..1251731,1251795..1252407))
                     /locus_tag="CNC04040"
                     /product="folic acid and derivative biosynthesis-related
                     protein, putative"
                     /transcript_id="XM_570005.2"
                     /db_xref="GeneID:3256788"
     CDS             complement(join(1249973..1250969,1251028..1251272,
                     1251324..1251731,1251795..1252352))
                     /locus_tag="CNC04040"
                     /codon_start=1
                     /product="folic acid and derivative biosynthesis-related
                     protein, putative"
                     /protein_id="XP_570005.1"
                     /db_xref="GeneID:3256788"
                     /translation="MPPDTITISSLTLHLPHGLGPSAFHLTPSPPCPALLSLTIHLVP
                     NSVSATAAGDSMAGLGVNYSSVSKAVYALANDAEKVWSGPWELMRAVSAIPLGFDDVQ
                     SVDIRLGLPKALLHALEAVYKASYAKNGEETGRSCTIRDLKVVCIVGLHEHERKEKQR
                     LELDVKVRGGDWNVWGHKGFADEIYDFVSNSAYGTIESLNHELGQHLLKSRYLGDPTQ
                     SHLEITIRKPSAIPFATPSITIHRSQADYAPSLPSGTACNAPREALERVFVAVGSNIG
                     DRVANITRAVSLLEEAGCKLLGTSRLYESEPMYVEDQDRFINGVIELATPLEPLEVLR
                     LLKHIEKAVGRTKTFTNGPRVIDLDLVFYGHRVVKIGNETDEEDEHGIKWLECPHKRL
                     REREFVLRPLADIDPEFTHPALRRSVGQLLASLPTTFPPSLSPIIPLHSHSSPLRLSI
                     PASPYIMAIFNTTPDSFSDGDPARTNVEYALAACEKLLKGPEPPAILDIGGMSTRPGS
                     EPCSEEDELSRVIPLVKAIRSSSNPIVASIPISVDTYRPSVAKAAVEAGASIINDVRG
                     GQEPGMLRVMAEADVPVVLMHSRGDSKTMIAADVQDYDSHGGVIKGVIQEMRVLVEQA
                     LKSGVKRWNIILDPGLGFAKSSSQSLTLLKHLPDLVLPGTGLERLPMLVGASRKGFVG
                     QTIKRAVPKERSFGDAAVSGWCASSGVVDILRVHEPREMAEVVKMACAIRDAE"
     gene            1252481..1253747
                     /locus_tag="CNC04050"
                     /db_xref="GeneID:3256435"
     mRNA            join(1252481..1252575,1252634..1252663,1252725..1253097,
                     1253161..1253747)
                     /locus_tag="CNC04050"
                     /product="dephospho-CoA kinase, putative"
                     /transcript_id="XM_569643.2"
                     /db_xref="GeneID:3256435"
     CDS             join(1252569..1252575,1252634..1252663,1252725..1253097,
                     1253161..1253602)
                     /locus_tag="CNC04050"
                     /codon_start=1
                     /product="dephospho-CoA kinase, putative"
                     /protein_id="XP_569643.1"
                     /db_xref="GeneID:3256435"
                     /translation="MLIVGLTGGIASGKSTVSKLLSERHHLPIIDADLIAREVIEPGT
                     SGYSLVVSHFGPDRILQEDGVSLDRGAIGDIIFHDPEERKWLNGVVHPRVKKEMVKRI
                     IRYWLNGEWCVIVDVPLLIEAGMWKWVGDTVVVYVNERLQLSRLLGRQSNPPLTQSQA
                     SSRIASQLPLSAKLSYATSVIDNSGSFSDLNDQVDRTVAKWKAQQGGDSGWWWRVCWL
                     VPPVGLAAGALSLLAVWRKGKKDRRRGRGEVSRRDNSEQASERIELMELKGGRRRTAS
                     GSVTDEE"
     gene            complement(1253660..1255322)
                     /locus_tag="CNC04060"
                     /db_xref="GeneID:3256171"
     mRNA            complement(join(1253660..1255074,1255125..1255322))
                     /locus_tag="CNC04060"
                     /product="expressed protein"
                     /transcript_id="XM_569645.2"
                     /db_xref="GeneID:3256171"
     CDS             complement(join(1253902..1255074,1255125..1255172))
                     /locus_tag="CNC04060"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569645.1"
                     /db_xref="GeneID:3256171"
                     /translation="MSEAGSASTPQSNATKDRHEPRGRKPNDQLPPSRAREVQRAFRL
                     RRAEHLASLEERILQLETENTQLRALLSLPAADRPKIGSGPTGRGKALKEGGVPMSER
                     VRARKEARERERRALGLPEADTTDMSEAERGNGRDSATLSPRATSGAGPSNATAAAHT
                     AQQQPNVPHLSNPQNVPALFNSPADVSPAPFNYQLPMPFNLPVSPDTQFADFTNNIDN
                     SLYKNNTTSATPNFGGMFSMFSSADHNGDSSANGSGVNKPSPISPPLTNPPHAPSPSQ
                     LDLLTRLKSCCHVSDSHVVNDPGLLVFATRLCQSFGCSFGGTHTEANPRSDAENLTLE
                     DAWHALKATLDPGGDADGENRINTGKMAAELVVRAAHSRGAGGWISCRYREGLSIRRN
                     MVQALVQGLGGKLD"
     gene            1255547..1257949
                     /locus_tag="CNC04070"
                     /db_xref="GeneID:3256626"
     mRNA            join(1255547..1255603,1255678..1255702,1255743..1256204,
                     1256258..1256411,1256468..1256660,1256712..1256733,
                     1256792..1257949)
                     /locus_tag="CNC04070"
                     /product="urea transport-related protein, putative"
                     /transcript_id="XM_024656799.1"
                     /db_xref="GeneID:3256626"
     CDS             join(1255587..1255603,1255678..1255702,1255743..1256204,
                     1256258..1256411,1256468..1256660,1256712..1256733,
                     1256792..1257799)
                     /locus_tag="CNC04070"
                     /codon_start=1
                     /product="urea transport-related protein, putative"
                     /protein_id="XP_024512432.1"
                     /db_xref="GeneID:3256626"
                     /translation="MGATGESFLPQVVGLFYATFDPSLGPVVRYQVPENLISDSTTEE
                     ARSPSNSRSRSRSRASRFVSPSPSPSPLPNRTLLNFGPISEYVIPKKSLHGRLVTLLT
                     TGTGCDEDEQAGYRVMGFPNVMTAPEGTYTRNEYMWNLCFVFHSSSSLEAFEPVVRKC
                     ARILRSAERDSAYLSKPSPDHTALPAVLEQLFEDLNSYSETSIPLDGFNSLELKLFPF
                     YPNPPDCDDWHVPVALVDLNAHKDDNWDITAARVCQFIDGVNHVKKIAELAKADEALT
                     RETLRHMLYYQVIMMIDIFQYSNMYTLKPIISRLSADETIISECACYVTRSGFPLPDW
                     PTLLQLYSRFQPGITVHDWIEAHEVLSMGIDPRRFVSFGIIKGFLRRVNRWPKLVERR
                     EPLIHVPEHRKRVGFDDSVRGNSSGFYRDRDRSQSQIHLYQQGHQHTSGFHPNDSAAS
                     LSRGILGGESTFTLRSVGSNASLGVSPSSIPTRTPPSLHGRSPRRHPFAPSTAGTGST
                     HTALPRSHVSAAESHPSTSSRRAIGGSITGTNTTGGLVPGGSGFNIRYGLNTRQREEA
                     AAVKQAEELEEELIGFLDGSHHADEIQVRFGWSWGQLEKILGLDEMTGGMGRKGVTVV
                     YR"
     gene            complement(1258027..1259635)
                     /locus_tag="CNC04080"
                     /db_xref="GeneID:3256226"
     mRNA            complement(join(1258027..1258405,1258511..1258843,
                     1258916..1259297,1259379..1259635))
                     /locus_tag="CNC04080"
                     /product="galactinol synthase, putative"
                     /transcript_id="XM_569649.1"
                     /db_xref="GeneID:3256226"
     CDS             complement(join(1258090..1258405,1258511..1258843,
                     1258916..1259297,1259379..1259463))
                     /locus_tag="CNC04080"
                     /codon_start=1
                     /product="galactinol synthase, putative"
                     /protein_id="XP_569649.1"
                     /db_xref="GeneID:3256226"
                     /translation="MVVSPPLTPGVQGSRAWVTLVTNPAYVAGLLTLHRTLSSLSAYP
                     LLVMTTPSLPATHSSLLRSLGLNLVPVSHLSPSSSQHPGFDPSFSRFNDAWTKLQVFG
                     LTEYDKVILIDCDMIFLKDMDELFDFELPGRDWIGASPACVCNPLKLGHYPKDWIPAN
                     CSLSMQQSPTSLTSPPIPSPSAPRTAHLLNSGLVILHPSSTVLASLIDFINTSPTIAH
                     VKFADQDVIAEAFKGRWRPLPWWCNALKTLRAVHKPLWRDEEVGIIHYILDKPWSARP
                     PSLPPHQHPSPALPPSPASLDGSDDGQASYHVKPQIRRRPLPSGLLDAVRNSPPQKSL
                     TDYSEVDAWWWIVYEDLLDDLKARGVDWEAVDKWVTR"
     gene            complement(1259870..1261720)
                     /locus_tag="CNC04100"
                     /db_xref="GeneID:3256602"
     mRNA            complement(join(1259870..1261164,1261217..1261277,
                     1261334..1261454,1261516..1261720))
                     /locus_tag="CNC04100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656800.1"
                     /db_xref="GeneID:3256602"
     CDS             complement(join(1261023..1261164,1261217..1261277,
                     1261334..1261454,1261516..1261653))
                     /locus_tag="CNC04100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512599.1"
                     /db_xref="GeneID:3256602"
                     /translation="MSQSKPPSPPLNIPSGNSQITPDPEPLKPDETLSGDKFHDFKAA
                     LRRIDPRQDLENIGKIPCARNSLLYGIAGGVGVGAVRFLGSRKPWLAANWAVGSFIAI
                     SIFQWETCNRARRKELAQMRIIQERYPHRHVSKLQKNNQNSEAGQGEQQSS"
     gene            1261907..1263897
                     /locus_tag="CNC04110"
                     /db_xref="GeneID:3256614"
     mRNA            join(1261907..1262194,1262245..1262275,1262332..1262661,
                     1262722..1263034,1263084..1263321,1263372..1263897)
                     /locus_tag="CNC04110"
                     /product="AAA family ATPase, putative"
                     /transcript_id="XM_569653.2"
                     /db_xref="GeneID:3256614"
     CDS             join(1261998..1262194,1262245..1262275,1262332..1262661,
                     1262722..1263034,1263084..1263321,1263372..1263813)
                     /locus_tag="CNC04110"
                     /codon_start=1
                     /product="AAA family ATPase, putative"
                     /protein_id="XP_569653.1"
                     /db_xref="GeneID:3256614"
                     /translation="MFRSSLPQRTSHNSASEAGPSIPTPIPTDGDAVTLENASNTTGE
                     ATLSSSGSSEGESLISKMMADNPYFSAGAGLMGIGVALTALRRSITLGATMAQRRMLV
                     TLEIPSKDRSYPWFLEWMAHQSAAQTRGNVKPPGLFGWGQGMRSHELAVETSYKQHEN
                     GASEAIFNLVPGPGTHYFKYGGAWFQVKRERDSKLMDLHSGTPWETLTLTTLSTSRDL
                     FSSLLEEARTLAEASTEGKTVVYTAWGVEWRPFGKPRRRREMGSVVLGKGIAEEIESD
                     LKGFLGRGKWYAERGIPYRRGYLLHGPPGSGKTSFIQALAGSLNYNICLMNLSERGLT
                     DDKLNHLLGLVPERSFVLLEDIDSAFNRRVQTSEDGYKSSVTFSGLLNALDGVASSEE
                     RIIFMTTNHYDRLDPALIRPGRVDIQQLLDDAAGEQAKRLFVKFYGNSVNEDGTKGRV
                     LREGELPLNDEEVESLGNSVQRIVDDERAHGKVVSMASLQGHFIRTGAKESLDGIREL
                     CRPREGQA"
     gene            1264075..1266187
                     /locus_tag="CNC04120"
                     /db_xref="GeneID:3256682"
     mRNA            join(1264075..1264301,1264367..1264569,1264621..1264901,
                     1264957..1265107,1265169..1265348,1265411..1265475,
                     1265542..1265739,1265818..1266187)
                     /locus_tag="CNC04120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569655.2"
                     /db_xref="GeneID:3256682"
     CDS             join(1264184..1264301,1264367..1264569,1264621..1264901,
                     1264957..1265107,1265169..1265348,1265411..1265475,
                     1265542..1265739,1265818..1266142)
                     /locus_tag="CNC04120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569655.1"
                     /db_xref="GeneID:3256682"
                     /translation="MSQSRARKVLIVGAGPVGALTALSLHRRGWEVEVWETRDDPRGQ
                     DAAPSNLRSINLAISSRGLEALRSVDPSIAENFLEEAIPMKGRMIHHTDGKQESQLYD
                     PIGGQSINSISRPILNQRLVQSLPEAVKLRFNTKLKHIDFKNRVAYASHKQETSLLPG
                     EESEKDKKQNTEDEDGTAFDLVIGCDGSWSKVRTAMMRAERIDFSQSFIPHAYIELHM
                     PSDPAFPGGYAMDKNHLHIWPRHAFMLIGLPNKDGSFTLTLFIPFSSLELLDTRESAA
                     AFFREHFPSAVDIVGEKVLLDDFEKNPRGNLVTINCTPSAWSSHAILLGDASHSMVPF
                     YGQGLNCGLEDVRVLSSILERHHISPTTTLALGETDPELELALKAYSDERQGDLKAIC
                     ELALQNYTEMRSHVLSPLHHLRRQVDKVFTTLFRSAPQATLSLMEPFPTKKVRGWTSL
                     YEMVTFRPDVGYSEALRKERWQKDVVGYAGWIGGVVGVGAAGVFAATMAKKWLERR"
     gene            complement(1264802..1268143)
                     /locus_tag="CNC04130"
                     /db_xref="GeneID:3256307"
     mRNA            complement(join(1264802..1266986,1267034..1267616,
                     1267663..1267794,1267845..1268143))
                     /locus_tag="CNC04130"
                     /product="Dihydroorotate dehydrogenase, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_569657.2"
                     /db_xref="GeneID:3256307"
     CDS             complement(join(1266247..1266986,1267034..1267616,
                     1267663..1267794,1267845..1267970))
                     /locus_tag="CNC04130"
                     /codon_start=1
                     /product="Dihydroorotate dehydrogenase, mitochondrial
                     precursor, putative"
                     /protein_id="XP_569657.2"
                     /db_xref="GeneID:3256307"
                     /translation="MPLMRLVADPEQGHKLAVRVLAWDKWARPRDMGVDGAELQAELF
                     GMHLKNPVGIAAGFDKDAEAIDGLFDLGFGYVEVGSVTPEPQPGNPKPRFFRLEEDDA
                     CINRYGFNSLGHGHALARLRLRLAKFAQDHPSLFPSPLPANLVPPAGLPRSLRAGQLL
                     AVNLGKNKASDPDSNDDYVRGVRTLGPFADVVVINVSSPNTPGLRALQGKQQLERLLN
                     DVVEERNKIAQGTGLPKIAVKVASDLSEDELADVASAVRSSGVEGVIVSNTTIRRKEL
                     NLVSGNQDQIGGLSGKPLFPYALNALKTLRPLLPPSIPIIGCGGISSGSDALTMANAG
                     ASIVQVYTSFGFRGVGTPRLIKDEITEHLKGESWKTHVGRDWASSGQPMGWDENRLKQ
                     ESQALVDEANGLAELLRQSNDKAETAKLIEDAERALGIVKEKDGAASAATVVDETMPS
                     LPPQAAVPSQGGGFGIEGVGAPSIGEALIAEPVPQVDLAPIVVLEEKKDNVDDRREGG
                     ERDNEWKQAVKAGPKRLV"
     gene            1268309..1269878
                     /locus_tag="CNC04140"
                     /db_xref="GeneID:3256820"
     mRNA            join(1268309..1268378,1268425..1269107,1269165..1269878)
                     /locus_tag="CNC04140"
                     /product="phosphoribosylglycinamide formyltransferase,
                     putative"
                     /transcript_id="XM_024656801.1"
                     /db_xref="GeneID:3256820"
     CDS             join(1268336..1268378,1268425..1269107,1269165..1269236)
                     /locus_tag="CNC04140"
                     /codon_start=1
                     /product="phosphoribosylglycinamide formyltransferase,
                     putative"
                     /protein_id="XP_024512568.1"
                     /db_xref="GeneID:3256820"
                     /translation="MPRTRRITVLISGSGTNLQALLDAAGTPRLPGAAITAVISSRSN
                     AYGLTRARTHAPPIPAAVCALKTFLNRNPGATREDYDAEVARQVLDTRPDIVVLAGWM
                     HILSDRFLDILDGKKEPPPAPALPPPAPSSLPTQTEPIPSHAPGAVSQNAQATSELPP
                     PPPSQSFPVPIINLHPALPGAFDGAHAIDRALEAFQKGEVTRTGVMVHRVVAEVDRGE
                     PLLVKEVEIKPEDRLEDLEERIHSVEHEIIVDGARLIIEQLDRQGRP"
     gene            complement(1269226..1271730)
                     /locus_tag="CNC04150"
                     /db_xref="GeneID:3256563"
     mRNA            complement(join(1269226..1269467,1269522..1269621,
                     1269686..1269848,1269912..1270059,1270125..1270180,
                     1270240..1270590,1270654..1270893,1270947..1271200,
                     1271259..1271357,1271425..1271508,1271577..1271730))
                     /locus_tag="CNC04150"
                     /product="family II 2-keto-3-deoxy-D-arabino-heptulosonate
                     aldolase, putative"
                     /transcript_id="XM_569659.2"
                     /db_xref="GeneID:3256563"
     CDS             complement(join(1269358..1269467,1269522..1269621,
                     1269686..1269848,1269912..1270059,1270125..1270180,
                     1270240..1270590,1270654..1270893,1270947..1271200,
                     1271259..1271357,1271425..1271508,1271577..1271636))
                     /locus_tag="CNC04150"
                     /codon_start=1
                     /product="family II 2-keto-3-deoxy-D-arabino-heptulosonate
                     aldolase, putative"
                     /protein_id="XP_569659.1"
                     /db_xref="GeneID:3256563"
                     /translation="MAPAPAPWHPSSWREKPIAQDVVYEDKDQLETVLNKLRRLPPLV
                     SPVEIDRLRTQLADVAAGKAFLLQGGDCAELFDDCSQDPIEHKLSLILLMSLIILHGS
                     RLPVVRIARIAGQYAKPRSKPTEIVEFPTKDGKTEKKEVLSFRGDNVNGYDPTDRAPD
                     PQRLLGSYFHSTATLNYIRTLLSSGFANLHNPVDWSFSHVRSPELQQAFSSVIESLQD
                     SLEFMKVATGAVGGGERGGMETVDFYTSHEALLLEYEEAFTRSWDSTTLSPPATGDST
                     PILSRSASRIREASSSSSYPHSPARRPKSPKNLSDSINSLSMSVGDLGKGEAKKWYNT
                     SAHFIWIGDRTRQLDGAHVEYFRGIANPIGIKIGPSMEPEEIVRVLDIVNPDKIPGKV
                     TLIGRYGAAKVDQFLPKHIDAVLRTDHPVVWQCDAMHGNTKSSVHDPTLKTRHFVDVI
                     TEITRSMEIHKEKNTILGGVHLELTGEVNDDGYSVTECIGGSMELEDKDLSFNYRTHC
                     DPRLNYEQSLDVAFLLADYLKSKRRGERPHDILLASLRGRKNDVEK"
     gene            1272257..1273715
                     /locus_tag="CNC04160"
                     /db_xref="GeneID:3256499"
     mRNA            join(1272257..1273196,1273261..1273715)
                     /locus_tag="CNC04160"
                     /product="pria protein precursor, putative"
                     /transcript_id="XM_569661.2"
                     /db_xref="GeneID:3256499"
     CDS             join(1272802..1273196,1273261..1273465)
                     /locus_tag="CNC04160"
                     /codon_start=1
                     /product="pria protein precursor, putative"
                     /protein_id="XP_569661.1"
                     /db_xref="GeneID:3256499"
                     /translation="MLPVPPSVHRLVILFLVAVPLLSIILPVTAAAAGVDAPSKLQPR
                     APQPSRRMGATKRSKKIEPLKKKDYSSFLCPGGSVACPIPGDEVSPSSVEALEKSLNS
                     LADWFKVGFECVELETELNSCGGCLALGSGQDCALIENARTTGCESGSCQVYSCFDGY
                     VVSPDRTSCVKKGSTIPATPVTAVNVEELVADDQLPLGQ"
     gene            1273893..1275575
                     /locus_tag="CNC04170"
                     /db_xref="GeneID:3256544"
     mRNA            join(1273893..1274037,1274094,1274170..1274179,
                     1274239..1274260,1274314..1274537,1274593..1274658,
                     1274715..1274955,1275005..1275135,1275193..1275575)
                     /locus_tag="CNC04170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656802.1"
                     /db_xref="GeneID:3256544"
     CDS             join(1273965..1274037,1274094,1274170..1274179,
                     1274239..1274260,1274314..1274537,1274593..1274658,
                     1274715..1274955,1275005..1275135,1275193..1275213)
                     /locus_tag="CNC04170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512438.1"
                     /db_xref="GeneID:3256544"
                     /translation="MTALLAQRVLPQIEYAIFDMDGLLIDSERIYTEVTNAILGRYGH
                     TMTWDIKAGVMGKPQRIAAEYILSHFPDILEKLTVEEFIAEGVQRREELFKRVEPMRG
                     AAELVKGLHAAGIPIALATGSTMPNFIHKTTHLPHIFSLFPPTSILTADSPEVKRGKP
                     NPDIFLAAAHSLGRDVGTADECTEEQKAERSRGLVFEDARPGVLAGIAAGMNVIWVPD
                     AELLALNPGETYGATEVLTHLEEWDPTRWGLPPLPGFNHIPAQP"
     gene            complement(1275225..1277670)
                     /locus_tag="CNC04180"
                     /db_xref="GeneID:3256526"
     mRNA            complement(join(1275225..1275540,1275596..1275714,
                     1275763..1276018,1276067..1276345,1276397..1276610,
                     1276671..1276724,1276773..1276914,1276968..1277313,
                     1277364..1277462,1277538..1277670))
                     /locus_tag="CNC04180"
                     /product="dihydroxyacetone kinase 1, putative"
                     /transcript_id="XM_024656803.1"
                     /db_xref="GeneID:3256526"
     CDS             complement(join(1275287..1275540,1275596..1275714,
                     1275763..1276018,1276067..1276345,1276397..1276610,
                     1276671..1276724,1276773..1276914,1276968..1277313,
                     1277364..1277462,1277538..1277550))
                     /locus_tag="CNC04180"
                     /codon_start=1
                     /product="dihydroxyacetone kinase 1, putative"
                     /protein_id="XP_024512571.1"
                     /db_xref="GeneID:3256526"
                     /translation="MAPAQKHLLNTPQTLVVDSLKGLATLNPNVKLDEAQRVIYTPPT
                     EPKVALLSGGGSGHEPAHAAFVGPGLLSAAICGNIFASPNVAQIRRGLELVTREKGGL
                     VVVMNYTGDALHFGLAAEQHRSAGKVGDVRVLMVGDDVAVGREQGSIVGRRGLAGTIL
                     VYKVAAALSDKGADLDSVENIAKYVASRLGTLGVGLEHCHVPGTRAGTSHLGANEVEV
                     GMGIHNEAGTYKLEMTTASELVGRMLTQITDTTDKDKSFVPFKGDGSDEVVLLVNDLG
                     AISELEMGGLTNEAVKWLQSRKIKVRRVLAGTYMTSLNMPGFSLTLLLLPSASEKAPY
                     SANEILEYLDTPASAPGWKWHAGREPGTLDVKAEEAPIPVQKDNAVLPSTDAKGFLAA
                     IARACKALIAAEPELTEQDQIAGDGDAGLTLEAGAKGVLKAIEEGRLKGENVVQDVKV
                     IAEIVEDDMGGTSGALYSIFFAGLGKSLRDAATNGAKSTSPEVWSKAAAEALATLYKY
                     TRARPPSRTLVDPLDAFVASLPSKGLSSAAEDALAAADKTKELVAKAGRGAYVNQEDL
                     KKREVPDPGAWGIWRILDGLRGFEA"
     gene            complement(1277910..1280312)
                     /locus_tag="CNC04190"
                     /db_xref="GeneID:3256804"
     mRNA            complement(join(1277910..1280031,1280095..1280312))
                     /locus_tag="CNC04190"
                     /product="expressed protein"
                     /transcript_id="XM_569665.2"
                     /db_xref="GeneID:3256804"
     CDS             complement(join(1278125..1280031,1280095..1280158))
                     /locus_tag="CNC04190"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_569665.1"
                     /db_xref="GeneID:3256804"
                     /translation="MLDLSVTPKHGNAGGRYFPHTGHLGVSPVVVQGKVATKLPPVCD
                     PLLVKSISLRIKCTEYRTGGAFEGDLQNTLWEQSQLLLAPPDGEKYLNVGDWDQQFKM
                     AIPIEAATQGRSTMCIREYKVVWRMEVVIEHKPIHYVGTSITKAFALNLQNHQAPPLR
                     PLSPSPSLCIGSDAYVSEACLNVPHGVFGPGDSFHVALLIKPENPTTMVKKVTVVLER
                     LIELVDSKSASRRDSFNDRSPSKRRHVHSSRSYSPTQTSRLTSILRRSLSPRPPFHRL
                     QSDPHTSVGPSVQHEGQVIRDKITESSTTDMTSGGAGFRCSLPMSLPRRTGKWALGET
                     HQTGLVSMSYQLRASITLKGVRRSSPSKTFILPTAPITLISTSTTERLDAVAAAEHKR
                     KKLGSLGKGLYLHGENSSIVDSRDPVHPEEPPALSTVIGVATNIKPILLPPDKSQHPP
                     SQSISFSFPSPSQRSPTVRSLPIQSLLNPETSKSSSNHQLPSPPPTRQGPSSLDVVAD
                     PESGSLLRLFHVQGSGRRISTTTSEEEEVQPSRSRQKLRAEPPTTIAEFEWPSLPSLD
                     TLGLGLPHVPEDHRPRSRPRTAPIHSTFAMSKNGVPPPLSGAFGGPMSGDQLGQRPMT
                     SAGASRGWREEEDAATFAFALPEDKGHIDMRR"
     gene            1281585..1283035
                     /locus_tag="CNC04200"
                     /db_xref="GeneID:3256797"
     mRNA            join(1281585..1281719,1281900..1281973,1282030..1282170,
                     1282228..1282332,1282390..1283035)
                     /locus_tag="CNC04200"
                     /product="thioredoxin (allergen cop c 2), putative"
                     /transcript_id="XM_569667.2"
                     /db_xref="GeneID:3256797"
     CDS             join(1281932..1281973,1282030..1282170,1282228..1282332,
                     1282390..1282416)
                     /locus_tag="CNC04200"
                     /codon_start=1
                     /product="thioredoxin (allergen cop c 2), putative"
                     /protein_id="XP_569667.1"
                     /db_xref="GeneID:3256797"
                     /translation="MVKAIESYDEWKTLTSGSDVVVVDYWATWCGPCKMISPHFAKLE
                     GKFPNVKFAKVDVEEQEDIAKEAQIKAMPTFVAYKDGKVIETVTGAVPAKINALLDKV
                     AA"
     gene            complement(1282491..1284030)
                     /locus_tag="CNC04210"
                     /db_xref="GeneID:3256419"
     mRNA            complement(join(1282491..1283065,1283127..1283300,
                     1283361..1283603,1283659..1284030))
                     /locus_tag="CNC04210"
                     /product="inositol/phosphatidylinositol kinase, putative"
                     /transcript_id="XM_024656804.1"
                     /db_xref="GeneID:3256419"
     CDS             complement(join(1282550..1283065,1283127..1283300,
                     1283361..1283603,1283659..1283802))
                     /locus_tag="CNC04210"
                     /codon_start=1
                     /product="inositol/phosphatidylinositol kinase, putative"
                     /protein_id="XP_024512598.1"
                     /db_xref="GeneID:3256419"
                     /translation="MDINQRASLTLGTQRSPPDTLDVARFHLQAAGHDGTIDASLDHR
                     NLYKPTTQEEIQFYENINDFDFLIEHPGLVKIKPFIPTYKGCVDRSSYIRSDDSIQTE
                     DAEEVPVYGEGGEVIGYKENIAKKHTQSIVLSNLLYGLLNPIVADFKLGKRWWGSRSG
                     RAKRLRHDKSCAATTSGTTGIMFAGAHTWVPGKETCVSTTKSYGYSLRDDNLSDSMAC
                     VFPSVTDWHLFSKKPHLTLRTDPSSRLQRKPSSDCMADMLSRTLKTIESVTDIRTAMK
                     ESGWSYPGSSLLIAHGVSEFTGKTEVRCALIDFAHAHEHNDELPPDGVDDGLETLSKL
                     LKDRANYLQSYRSTTTRCDDTAEL"
     gene            1284766..1287018
                     /locus_tag="CNC04215"
                     /db_xref="GeneID:36392799"
     mRNA            join(1284766..1285817,1285870..1287018)
                     /locus_tag="CNC04215"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658437.1"
                     /db_xref="GeneID:36392799"
     CDS             join(1284926..1285817,1285870..1285880)
                     /locus_tag="CNC04215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514295.1"
                     /db_xref="GeneID:36392799"
                     /translation="MTLRYRPIPLRPILPPYLSLSTHLPINRTPAVPFYRDSKHTVPT
                     KWSLYRSLLRFSKSSKPGYPAHYPEIRNEIKRLWKKHKSLTSIPRVQQFLNGQYDILS
                     AFQLGESSKLSELESRLENKRVLRDLSKSRDRADQASQPDSKPPRLTGGYLRPTLFNP
                     PLPRLKPQPIGLSMMIHNRLRKRERRMEKRRVYASLRTDLKLEVAFWRATEGNDTDWS
                     RRKDERSHFGWDKLLREEIILMDKRFIKENMRSDMVYDSNMMRRVERAKTRKLVWWKG
                     KKEEATSAKREKGMEQCNVTSNQP"
     gene            complement(1285732..1287115)
                     /locus_tag="CNC04220"
                     /db_xref="GeneID:3256720"
     mRNA            complement(join(1285732..1286563,1286622..1287115))
                     /locus_tag="CNC04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656805.1"
                     /db_xref="GeneID:3256720"
     CDS             complement(join(1285855..1286563,1286622..1287109))
                     /locus_tag="CNC04220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512439.1"
                     /db_xref="GeneID:3256720"
                     /translation="MSSLPQKPTENTFQSSSAAGPSKICAVCSSPAKYTCPRCSARSC
                     SLNCSQIHKSRDSCSGIRDPAKFVPLNQYGQGVWSSDYTLLEEGRRQIAGWGKGIKIE
                     EVNGGVVSSRGRGRGSRAPKGQRRSKTDGLRRELERYGCRAEFMPEGMGRKKTNQSSW
                     NPKTEQLHLTVHLIIPSNLILPSPDSTIITSTSFKTITHPRVLFHAREAESLPTISSL
                     LPSLTIPLSEIRFCQPFHSTPFRPAPSHQPNQKIFYPPLDANKPLKDVLKGSAWVEFP
                     EIQLMARENWEEMVDKGEAIITEIEAISQVSGRERDSGWGAKRRLNEVAEGKVQHNGT
                     KRLKSESNQGLLALGEYDSEEGSDAENGAEEADDVSAEEAQDQDPSPEILAAVGRALM
                     ADLEEA"
     gene            1287665..1289224
                     /locus_tag="CNC04230"
                     /db_xref="GeneID:3256732"
     mRNA            join(1287665..1287731,1287782..1287914,1287972..1288031,
                     1288089..1288140,1288269..1288347,1288445..1288529,
                     1288589..1288804,1288859..1288921,1288976..1289224)
                     /locus_tag="CNC04230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656806.1"
                     /db_xref="GeneID:3256732"
     CDS             join(1287882..1287914,1287972..1288031,1288089..1288140,
                     1288269..1288347,1288445..1288529,1288589..1288804,
                     1288859..1288921,1288976..1289053)
                     /locus_tag="CNC04230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512441.1"
                     /db_xref="GeneID:3256732"
                     /translation="MSHSSLDYPEMKELFNRNLKWSENVWARDPSFFPHHFPGQRPEI
                     LWIGCSDARVPETTILGCQPGDIFVHRNIANLYSPQDDSLNAVLMIALFNFNVKHIVV
                     TGHTNCVGCLTALNVSRLPATPPTTPLQRYVKPLATLARTLYTPDGPPTLDLLVEENV
                     VQQVKNLVESDIIKGNWKKRGADGVVIHGWVYHLEDGTIRDLNVSVGPSGHIPGKKVK
                     SLF"
     gene            complement(1290327..1292507)
                     /locus_tag="CNC04240"
                     /db_xref="GeneID:3256267"
     mRNA            complement(join(1290327..1290612,1290668..1291006,
                     1291059..1291740,1291816..1292081,1292148..1292212,
                     1292266..1292507))
                     /locus_tag="CNC04240"
                     /product="di-, tri-valent inorganic cation transporter,
                     putative"
                     /transcript_id="XM_569673.2"
                     /db_xref="GeneID:3256267"
     CDS             complement(join(1290459..1290612,1290668..1291006,
                     1291059..1291740,1291816..1292081,1292148..1292212,
                     1292266..1292331))
                     /locus_tag="CNC04240"
                     /codon_start=1
                     /product="di-, tri-valent inorganic cation transporter,
                     putative"
                     /protein_id="XP_569673.1"
                     /db_xref="GeneID:3256267"
                     /translation="MGLSRQARIITLLVIDSVFFLIELITGYAVGSLALVADSFHMLN
                     DVLSLIVALYTIRLATSPSSSANSYGWQRAEILGALINGVFLVALCVSIGLEAVGRIF
                     SPPEISNAQLIVVVGSLGLLSNIVGLFLFHDHGHSHGGHTHGAVALPNDEDETSSLIS
                     RDDSVSELYQHPAQTRAQVIETAQEFGYGGTQLSSSLDSRAGHLAKSPNAGGHGRTGS
                     ASRRTKRGSFSRAGGHSRLGSANIVPPVPGQNDVLPPVGGDGNSTSSSTVIDNGKKKA
                     SKKDDHDQDHGREREQGSDSGKKLAGNASDAESGHTHGSPAEHGRHGGHGHSHGAMNM
                     RGVFLHVVGDALGNVGVISAGLVIWFCQGRWTLYFDPGVSLVITCIIFSSALPLVKSA
                     SYILMQGVPSHVSLDAVRQCIYEVPGVDSVHELHIWQLSESTVVASVHVMIEAGRDYM
                     VVASGIRERMHSHGIHSVTIQPEFYCEETDPQDTEACLIRCPPGQCSGDTCCPPGVKI
                     TGPEGDEGNGHDHEH"
     gene            1292890..1295327
                     /locus_tag="CNC04260"
                     /old_locus_tag="CNC04250"
                     /db_xref="GeneID:3256265"
     mRNA            join(1292890..1293872,1293920..1295327)
                     /locus_tag="CNC04260"
                     /old_locus_tag="CNC04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656807.1"
                     /db_xref="GeneID:3256265"
     CDS             join(1293066..1293872,1293920..1295242)
                     /locus_tag="CNC04260"
                     /old_locus_tag="CNC04250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512443.1"
                     /db_xref="GeneID:3256265"
                     /translation="MGDDPILCPYCDKPLPPSLFAQVAEHSHRHQTLGPSRPSSVPSS
                     AVSAKLGPTPGHKSADKTTSDALSATVRNGDAANHSAVVNTISPADIARWSSLAGISI
                     TMPEPSGPSQGIHKAKDADAKPFPMIPPPPPPNKLTRPPPASRHNSADSGSRFGFFRR
                     DSKREDDSDGEGEDRGSGYAKLGAGGSDDEEEVTSGKKEQHDGVNEGDDDAKVEDNAS
                     LDLGDQDKNGQVEDEGRPESTAKDPGEVSSVDSNSDLKNVMQEILTKVNQMTASHNQL
                     LDSHSSLLTSLKIARSNLAMAEANSEMLEEQLKRQPSTSSARVVSGPAASPVTSNFTH
                     ASRPSSPMPGNISDQRARPSSLNLTSLPTNSAPSSAAPESSKSWFWSNNKKRPNEAPV
                     TGGRTSGEYLKGLTSPPMAVPYGGALPEGRPMPARSATHSGQLATGVSKSLGADSILS
                     KQSSTRPSTPTQTPGPVPVSNAELASLRTAYSSALSKLSSLTAELTDLKRTNSAMEAE
                     LESLSQALFEEANKMVADERKRRAEMEENLKEVREEREALKETVKVLGGKVSPPNEDA
                     DAKPPKKNEPEEVEEENIIPRDLDKHYAALRKSIHNVASPPISPPADASRLPATFELP
                     ESGLASRASPEEVGRPLSVSLPDESNPWASSANSAAAAAAAAPVGLGLGVDEEGSVPT
                     EFRLSVVTPSPRKEKTGEGLESGAGLS"
     STS             1295041..1295218
                     /locus_tag="CNC04260"
                     /old_locus_tag="CNC04250"
                     /standard_name="AGC17"
                     /db_xref="UniSTS:470821"
     gene            1295471..1297947
                     /locus_tag="CNC04270"
                     /db_xref="GeneID:3256283"
     mRNA            join(1295471..1295883,1295940..1296557,1296614..1296668,
                     1296725..1296810,1296866..1297947)
                     /locus_tag="CNC04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_569679.2"
                     /db_xref="GeneID:3256283"
     CDS             join(1295562..1295883,1295940..1296557,1296614..1296668,
                     1296725..1296810,1296866..1297728)
                     /locus_tag="CNC04270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569679.1"
                     /db_xref="GeneID:3256283"
                     /translation="MHKNETTSHPPPETTSSTIHQALPPDSLQDHPDTHPVNPLGLFI
                     RPHPTRGNGLFSPRPIPAGTVVEESPVLVLTKEQWEQGQMDGTILGEYGFCWSAGGMA
                     IGLGLASLFNHSSRPNVNFIRSPSTKTIRFVTAKHISPGEELCICYTADESKLWFTPA
                     RGEEEDEVLGGESEGEGDGLPDDVDGLVEDVQQAKLNSSEPTLQAPRPVHISSLPSYP
                     SSSSSSPAPQHTIPPSSLPAPLHSSGHKASGQRHLSKHRQPATLVDDLAWQEDEWKDE
                     KGRDHVGEGKKAGEDWGEVIRVKGPAERENDGNDRELMQVWILEFSDAKLTKTALNFS
                     KEIWPNDVNERLRHLKRVCRRNEDGKEICRIALCPLDEHSADSLSSLMTAFSPLLSSL
                     TPKSWSVPSSGARTQEQLKWKHHIWPVSFSPAPIIPADSSSWPISRKAWVAAGIKRVL
                     KLAVNAKQKSELPVATFCTSAPPCFWPTMDGFIPPTLNLRASSCDTRISESHPLRHAT
                     LNCVASIAHLRTVPPFTDVPPTRNGADYLLTSLSLFISHEPCVMCAMALLHSRVREVF
                     YVFPRKKGGGFEYNEGNEYGEGSPVHQHDEGAGTREDISGQGGFGIHARRDLNHRFEV
                     WKWNGHVDEDVRKELEIDENLQL"
     STS             1296428..1297122
                     /locus_tag="CNC04270"
                     /standard_name="Eco4"
                     /db_xref="UniSTS:470757"
     gene            complement(1297928..1301958)
                     /locus_tag="CNC04280"
                     /db_xref="GeneID:3256258"
     mRNA            complement(join(1297928..1299282,1299334..1299644,
                     1299694..1300308,1300355..1300890,1300944..1301361,
                     1301411..1301440,1301494..1301653,1301735..1301802,
                     1301850..1301958))
                     /locus_tag="CNC04280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656808.1"
                     /db_xref="GeneID:3256258"
     CDS             complement(join(1298469..1299282,1299334..1299644,
                     1299694..1300308,1300355..1300890,1300944..1301361,
                     1301411..1301440,1301494..1301616))
                     /locus_tag="CNC04280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512570.1"
                     /db_xref="GeneID:3256258"
                     /translation="MTTDISTRPDFKADDLVSAMGEVTLNGSGRNGHEALDLAETAEV
                     SNQAVQERLEQKRLEHERARLAQRAKFEQQMRELEANQLAEERQLMSATSPLPAGEAA
                     SAPTTPPGHASLGSSVHDLHKEAPAPIGSLVPGPREGLNGAKSMPGSRRTSTYGGTFG
                     MEKMSLSVMTDGSRREWRQEDDDVDAEGAQSSVKYLGMNDDDPFPGIPKQESKHLSAA
                     SAALDLAPLSQTPPRAFGSRPFETSLKTSEWPQFSAVPGASSGPARGVTSPLQASGMM
                     SDELREPTLLGSRKTSPTAGMADSIASLPAMPSKSVPGTPFGFGGAGGGGAGVGKRVD
                     SGEGLSHGQRGFSNPDLARAFGKVGGGFSVGENARQPYNDLYNSFSPVNASLPPSAAV
                     AAAFTPQVAYDPYGFDEDGYGSGSLYPGGSVGLKNKRADQDREFNRFAGVRIEDLKGE
                     LLSLCKDQHGCRYLQKKLEDGDPKHRDMIFNETYGHFPELMTDPFGNYLCQKLLEYST
                     EEQRSAIIDSVANDLVGISLNMHGTRAVQKMVDFLAQPRQPKQIRTLILALSMNVVAL
                     IKDLNGNHVIQKCLNKLIPEDNQFIYNAIAANLIEVATHRHGCCVLQRSIDHASPAQR
                     MQLVTEIIFNSLYLVQDPFGNYVIQYILDLNDARFSEPLIRTFIGNVCSLSVQKFSSN
                     VVEKCIRVADPEIRKVLVGEVLNRSRLEKLLRDSYGNYVIQTILDYCEIGQRMVLVEC
                     IRPILPSIRNTPYGKRIQSKLAREDASFQPYNGYNNNGNNSNRGRGGGGGGNYHSSRG
                     HIGRPQLQHVNALTDIYGGGGPFMQYGHAPAGHMHPAHAGWTPGREPPHMGGPTHTGL
                     SYHAPGPDGQPWLHLRGPGGGPAPNWHLSQDGSHGGVLPGGMNPQMTGASAQAGGAVG
                     AGEEEGLQVGAGAGAWQDPQSGGFYNGPSHVPMM"
     gene            complement(1302191..1303416)
                     /locus_tag="CNC04290"
                     /db_xref="GeneID:3256416"
     mRNA            complement(join(1302191..1302276,1302371..1302394,
                     1302445..1302481,1302538..1302543,1302607..1302672,
                     1302982..1303008,1303059..1303104,1303238..1303416))
                     /locus_tag="CNC04290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656809.1"
                     /db_xref="GeneID:3256416"
     CDS             complement(join(1302268..1302276,1302371..1302394,
                     1302445..1302481,1302538..1302543,1302607..1302672,
                     1302982..1303008,1303059..1303060))
                     /locus_tag="CNC04290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512569.1"
                     /db_xref="GeneID:3256416"
                     /translation="MAHSNVWFSRPRNYGKGSRQCRLCAHQAGLIRKWGLDLCRQCFR
                     EKSKVIGFDKYN"
     gene            complement(1304249..1305559)
                     /locus_tag="CNC04300"
                     /db_xref="GeneID:3256472"
     mRNA            complement(join(1304249..1304350,1304387..1304704,
                     1304758..1305559))
                     /locus_tag="CNC04300"
                     /product="ornithine carbamoyltransferase, putative"
                     /transcript_id="XM_024656810.1"
                     /db_xref="GeneID:3256472"
     CDS             complement(join(1304338..1304350,1304387..1304704,
                     1304758..1305548))
                     /locus_tag="CNC04300"
                     /codon_start=1
                     /product="ornithine carbamoyltransferase, putative"
                     /protein_id="XP_024512444.1"
                     /db_xref="GeneID:3256472"
                     /translation="MPSATVIRYAIQGARKPTPNVIIPFKPTNIAKSRQLPPPHLLTL
                     ADLSPEQISSLIANAAALKFVSKNVHTTAIPKRLDRRTVALIFNKRSTRTRVASETSV
                     EALGGHPMFLGKDDIQLGVNETLEDTAKVVGSMTDGIMARVAGHEEIETLAQYSPVPV
                     INALSDLYHPTQILADLLTLCEIYAPVPPPTEIVSGQAYSSILSYYQSALNPTKILQG
                     KKVAWVGDTNNITNELLVTLPRFGMHFSVAAPKGYDKFDERVWSRLAESKTESLVTLT
                     NSPAEALRDADVVVTDTWISMGQETEKAARLEAFKGYQITNKMVSEAGAKEDWKFMHC
                     LPRKKEEVDDEVFYGPRSVVFPEAENRKWTIMAVFDLLT"
     gene            1305727..1306272
                     /locus_tag="CNC04305"
                     /db_xref="GeneID:36392800"
     mRNA            join(1305727..1306137,1306195..1306272)
                     /locus_tag="CNC04305"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658438.1"
                     /db_xref="GeneID:36392800"
     CDS             1305781..1306137
                     /locus_tag="CNC04305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514296.1"
                     /db_xref="GeneID:36392800"
                     /translation="MFSRSVLSTARSYYTSTSQPAQATHHLITLVRSPIGLTKDSKQT
                     LVALGLHRLRQSVLQPFGEVTAGRILKVKELVQVANVTKEEGEALMKRRRGEGNGVEP
                     SGRVYGGGKGLVESEI"
     gene            complement(1306711..1309957)
                     /locus_tag="CNC04310"
                     /db_xref="GeneID:3256502"
     mRNA            complement(join(1306711..1307122,1307177..1307332,
                     1307415..1307689,1307749..1307978,1308031..1308389,
                     1308440..1308547,1308597..1308975,1309027..1309108,
                     1309170..1309957))
                     /locus_tag="CNC04310"
                     /product="glycerol-3-phosphate dehydrogenase, putative"
                     /transcript_id="XM_569683.2"
                     /db_xref="GeneID:3256502"
     CDS             complement(join(1306799..1307122,1307177..1307332,
                     1307415..1307689,1307749..1307978,1308031..1308389,
                     1308440..1308547,1308597..1308975,1309027..1309108,
                     1309170..1309653))
                     /locus_tag="CNC04310"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase, putative"
                     /protein_id="XP_569683.1"
                     /db_xref="GeneID:3256502"
                     /translation="MFRGRSYMPGRRALVFTTATTVAVGSAYYALRPTPLHLDSQHVP
                     LTKRRPGPLWAPPSREQMLEHLRTSGIYIHRTEEGGPEPGAVLRKDEAESEGDDVFDL
                     LIVGGGATGAGTALDAASRGLKVACVEREDFSSGTSSKSTKLVHGGVRYLQKAIFELD
                     YEQWKLVKEALRERRIFLETAPHLSHMLPILLPIYTWWQLPYYYAGCKLYDFLAGKEN
                     MESAYWMGKGKALEAFPMLKKDGLVGGVVYYDGQHNDSRMNISLVMTAVQHGAVVANY
                     VEVTELHKKPDPSRGGQERICAATLKDRRTGETWKVRTRGVINATGPFSDGLRKLDEP
                     TTQDIVAPSAGVHITLPNYYGPKTMGLLDPATSDGRVIFFLPWQGNVIAGTTDSPTKV
                     SQNPIPDEKEIQWILDEVRNYLSPDVKVRRGDILSAWSGIRPLVKDPNSKNTESLVRN
                     HMINTSKGGLLTIAGGKWTTYRAMAEETVDVAVKEFNLKPNGPSQTNHIKLVGGHAWS
                     KTMYIKLIQQFGLETEVANHLSESYGDRAWTVASMAKPTGESWPFHGVRLSKLYPYIE
                     AECRYACRCEYAQTAVDFIARRTRLSFLNVQATVETLPRVLEIMGEELGWDMKRKEQE
                     FDDAMEFLKSMGLPQHTKLKLSDVEKSHGHIGPLGLAQKEEVALYQRAQFTPDEVSHL
                     RTQFERFDFDHDQRITRADLIHAMTGMGYDASVELADSILREVDFGRKGEIDFQDYLD
                     IAAGLKELQLENAFTHLTQLDSSRKEAGARDIGDHAHESSERREKRRKIPVERSGGGA
                     "
     gene            1310265..1312955
                     /locus_tag="CNC04320"
                     /db_xref="GeneID:3256810"
     mRNA            join(1310265..1310945,1311005..1311086,1311138..1311322,
                     1311371..1311564,1311611..1311718,1311771..1312129,
                     1312186..1312684,1312739..1312955)
                     /locus_tag="CNC04320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569685.2"
                     /db_xref="GeneID:3256810"
     CDS             join(1310462..1310945,1311005..1311086,1311138..1311322,
                     1311371..1311564,1311611..1311718,1311771..1312129,
                     1312186..1312684,1312739..1312834)
                     /locus_tag="CNC04320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569685.1"
                     /db_xref="GeneID:3256810"
                     /translation="MFRGRSYMPGRRAFAVTTTTTLAVGSAYLYFRPQPVRLEDASSV
                     YDVKRPANLSWKPPTRDQMLSHLATSGIYVNRTQESGPEIGEIKGEKKEEDDDDVFDL
                     LIVGGGATGAGTALDAVSRGLKVACVERDDFSSGTSSKSTKLVHGGVRYLQKAIFELD
                     YEQWKLVKEALRERRIFLDTAPHLSHMLPILLPIYTWWQLPYYYAGCKLYDVLAGKEN
                     MESAYWVGKGKALEAFPTLKKEGLVGGVVYYDGQHNDSRMNISIMMTAVQHGAVVANY
                     TEVTELHKKADPLRNGQERIYAATVKDNLTGKTMKVRCRGVINATGPFSDGIRQLDEP
                     SVQNIVAPSAGVHISLPNYFGSKTMGLLDPATSDGRVIFFLPWQGVIIAGTTDSPTSL
                     SQNPIPDEKEIQWILDEVDHYLSPDVKARREDILAAWSGIRPLVKDPNSKNTESLVRN
                     HIINTSKGGLMTIAGGKWTTYRAMAEETVDAAVKEFDLKPNGPTRTHHLKLIGGHAWS
                     KVMYIKLLQEYGLETEVAKHLSESYGDRAWTVASFANPTGESWPKHGVRFYRRYPYIE
                     AECRYACRCEYAQTAVDFLARRIRLSFLDIHATVVALPRVIDIMSDELGWDAKRRAEE
                     LESTIKFLQSMGLGSKSDRDYAHELSERRGERRQIPIERSAGGA"
     gene            complement(1312940..1316266)
                     /locus_tag="CNC04330"
                     /db_xref="GeneID:3256375"
     mRNA            complement(join(1312940..1313322,1313372..1314063,
                     1314114..1314231,1314281..1314929,1314992..1315224,
                     1315276..1315656,1315712..1315958,1316011..1316266))
                     /locus_tag="CNC04330"
                     /product="nucleoporin-interacting protein NIC96, putative"
                     /transcript_id="XM_024656811.1"
                     /db_xref="GeneID:3256375"
     CDS             complement(join(1313008..1313322,1313372..1314063,
                     1314114..1314231,1314281..1314929,1314992..1315224,
                     1315276..1315656,1315712..1315958,1316011..1316231))
                     /locus_tag="CNC04330"
                     /codon_start=1
                     /product="nucleoporin-interacting protein NIC96, putative"
                     /protein_id="XP_024512446.1"
                     /db_xref="GeneID:3256375"
                     /translation="MSTNSPYRPHNHGPAARPPAASALSSLLAQANSLNEVDYDSELP
                     QIRFGIDDIERMSEAVAGRGKRAKSEKGEAFNLLSNLGVNTSQLTHSISQLPSEPAAP
                     RPRRRRAAQIQAQTADQVPELGRGFVAAEGDIGTWGRNWHEMVILSGIEMQRQRTVNS
                     FQKQFQQRILQNWQLEKARVLQDELGVTDDELAGIVDAARLAASTSGNSTLGRSALGA
                     STRRFPMGQSTLGKSTTAESREGGLVMHTKMVRYERVIGELNQKRLRKEPYEFCQALS
                     ESTKNDSKNPLLWQSFNLLAHLVYEPSLRDSEYRGSSHSEAVPPVAEPVNERQYSAAY
                     LGDQKAHQAALLRGRLVTGGLKYLERDFERHVDETIARNPKEAALGGVPGIRNKVRAF
                     VDVTLRTKEAREAYKPESVNGTLLWAQTYYLVRCGYIDDALNLVAENQQHISRDDWSF
                     PGCFKSAMQSPERRLSKTQRDQLYNDFNAHIRNNPLIDQFKAALYKLVGRFELNRKTA
                     KVATTTEDWMWLQLNLVRENRDGDAPQEQYDLADLGRLLEKYGSDKFDAGGTKPLAWF
                     NLLLFTAQFEKAVAYLYSKPQMKTDAVHFAIALSYYGLLRVPTKGDEAELLAVTDSGD
                     VSFLNFARIIKQYIAPFFKLEPQTALQYAYLVMLNSDAPAPSGPKQRQLCLELVRDIV
                     LSSRSWSRLLGSVRSDGSKETGVIERDLKLLKLEDEQDYLRQVVLAAADQSSLDSSLT
                     DSIELYHLAGSYDKVVETVNRALGHSLSQTAGTAPLPSDAAQVGLTGAFGGAPDLYSL
                     AQKVHAVYERDFGKRTRVSSLHWETLETLLQLKLALAQFAADRPDLALETFKATNLLP
                     LDNDPSSITRYAQKFRDMLDQPVVSNLDDVIVTTMKCLHLLSQQLKQSPYGDQGRAAQ
                     LSVYKHQAQCLIQFASTLRLRLGPDVYRQLSSMSAFF"
     gene            1316429..1318043
                     /locus_tag="CNC04340"
                     /db_xref="GeneID:3256613"
     mRNA            join(1316429..1316500,1316619..1316650,1316777..1316848,
                     1316929..1316987,1317050..1317062,1317135..1317230,
                     1317306..1317513,1317579..1318043)
                     /locus_tag="CNC04340"
                     /product="Rab/GTPase, putative"
                     /transcript_id="XM_569689.2"
                     /db_xref="GeneID:3256613"
     CDS             join(1316469..1316500,1316619..1316650,1316777..1316848,
                     1316929..1316987,1317050..1317062,1317135..1317230,
                     1317306..1317513,1317579..1317702)
                     /locus_tag="CNC04340"
                     /codon_start=1
                     /product="Rab/GTPase, putative"
                     /protein_id="XP_569689.1"
                     /db_xref="GeneID:3256613"
                     /translation="MSGPAGQHYDFLIKLLLIGDSGVGKSCLLLRFCEDSWTPSFITT
                     IGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDEKSFNN
                     IRTWLSNIEQHASPGVNKILIGNKCDWEEKRSVTIEQGRALADEFGLRFLETSAKANE
                     GVEEAFFTLARDIKTRLIDSQPQEAAPVQLGADRNGVNVNKQSDSSSGGCC"
     gene            complement(1318011..1319710)
                     /locus_tag="CNC04350"
                     /db_xref="GeneID:3256250"
     mRNA            complement(join(1318011..1318275,1318378..1318545,
                     1318609..1318789,1318852..1319372,1319428..1319530,
                     1319577..1319710))
                     /locus_tag="CNC04350"
                     /product="aminomethyltransferase, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_569702.2"
                     /db_xref="GeneID:3256250"
     CDS             complement(join(1318103..1318275,1318378..1318545,
                     1318609..1318789,1318852..1319372,1319428..1319530,
                     1319577..1319660))
                     /locus_tag="CNC04350"
                     /codon_start=1
                     /product="aminomethyltransferase, mitochondrial precursor,
                     putative"
                     /protein_id="XP_569702.1"
                     /db_xref="GeneID:3256250"
                     /translation="MFSLARPTARPVAALARRALATSAVLAQLKKTPLHDFHVQHKAK
                     MVPFAGYSMPLSYGETGQITAHKHVRSDAGLFDVSHMLQHNFTGPTAQEFLLTLCPSS
                     LDSLKPFTSTLSVLLNEQGGIIDDTIITKHSDSAFYVVTNAGRSVEDKAHISQKLEEW
                     NAAHKGREVKWETLEGWGLLALQGPKAKDVLQRVTDQDLNKVKFGSSVFADIKTMDGQ
                     TVKCHVARGGYTGEDGFEVSIPPEHTLALSNTIASHPDVMLIGLGARDSLRLEAGMCL
                     YGHDLDESVSPVEGGLSWVIGKDRRAPDAQPSFPGKSRILEELANGPSRRRVGFEVIG
                     SPAREGCKVLDALGEKEIGVITSGIPSPTLGTNIAMGYIANGSHKKGTAVKVEVRKKL
                     RDAFVKPMPFVPTKYFK"
     gene            1319871..1321681
                     /locus_tag="CNC04360"
                     /db_xref="GeneID:3256287"
     mRNA            join(1319871..1320023,1320082..1320215,1320267..1320348,
                     1320414..1320525,1320588..1321681)
                     /locus_tag="CNC04360"
                     /product="vacuolar membrane protein, putative"
                     /transcript_id="XM_569704.2"
                     /db_xref="GeneID:3256287"
     CDS             join(1319900..1320023,1320082..1320215,1320267..1320348,
                     1320414..1320525,1320588..1321611)
                     /locus_tag="CNC04360"
                     /codon_start=1
                     /product="vacuolar membrane protein, putative"
                     /protein_id="XP_569704.1"
                     /db_xref="GeneID:3256287"
                     /translation="MLPDNSTIIDPVGPPHTPTDTPADPQRCKLLGTTGLVVQALMGI
                     LVIASLVVKKRLEKRKRSWRIWFLDVSKQLVGQAVVHALNLLISDLVASVGNSNPCSL
                     YFLNILIDTTIGVGIIFLSLKFFTWLFSSYLGYDGFISGKYGNPPQALFWWKQLLTYV
                     FSIIIMKLLVLLPLTLPRISDLLLHLGHYMLEYFSPSVQVIFVMAIFPLIMNIVQFCL
                     VDQVIKAGGKADDEEGRIHDTGDEEEGYSRVPDWENDLDGHGRRSGEGSPREMTKKEE
                     EETTARATGISTALPPSSPLLSPARYDGYGSTTPSPVGSPTKSVEGQNMWTKMMSKSK
                     DTGGGSSNNASLKERHGVNSRKSSNTWWEYPDDEDEDGGGGLEAPIQRNTRSHAPSPE
                     SVYPAELPPPFVVNGSSAAAFRKNSRTPPEWGASSTHSSHTARRLTSEVEREARLTLS
                     PPRSPRVENSSSSGGGGGGGGGGGNGRSERGEEVGLDVLRR"
     gene            1322083..1325395
                     /locus_tag="CNC04370"
                     /db_xref="GeneID:3256462"
     mRNA            join(1322083..1324045,1324111..1325395)
                     /locus_tag="CNC04370"
                     /product="serine/threonine kinase, putative"
                     /transcript_id="XM_569705.2"
                     /db_xref="GeneID:3256462"
     CDS             join(1322159..1324045,1324111..1325232)
                     /locus_tag="CNC04370"
                     /codon_start=1
                     /product="serine/threonine kinase, putative"
                     /protein_id="XP_569705.1"
                     /db_xref="GeneID:3256462"
                     /translation="MSLFRDLPSRNLNILSSPPDTATTASSMARTSSSSSRNDLFTTS
                     WQPEIPPPRPLTHDIPSTTATDGREEEPTTDPLHLLSSAKISSNGVHANTMPLPMKRR
                     DFSRYDANHTTRHSVTSSPAESGRNSPMLVDEFGVPKRGHVPSSVTAPTHQRPHSQTT
                     NPNARQGSPRTSSFFDVVLSTDLPAPPPAPPRATPTLHSMHASSGNNSPNNLSRSTSL
                     RRAPPPPLLPLSRTGSNNYNINGGGGSDRQRSWESYTSSIPSSPSASASYATAEEDPL
                     SPLHQSPQLPPSRAGQADWIPPLPPAADDIELRLVPNSTYLLGEGRYAKVYLAAYKRT
                     KKLKVRGKEELLGRIPPFGHSSFTPAPVRGEDKAGAEEKKEVNEDGDGLVGGDWKLCA
                     VKRLAPDRESQTMGLREAFFLNRLMATSSLSGDGRPVDFPKSGRTRAVSPLRDSFGQT
                     PRQTMKHASRRRSRNGSVYITKLIAVKEDVEGLPHSAHVRSTSDAIKSQKTKASNGTL
                     TRQRSSTMLPPHSPTTAPVNRVAAKVSVGCSQPDITKISSFPSFPSLAQAIRQEYAAP
                     SLSRLVLVLEHAPLGTLDRLLRTSPQLVGKKLWGRWAREGVEALEWVHGKGVVHADIK
                     PGNLLLTTDLHIRLSDFGSSLLIHPFHPPTDGLGLGTLPFSPPELVDPSVTFSFPVDI
                     FALGATLYQCITGREPFRGLRSIEMMHHVKKGGLWAYEEEERLSRVGEPHREGIQAGT
                     PYPSAWRDNYSGSTSHILAAGAGVRRAGSLRVPPTHSTYAEEPLPPGRPRLKRMTSAE
                     SVRANDDAGKSESPAGVKLWAKWVKDGAGVDPVTALLSDADFPADASKAGVSLFRRDS
                     QNLGRSASIRSVIPDMTSARVSPPADAAPSTPPSHHPPLTLTVHSPPSSAPSHSSPPP
                     SPPQSLLQRGIYESYSDGSPAMLFLDGTERVSEDVRDVLRGMLEPDQWIRYGANEVRE
                     RWDELGVGIEEDIEPEEAGQGQGEGADERE"
     gene            complement(1325400..1326679)
                     /locus_tag="CNC04380"
                     /db_xref="GeneID:3256660"
     mRNA            complement(join(1325400..1326271,1326327..1326679))
                     /locus_tag="CNC04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656812.1"
                     /db_xref="GeneID:3256660"
     CDS             complement(join(1325519..1326271,1326327..1326608))
                     /locus_tag="CNC04380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512452.1"
                     /db_xref="GeneID:3256660"
                     /translation="MLPYSSGYSTSASSSSSPHFHASLPSHLSTELALLQTFIKRASA
                     QHRSQLFLQRMEGVVRIGKAMMLHVRKIPEERRGEACIAWRGKGENLVKKMIRMLFSA
                     QYITSQIIDLYHFLPLQTTVLSIYARLFTMTVSLANSLEMDVEELLISAGRKTNGKRK
                     TGAGKNQKTNEVAMDTLLADAIQKMGADLEVGEVIERSNQSLGPVSKASPGSISERSA
                     FSSKSPKPGKLVASAVAVLSSTVAPGNGCLEKETTIVSKPVELPPSLQIDQLLDTSSN
                     EKDKKKKRRVETGTNASDAMTPEELSTAGDIIPKKKSRVVKHEKGKGDEKARAKKKKK
                     KDAMDDIFGF"
     gene            complement(1326895..1330414)
                     /locus_tag="CNC04390"
                     /db_xref="GeneID:3256216"
     mRNA            complement(join(1326895..1327023,1327089..1329573,
                     1329645..1330414))
                     /locus_tag="CNC04390"
                     /product="expressed protein"
                     /transcript_id="XM_024656813.1"
                     /db_xref="GeneID:3256216"
     CDS             complement(join(1327109..1329573,1329645..1329774))
                     /locus_tag="CNC04390"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512579.1"
                     /db_xref="GeneID:3256216"
                     /translation="MGSSLGLSEPCRPISGPSIASCVDYENDAEMAKGEKALANVDDN
                     MESNTELTPKALQSIQLLPSHNLSSPRPSVASDSNGTLYSPKSEFSLFDPTQFPQPPR
                     AASPSSTHQSPALARSRSEHRSRVSLDATPLKPAAELHRPSSPKLAEEDDEAERVSVL
                     TSSPSTIATFHVARAVRAPATPYGDTFLLQTSHGKQEVLSRHDISENVKYDNPLAEEV
                     LRSTPGVAGLGEGWIGGPRPKRRKSWLNTRKTMDNPDPLNLWHSGLGDRDDPTGRTAT
                     TSILKQVWNRSVRSLAGDGASVSLDKQSGKPDVKTASGAEMSTSSLADLPVLPIVGPK
                     PPAINLVGFSIPTTSSHSIHSLQSEVHLVSKASFPHSLQSGQPWSSLPSLPTSSIRPA
                     RSFSAQVYKSTQAGIPSFARSESDLHLSLRQRQGPRPPWRPQSIVSAGQRHSPTILEI
                     GESRSSIPPLVQGSRSPSFISIPSPNALQSLKHSSSTDDCRAVSPLLKTPLIRIETFG
                     QEVAARDKRKEENTAKGLPDKDESWLGRIEESSEKEHPQSEKESKGSRHKKSFLSKVK
                     ALICRPREISAEDQGSTTPFRNQRLGRKLSMKRSSPFRLSSKSQVRLVSPSVPAFHPV
                     DNFAGERNDPTVAARAQTPTAKRLSLFTERLSAAEDSQALANSLQTGVRKASDSSKRL
                     FRRSTLLRKNRPRSPSNPTTSSLGRYSSADLSLDVHLEGEKLGLDDILDKEKRETIVH
                     QLYPRLAMSVDDLTLLSKLPRSSSEPMSLGTGGWKSSHQKSASESTPQLKSVSFDRPL
                     ASLKPPPTILEHPSPFTESHNPMSSHSIISTPGFQESKKLTWSSAQGLTIVKEYSDLG
                     EVVNVVEA"
     gene            complement(1331579..1336312)
                     /locus_tag="CNC04400"
                     /db_xref="GeneID:3256523"
     mRNA            complement(join(1331579..1332008,1332064..1332197,
                     1332256..1332305,1332362..1332437,1332499..1332966,
                     1333052..1333557,1333615..1333710,1333765..1333787,
                     1333837..1333853,1333913..1334664,1334717..1335693,
                     1335748..1335884,1335945..1336086,1336170..1336312))
                     /locus_tag="CNC04400"
                     /product="ATP-dependent DNA helicase hus2/rqh1, putative"
                     /transcript_id="XM_024656814.1"
                     /db_xref="GeneID:3256523"
     CDS             complement(join(1331741..1332008,1332064..1332197,
                     1332256..1332305,1332362..1332437,1332499..1332966,
                     1333052..1333557,1333615..1333710,1333765..1333787,
                     1333837..1333853,1333913..1334664,1334717..1335693,
                     1335748..1335884,1335945..1336079))
                     /locus_tag="CNC04400"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase hus2/rqh1, putative"
                     /protein_id="XP_024512578.1"
                     /db_xref="GeneID:3256523"
                     /translation="MLSRVSSHLMTPTSNVGSSSPFNVKGKGTEASAAQPPGTNPRDN
                     GKTTEKLQTMLVKYMEEKDQLKDQKFAIATGQDGMDDLDMDMVEEKIELVTKRIREIK
                     TLLTVRAQIPSSSTPPAPSRQSSFQPPETRQSPFQMADAKPTSLAVKDYPTPTAASSS
                     KAKHTTLDNWNASRSNGVPSDDSDMPVTSGSLQLNREYPSPAVAGPSRPTCRRPSPPQ
                     DVPQDLHDFDIAMAEEDFHDLEEEPVLVPPSTPPVAPSPRVPTKMSARQPQPLLAPEN
                     NKQSILQHTGHLPDEFHDIPFNEIFSSPTSPTRNLPNPPIRAESSPPKPIDPPRASVL
                     AGPSRQPMETHSPVKEAVPAVPQHRVIPLEITHRWSKEVNQKLRQVFKLPNFRKHQKE
                     AIDETMAGRDVFVLMPTGGGKSLTYQLPAICSSGKTRGVTFVVSPLISLINDQTRHLI
                     SRGIPAIAYTGDLTQRDKNLAHEELSKREPITKVVYVTPEMMSMGGHIKSILRGLLQR
                     KQLARFVIDEAHCVSQWGHDFRADYLRLGELRRDYPGVPIMALTATAQNKVQEDIIRS
                     LRIEGCVCLRQSFNRPNLHYEVRPKTSSVIQEIVAFVHTQEARASGIVYCNSRDNCEN
                     LAKKLREDHGLRAYHYHAGMTKENRRKMQEGWQDHKFEIMVATIAFGMGIDKPDVRYV
                     IHHHLPRSLEGYYQETGRAGRDGNPSTCILYYSFKDGKKILGQIDQEKDLTRDQKERQ
                     KASMQEVLRYCNNKVDCRRSQVLAFFNETFDAANCNQGCDVCLGRDRNVFRTEDVTDD
                     AVTVIKMVQAFSNTKITILNAAECFRGFKGNSGKQLNQNPYFGAGQSWDRNEGERLIQ
                     TLVIEGALEEYCVESKAGWTNAYLRVGKEGYKYLNGTARLKMDFREASPRKLTTKPKQ
                     SAKRRSAKSKGPATLEKTTNSNPIARKRSLQQIMAEEAEFDNSHWGDTDDEYNPENDG
                     DPIIASGDETEMDDDVPLKRRKSTEASKEKTPRSTRSKAKEATHDNDGESSVEQCFKA
                     LEKMRNQSVAKNKTYPVLTDELLQMVAALMPANEKRLREIEGMTPQLIEAYSTKILGI
                     CIKFRPANQNPLNTAAHKDALRPSAMPAPVTLPRTNSTTMQRIKQYAYEPSSASKTPL
                     TSSAVRRPSSTSSLKRQTLLFSTSSNTVGNGDSATPTAAKRHNNVDSVRPMLTARGGN
                     VVSRKDKF"
     gene            1336498..1338743
                     /locus_tag="CNC04410"
                     /db_xref="GeneID:3256620"
     mRNA            join(1336498..1336762,1336811..1336918,1336963..1337166,
                     1337220..1337555,1337604..1338078,1338133..1338743)
                     /locus_tag="CNC04410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570009.2"
                     /db_xref="GeneID:3256620"
     CDS             join(1336541..1336762,1336811..1336918,1336963..1337166,
                     1337220..1337555,1337604..1338078,1338133..1338425)
                     /locus_tag="CNC04410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570009.1"
                     /db_xref="GeneID:3256620"
                     /translation="MATRGSMLIKRISGAALRRKHTPLPAIRLPSLPAVPAVFVGSRR
                     GKSTSTTKGKGKERYNFNTSIEFSNEPDPDHVNWRKVTAADLAARKEPPTRVKMLVRD
                     FIDDSLYNPNYGYFSHHATIFTPPKDGFDIISFRDVAHFQETVAERYEREYGLEPTEG
                     AQGGLGRQVWHTPTELFKPYYARSLISAIVQSYKLYHFPSEPLIIYEIGAGNGSFMID
                     SLTYLRDHHPDVFARTKYRIIEISSALAKGQRERAEKEGFGMKVQVLNKDFFQWDGVG
                     GGDQPCFVVALEVFDNFAHDMVRYELDTLTPRQAVVGIDASGDFTLLYETINDPLISR
                     VLSYNRLLPQSSSTLPPLPYPLLYSETLRKAYASMPFAPNLSAPDFLPTKAVLFAEKL
                     REKLPGHRLLMADFDELPDAVGGRNGPVVQTRYGNSMIPCETFLVKQGYFDIFFPTNF
                     EHFRDLYSIIMNSPSRITPSPSSTPDSPSSLPSKIKQDFFSHSSGVKGFRRRNIGIYT
                     HADFLAKYGGKEILDKTTVKDGANVMTAMYKNAKMMF"
     gene            complement(1338505..1339838)
                     /locus_tag="CNC04415"
                     /db_xref="GeneID:36392801"
     mRNA            complement(join(1338505..1339415,1339475..1339838))
                     /locus_tag="CNC04415"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658439.1"
                     /db_xref="GeneID:36392801"
     CDS             complement(join(1338565..1339415,1339475..1339685))
                     /locus_tag="CNC04415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514297.1"
                     /db_xref="GeneID:36392801"
                     /translation="MDGFLKPSRPSTIDKRVPLRRDESTETRSSYVSTTPGSGASEWE
                     EEERVHSPVQQGETKEVEPMSPIVVVLYVVAFYLVFQILTRPDDVDLFSNPTTTIPQS
                     QSPMDIPRYHLPYQLPHIPGPTTPIENACKASLWRVILGYMVYPIYRAVTIIATPLPL
                     SLSALSLLTKLVATLLWPFISLAQLLFRSCVTYPWNICIRVLDLLYPVFVFVGGILGV
                     GCLIGGMAGWIGSVCMNRYIEWKEGDTKQVKTRAKKIRSSSRRVHRKRHSSESPKTRS
                     YISQVKPLDNPAARHPRKPSLSGSSTERPQSSEEILHDPISLLSERSRVKPARWEEKG
                     LGTARERVVVGIRKRGRRG"
     gene            1340023..1341850
                     /locus_tag="CNC04420"
                     /db_xref="GeneID:3256327"
     mRNA            join(1340023..1340113,1340160..1340189,1340236..1340410,
                     1340467..1340610,1340663..1341120,1341174..1341402,
                     1341463..1341850)
                     /locus_tag="CNC04420"
                     /product="argininosuccinate lyase, putative"
                     /transcript_id="XM_569694.2"
                     /db_xref="GeneID:3256327"
     CDS             join(1340073..1340113,1340160..1340189,1340236..1340410,
                     1340467..1340610,1340663..1341120,1341174..1341402,
                     1341463..1341786)
                     /locus_tag="CNC04420"
                     /codon_start=1
                     /product="argininosuccinate lyase, putative"
                     /protein_id="XP_569694.1"
                     /db_xref="GeneID:3256327"
                     /translation="MASEQDFTKRKLWGGRFTGSTDPLMHEFNQSLKYDKRMYAADVK
                     GSIAFSKALLKAGILNEHEQQEIARGLMIVESEWAENKFVIQSDDEDIHTANERRLSE
                     IIGKDIGGKLHTGRSRNDQVATDMRIWLMEETTRVEGYLKDLLNVMVSRAEKEVDAIL
                     PGYTHLQRAQPVRWSHFLLSHAQSFLGDLERLRQLYPRISVLPLGSAALAGNPYSLDR
                     ELLRQELDFESIGENSMHAVADRDFIVEWLQWASLTQVHMSRMAEDLIIYSSAEFGFV
                     QLSDAYSTGSSIMPQKKNPDSLELLRGKAGRTFGQMAGFMMSLKGVPSTYNKDLQEDK
                     EPLFDAVDTVSAALRIAEGVLATMSINPEKMAAALTMDMLATDIADYLVRKGVPFRET
                     HHISGRSVALAEKTNCQISDLTMEQWKELDERFDETVMEVFDFETSVEKRNAIGGPAR
                     SMIARQVEVARQRIGK"
     gene            complement(1341821..1343908)
                     /locus_tag="CNC04430"
                     /db_xref="GeneID:3256636"
     mRNA            complement(join(1341821..1343610,1343670..1343729,
                     1343781..1343908))
                     /locus_tag="CNC04430"
                     /product="amino-acid N-acetyltransferase, putative"
                     /transcript_id="XM_024656815.1"
                     /db_xref="GeneID:3256636"
     CDS             complement(join(1341937..1343610,1343670..1343729,
                     1343781..1343855))
                     /locus_tag="CNC04430"
                     /codon_start=1
                     /product="amino-acid N-acetyltransferase, putative"
                     /protein_id="XP_024512577.1"
                     /db_xref="GeneID:3256636"
                     /translation="MKPPIRPQVTLRSLKRTPNPTPVVCHVRQRHHESKILQEIKDED
                     NAFILSILQASPSARDSRSYLSSFAPPQPADIATATPAATPSDGAQPPAQNPLVNALL
                     NPILRRPALVKIQGPFTDAQLESICRGMAHLQKLGLVSVIVVDRDDLPSTESSDRYEA
                     QRQRAIVRHEVERVVHFLSRHRAAARPVFSTVARIADPELEPEEAQKGVFVEEEGLDH
                     VRRAVGEGEIPVLLPVALDSGCRSRRIPANRVLLALASAMSTHTSSPVDLTPRRLLVI
                     NREGGIPSYARQGLPHLYINLASEFSYINRTFQPQWNDSHPTALSNLFLANGCLAHMP
                     REASALIVSHRSPAALIANLITNKPAHSASLPHALLVESEGRITRDTPTLIRKGLPVR
                     VLRSMEEVDQDKLTHLLETSFKRTLDREGFYNRLKNDLDFVIVIGDYAGAAVCTLEGK
                     PVSDSFAYPPNHPEPICYLDKFAVHPSHQGDGTVDFLWVALRDETYGLGQLDASNPSI
                     GSLRGVGRGRDLVWRSRSDNPVNKWYYERSSGFLKTRDEKWKVFWCDAEQRLGEIWRE
                     REFGGGRLVRVVEKEEKGRVKWWEEVIGAIPSAWSA"
     gene            complement(1344134..1344822)
                     /locus_tag="CNC04440"
                     /db_xref="GeneID:3256414"
     mRNA            complement(join(1344134..1344274,1344362..1344444,
                     1344523..1344552,1344620..1344637,1344693..1344822))
                     /locus_tag="CNC04440"
                     /product="ribosomal chaperone, putative"
                     /transcript_id="XM_024656816.1"
                     /db_xref="GeneID:3256414"
     CDS             complement(join(1344175..1344274,1344362..1344444,
                     1344523..1344552,1344620..1344637,1344693..1344710))
                     /locus_tag="CNC04440"
                     /codon_start=1
                     /product="ribosomal chaperone, putative"
                     /protein_id="XP_024512576.1"
                     /db_xref="GeneID:3256414"
                     /translation="MIVKVKTLTGKEVDIDVQPDMTISKVKERVEEKAGIPPVQQRLI
                     FGGKAMGDDKTIQDYKIQAGAAIHLVLALRGGRTLNGN"
     gene            1344932..1349158
                     /locus_tag="CNC04450"
                     /db_xref="GeneID:3256161"
     mRNA            join(1344932..1345030,1345108..1345270,1345328..1347038,
                     1347085..1348412,1348467..1349158)
                     /locus_tag="CNC04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656817.1"
                     /db_xref="GeneID:3256161"
     CDS             join(1345186..1345270,1345328..1347038,1347085..1348412,
                     1348467..1349035)
                     /locus_tag="CNC04450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512449.1"
                     /db_xref="GeneID:3256161"
                     /translation="MARSIRSSTTKGRSKGTSVRKTQTFKRTNQQSKAISQQLPAVAQ
                     KVTRSSARLAARTQPVQPRHKAATVAHDQVLQSNPTEDGKKNLSNFIPASTLARQLSV
                     VDISKPRTASLDIPEQGGYDDRGFWRESPSTAEHSILPQQGPKTGKNAVKSHVTVTTA
                     TPMIGSYKRRHLSLPSSSSSSSASLPATDLRTPHLQNLVNNKGTNGCKDNHFFRTQGY
                     TPPSGAIGDLFRIKSLALPTQSLSHAGVFKPPNCIAAHQGPMVVPISSSTQTADTSET
                     GHQVEELSYEDEPSPVKRPITRRSRIRPVEGKLYMISDGEGEEEIQEQEREEGDGNLQ
                     PIQPLDLDLSGSVSSSSKWRDPFSYIPAANTQSAAPLRSHRRSQIRPSLNTPSELVAH
                     NTTVDEESPSQIKVDRVEKTSEILLRNASTSVVKATPMLGKRIYGKGRSHIYKVGLPD
                     PVSNGQAANLTPPAHSPSTHSPSAIGLLRKESVQNDIKVPESLNKAPDRPAVNHPEEG
                     EDELWSDDWPGDLEESPTKRGPLRPVTMVLGNRSPRKRVGESDSECISDANNYAKKKQ
                     KAEFSNETASSAAQGTSRLRLSRNDSVQIRVQNYIQVVHSVRPKRSRRNISRRIRPPI
                     GYSLKPFDAIPFSEYVKEYRKNPDMTLFQMPTGLFSSGCFAKRHESKKVSGKFTGRKT
                     PLVLDPSQNDPHWEDEIVFESSTRPLQRGRKNNGKAEVSTKRIPRLNLIADPIGHQPQ
                     SQLPPGRLSQRKRRQSVDDACRKVLNTGPTKAGHEGRLGSIEFEKLESPSLISSPSRR
                     TVIKDTGYWKILQQDQPAKRFNAPKKSVWPIQLRPQESIKQFPSPAFVSVNLSLSISG
                     DSTQERQSPTSQRLNPEDELADRRMMSGTDTTNHLVGRPNSHSIQSRKERQAAREKRV
                     KEKREALRREEENGADAAVDEDVQRPFQKKSAPVTRNQSYVIVPSSHAKPSDTQGTTP
                     SRRAVAIPDPSRVLVRSSTQVRPLSAYPTPSRIGLMRRNSMLPSPSLKKDHSVAELQP
                     VRPQPSNIIVTPSKPFAIPTQRNTQHNTRTSSCTQSYPPLAQASRHLGTQYTQVLERT
                     EVDSSHTRPTQNLERTEVDSSSQPRLTQGLEKTWIGSSRPHFRAFSSEAENEEAHGIN
                     DALFSQGTPERSPSPPPVTQALSRLRSRSAGSRSIGLRALPSLQKTPVSQRTRSQGTQ
                     KSGLYSQFRSPLKNAAGTSRRTGIPS"
     gene            complement(1352782..1355802)
                     /locus_tag="CNC04460"
                     /db_xref="GeneID:3256148"
     mRNA            complement(join(1352782..1353442,1353500..1353754,
                     1353809..1354107,1354160..1354652,1354713..1355280,
                     1355340..1355802))
                     /locus_tag="CNC04460"
                     /product="shk1 kinase-binding protein 1, putative"
                     /transcript_id="XM_569696.2"
                     /db_xref="GeneID:3256148"
     CDS             complement(join(1352898..1353442,1353500..1353754,
                     1353809..1354107,1354160..1354652,1354713..1355280,
                     1355340..1355750))
                     /locus_tag="CNC04460"
                     /codon_start=1
                     /product="shk1 kinase-binding protein 1, putative"
                     /protein_id="XP_569696.1"
                     /db_xref="GeneID:3256148"
                     /translation="MPRHKVALYLPHPLPSLPIEPPPTPSPLQQVIASTLSTTDYDLV
                     SFPLTNAAWQARWEKLCLRPIEEEGLSEAELERRAIEEKKVDQEADIWRRDGGLKRSE
                     VVVSRLEESQGVIPLASEWLELDSPDEGIRFDSELALRAEFAHALYLSLPVLILPAPS
                     LANREYLPSYARAISNLLQMGGQSAVTNISIRIPVSNPLELIAPESVMPNGLPGSPSP
                     IAPPLASGAPQTDKKHKRLSSLSTRPQSMQTSLFGQPANQGTNQNQQQGMRITSGASS
                     LMSANTAYGSVAGVGQASLGVAAHGGDLSSTWEMWDCIRTLCGYHPRLSVTLDLTNPL
                     PPSAGALARWSAEPVNYIWLPASSFIPNAKGYPVLSKACQAFIREMGKQNPTYILSQT
                     TMKRHSAGGHNAYLQYIRHITSTPQPGPNAQPRAIMALPAGASEKFQDYSDYLQAPLQ
                     PLMDDLGSMTYNIFENDPVKYAQYESAITQALLDLPANKKHVVTVVGAGRGPLIDCTL
                     RALLHSGRQASIYAVEKNTNAFVTLQERKELEWRDKVHIISGDMRAVDVPEKCDILVS
                     ELLGSFGDNELSPECLDGALRLMKSTGVSIPSSYTAHIAPLSTSKLYQETHSPTRGPS
                     SAETPYVVMLSQVDPISGDNNVPGVSARCGERIQQCWQFVHPNRDITVDSNGVPLSNS
                     HNARASTHTFHIPHAATLHGFGGYFEAHLYGDVGLSIHPENAHAVSPDLTSWFPLFFP
                     LKEPMYLPSGAELQVNLWRMGDGKGKKVWYEWAVESYLPVVQSVSSGPGAATVPGSRN
                     VSSASASGIGFGGQPSPLMDAQFSPGTGHMGLSGELGRVKIGQSTLHNPGGIHSWVGL
                     "
     gene            complement(1355941..1357788)
                     /locus_tag="CNC04470"
                     /db_xref="GeneID:3256146"
     mRNA            complement(join(1355941..1356522,1356574..1357217,
                     1357268..1357374,1357439..1357500,1357553..1357788))
                     /locus_tag="CNC04470"
                     /product="delta24(24-1) sterol reductase, putative"
                     /transcript_id="XM_569697.2"
                     /db_xref="GeneID:3256146"
     CDS             complement(join(1356018..1356522,1356574..1357217,
                     1357268..1357374,1357439..1357500,1357553..1357707))
                     /locus_tag="CNC04470"
                     /codon_start=1
                     /product="delta24(24-1) sterol reductase, putative"
                     /protein_id="XP_569697.1"
                     /db_xref="GeneID:3256146"
                     /translation="MSVTQDNLRQRKATNLRSDDIANGNSTALLKINAVPTEHGQERD
                     KELDEHQEYEFGGPVGVLAMMLGFPLLMYYLWICLWYYQGSFVYPTSVDDIGPFFHRM
                     WEHIYDGAYPTKFAFTTYWGLTAIQLVFAAVMPGIYQNGLPVPSLNYKTLTYKCNALY
                     SWYTTLILAGVLHKTGIYRLPWIIENFGHIMTVSIITSYSVSIIIDVFARVFKYGGGP
                     LRMSGNIFYDHFMGVSLNPRLGIIDLKMFAEVRVPWVLLFLFALSATVKQYEEAGRVT
                     YNMVHFLLATGLYINACAKAEQMIPQTWDMFHEKFGWMLIFWNMSGVPMTYVYPAIYM
                     SRAPIASYEFSRLGSLALFSTLMLCYYIFDCSMAQKSVFKMQQQGEYKPRKAFPQMPW
                     AELKNPTYIQTKHGNKLLTSGFWRFARKPNYTADWIQACTWGLTAGFNTIITMWYPIF
                     FLAVLIHRCERDFAKCARKYGDDWDEYCKVVKWKFIPGIY"
     gene            complement(1358004..1360809)
                     /locus_tag="CNC04480"
                     /db_xref="GeneID:3256350"
     mRNA            complement(join(1358004..1358447,1358518..1358595,
                     1358647..1358685,1358736..1358946,1358999..1359095,
                     1359169..1359421,1359501..1359591,1359633..1359755,
                     1359818..1360031,1360100..1360152,1360201..1360809))
                     /locus_tag="CNC04480"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_024656818.1"
                     /db_xref="GeneID:3256350"
     CDS             complement(join(1358234..1358447,1358518..1358595,
                     1358647..1358685,1358736..1358946,1358999..1359095,
                     1359169..1359421,1359501..1359591,1359633..1359755,
                     1359818..1360031,1360100..1360152,1360201..1360399))
                     /locus_tag="CNC04480"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_024512450.1"
                     /db_xref="GeneID:3256350"
                     /translation="MRSFSPTLLFLLLSLISHFVVAVPIATSVTQHRLKLRKLPVARD
                     DEHPVVAFERHYDAATRRLHHYQRLSPPEITYLKGLTKEKRQTIERDTMLRNRTWTPR
                     LLRKKRSNQSSKRAYWREGDNEPSGISVPLPKFHLLAINSTGTAAAAATRTVTASGSN
                     ANGFSQAAADTDIVLTNSTSALVQGGSPAIIDANDIGYLCEIQIGTPPQSFLMLMDTG
                     SADTWVPSTECLPQNCGNHLSLGANTSSTFQASNRTFQVTYGSGAVSGIIGADTVTVA
                     GMTLENYSMGATLQESVQFGDDNIPFDGLMGLAMNQLSHQGVPTLVDSLQSAGLIQNA
                     ILGIALGRYADGENDGELVFGQADASKFDPSTTQTLPVTSDDGFWQVTMSAVTIDGQD
                     AVINRQAILDTGTTLMMAPNDDAMAFHELINGSASIGSGMFSIPCTIEQVVTMTFGNV
                     AFQIDVRDLIFQPITDDLRGNCVSSLSAGTIKNGDTWLLGDSFLKNVYMTTNVDDKTV
                     QLSARTNAPGSSSLE"
     gene            1360989..1361969
                     /locus_tag="CNC04490"
                     /db_xref="GeneID:3256191"
     mRNA            join(1360989..1361167,1361316..1361399,1361456..1361470,
                     1361527..1361969)
                     /locus_tag="CNC04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_569699.2"
                     /db_xref="GeneID:3256191"
     CDS             join(1361088..1361167,1361316..1361399,1361456..1361470,
                     1361527..1361596)
                     /locus_tag="CNC04490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569699.1"
                     /db_xref="GeneID:3256191"
                     /translation="MTASTTASQTEMEAARVPLGWRDQCSALLIPLNVCRHKELYMPW
                     KCEDERHGYEKCQYDDYIRRMKQLTRQKKEAAEAASEE"
     gene            complement(1361816..1368118)
                     /locus_tag="CNC04500"
                     /pseudo
                     /db_xref="GeneID:3256569"
     gene            complement(1368455..1371172)
                     /locus_tag="CNC04510"
                     /db_xref="GeneID:3256241"
     mRNA            complement(join(1368455..1368537,1368599..1368854,
                     1368911..1369211,1369270..1369508,1369558..1369878,
                     1369928..1370040,1370096..1370272,1370328..1370384,
                     1370455..1370509,1370564..1370665,1370721..1370786,
                     1370846..1370878,1370939..1371172))
                     /locus_tag="CNC04510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656819.1"
                     /db_xref="GeneID:3256241"
     CDS             complement(join(1368653..1368854,1368911..1369211,
                     1369270..1369508,1369558..1369878,1369928..1370040,
                     1370096..1370272,1370328..1370384,1370455..1370509,
                     1370564..1370665,1370721..1370786,1370846..1370878,
                     1370939..1371117))
                     /locus_tag="CNC04510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512451.1"
                     /db_xref="GeneID:3256241"
                     /translation="MTTLSQSNLPLDPEAHQDAKKARDLEEAGAAPQDELYYEDTSSE
                     EVLTGVSKVEAAAAVWGPKSQWFLFIGIALSAYIYSLDGVTTYQYLSYATSYVLDHSV
                     SGTISTANAIIIAVGKPLMAKLADVVGRGETFIIVTILYVVGYIVIATANDVGQIAGG
                     QVIYSFGYTGLQMLQQIIIADMTNLRWRGLVTGLVSAPFIINNFVSAEIAEGVLPNWR
                     WGYGMFAILVPVSLSPIIIALMWAQHKAAKQLKIRYSRPPIKVGFWITIREACLEMDF
                     MGLILIAASLALILLPLGLAPSASNGWKTPSMIVMLIIGGLLFPVFLYYESRFPRKPV
                     LPMRWLKRGPILGACLIGFFDFVSFYLQYTYLYSYVYVTEDWSYRNLTYFSSTQSLAL
                     TIFGIMAGFIMYATRRFKWMLFIGLLIRLLGVGLMLKARSATGNTAELVMCQILQGMG
                     GGAAATAIQVSAQAAVAHVDVATVTAVVLLITEVGNSVGSAVASGIWASYMPKELAKN
                     VPTTNATLLAELYGSITDIALYPSDDPIRLGAIAAYQNVMFRLVLGAVIVAIFPPIWC
                     LLFTKDVKLTRAQNAVDAKDLSGRPTDEPTLDERTPSEAGMSDPRRKD"
     gene            1373752..1374643
                     /locus_tag="CNC04520"
                     /db_xref="GeneID:3256421"
     mRNA            join(1373752..1374187,1374247..1374643)
                     /locus_tag="CNC04520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570046.2"
                     /db_xref="GeneID:3256421"
     CDS             join(1373869..1374187,1374247..1374560)
                     /locus_tag="CNC04520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570046.1"
                     /db_xref="GeneID:3256421"
                     /translation="MVRFKNRYLLVEFLLPTSLSSTLDAHYDSMDPIIPKEQALEDND
                     SEDEEDEEEFSPIPSLRFMVPSILPDSQLGEEGGQGIYRAIRSTVISVFGDEGWGRIA
                     SSFRVIYHSPLTTLTFLRVARPHYRLLWSALTFITSLENIPAIPRVIAISGTIKKLQN
                     RGIAYHRAMVGALISAGVDKSKTGISGVGGGKLQKEAEQERQEMERMQET"
     gene            complement(1374577..1376568)
                     /locus_tag="CNC04530"
                     /db_xref="GeneID:3256381"
     mRNA            complement(join(1374577..1375326,1375381..1376303,
                     1376353..1376568))
                     /locus_tag="CNC04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_569701.2"
                     /db_xref="GeneID:3256381"
     CDS             complement(join(1374820..1375326,1375381..1376303,
                     1376353..1376383))
                     /locus_tag="CNC04530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569701.1"
                     /db_xref="GeneID:3256381"
                     /translation="MTLVPPGAHLSPVDLPPPPPSADPREPSPVSVPRRTGARTPQRA
                     RSPLSSRDASPIRVPQSNRSPSSEHTSPLLQPFPRTSGSAIATPPSAVPVQSTLGHHL
                     SRPSSPSSIHSSGSAIFERDIEHPPMASLSLNPNPSHQSHTLSHKPSRLLHLPHGSNL
                     DHTVPAVLDDAVEALTSGDSTSGGFEGLEIEAPAPSGIGMARQSSSNLPSAGRKVTAG
                     PTAIFSSPSRSSSPISLDSLTSSMASPAQSPPILTQLSPPQSLTGLAAQDGVPASPTS
                     PTVSKTQVTASVPRPAVPRRISTGPQLPGGWAFNESEKTQEESTSTPVPAPATVSYPT
                     VPSAVPPHMSPSKGKPPHHRLSFISYNDILLSVPTQVTSFSEITSGNVSPDHLPGTVS
                     PSLSSRSPIASLPHHGMPSAATNVTPSATIASSEGPIAEPKLDGDASGNATKGALGLA
                     EGEWERSDGTARGEWEREGLGKGLEQRLEDLAHTEV"
     gene            1376737..1377490
                     /locus_tag="CNC04540"
                     /db_xref="GeneID:3256624"
     mRNA            join(1376737..1376926,1376978..1377059,1377119..1377490)
                     /locus_tag="CNC04540"
                     /product="30S ribosomal protein S17, putative"
                     /transcript_id="XM_569703.2"
                     /db_xref="GeneID:3256624"
     CDS             join(1376849..1376926,1376978..1377059,1377119..1377432)
                     /locus_tag="CNC04540"
                     /codon_start=1
                     /product="30S ribosomal protein S17, putative"
                     /protein_id="XP_569703.1"
                     /db_xref="GeneID:3256624"
                     /translation="MPYQPNHVFKGIVTKVGAMRKTATVTVERIFEHPKILKEMKRHK
                     KFLVHDEGELARLGDKVSIIHGARTSRHKSFRLQSILSRNTQKFPDDPIPAEIPLPSI
                     KPSKQKKLLEKAALRSSGQVDASGGSGKVIDALKEAELAKGQAARVAEVAGRNVV"
     gene            complement(1377416..1379628)
                     /locus_tag="CNC04550"
                     /pseudo
                     /db_xref="GeneID:3256223"
     gene            complement(1379994..1382181)
                     /locus_tag="CNC04560"
                     /db_xref="GeneID:3256670"
     mRNA            complement(join(1379994..1380425,1380481..1380544,
                     1380615..1380745,1380801..1381220,1381281..1381451,
                     1381505..1381662,1381718..1381849,1381900..1382181))
                     /locus_tag="CNC04560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569706.2"
                     /db_xref="GeneID:3256670"
     CDS             complement(join(1380255..1380425,1380481..1380544,
                     1380615..1380745,1380801..1381220,1381281..1381451,
                     1381505..1381662,1381718..1381849,1381900..1381936))
                     /locus_tag="CNC04560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569706.1"
                     /db_xref="GeneID:3256670"
                     /translation="MSSQPSNIVIIGASVAGHNLANSLYPTLPSTHRILLIDALDYGF
                     FPIACLRAAVVPGWEDKVTVPLTTKTVFPSGTAHQVIALNKVIELRENSVVLEKPFEG
                     STEVPFFRCVIATGASQPSPMRPPPGATSQKQFIDNLRHIQSDISRAKKVVIIGGGTV
                     GIEFAGEVRDAHPDTEVTIIHSKPSLLSPIPSAGPESSSNLSWSSPPTNPKLSKSLEQ
                     VLKNLNVNLILDDSVYIPVGDNASVAGEWDGSFGLQDEVKKLKLRSGKEVQGDYIFVS
                     VGNNPNIGLVASVDPAAITSGLVAVDDYLKVASDNPASLLTKNSNYYAVGDASAVTGL
                     KTAWLARVAATHVAKNIINEVKGKELLKYSPGSFNALFVPIGPTHGAGSITFPFLGTW
                     IVGGGVVKAAKGKDLLIGQVWQPLWQGSDKVDLKV"
     gene            1383002..1385355
                     /locus_tag="CNC04570"
                     /db_xref="GeneID:3256828"
     mRNA            join(1383002..1383444,1383508..1383651,1383699..1384001,
                     1384058..1384223,1384280..1384335,1384391..1384529,
                     1384590..1384641,1384694..1384913,1384961..1385200,
                     1385252..1385355)
                     /locus_tag="CNC04570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569708.2"
                     /db_xref="GeneID:3256828"
     CDS             join(1383079..1383444,1383508..1383651,1383699..1384001,
                     1384058..1384223,1384280..1384335,1384391..1384529,
                     1384590..1384641,1384694..1384913,1384961..1385200,
                     1385252..1385293)
                     /locus_tag="CNC04570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569708.1"
                     /db_xref="GeneID:3256828"
                     /translation="MKGGRFLLPALFKTLLLPPLIAALFIHHFPSLFLPFSALIYLIS
                     FPALYVFRSYASLVASSWKASALGAIDIPRVNGTWPLNIDILLNWAKSGTEEEVGRMM
                     VLMGRQYGGTYNTRVLGEDQIISSDPKVIKHVLIDDFDNFVKGQKFKERAQDFLGDGI
                     FNSDGDNWKFHRSFMRPFFQPKYISPLHFSTNVQNFFAKLPSYGKAFDMQARIGQLAL
                     ELAIMWLCGEDMSGDASNVARTEEWKKAKGEISWAMTEAQKIVGKRVKIGTIWPLFEV
                     RHDPLERPMKVIRAFFRPIISRALNRKRQRCKLDNTEDVYMIDRLVEATDDIKLVEDQ
                     LINVLLASRDTLASLLTFSVYAIVLHPDFAARLKDEVFTIANQECEVTKDTIRQLRYC
                     RAFINEVLRLFPPVPLNIRRTLRPSLLPTPNHLAYMPANTSIILATILMQRDPAVWGE
                     DAQVFNPDRWLEGGGLGKEKEGFMSWNLGPRMCLGQSFALAITHTFLVYFFRHIAHVG
                     TLVGHNTTVQLALDAQPPETVLPKEWMTPEGGDGRARGGRDKVWIVADVVLAIKGGLW
                     IRFGAEETE"
     gene            complement(1384403..1386357)
                     /locus_tag="CNC04580"
                     /db_xref="GeneID:3256669"
     mRNA            complement(join(1384403..1385547,1385601..1386178,
                     1386238..1386357))
                     /locus_tag="CNC04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656820.1"
                     /db_xref="GeneID:3256669"
     CDS             complement(join(1385368..1385547,1385601..1386178,
                     1386238..1386295))
                     /locus_tag="CNC04580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512453.1"
                     /db_xref="GeneID:3256669"
                     /translation="MSFSTRSISRAAVSGSRSAAQVRFSSTAPPSLTASLLLSRPPLL
                     TPTPTPFESAYYSHSRSVAHALSSPLPLDFYFKTGSLPLRRHLVAEHAFVSETYGKKL
                     SGKAPDVGDIPPETEYEIIERDRWEKADAKRGEKSLERKPEEEVYCLVLKGKEKEGKW
                     TFPDVKVGKLEALDEAVTRGITGVEGSLGGKGMDSWLVTRKPVGMVKDGESRTFFIRG
                     HILGGEPTLSPSSPYSSWAWLTAPEVEARLRQQGDEKLWEGVKGMFGIPKNEA"
     gene            complement(1387194..1388770)
                     /locus_tag="CNC04590"
                     /db_xref="GeneID:3256684"
     mRNA            complement(join(1387194..1387541,1387600..1387669,
                     1387729..1387948,1388008..1388221,1388284..1388302,
                     1388541..1388770))
                     /locus_tag="CNC04590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569712.2"
                     /db_xref="GeneID:3256684"
     mRNA            complement(join(1387194..1387547,1387600..1387669,
                     1387729..1387948,1388008..1388221,1388284..1388302,
                     1388541..1388770))
                     /locus_tag="CNC04590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658441.1"
                     /db_xref="GeneID:3256684"
     CDS             complement(join(1387371..1387541,1387600..1387669,
                     1387729..1387948,1388008..1388221,1388284..1388302,
                     1388541..1388707))
                     /locus_tag="CNC04590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569712.1"
                     /db_xref="GeneID:3256684"
                     /translation="MSASGYTIHVAGLAPETTEDKLHDFFSFCGKLTSVKKSGSAADI
                     TFEKLSAMRTSLMLNGGTLDGAHLEVTSVSDIEKTPSILPASATGSTPIGATEGDLAQ
                     EDKPKAAIVAEYLAHGYALGDHIVQKAIDIDHKQGISSRFLSFFNNLDSTVGNKVVGE
                     NQTVSGKIHEHAAAAVAKTREVDQSRGISSRFQEYYSKVLGTPVGQKVHQFYTTTHKQ
                     VMDVHEEAKRIAEEKKKSQSATVPADEAGSALPSSDVKADIASSTTPAAAAASRNPAA
                     SATVIPPPLL"
     CDS             complement(join(1387371..1387547,1387600..1387669,
                     1387729..1387948,1388008..1388221,1388284..1388302,
                     1388541..1388707))
                     /locus_tag="CNC04590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514298.1"
                     /db_xref="GeneID:3256684"
                     /translation="MSASGYTIHVAGLAPETTEDKLHDFFSFCGKLTSVKKSGSAADI
                     TFEKLSAMRTSLMLNGGTLDGAHLEVTSVSDIEKTPSILPASATGSTPIGATEGDLAQ
                     EDKPKAAIVAEYLAHGYALGDHIVQKAIDIDHKQGISSRFLSFFNNLDSTVGNKVVGE
                     NQTVSGKIHEHAAAAVAKTREVDQSRGISSRFQEYYSKVLGTPVGQKVHQFYTTTHKQ
                     VMDVHEEAKRIAIQEEKKKSQSATVPADEAGSALPSSDVKADIASSTTPAAAAASRNP
                     AASATVIPPPLL"
     gene            complement(1389058..1391018)
                     /locus_tag="CNC04600"
                     /db_xref="GeneID:3256703"
     mRNA            complement(join(1389058..1389359,1389416..1389593,
                     1389649..1390246,1390296..1390585,1390637..1391018))
                     /locus_tag="CNC04600"
                     /product="CDP-diacylglycerol-glycerol-3-phosphate
                     3-phosphatidyltransferase, putative"
                     /transcript_id="XM_569714.2"
                     /db_xref="GeneID:3256703"
     CDS             complement(join(1389091..1389359,1389416..1389593,
                     1389649..1390246,1390296..1390585,1390637..1390960))
                     /locus_tag="CNC04600"
                     /codon_start=1
                     /product="CDP-diacylglycerol-glycerol-3-phosphate
                     3-phosphatidyltransferase, putative"
                     /protein_id="XP_569714.1"
                     /db_xref="GeneID:3256703"
                     /translation="MHRPARGALRISTRLATRPPLPALIHSRPYSLSATEPPPNLQPH
                     QYPAFERLSTALSLKQPCFGARGDEVELLTGPEVFYSRLLDMIKGAKRRILISSLYIG
                     AEEGELVEAIQAALTNNPQLRVVFILDYHRATRLATSTNLPPSTAHLLLPLVERFSDR
                     CEVWLFRSPKLKGLMEKIVPARYDEGWGTWHGKWYGADDEVIISGANLGRSYFTNRQD
                     RYIHFRSNPSLLSYLSSLTRLFTQYSYLLHHSPPPHIPPYNTVPLPSPENPDNSKLPS
                     SSVSIRPRASLIWPSSSINPRKFSLHALATLSAFQNSWRASNSARSRRVDVDTWFWPV
                     LQAGVLGIKEEERAMAEVWKAVRESHEGEQNESRKVEVDLTSGYFGLYKKYKQLVVES
                     PASVKIIAASPKANGFYGSKGFSRLIPEGYTLLETRFHRDTVRAGRTWNVEKGTGVRL
                     KEWEREGWTYHSKGLWVSPPDSKPFLTFVGSSNLSTRSLTLDTELSMVMMTSSPTLRR
                     ALDTELKHLDEYATQVGEETWKLEERQVSWLAWLLVALGVEGML"
     gene            1391155..1393278
                     /locus_tag="CNC04610"
                     /db_xref="GeneID:3256763"
     mRNA            join(1391155..1391362,1391418..1391556,1391614..1391683,
                     1391736..1391794,1391846..1392002,1392058..1392224,
                     1392282..1392404,1392458..1392649,1392706..1392911,
                     1392981..1393278)
                     /locus_tag="CNC04610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569716.2"
                     /db_xref="GeneID:3256763"
     CDS             join(1391278..1391362,1391418..1391556,1391614..1391683,
                     1391736..1391794,1391846..1392002,1392058..1392224,
                     1392282..1392404,1392458..1392649,1392706..1392911,
                     1392981..1393087)
                     /locus_tag="CNC04610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569716.1"
                     /db_xref="GeneID:3256763"
                     /translation="MLATGLHGLKRAAIILPVAWTGIWLGYYAYTDTLRRAHIRERNK
                     KLIKTLETLPGGGPDHAQPATEIERNALKERYSSLKFAGRYWNPYVEWREQGAWEWAL
                     WKGVISTLTLKLFYNGGVPPDRPIPDLPVERPDFDLLYPSSSSETPTTRESGSGGSDI
                     EITDKYTCTWLGQSTSYVTLDNLAILTDPALQHRTIPSRLAPERLRPPPCTLSELKRV
                     DVVLVSHNHFDHLDPGAILELGDSCEWIVPVGCGPFLRKHGATRVTELDWWQETKHTL
                     SRPGQKDKTYTITAVPSMHWSARSPLDTNATLWAAFHVKSDTDKPKSFIHLGDTGYSP
                     TLFHAVGRIMGPVDLAAIPIGSYEPRWHMHLQHTDPEGAVRMALQMHVRKSIGVHWGT
                     WMMSDEAYNKPPLDLELARQLLDVSENQFSVVPVGKTIVLED"
     gene            complement(1393994..1395501)
                     /locus_tag="CNC04620"
                     /db_xref="GeneID:3256529"
     mRNA            complement(join(1393994..1394477,1394555..1394611,
                     1394665..1394875,1394939..1395086,1395158..1395234,
                     1395298..1395501))
                     /locus_tag="CNC04620"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_024656821.1"
                     /db_xref="GeneID:3256529"
     CDS             complement(join(1394389..1394477,1394555..1394611,
                     1394665..1394875,1394939..1395086,1395158..1395234,
                     1395298..1395390))
                     /locus_tag="CNC04620"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_024512454.1"
                     /db_xref="GeneID:3256529"
                     /translation="MQTSTQSEPLEDLKDSHERSMATNHLDVEEELSFYASYHSNKTN
                     QMIHFFCIPQILWTWLIVAAHVTLPDAKLFTLTWGLAFQPSLALAFITSYMTYYTLLD
                     PIGGVTYIPVGSLLYLTATYLATSPPSWLPLTSPVEPSAIPFALAIHGLAWIAQFIGH
                     GVFEHRAPALLDNLVQALVLAPFFVHLEALFALFNYKPDLHKKIKARAGLRISEMNRQ
                     KSHKAE"
     gene            complement(1395619..1396882)
                     /locus_tag="CNC04630"
                     /db_xref="GeneID:3256410"
     mRNA            complement(join(1395619..1395874,1395935..1396266,
                     1396318..1396405,1396466..1396574,1396625..1396882))
                     /locus_tag="CNC04630"
                     /product="thymidylate kinase, putative"
                     /transcript_id="XM_024656822.1"
                     /db_xref="GeneID:3256410"
     CDS             complement(join(1395943..1396266,1396318..1396405,
                     1396466..1396574,1396625..1396757))
                     /locus_tag="CNC04630"
                     /codon_start=1
                     /product="thymidylate kinase, putative"
                     /protein_id="XP_024512575.1"
                     /db_xref="GeneID:3256410"
                     /translation="MSTSTRGAFIVFEGLDRCGKSTQVDRLVQRLERQGHRARLQKFP
                     ERTTQIGKMIDAYLQSKTEIDDHAIHLLFSANRWECSAAIRRDLANGITVIADRYAFS
                     GIAFSAAKGLPFDFCLHPDAGLPLPDVTLYLTLPPETAAKRSAYGEERYESVSIQQAV
                     RQQFKLVANEIKKRHGADKWIEIEADGTFEDVEERIWSQISDVVEYSNGNIGDLWSR"
     gene            1397107..1398854
                     /locus_tag="CNC04640"
                     /db_xref="GeneID:3256368"
     mRNA            join(1397107..1397212,1397274..1397711,1397760..1397881,
                     1397938..1398058,1398115..1398208,1398272..1398339,
                     1398405..1398661,1398719..1398854)
                     /locus_tag="CNC04640"
                     /product="expressed protein"
                     /transcript_id="XM_024656823.1"
                     /db_xref="GeneID:3256368"
     CDS             join(1397569..1397711,1397760..1397881,1397938..1398058,
                     1398115..1398208,1398272..1398339,1398405..1398661,
                     1398719..1398732)
                     /locus_tag="CNC04640"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512456.1"
                     /db_xref="GeneID:3256368"
                     /translation="MSPTSNIKPFLPSSRPSGAVFIGLNAVRALSIIALLLVFAANIE
                     TMVSDIKAIKNPASDEDDCDYIEYSSVPDQTGGPFWSILNRIFILSECLLLIMSEVGV
                     PRRLFENYIPMLGPAYGLGCLGVFQALIGAQVLSHYCDLFPQVSSWLLFIVGCFNILV
                     GIFLREGAKEKRLIFSWENASSLTPQTRMATTAWDMVTEKKRSKSPSESSKQPDGLSR
                     LNTSGSGSPLLPANSTAPGARFGGFGFGRQGEKAAADRGWKVSRPLDVLPRYAV"
     gene            complement(1400004..1405388)
                     /locus_tag="CNC04645"
                     /db_xref="GeneID:36392802"
     mRNA            complement(join(1400004..1401659,1401713..1402251,
                     1402308..1404629,1404686..1405388))
                     /locus_tag="CNC04645"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658442.1"
                     /db_xref="GeneID:36392802"
     gene            1400028..1405392
                     /locus_tag="CNC04650"
                     /pseudo
                     /db_xref="GeneID:3256409"
     CDS             complement(join(1400073..1401659,1401713..1402251,
                     1402308..1404629,1404686..1405352))
                     /locus_tag="CNC04645"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514299.1"
                     /db_xref="GeneID:36392802"
                     /translation="MSKRTTTLADIGDMPSTSDGARRRRRPHDDSPEPRNLLPSDRFP
                     GGQYPAFRHPRRESRPPTRLDDENEGNQQFHDLDQQPARRRPRRERRAPARFDDIDEG
                     DQQLRRPPRPIKCALCDESFPRERFEANGESYDTCIECRRTIPPSRIPFTDNVDAPAI
                     PQHAISCIKTFQSECEKITVDTCITCNERWFGLDVSREGRCTRCRSSYLRRTKFTDYN
                     NMDPGKSLGDLCEEAGMQRPEPPSHTEELLLSKIHLQVQYWNVHGQQTAYAGHTCLFS
                     RDNAAFLNTLPILPEHLDVLILRDASASPTHITGFGNRAEFHVKRQRLIDNLLALQRF
                     HPSYRDIIISQENLASLPEDGSVFHRLRSATQASDPNVTTHTAPDSGPHAGNLPEANN
                     DIVSAGCVPNLMQPGMELDDARAALGHYARDDDGEEIALAVPLLGSQPVNEHDQGHEY
                     LIEAFPFLFPSGVADLHAHRIHAVHPDEYFRHLLRYKDGRFASDPRFRFYAFNALLRW
                     QAKKMSGFLVSRNEEDRGLSAGDLRDLAQSDARSLLDRVRRGGHQLRGTAPYWHKRST
                     ELSAMVQQLGTPNAFLTVTAADLHWPDLHRHMPPPDEPHVSETARQRHNSKNVNNNPA
                     ITAWYFQKRFQLFFEHVIKPVFKVKEWWFRYEWQSRGSSHVHGLIWMDGAPDPSALGD
                     DMSRNAFAEFWDKHITAFNPEVGLPAGDCHPSSLAFADIEFTHHAVAQRINCFQRHAT
                     HSQYCMKRKRNAPSDAPAQCRFGFPRPLHEKTEWVRGEEEGDEWAFVVKSNDQDLNTF
                     SPVLVLGWTANTDFSPCKSPHAVLNYVAKYASKSEKSSADLLPTLFSIIEHLEDDTPL
                     RVVAQKVLSNDISSRDYSGQEVCHSLLGCHMFSASRSFRSLALSMNRFRRLRGPEEQE
                     GNGGQDDMDDAEDDDDGPEMKDWRDAYEERPPEEENISLYEWYLFFEKNKRTGNLSRR
                     DDESCYVLRLWPVYFPPYEMYTDNEPPLSPPPPVLPASPRITHSPLLPSSPGEEHEEN
                     PGANPSNEEDSEDWFRAKILLHVPYRNQTELRLDNESWADTYFRLLAARALRNNGGRA
                     DSMPSKPRSRVVVQSPEEEFEELDIVQERILTDEQLLSAMGPRPNQFIGNRLGLRDFD
                     KDFRWKEWSERRGGEDVALLSKGIKDWKNPPPPELPHPLPPLPRVDVTLLNFKQALCH
                     TKFRRHCQRSLQAGPNNPLPPFLLNLDGTAGTGKTFTVNAICQTAADLVDDAGMGSMV
                     IVRRLAPTGIAAFHIHGSTYHSALGISPKEKKGKAAAGRQLAALQEDWKHIRYLIIDE
                     KSMVGRVGLALIDKRLREIFPHRDVWFGGLSVILCGDFGQLPPVGDVPLYSTDIQTGN
                     SDRSRLLNHGRLAYLAFSESLELDVEMRQAGMDETTRKFKEHLLRSRAGKVIEQDFAD
                     VVQTRFFAKLPTDEQKLFVQATHLCATSAHVQELNLSGLYLAKKPVLRVSALHTGVGA
                     EKRRPDDADSLTNVVFLMEGAKVMLTRNLWVDQGLTNGSMGQVHEILWDGVARPGVDM
                     PSSVLVAFPGYTGPVHAGTNAQGVPLVPITPVKCEWKSQGVACSRTQFPLQLAFAITI
                     HKSQGMTLDRVCLHLGDREFARGLTFVAMSRVRKLEHIAFKPGFELERLMQVNGAKSS
                     RGTGMRRRWEDDNERRKGLVGGFDDYSGWEEEGIFV"
     gene            1408028..1410075
                     /locus_tag="CNC04660"
                     /db_xref="GeneID:3256262"
     mRNA            join(1408028..1408234,1408292..1408849,1408906..1409184,
                     1409237..1410075)
                     /locus_tag="CNC04660"
                     /product="glutathione transferase, putative"
                     /transcript_id="XM_024656824.1"
                     /db_xref="GeneID:3256262"
     CDS             join(1408211..1408234,1408292..1408849,1408906..1409184,
                     1409237..1409914)
                     /locus_tag="CNC04660"
                     /codon_start=1
                     /product="glutathione transferase, putative"
                     /protein_id="XP_024512457.1"
                     /db_xref="GeneID:3256262"
                     /translation="MSEVDVIIIPTFPPSPPTTSSSRMISTSPEWFSAPVKPPYKPSP
                     LSISIPISPLTVMDSESDSNINHQEDGSLSPEASTPPLSPSDAISSVDMTRKVSSYST
                     CSSGSDGDTEEVIVTPSSQSPSSQGRNSPSSYFDFDSRRGKEDSRSRPPRVPVRGLIE
                     PMWKLEEKEKSEVKVKSTGTNKLLEPFQMAFPTKKHTDIQYVFDEDSFVLTHVPAKIV
                     SLSVFKPRLPRVPRWQRPIVIAVMSILLFGSLCIVSWFQQSLINAERSIAVRKGEWMV
                     KYGAIAKAESDQMVDTEPGYKPAKPQHHSLKGQSKLSKRVDEEQKPFKKVSFHMTKDE
                     ELAALMSFIVGTSANALPPIDPENELSLEGFLPFNPHSPHAKTELEELVRTQWEVNPI
                     MVLGNMRDPMMREARALFKKYNVKPAPFYVDIDQRSDSAHLSATLEHILGKQTGPYVL
                     LAGKNIGNTSKLIELETNGALIDTVKEAGATIAKKLKKNKHQREEERKENERVLGPQR
                     IAGA"
     gene            1411239..1414461
                     /locus_tag="CNC04670"
                     /db_xref="GeneID:3256188"
     mRNA            join(1411239..1411643,1411697..1411897,1411944..1412530,
                     1412584..1414461)
                     /locus_tag="CNC04670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569724.2"
                     /db_xref="GeneID:3256188"
     CDS             join(1411464..1411643,1411697..1411897,1411944..1412530,
                     1412584..1414261)
                     /locus_tag="CNC04670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569724.1"
                     /db_xref="GeneID:3256188"
                     /translation="MAPIIEAAVVLLALTGNIVEAKPLRTPGRHAPPGVANVLASSKR
                     SLHSLLARYYGTAHGLSKPPSLPTKRDTSLPNGWSTFGCVAESYDERLLQGFAFSSSS
                     LTPFLCVTECTKLGYTMAGTEYGDECYCGDNFVGNGGGMAPSSFCSMPCEGDTSEMCG
                     NSWYLNLYTYNSSALPLCSGPTSTVSAPVEETSSLLSTYYSTFESSVTATSSLASASS
                     TDATISANSSSSVMSASATATVSSSAIETAGSVTNSVSSDTAPAATSISTCPIHEDSD
                     DSSEWYALGCGLDSEDRILSSYFISLDNMTVDSCLTICETRGYVYAGLQYSDECYCGN
                     SLSSSTSYDSTRCDMDCAGDSEDTCGGTWAIELFSLISSSSSSCTDSLSTESATTTLV
                     TSTTSGFNTANTTAIASSTDSASSVIVTSSERATEATSVTESTAGSETVSVPVTSASV
                     ISPTSTTSTESTASAASTSVPSSSSTHQVWAHYMVGNTYPYTVSNWASDISAALAAGI
                     DGFALNMGSDDWQPARVADAYSAAASTGFKLFLSLDMTVLSCSSSSDAAKLVSIVEGY
                     ATATAQATYEGKVLVSTFAGSDCAFSWQTDFVDVLSSAGINIFFVPSIFSDVSTFSSN
                     TWMDGELNWNSGWPMGAEDITTTSDDAYMAALGSKEYMPAVSPFFYTHFGPNSWNKNW
                     LYRSDDWLYCTRWEQIIAMRDSVQMTEILTWNDFGESSYIGPIEGALPAGSEAFVDGF
                     THTGLYSLTYYYATAFKTGAYPTITEDEIIVWARPHPHDATASSDSIGRPTGWSYTED
                     YLYAVALTTDAATVTLTSGSTTETFTVSAGLTKLRVSLSEGSISGSISRSGSTVASYD
                     AGSAFTYTTSPTTYNFNYFVGSSSS"
     STS             1412212..1412886
                     /locus_tag="CNC04670"
                     /standard_name="Eco5"
                     /db_xref="UniSTS:470755"
     gene            1414663..1416532
                     /locus_tag="CNC04680"
                     /db_xref="GeneID:3256500"
     mRNA            join(1414663..1414902,1414970..1415140,1415209..1415289,
                     1415340..1415658,1415714..1416008,1416072..1416532)
                     /locus_tag="CNC04680"
                     /product="threonine aldolase, putative"
                     /transcript_id="XM_569726.1"
                     /db_xref="GeneID:3256500"
     CDS             join(1414701..1414902,1414970..1415140,1415209..1415289,
                     1415340..1415658,1415714..1416008,1416072..1416380)
                     /locus_tag="CNC04680"
                     /codon_start=1
                     /product="threonine aldolase, putative"
                     /protein_id="XP_569726.1"
                     /db_xref="GeneID:3256500"
                     /translation="MVRGACFKYASLPVRISASIIFPTRTLATTAPIAMPVASSKSSA
                     DVTPDVGGQANVDQLHRVSRDFRSDTITIPTDAQLLCCLRATRGDDVYGEDTSTTALE
                     KRIAKLTGKEAAMFAVSGTMTNQLAIRTHMKQPPHSVITDWRAHVHKMEAGGIAMFSQ
                     ATTHQLVPENGLHLTMQDIEPALQLGTNIHIAPTKLICLENTLSGMIFPQEEIVKIGE
                     MARKHDIGMHLDGARIWNVAADVIAKRGLNPNKEEDLQTVLTELIAPFDSASLCLSKG
                     LGAPIGSALVGSKEFIDRAKWFRKAFGGGIRQAGGIAASADYAITHHFPRLIKTHELA
                     SRLEQGLRELGCDILAPVDTSMVFFQSKSIGLPLDAVMARLAALPDPIVIGGQRCVVH
                     HQISPQAIEDFIGCIAEMKKEKEEKGEYKVTTLGQEEKDKLSRFVSPEIKNETSEARL
                     RKEAALGY"
     gene            1416843..1418775
                     /locus_tag="CNC04690"
                     /db_xref="GeneID:3256210"
     mRNA            join(1416843..1417220,1417275..1417593,1417651..1417823,
                     1417885..1418775)
                     /locus_tag="CNC04690"
                     /product="aminotransferase, putative"
                     /transcript_id="XM_569728.2"
                     /db_xref="GeneID:3256210"
     CDS             join(1416961..1417220,1417275..1417593,1417651..1417823,
                     1417885..1418572)
                     /locus_tag="CNC04690"
                     /codon_start=1
                     /product="aminotransferase, putative"
                     /protein_id="XP_569728.1"
                     /db_xref="GeneID:3256210"
                     /translation="MPPRIAPLLSRTVRTSTRSFASTSVSMSAPVRTAAQWSDFGREH
                     VSHGLGRVKDHVIVKGEGLNLYTADGKKLLDFTAGIGVTNLGHCHPAVSKAAAEQINN
                     LVHLQCSIAFHQPYLELIEKLLPVMPDPSLDQFFFWNSGSEAVEAAVKLTRKATGRQN
                     LIVFQGAYHGRTMGSGSMTRSKPIYTQNTGPLMPGVIATPYPYWHSLGASPSTSEEEL
                     VNLAKYQLDLLFRQQTSPKDVAAIFIEPVQGEGGYVPCPPAFMKHLREVCDKHGILLV
                     VDEVQTGFFRTGKYFAVNSIPDFRPDVLVFAKGIANGFPLSGIVSTKELMSTLDVGSL
                     GGTYAGNPVACAAGIAAQEVYASGEIEKNVAARSEQLFTALNKLASSEKTKHLIADVR
                     GVGLMTAIEFRSASDPLTHEGLPEGTKIPKDIGKRVQAYCLEKDLMVLTTSCFDTIRF
                     IPALVINEEEMKRAMDIFTEAVEKVALEA"
     gene            complement(1418749..1421068)
                     /locus_tag="CNC04700"
                     /db_xref="GeneID:3256268"
     mRNA            complement(join(1418749..1419348,1419402..1419501,
                     1419551..1419624,1419676..1420403,1420452..1420537,
                     1420593..1420729,1420799..1420828,1420879..1420948,
                     1420995..1421068))
                     /locus_tag="CNC04700"
                     /product="amidophosphoribosyltransferase, putative"
                     /transcript_id="XM_569730.2"
                     /db_xref="GeneID:3256268"
     CDS             complement(join(1418910..1419348,1419402..1419501,
                     1419551..1419624,1419676..1420403,1420452..1420537,
                     1420593..1420729,1420799..1420828,1420879..1420948,
                     1420995))
                     /locus_tag="CNC04700"
                     /codon_start=1
                     /product="amidophosphoribosyltransferase, putative"
                     /protein_id="XP_569730.1"
                     /db_xref="GeneID:3256268"
                     /translation="MCGIIGLLLHDPLATQTTLAGTELAEGLSLLQHRGQDAAGVVTC
                     GSGGRFYQVKANGMVRDVFDEAAVAGLKGWMGIGHARYPTAGSSAHAEAQPFYVNSPY
                     GICFAHNGNIVNTPALRQFLDVDAHRHINTDSDSELLLNILANNLQKTGKFRINEEDI
                     FTAVGDLNKACIGGYACVAMIAGFGLVVFRDPNGIRPVGIATRQGARGGLDYLVASEN
                     IVAQGLGFSDWEDVKAGEAIIITREKISRRQVAEPQVFSPDIFEYVYFARPDSTIDGI
                     SVYRSRMAMGEYLAETAKKELAKAGLTVDVVIPVPDTSRVAALQLAQHLGIPYREGFI
                     KNRYVGRTFIMPGQTQRRKNVRRKLNAMPMEFAGKVVMLVDDSIVRGTTSKEIVQMAK
                     DVGAKKVVFASCAPPIRYSNVYGIDMPSPEELVAHNRTTEEIAKHIGVDLVIYQTLDD
                     LVASCKQFNPSIEQFDCSVFTGEYVTGGVDDRYLEHLMKLRNDKAKAKKIQAVVEQPE
                     GQISCSGPMNGSDSLMGLANHSPKIGPSAMPSPNDTVGLHNSWFGS"
     gene            1421252..1422620
                     /locus_tag="CNC04710"
                     /db_xref="GeneID:3256243"
     mRNA            join(1421252..1421330,1421385..1421765,1421822..1421941,
                     1421993..1422057,1422116..1422142,1422201..1422281,
                     1422336..1422620)
                     /locus_tag="CNC04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656825.1"
                     /db_xref="GeneID:3256243"
     CDS             join(1421271..1421330,1421385..1421765,1421822..1421941,
                     1421993..1422057,1422116..1422142,1422201..1422281,
                     1422336..1422378)
                     /locus_tag="CNC04710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512458.1"
                     /db_xref="GeneID:3256243"
                     /translation="MTSISPEADTSLRRSTRAKKRIVLAESDEENDGPQTAPKKSRAS
                     KPKSEDVLVISDKAEITTEGVSLSPKAKKVVAAVSKPKKAPAKKKKEMTPDEDSEERE
                     DEEDGEVLKMGDRLPSIKLEDEEGNTVDVSTLAGEKGVVFFLYPKADTPGCTNQACGY
                     RDMFEEIAVFGYEIYGLSKDTPTAQQKWKAKKSLNYHLLSDPKSKLIKRLGAFVPPKN
                     TKRSHFIFEKGTGNLIDIDIGVRPAEDPNNVVGFLTEKYL"
     gene            1424611..1425997
                     /locus_tag="CNC04720"
                     /db_xref="GeneID:3256230"
     mRNA            join(1424611..1424856,1424916..1425123,1425172..1425480,
                     1425542..1425667,1425723..1425997)
                     /locus_tag="CNC04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_570016.2"
                     /db_xref="GeneID:3256230"
     CDS             join(1424711..1424856,1424916..1425123,1425172..1425480,
                     1425542..1425667,1425723..1425827)
                     /locus_tag="CNC04720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570016.1"
                     /db_xref="GeneID:3256230"
                     /translation="MLSFFRSAKALGLLTLITATSVTAKGTLGIKGAKVAVTSPDGLN
                     DATYTLKEPTPLPSPIALSETTNFKLAFTVIDTTSGEPVYPQQAHLLLEGLQGDDDDV
                     TLPITVKSNGKAQITINAAKPHPALLPTRGKFHLTLLLSSLDEYTPLAYPLGELSIPE
                     SILQPRPRKRHDLPPRAGEPAFQPEQELYHTFKEDPKTVGCAKSGAGIIVTLAPWGVL
                     FALFGKLSPSLNFQTPPVSSYVFLLVLAAIETLIFVYWVGLKLYQLLPPFLALCAIAA
                     YSGLIALRELRERRLKAGGTP"
     gene            1426528..1431005
                     /locus_tag="CNC04730"
                     /db_xref="GeneID:3256702"
     mRNA            join(1426528..1426977,1427030..1427212,1427261..1427295,
                     1427343..1427496,1427550..1428028,1428067..1428140,
                     1428188..1428328,1428380..1428771,1428821..1429034,
                     1429101..1429138,1429198..1429205,1429264..1429278,
                     1429332..1429409,1429461..1429526,1429565..1429609,
                     1429665..1429803,1429852..1430026,1430075..1430121,
                     1430173..1430288,1430342..1430426,1430478..1430496,
                     1430555..1431005)
                     /locus_tag="CNC04730"
                     /product="potassium transport protein, high-affinity,
                     putative"
                     /transcript_id="XM_024656826.1"
                     /db_xref="GeneID:3256702"
     CDS             join(1426846..1426977,1427030..1427212,1427261..1427295,
                     1427343..1427496,1427550..1428028,1428067..1428140,
                     1428188..1428328,1428380..1428771,1428821..1429034,
                     1429101..1429138,1429198..1429205,1429264..1429278,
                     1429332..1429409,1429461..1429526,1429565..1429609,
                     1429665..1429803,1429852..1430026,1430075..1430121,
                     1430173..1430288,1430342..1430426,1430478..1430496,
                     1430555..1430718)
                     /locus_tag="CNC04730"
                     /codon_start=1
                     /product="potassium transport protein, high-affinity,
                     putative"
                     /protein_id="XP_024512580.1"
                     /db_xref="GeneID:3256702"
                     /translation="MPSIRPSLSTLPSYLALPSRRTKWKALIVGSLNFYRIHLITFTV
                     VPLITSSIMFACNTEYHISYIDCLFCCMSAMTVTGLATVDLSTLSPFQQVILFLQMII
                     GSLSFVSIVMILVRQYFFRQTFKHVLQERERRRTRLTKTITRVATAAPPISAIRKRFG
                     AGFRQFDKGDTELKNGSPERSAPSSLELKAVSHSPKKPEDHHHKHWKKGHQKLRPDMI
                     KRVQGGGVGLVNPMGWYDVERAEIATPAPTPELRSDTPLPSGKTVAADGKDLSQALEA
                     VVVSGVAQARQSAGEAEQEVSEVENKEPKTKLSEAEAGAKVADKVSTGSNEGDRTPTP
                     PPSPARHKIPYAGLQLTDEAFPRSKTIAFEDTIDDSHDHRERGPTTQREGGTFPRTAT
                     FRNNAVDPRLPHSATMQSNAGNFPRTYSLRPMNSRRTDAKMEGFGGFPTPLAIGKKVF
                     GKVFPETSKSLSKTFTVPRTNTLSGRSTGGGTEGKDAPYISFSATVGRNSRFQGLTTE
                     QMDELGGVEYRALRVLLYIVVGYVIFMPLAGFVIIAPYISAGNRYDYVFNEQPRNVGI
                     PWFALYQSISAFTNTGMSLCDMSMLPFQRAYLMIVVMIILIFAGNTALPVFLRCTVWV
                     IYKCVPESSRVRESLKFLLDHPRRCFVYLFPSTQTWVLALVMLTLTLIDWVSFLVLDL
                     GTEAIMSLPIGTRIAAGFLQSAAVRAAGFSIVPLGDLAPAVKVLYVVMMYISVYPIAL
                     SVRSTNVYEEKSLGLFGDEVEEDDLSEEGSGAHAVAKYIGWHARRQLAFDIWWLAFAL
                     WLVCIIERGHIDNDQEWFSIFNIIFELVSAYATVGLSLGVPYDNYSFCGGFRKLSKLV
                     VIIVMLRGRHRGLPVAIDRAVMLPKDFTTAEETAFEEERSRRASRMGSMFNEDVFDMR
                     RGSYGGDVPNYRASDPAS"
     gene            complement(1433282..1436556)
                     /locus_tag="CNC04740"
                     /db_xref="GeneID:3256383"
     mRNA            complement(join(1433282..1435650,1435707..1436360,
                     1436420..1436556))
                     /locus_tag="CNC04740"
                     /product="response to drug-related protein, putative"
                     /transcript_id="XM_570022.2"
                     /db_xref="GeneID:3256383"
     CDS             complement(join(1433466..1435650,1435707..1436167))
                     /locus_tag="CNC04740"
                     /codon_start=1
                     /product="response to drug-related protein, putative"
                     /protein_id="XP_570022.1"
                     /db_xref="GeneID:3256383"
                     /translation="MPSRWIPSGFTTPSAPSSRPSSRASSPTRNGPAPRPANMLSSRR
                     RDGTVDSGELGDYFSVPPTPAYDASAPTSPSMWGGPVTPSVMNTPGGSSGHTLAIVLD
                     SDQLVLRGQGGDMNPAYLSGRVELNLLEATNIKEIMMSLTGKAKVQFSDGSGTSSKHR
                     HYSHPITSHDWSFLQGDRGHSHTLKAGRHTFHFTHTLDGNLPSTLRTYSGDALIVYKL
                     RAVVVRSGFASNFSATREFNLSRMFTPEALEFNQTLEIENTWPGKVMYSLTLPYKAYA
                     AGDEIPVNIKFMPLAKGVKVTAVVSVLKEYTLVHTKHSSHPDTRVDSCVKHEIRRGRA
                     EEIAREPIRPPQHWIDTHGHSSRSSANQSRHPSPSQTPVANTRARLPLTTWGARPADS
                     YFPGQTSDAPEQAQAGPSNSRDSASITESTETDIEVGDDEVNTYFSIPIPAWVTPSHA
                     IHPVFITHKIKWSCSIANPDGHVSELRCALPILILDHSLLSEARAAGASTRGLLFGNA
                     QPEEPQVDLPSYSNHVYDRVAIADSSTTSGWIPRSINPTPLHSPHDDTPPRSRAPSRP
                     GSPTRGRSGESTPEVPPRRQLSQFVDSELLLSLGALRTHSNDTSPHSTPPDSRAPSRP
                     LSRRNSRSNLSSRVSSRPGSRAGSRASSPERGSQQSSTSGSYVEDAHMRPGYERHRSS
                     GLHGLFHLPLKPIRPFSSLGASHVSRPILRNGNQSNTNLPAAVDDIPRNSSVPGSLNS
                     AGASNSGMQSSASSQNHVSFASHAVTFEPERSSIRFEIGAPDTPSETEDDIDPLMRVP
                     SYDIASRGFLGGGVVPIDTRLPTYDASEMSMRRTRSGTDLGSSGGLVRPRSDTALVQL
                     GAQAAAEAEERANDDVDDTGAPTGA"
     gene            complement(1436837..1438619)
                     /locus_tag="CNC04750"
                     /db_xref="GeneID:3256353"
     mRNA            complement(join(1436837..1437174,1437228..1437729,
                     1437783..1438168,1438224..1438393,1438442..1438463,
                     1438513..1438619))
                     /locus_tag="CNC04750"
                     /product="adenylosuccinate synthase, putative"
                     /transcript_id="XM_569734.2"
                     /db_xref="GeneID:3256353"
     CDS             complement(join(1436972..1437174,1437228..1437729,
                     1437783..1438168,1438224..1438393,1438442..1438463,
                     1438513..1438522))
                     /locus_tag="CNC04750"
                     /codon_start=1
                     /product="adenylosuccinate synthase, putative"
                     /protein_id="XP_569734.1"
                     /db_xref="GeneID:3256353"
                     /translation="MAPSPEGVTVVLGAQWGDEGKGKLVDILAAEADICARCAGGNNA
                     GHTIVVRNDKGEKTSYAFNLLPSGLINPECTAFIGSGVVVHVPSLFNELDTLERKGLK
                     VAGRLFVSDRAHLVMGFHQIVDGLKEVELGGSSIGTTRKGIGPAYSSKASRSGLRVHH
                     LFDPTFPAKFRKLVEGRFKRYGHFEFDTEGEIEMYLAFAERLRPFIVDGPTFMHNAVN
                     SGKRVLVEGANALMLDLDYGTYPFVTSSSTSIGGVVSGLGISPFAIKRVVGVIKAYTT
                     RVGGGPFPTEDLATVGETLQEVGAEYGTVTGRRRRCGWLDLVVMKYSTMINGYTSLNL
                     TKLDVLDGFDEIKVATGYKIDGVEVEGFPADLDRLAKVEVQYATLPGWKTDISNCKTY
                     EEFPENAKAYIKFIEDYLGVKVQYVGVGPGRDQNVIIF"
     gene            1438842..1441057
                     /locus_tag="CNC04760"
                     /db_xref="GeneID:3256568"
     mRNA            join(1438842..1438901,1438997..1439159,1439217..1439294,
                     1439343..1439441,1439495..1439745,1439798..1439926,
                     1439982..1440094,1440148..1440318,1440371..1440528,
                     1440585..1440757,1440818..1441057)
                     /locus_tag="CNC04760"
                     /product="NADH kinase, putative"
                     /transcript_id="XM_024656827.1"
                     /db_xref="GeneID:3256568"
     mRNA            join(1438843..1438926,1438997..1439159,1439217..1439294,
                     1439343..1439441,1439495..1439745,1439798..1439926,
                     1439982..1440094,1440148..1440318,1440371..1440528,
                     1440585..1440757,1440818..1441057)
                     /locus_tag="CNC04760"
                     /product="NADH kinase, putative"
                     /transcript_id="XM_024658443.1"
                     /db_xref="GeneID:3256568"
     CDS             join(1439047..1439159,1439217..1439294,1439343..1439441,
                     1439495..1439745,1439798..1439926,1439982..1440094,
                     1440148..1440318,1440371..1440528,1440585..1440645)
                     /locus_tag="CNC04760"
                     /codon_start=1
                     /product="NADH kinase, putative"
                     /protein_id="XP_024512459.1"
                     /db_xref="GeneID:3256568"
                     /translation="MLKLLRSPRQSALYLRESRRSIHYLRDLPVSPPSQLTSKPRLVP
                     CEPLIGDSSAMGAAKFPPAAHQLKKWTTEPTTLLLIQKRNDPRTTAAMGFILSHIQEH
                     YPHLRLIVEPHTAMDHPSFDNLIVASPGDQALLPLHTSLVLTLGGDGTILHVSNLFSQ
                     GECPPVLSFSMGSLGFLLPFHISALSTALENTLKGPVSVLNRMRLACKPIAVDGDPLN
                     RCTENVSEAGWQVMNEVALHRGRNTHLTVVDTYFDGQHLTEAVADGILLSTPTGSTAY
                     SLSAGGPISHPETDAFLLTPIAPRSLSFRTVILPGRGEVRLEISPLARSPAELSIDGK
                     GVCLLNAKESVIISRSPFPIPCVERSGNESGWVKDINSLLQFNVGFKNKSLMGHSS"
     CDS             join(1439047..1439159,1439217..1439294,1439343..1439441,
                     1439495..1439745,1439798..1439926,1439982..1440094,
                     1440148..1440318,1440371..1440528,1440585..1440645)
                     /locus_tag="CNC04760"
                     /codon_start=1
                     /product="NADH kinase, putative"
                     /protein_id="XP_024514300.1"
                     /db_xref="GeneID:3256568"
                     /translation="MLKLLRSPRQSALYLRESRRSIHYLRDLPVSPPSQLTSKPRLVP
                     CEPLIGDSSAMGAAKFPPAAHQLKKWTTEPTTLLLIQKRNDPRTTAAMGFILSHIQEH
                     YPHLRLIVEPHTAMDHPSFDNLIVASPGDQALLPLHTSLVLTLGGDGTILHVSNLFSQ
                     GECPPVLSFSMGSLGFLLPFHISALSTALENTLKGPVSVLNRMRLACKPIAVDGDPLN
                     RCTENVSEAGWQVMNEVALHRGRNTHLTVVDTYFDGQHLTEAVADGILLSTPTGSTAY
                     SLSAGGPISHPETDAFLLTPIAPRSLSFRTVILPGRGEVRLEISPLARSPAELSIDGK
                     GVCLLNAKESVIISRSPFPIPCVERSGNESGWVKDINSLLQFNVGFKNKSLMGHSS"
     gene            1441618..1445883
                     /locus_tag="CNC04770"
                     /db_xref="GeneID:3256577"
     mRNA            join(1441618..1441719,1442244..1442846,1442898..1443100,
                     1443152..1443501,1443551..1443717,1443770..1443788,
                     1443845..1443987,1444040..1444717,1444780..1444880,
                     1444966..1445156,1445234..1445559,1445676..1445883)
                     /locus_tag="CNC04770"
                     /product="endo-1,3(4)-beta-glucanase, putative"
                     /transcript_id="XM_024656828.1"
                     /db_xref="GeneID:3256577"
     CDS             join(1442412..1442846,1442898..1443100,1443152..1443501,
                     1443551..1443717,1443770..1443788,1443845..1443987,
                     1444040..1444081)
                     /locus_tag="CNC04770"
                     /codon_start=1
                     /product="endo-1,3(4)-beta-glucanase, putative"
                     /protein_id="XP_024512460.1"
                     /db_xref="GeneID:3256577"
                     /translation="MLFSNVVFPLFTLSFAAPAVSAMHLNPAHAKRAAVAHRDIGSVK
                     LARSEDAVIAGRNKEKRLVRKKKRSTCQAKFNATSSSIDSGTSSSVTASATATNAIGN
                     IENWANGSASASSSNAEMTSTSSAFSAAQTAASTSGWYLVEEWSGSTFFDNWSFWDYS
                     DPTHGTVDYVSASEAWNQGLISINSAGHAIMSVDTTEVVSGGRKSVRIHGNKIWNGGM
                     VIMDAYHMPTGCGTWPAWWQNGPNWPEGGEIDILEGVNDFTQNQVSIHTGVGCTIPSD
                     TNDKQLATLTTGSFDSYDCSSADTSNQGCGARDETNDNSYGANFNSVNGGVYAMRWDK
                     SGIAAWFFQRSDIPSDITNNSPDPSTWGTPVAYFASDSCDPYEFFYDHFNIFDTTFCG
                     DWAGADGVWNNAGYAGQDQSCAAITGYSTCSDYVLNKGSSFSEAFWEIASVKYYNSTT
                     EV"
     gene            complement(1444574..1445455)
                     /locus_tag="CNC04780"
                     /pseudo
                     /db_xref="GeneID:3256403"
     gene            1446490..1447832
                     /locus_tag="CNC04790"
                     /db_xref="GeneID:3256356"
     mRNA            join(1446490..1446776,1446830..1447459,1447525..1447832)
                     /locus_tag="CNC04790"
                     /product="histidinol-phosphatase, putative"
                     /transcript_id="XM_569759.2"
                     /db_xref="GeneID:3256356"
     CDS             join(1446618..1446776,1446830..1447459,1447525..1447785)
                     /locus_tag="CNC04790"
                     /codon_start=1
                     /product="histidinol-phosphatase, putative"
                     /protein_id="XP_569759.1"
                     /db_xref="GeneID:3256356"
                     /translation="MPHSHHSHSGQFCRHAKDNLEDVILEAIRQGFQSFGLSEHAPRW
                     RVEDLFPEEADLCPSDLLSTYEDFLKTALILRSKYDSQISLLVSLETDYITPLDSEKL
                     TSFLVEHTEIDYIVGSVHHVNGVSIDFDRPTWLRAVKLAKEGRIGKTMDPGPPPTLEL
                     GDPNDPELMTTYTPDLLSVQPFFEAYFDAQYDLIVKHQPEVLGHIDLCSLWIPNISLM
                     EQEPVWQKVIRNVKAVIAYGGLFEANAAAIRKGWKTSYPCRDILQLIQELGGRVCLSD
                     DSHGISYVGLNYLKMRDYLKGMGLERTWYLVSSSRRQTGDYTVGERGRVAARPLDGWY
                     DHPFWAKLSDAQRRK"
     STS             1447090..1447909
                     /standard_name="Xba12"
                     /db_xref="UniSTS:470754"
     gene            complement(1447830..1449082)
                     /locus_tag="CNC04800"
                     /db_xref="GeneID:3256491"
     mRNA            complement(join(1447830..1448141,1448196..1448355,
                     1448412..1449082))
                     /locus_tag="CNC04800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656829.1"
                     /db_xref="GeneID:3256491"
     CDS             complement(join(1447956..1448141,1448196..1448355,
                     1448412..1449013))
                     /locus_tag="CNC04800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512601.1"
                     /db_xref="GeneID:3256491"
                     /translation="MSWTMGNCLSVPVSSSNSSSNNIQLPPRRPISSSLSSNNTLSST
                     SYPVPKKGKNHAQSFHRRRTSESSQMASHPLLALRQYATLPNPQSSLPPSKLLFSNSN
                     TMVVFDSYPKAKYHFLVLPRYPFPPQSDPDSDESIVSIETLDDLKSLLRKAGADQREE
                     VLRAMAETAREVEEMIRDEMLKTEGFEWKIDVGFHAIPSMKHIHLHVISEDRISPYLK
                     SKKHYNSFRPDLGFFIPIMEVQRWLQDDRTVLDRVEALPATQTLLKTPLTCFKCDEPM
                     NNIEKLKQHFEKEFSSERKEAFKYIAKHGRQRSSEEEIF"
     gene            complement(1451495..1452829)
                     /locus_tag="CNC04803"
                     /db_xref="GeneID:36392803"
     mRNA            complement(join(1451495..1451949,1452011..1452166,
                     1452217..1452525,1452590..1452829))
                     /locus_tag="CNC04803"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658444.1"
                     /db_xref="GeneID:36392803"
     CDS             complement(join(1451686..1451949,1452011..1452166,
                     1452217..1452402))
                     /locus_tag="CNC04803"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514301.1"
                     /db_xref="GeneID:36392803"
                     /translation="MIFALALFTTAVAVKGLSIPGVRDTPASSTTLAYIGCVADDSVS
                     SLTSGSAATNAEARESCASTCLQRGGSQLAYFNQEAHSCVCAGADQYPSSGEIVYAED
                     NSGNCRDSDGASVDYIFSPYTLSQCYLTLDSEIAPSSNMTSPSPLDCLNTCTTEYLSI
                     RPEYDEANDQYVYECSCWEDQVQGGQNSDCGFGIEAVYRKA"
     gene            complement(1453529..1454928)
                     /locus_tag="CNC04805"
                     /db_xref="GeneID:36392804"
     mRNA            complement(join(1453529..1454093,1454159..1454311,
                     1454372..1454928))
                     /locus_tag="CNC04805"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658445.1"
                     /db_xref="GeneID:36392804"
     CDS             complement(join(1453743..1454093,1454159..1454311,
                     1454372..1454584))
                     /locus_tag="CNC04805"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514302.1"
                     /db_xref="GeneID:36392804"
                     /translation="MISVQLLAILFVPSTFAISLPYLYTRRLTHVDQEPFSPQFTGCV
                     KEDYTTGLTEDGYLLDKSMQYNNEDCIKHCIEDGINQYAFYSYKDRMCHCSKEQQYIP
                     SADYRDGDGDAGGCMPHQIIITYLISPFIFSGCTWSSTSTRPNASIRSFITFPTASHE
                     NCLDLCSSNPEANVAEVTPTYNAEHDWWHFQCSCFNEQSSSPEPSLVVNQEMDIELVT
                     WEDYKSSCGFESVFKYRRST"
     gene            complement(1456110..1458715)
                     /locus_tag="CNC04810"
                     /db_xref="GeneID:3256545"
     mRNA            complement(join(1456110..1456499,1456555..1456648,
                     1456700..1456761,1456826..1457045,1457108..1458056,
                     1458112..1458177,1458229..1458715))
                     /locus_tag="CNC04810"
                     /product="pantothenate kinase, putative"
                     /transcript_id="XM_569762.2"
                     /db_xref="GeneID:3256545"
     mRNA            complement(join(1456110..1456499,1456555..1456648,
                     1456700..1456761,1456817..1457045,1457108..1458056,
                     1458112..1458177,1458229..1458715))
                     /locus_tag="CNC04810"
                     /product="pantothenate kinase, putative"
                     /transcript_id="XM_569761.2"
                     /db_xref="GeneID:3256545"
     CDS             complement(join(1456421..1456499,1456555..1456648,
                     1456700..1456761,1456826..1457045,1457108..1458056,
                     1458112..1458177,1458229..1458330))
                     /locus_tag="CNC04810"
                     /codon_start=1
                     /product="pantothenate kinase, putative"
                     /protein_id="XP_569762.1"
                     /db_xref="GeneID:3256545"
                     /translation="MPAQSSMPDISIPQARRIVVDTTGAQIVQEESPATRDSRGIYLP
                     HYTEPVSHIAIDVGGSLAKVVYFTRSNLPISATPTSSGTSSPFLPPSQSVSQPTPIVT
                     ERSPMSSYFPRDSPTLNPHSHAPFDPSPAEPRRPTVNGALTPATLSEDNATTPLPAKS
                     KHRSRNSIHNPLPPPLPGGLLNFARFETDNIEELIIFLQDLISSSATANRVSLEKMKR
                     NVKVMATGGGAHKYYDRLADELGVEVHREEEMECLIRGLGFVTRVPEEVFYFSEELVY
                     KVSHAGSASEQALTIPASELPRPSPMPPAYQVTFAPIPSDDDPVPHFPCLVVNIGSGV
                     SIVKVDEDGSFERVSGTSLGGGTLWGLLSLLTDAESFDEMLLLSEKGDNSAVDMLVGD
                     IYGSDYNKIGLKSSTIASSFGKVFKKGSNAERRKRFKQEDIAKSLLYAISNNIGYMNA
                     AKYGLDKVFFGGCFIRGHAATISTLSYAIRFWSKGTMTACFLRHEGFLGAIGAWIKNV
                     GELDENGSPLQKHSD"
     CDS             complement(join(1456421..1456499,1456555..1456648,
                     1456700..1456761,1456817..1457045,1457108..1458056,
                     1458112..1458177,1458229..1458330))
                     /locus_tag="CNC04810"
                     /codon_start=1
                     /product="pantothenate kinase, putative"
                     /protein_id="XP_569761.1"
                     /db_xref="GeneID:3256545"
                     /translation="MPAQSSMPDISIPQARRIVVDTTGAQIVQEESPATRDSRGIYLP
                     HYTEPVSHIAIDVGGSLAKVVYFTRSNLPISATPTSSGTSSPFLPPSQSVSQPTPIVT
                     ERSPMSSYFPRDSPTLNPHSHAPFDPSPAEPRRPTVNGALTPATLSEDNATTPLPAKS
                     KHRSRNSIHNPLPPPLPGGLLNFARFETDNIEELIIFLQDLISSSATANRVSLEKMKR
                     NVKVMATGGGAHKYYDRLADELGVEVHREEEMECLIRGLGFVTRVPEEVFYFSEELVY
                     KVSHAGSASEQALTIPASELPRPSPMPPAYQVTFAPIPSDDDPVPHFPCLVVNIGSGV
                     SIVKVDEDGSFERVSGTSLGGGTLWGLLSLLTDAESFDEMLLLSEKGDNSAVDMLVGD
                     IYGSDYNKIGLKSSTIASSFGKVFKKGSNAERRKRFKQEDIAKSLLYAISNNIGHVAY
                     MNAAKYGLDKVFFGGCFIRGHAATISTLSYAIRFWSKGTMTACFLRHEGFLGAIGAWI
                     KNVGELDENGSPLQKHSD"
     gene            1458972..1462190
                     /locus_tag="CNC04820"
                     /db_xref="GeneID:3256584"
     mRNA            join(1458972..1459070,1459325..1459385,1459637..1459927,
                     1459986..1460332,1460382..1460778,1460829..1461115,
                     1461177..1462190)
                     /locus_tag="CNC04820"
                     /product="phosphoinositide phospholipase C, putative"
                     /transcript_id="XM_024656830.1"
                     /db_xref="GeneID:3256584"
     CDS             join(1459786..1459927,1459986..1460332,1460382..1460778,
                     1460829..1461115,1461177..1462094)
                     /locus_tag="CNC04820"
                     /codon_start=1
                     /product="phosphoinositide phospholipase C, putative"
                     /protein_id="XP_024512469.1"
                     /db_xref="GeneID:3256584"
                     /translation="MDNDSSVVPSQLQVGVPMLKISSKKIKQVIFKIRNGCILWSSKK
                     DSRVPIGDIRDLRLGQPPSDSYNSNRWITVVYVRSQQWKVLHMIALTDEIYFLWVKTL
                     KQLVSITLDRQVTDITPSDPDMLWIRQLWPLGTKAINREKAEALCAQIGLQIKADVGD
                     LKEGMLDITVFHDLIKASQTRPDINQVYRDLTLSGLLDKGRVVSFLTHIQRIPSSSVE
                     NVFNRYKSGDLWTIDSLTSFLSSSDNTPNQPQDMTHPLQHYFISSSHNTYLVGEQWKG
                     ESTVEGYIRVLLAGCRCVEMDVQSGDVEPVVYHRKTLTSSVPVRDICRAIKQYGFVTS
                     PYPIIISTEIHCASEQQNRLAIILKEVFGDMLVSAPLVEEFSELPSPEDLKGKILFKA
                     KPPKPELNSPKLEANLFYQESPSSTDSDTSFVRLARRLSIQSKTERPDIFSPQLSELL
                     VYTHGVKYQGFSKLNEYLPSHQFSVSERTAAKILKENKVDWIKHNFKHISRVYPRGTR
                     LGSTNFNPVDSWSAGCQIVALNWQTLDESILLNHAMFHDSNGYILKPLSLREKVVEVP
                     EKYLLTVRIISGQRTPLCADLYVEAILNGKISKRTRALSQVTLNPLWDETLTFEITST
                     PSLLMLNFLHLEVRNKALQAQWMRPVSLAPRGYHHLPLYDSLLSRFVFATLFVKITVE
                     KLQDVVENEKSNLI"
     gene            complement(1462196..1464404)
                     /locus_tag="CNC04830"
                     /db_xref="GeneID:3256592"
     mRNA            complement(join(1462196..1463749,1463818..1464404))
                     /locus_tag="CNC04830"
                     /product="tryptophan 2,3-dioxygenase, putative"
                     /transcript_id="XM_569766.2"
                     /db_xref="GeneID:3256592"
     CDS             complement(join(1462373..1463749,1463818..1464183))
                     /locus_tag="CNC04830"
                     /codon_start=1
                     /product="tryptophan 2,3-dioxygenase, putative"
                     /protein_id="XP_569766.1"
                     /db_xref="GeneID:3256592"
                     /translation="MFPPHTPSSRLAPSISLPPNHFLSLAPSFTQPNALYPSGAPSTS
                     SAASNGLAPNTASLASADFEVDVRTGFLPATKNVERLSGEYEVWEEALDAARGSAVGG
                     GVMLGGKREKDQLWRAGVESLPVVATDDLRASLPHLRRAHLVLTFLAHFYVHTTPLPG
                     PSAQKEPTSIPPCISIPLLAVSPLLGLPPILTYADTVLWNFLPLNSLIAPSAFSNPPN
                     RIITTFTNTRSEEQFYLISALCEIAGAEALGLMRQSLDELFIADEKALRRVTIYLKKL
                     ADQIDRISDITMTLMNEVDPEEFYHLIRPWFRGGDADGPGSVGWDYLGLAADNANVVA
                     GTHEAESASTEGRRGKLFSGPSAGQSSLIHAIDIFLTVDHSPTEEERREAMEAAENRP
                     EQSGVFIKMNSSPVNASTAPSASKPHGHSHGSIAPPVSNSNPSAAAPKSEATFLQRML
                     AYMPLPHRSFLIHLSTHPTPLRPLVLHFAASHPTLVQAYDGALESLRRFRERHMRVVS
                     KFIVQQARRKPGERIRRLTGMEMEDDEDESTMANAGELRGTGGTALFKFLKRCRDNTT
                     KAMLQPTGAGYELK"
     gene            complement(1464677..1466255)
                     /locus_tag="CNC04835"
                     /db_xref="GeneID:36392805"
     mRNA            complement(join(1464677..1465167,1465223..1465354,
                     1465402..1465451,1465504..1466255))
                     /locus_tag="CNC04835"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658446.1"
                     /db_xref="GeneID:36392805"
     CDS             complement(join(1464698..1465167,1465223..1465354,
                     1465402..1465451,1465504..1465916))
                     /locus_tag="CNC04835"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514303.1"
                     /db_xref="GeneID:36392805"
                     /translation="MNTLLYLAPTVSPSNSVPTSTTALFASTSNSSTMSSPPTIHRSL
                     TCPSSIPLPPSHPTPIFKYDDVGMSRTANHTCQEPQSTDNSGAIKENNIDVPDTPIAI
                     VWPPWKRRDGWSGWMGDTVTADSLVWSLIIQAFSTGILDATTSLDFSTFASNQTGNTI
                     LLTVAIVRLSGHLLLLTGVSLASFLSGALVFGHLGHFFGLRRRAWLLTNVFFQLVCLT
                     LAAIFLSPSGPVATRLGNKHDWTIIMLFAMMSGAQVAAARQASVQEIPTAPMTSSYVD
                     LVSDKHLFVGFTHKKAGARNRRLGYVLAMITGSFIGAIMHKYAGSWVVVVVAMGFKFA
                     VLLLMSVAPADPRKERPERV"
     gene            1466424..1468405
                     /locus_tag="CNC04840"
                     /db_xref="GeneID:3256575"
     mRNA            join(1466424..1466541,1466596..1466639,1466700..1466787,
                     1466853..1467095,1467155..1467478,1467533..1468025,
                     1468082..1468405)
                     /locus_tag="CNC04840"
                     /product="tetrahydrofolylpolyglutamate synthase, putative"
                     /transcript_id="XM_569768.2"
                     /db_xref="GeneID:3256575"
     CDS             join(1466491..1466541,1466596..1466639,1466700..1466787,
                     1466853..1467095,1467155..1467478,1467533..1468025,
                     1468082..1468332)
                     /locus_tag="CNC04840"
                     /codon_start=1
                     /product="tetrahydrofolylpolyglutamate synthase, putative"
                     /protein_id="XP_569768.1"
                     /db_xref="GeneID:3256575"
                     /translation="MLPTLRLFRMASTRTYAEAVSLLNTCQSNAATIEAFRKSGGRLT
                     EYAVAEMHDYLRRIGYKPEDLNALNVVHITGTKGKGSTSAFTERILRAHMPGKKVGLY
                     TSPHLCAVRERIRINGEPISETEFAKYFFEVWDRLEADSKPLTPQTPKFPVYFRLLTL
                     LAFHAFLSQGVSATVLEVGIGGLYDSTNIVPKPVVTGITSLGLDHTAVLGNTIEEIAR
                     NKAGIYKKGVPALSVVQEKGGDVLKEVAEMNEAPFEIVPTIPPTPLGLPGSHQLINAS
                     LAVSLSSHFLSSQGYKFSLATPPAVVPPSFVQPLASARWPGRCQLVKKGEITWLLDGA
                     HTVESLRSCGEWAWDAEKEDRMPQVLIFNCSGGRAAESLLGELLESGARTRKTSRDEI
                     ASKFDSVIFCTNVTYIDGHFKSDLDAKAIDPNDLSQLATQNALRDAWLRLNPSFAADR
                     VHAVASIQHAIRIVENLGEKTVLVAGSLHLVGGVMEVAGLQNALSME"
     gene            1468489..1471767
                     /locus_tag="CNC04850"
                     /db_xref="GeneID:3256119"
     mRNA            join(1468489..1468569,1468639..1469008,1469058..1469349,
                     1469401..1469579,1469637..1470080,1470137..1470826,
                     1470914..1471115,1471270..1471767)
                     /locus_tag="CNC04850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656831.1"
                     /db_xref="GeneID:3256119"
     CDS             join(1468641..1469008,1469058..1469349,1469401..1469579,
                     1469637..1470069)
                     /locus_tag="CNC04850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512581.1"
                     /db_xref="GeneID:3256119"
                     /translation="MAKLSPLTLIFIAACLSRILQLTILSGLSKALPLFDTSPSLLLS
                     SPPPALRWDAIHFASVAYNGYEYEQQVAFQPGWLAVMRLAGEGVRFIRAASVVELKDV
                     ILGGTIVANVAFVAATLVLYKLTKHIFNPTFAFLTSLLYLLPPTATPSAPYTEPIYSL
                     LTFSGIYLLSIKRQMVLAGLCFAGATTIRSTGIFNSITLMCFAVFGDAHIFDLDPKDY
                     CKIRKKLKPFLSAILVVAPFFMFQHYTETVFCTRELKRASTARPWCSNSPPVSYGFVQ
                     KLYWNVGPFEYWTVSQLPNFALAMPILFFSLAGVVKFFSHLVSSSQVLNHGTEEIPPP
                     PILFELYSVHVLTMALLLFTSHTQITLRVCLGDPVVWWNAVKLGFDNVQIGEAPTGQV
                     KVNKFGRYWIGWTVVWGAVAAVLWAGHYPPA"
     gene            complement(1470043..1471185)
                     /locus_tag="CNC04855"
                     /db_xref="GeneID:36392806"
     mRNA            complement(join(1470043..1470848,1470907..1471185))
                     /locus_tag="CNC04855"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658447.1"
                     /db_xref="GeneID:36392806"
     CDS             complement(join(1470343..1470848,1470907..1471075))
                     /locus_tag="CNC04855"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514304.1"
                     /db_xref="GeneID:36392806"
                     /translation="MTALLPIMTETTVGHLSTKKIDRFAIQSSQARNRFKVDETEQRE
                     NEYAYDEMAELSDSPSSVHTSSRPVTPSHPPPFPLHISTQDTPETEIFKLADKAEKIL
                     GLTPGTLAYARACLENARDKVRCMALLPSPEPLSIISKDGKLSHLDMGRGGIKEKMQT
                     RARKAVSITGLRLLDHQRIASVVLGAGGNEEEQQRLKRRRAADSVLYWQEEVARLEDL
                     DKRARE"
     gene            complement(1472106..1473109)
                     /locus_tag="CNC04860"
                     /db_xref="GeneID:3256498"
     mRNA            complement(join(1472106..1472264,1472316..1472422,
                     1472478..1473109))
                     /locus_tag="CNC04860"
                     /product="signal peptidase I, putative"
                     /transcript_id="XM_024656832.1"
                     /db_xref="GeneID:3256498"
     CDS             complement(join(1472363..1472422,1472478..1473086))
                     /locus_tag="CNC04860"
                     /codon_start=1
                     /product="signal peptidase I, putative"
                     /protein_id="XP_024512583.1"
                     /db_xref="GeneID:3256498"
                     /translation="MGITTHCVPLAMSFRTAFARLRPPPLLPTTIRTLQILATLHLVS
                     TTLAELRICTGFSMLPTLSQHGDCVLVSPLPYWSPLSEKHKSAGPKRGDVVVATSPMH
                     PGQTVCKRVLGIEGDLIEIEPRRGGQRKWIDAGGNGYMVDIPDSQAEMDNVLLPRRNG
                     EGQWVKVPKGHVWLVGDNLSNSTDSRKYGPVPIAMVKGKVIARVYPNPTWITNVARDI
                     QVEA"
     gene            1473224..1475672
                     /locus_tag="CNC04870"
                     /db_xref="GeneID:3256572"
     mRNA            join(1473224..1473980,1474032..1475672)
                     /locus_tag="CNC04870"
                     /product="hypothetical protein"
                     /transcript_id="XM_569771.2"
                     /db_xref="GeneID:3256572"
     CDS             join(1473289..1473980,1474032..1475514)
                     /locus_tag="CNC04870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569771.1"
                     /db_xref="GeneID:3256572"
                     /translation="MDNHQHLQQHPPPPVFSMTIAMPGPAPPRSSPPADGSDAHQAAD
                     SNQGPAQESTIYWTFHIGPGSVRSPNDNQSSNEHPAVPGPNGRSGEPRGPAEGGGDAN
                     NNAPPPWLFPPFFQFLMPRREPQPNPEKAAELLRSLPTVGKRLLNRVNNVVAAQDIDS
                     YEDDDDKGWKCGICLEGIHKEKLEKGEGKAVGDGKTEGEKEDKGTGVKALPCNHLFHG
                     DCLEPWFTTHHTCPTCRLDLDPLQTLNSPLRPGPARNNSFRPARTGAGRSTSNAHPYS
                     RDQSRDQSRNGERDQNDTAGDQVSADASGSGDNSRSNTPQERGQRSSLTPHLFIFAGP
                     NHPREPQQEHSPEAANDAAAVPHDPTSQPAEPPSANVPTGGEAPTTPGGNSRPSASHR
                     PFFDPAEILGAIFGGPPSASPLPMHRHSSPFPSSPGENATQSSNVPLSGNTGSTPTSQ
                     SGGSEPQDASSVESQPASEQSAQPPPSDRPQPERRAHIQIIQEALEQLPFIFNNHPIV
                     PPLPTAFPFPGMVPVGERPSTPNAVDHTTDGSTAGAPSNGDTATAADEALGAGQAQSQ
                     TSAKQPFVPQSLESWTEEKEKSLGWRCDAPECVYGPSTSEEDDDSDGYPPTTDELEED
                     QKNKEMVSIFSAVQPPLSSAEAKEAHENDHDFTLLACTHRWHRGCLEIAERSAGRMSK
                     DDGEGRIWVRCERCRKDGWIPPVAESTGSGVGRKRKEAEMTV"
     gene            complement(1475645..1477537)
                     /locus_tag="CNC04880"
                     /db_xref="GeneID:3256551"
     mRNA            complement(join(1475645..1475819,1475872..1476055,
                     1476110..1476502,1476552..1476978,1477037..1477220,
                     1477296..1477537))
                     /locus_tag="CNC04880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_569773.2"
                     /db_xref="GeneID:3256551"
     CDS             complement(join(1475697..1475819,1475872..1476055,
                     1476110..1476502,1476552..1476978,1477037..1477220,
                     1477296..1477409))
                     /locus_tag="CNC04880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_569773.1"
                     /db_xref="GeneID:3256551"
                     /translation="MKTPRRVPWTSQTELTELYDMLFSPAADLESRRRGLARMSIYIS
                     SPSCPSFIHLLHSLVAAELLPYPPPRGAEESQRMRMMMGMAIVRFVNGMVDPLQTGSY
                     ARPISHLAATLGLPPSLIALRHRATHEDLPPLPLLHQAVTQCIVYLHQNSFVPLVTSS
                     YGSPPPAVLERQQATAKRIDGLLKKWKKIAKNRLRDKEVREEDESAIEMKKVRKELEG
                     EVAGASGIVRGLVEVGSLVPLAKRKRASQKAVSPPPPSLKIWEPLLTHLSDTTMPDLS
                     STLSVQILDILLNPSTSPILSQEPQGFNPSEELISLNEDEKDTSGESESYRWGLAVWL
                     IYFWGNSSSESALKLTQEEKKAIYRRLALTLLHKYDDPILTRLHKCLAELDESLRDIA
                     NDLIVLSKTDARDNLTDSDMEVDVIESRLQAMEKRLVEVEGRSAPAQINDANAAPVIE
                     SASLPGWRRLTPQEWTPCPIGTFI"
     gene            complement(1477714..1480108)
                     /locus_tag="CNC04890"
                     /db_xref="GeneID:3256594"
     mRNA            complement(join(1477714..1478069,1478129..1478456,
                     1478517..1478627,1478680..1479792,1479950..1480108))
                     /locus_tag="CNC04890"
                     /product="ornithine decarboxylase, putative"
                     /transcript_id="XM_569775.1"
                     /db_xref="GeneID:3256594"
     CDS             complement(join(1477967..1478069,1478129..1478456,
                     1478517..1478627,1478680..1479721))
                     /locus_tag="CNC04890"
                     /codon_start=1
                     /product="ornithine decarboxylase, putative"
                     /protein_id="XP_569775.1"
                     /db_xref="GeneID:3256594"
                     /translation="MSSTIIQDYMAPAAPVSTRQSSWAEQQTLQSRSTVSNLIKTLDP
                     ATQIPYVPEVALPTPPATTTHSIISNDEEHPALAPVVDIPVHQLVQQTIAASTGVDID
                     ESAFFAADLSAVYQAVQMWRASPIGSRVEIFYAVKCNPSPAVLHLLSLMGTSFDCASS
                     SEINQVLSLPSAPSGDRIIFANPCKPASFIRTAAQRGVSMMTFDNVDELYKVKRICPN
                     AKLVLRMLTDDSKSLCRLGLKFGAPVDSCPGLLKVARQLGLNVVGVSFHVGSGCKDPM
                     QFADAVWRARKVFDMGKEAGYNFDLLDIGGGFERETFAEMTQVLKDSFDLYFPEDSGV
                     RIIAEPGRFLVSSAFTLATSIIASRRAPKAEASQQVQAATQEDTKSADVMYYINDGVY
                     GSFNCIMFDHQIVHPHPLTIGHKLAIAAPPFPPPPNVQLEVDLPVQMGYKDVEKVSVW
                     GPTCDSIDCVRQLVDLPKGMDVGDWIGWGEMGAYTLCAASTFNGFDRSPVLWTTGGNT
                     EDARMVRAILDSFAATSLR"
     gene            1482322..1485960
                     /locus_tag="CNC04900"
                     /db_xref="GeneID:3256546"
     mRNA            join(1482322..1482774,1482888..1482997,1483050..1483741,
                     1483799..1485960)
                     /locus_tag="CNC04900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656833.1"
                     /db_xref="GeneID:3256546"
     CDS             join(1482751..1482774,1482888..1482997,1483050..1483741,
                     1483799..1485759)
                     /locus_tag="CNC04900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512600.1"
                     /db_xref="GeneID:3256546"
                     /translation="MGGDHKCPLCSATFTRPQHVGRHLRSHTGDRPYECKECPLRFAR
                     SDLLSRHVNKAHRAPDEGPSDKKPTKKGRRKSVPASSHSALTKIRIEEQEEEQRRQLL
                     QRQQFQRQQQQQQEQQQQLLQQQMQQEAAAVRERSKSESLNQQPHLQALRMYPHHPLL
                     ASRPVQPSIASNSWNTNPSGSFAAAGMMAMSPPFDPTIQRLGGNLQPFQGQPFLVGQL
                     PNDPPFTGQPMRLSGSDQGMKAADGPSASVFYELGMKKRACDQCNHSKVRCDFADPCL
                     RCRQRNLSCSYRKPPKLSTTMAPPPAPYNLPLNTSSTTVSPTSPYSSPNSSTSVLAPT
                     EPISYRKPSVASLPPNLGNVPNQSNAQSVPWVSYQNTMGTTWPSPQAQTTYSIPDGTA
                     PGSITGQFVESPGAVHPALPPYSSQSKARAEHSLSPHRLSMTQTPSLVDSIDTSSEMD
                     MDDPAERRGSHNSFTSSVPRTQWGIKGKEVEGVLRLLPNTGAFEQNTSPTQTASNQVS
                     PVPVRADQLSDIVSNPQWQSQGTINPKWQTRGNFSSDDESSSVLSSSANSTFLEQSVN
                     ASASHGNIHHERRRSSESAWDKAMEQMTIQDPQKNMAVVGEIADGSVPTVPQISETAS
                     EGTQELPGLIGPNAEESPMVPTLSDVKDLWRFFMTEPMTGLTPAGEKLNELDNLPVVT
                     PRPGMGKRTFSKSSSMPDLQSPLVTGPAFFSTFLSGMTPKPTEAQHSYMPSHWAERDH
                     SSVTEGLDEPDMGKWNKEIEQRQSSFSLGKPNAKLGKGKPDTLSGINDAPIQPPATQP
                     IRPLPSVVQRSSALDQTLAPERLPSFGLTPGFEIQQNPLLSKLGLASADARTGSKRMA
                     SSTLVNDHRKATFTVWDEDGPATQGQGNGAGYGAESKALAGGGALGVSTAQGKGLQQS
                     PFKSWALNTSAGAS"
     gene            1486073..1487682
                     /locus_tag="CNC04910"
                     /db_xref="GeneID:3256815"
     mRNA            join(1486073..1486250,1486312..1486388,1486440..1486478,
                     1486531..1486626,1486687..1487682)
                     /locus_tag="CNC04910"
                     /product="expressed protein"
                     /transcript_id="XM_570019.2"
                     /db_xref="GeneID:3256815"
     CDS             join(1486163..1486250,1486312..1486388,1486440..1486478,
                     1486531..1486626,1486687..1487646)
                     /locus_tag="CNC04910"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570019.1"
                     /db_xref="GeneID:3256815"
                     /translation="MPPAQLSNSFIYLTALFKPALLRPHLRVPSIANVDFKALKKEGY
                     NAVVIDKDNCLTLPHKDDIYPPYQKAWTDLLSTFRPGRVLVVSNSAGTTKDPGGIAAE
                     AVSLSLRAPVLLHHIPKPGCSANILSYFCGKLGQPTTLRHDIASAGFKLWKAEKLDEK
                     TLWGKWENEVEGPLLGGSRREQEGDEDTDGEKVAKGQKVIPPISSTDRAHTLSKETLT
                     AEDLRLLVIGDRLFTDTLLADRLSRHLPPLSAAIPDVPSIPRVLSIYTTSLPQPRDVR
                     LLRWLEEKFSQGKTKGDYSKFITEENVLSSAADVSTTVPSIWKVLQWFTPARWREINV
                     PYLTWNPRSWKPLPLAVAFGKMTGRVGMLIWRYTRQGGQLGWSKGKQWFAERKEQSRK
                     LAVAKELESSVSREPFSKDERVTTSVA"
     gene            complement(1487789..1488899)
                     /locus_tag="CNC04920"
                     /db_xref="GeneID:3256747"
     mRNA            complement(join(1487789..1487980,1488079..1488248,
                     1488307..1488587,1488640..1488899))
                     /locus_tag="CNC04920"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658448.1"
                     /db_xref="GeneID:3256747"
     mRNA            complement(join(1487789..1488248,1488307..1488587,
                     1488640..1488899))
                     /locus_tag="CNC04920"
                     /product="hypothetical protein"
                     /transcript_id="XM_569777.2"
                     /db_xref="GeneID:3256747"
     CDS             complement(join(1487837..1487980,1488079..1488248,
                     1488307..1488587,1488640..1488845))
                     /locus_tag="CNC04920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514305.1"
                     /db_xref="GeneID:3256747"
                     /translation="MLSPISAPPTSISPEDHAQLTSSTPSSFSDIPPVLRWSDQVEVE
                     LSSTNGGWESWSSPRSQGKLYVTEESVAFIPNPPSTIGFNLPYTALTLHALTPASSGG
                     PAHLYCQVDDSDATGVSGQVDRQVNGDAMAEDEEEGEDEAGEDEYTVMREVRIYLSDT
                     SKLEPLFQALSQCSALHDSLLPNGEPSSFFGFGGDESEGEDGQWDDAPEDDDSTSGPG
                     RVEASFDDKSQETGQDEESQVVDQMERFLSLVDWGDVKKPDGWDIRGH"
     CDS             complement(join(1488022..1488248,1488307..1488587,
                     1488640..1488845))
                     /locus_tag="CNC04920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_569777.1"
                     /db_xref="GeneID:3256747"
                     /translation="MLSPISAPPTSISPEDHAQLTSSTPSSFSDIPPVLRWSDQVEVE
                     LSSTNGGWESWSSPRSQGKLYVTEESVAFIPNPPSTIGFNLPYTALTLHALTPASSGG
                     PAHLYCQVDDSDATGVSGQVDRQVNGDAMAEDEEEGEDEAGEDEYTVMREVRIYLSDT
                     SKLEPLFQALSQCSALHDSLLPNGEPSSFFGFGGDESEGEDGQWDDAPEDDDSTSGPG
                     RVRSDYHSGGGPEARFRPY"
     gene            complement(1489070..1490946)
                     /locus_tag="CNC04930"
                     /db_xref="GeneID:3256376"
     mRNA            complement(join(1489070..1489301,1489353..1489738,
                     1489953..1490030,1490083..1490476,1490525..1490625,
                     1490691..1490946))
                     /locus_tag="CNC04930"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_569779.1"
                     /db_xref="GeneID:3256376"
     CDS             complement(join(1489136..1489301,1489353..1489738,
                     1489953..1490030,1490083..1490476,1490525..1490625,
                     1490691..1490930))
                     /locus_tag="CNC04930"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_569779.1"
                     /db_xref="GeneID:3256376"
                     /translation="MSSRLLVTSLGPTRSSLLFNASTAVVFSLKPVTLTSFPQVPLKP
                     FSTSFAPCAKLKKMAPKKKVVEEKKIRLGRPGNNLKVGIVGLPNVGKSSFFNTLSQTD
                     LGKAANFPYATIDPEEARIPVPDERFDWLCSVYKPASKVPAFLTCIDIAGLTAGASTG
                     AGLGNAFLSHVRAVDGIFQVVRAFDDAEVIHVEGDVDPLRDMQIISTELRLKDIEWVE
                     KELDRLKKSSKNLGSVSLADKARKEEMATVEKILHTLVDENKDVRKGTWTSKEVEVIN
                     GLTLLTSKPITYLVNLSERDFIRKKNKWLPKIKAWIDENNPGDALIPFSVALEERLVS
                     MSDEEKAAEGEALGLGPKNPSALGKITTSGYSSLDLIRYFTCGPDEVRAWTVRKGIKA
                     PQAAGVIHSDFENKFVCGEIMSYDDLKEYGTEAAVKAAGKLRQQGKPYEIVDGDICYW
                     KSGA"
     gene            1491245..1492522
                     /locus_tag="CNC04940"
                     /db_xref="GeneID:3256143"
     mRNA            join(1491245..1491507,1491567..1491603,1491670..1491740,
                     1491793..1491836,1491898..1491938,1491995..1492452,
                     1492495..1492522)
                     /locus_tag="CNC04940"
                     /product="cytidine deaminase, putative"
                     /transcript_id="XM_024656834.1"
                     /db_xref="GeneID:3256143"
     CDS             join(1491441..1491507,1491567..1491603,1491670..1491740,
                     1491793..1491836,1491898..1491938,1491995..1492229)
                     /locus_tag="CNC04940"
                     /codon_start=1
                     /product="cytidine deaminase, putative"
                     /protein_id="XP_024512473.1"
                     /db_xref="GeneID:3256143"
                     /translation="MSIQSLDLSSEVLDKLFSTAVIYRDRAYAPYSKFRVGAALLGAD
                     GRFYGGCNVENASYGAGICAERTAVVKAVSESQQSFLAVAVVSDIPSPSCSPCGICRQ
                     FLREFVSLDTPIFYVSGEYPVNASPSFLADINGKEAKKYILQTTMGEILPHSFGPDHL
                     LMRT"
     gene            complement(1491939..1495685)
                     /locus_tag="CNC04945"
                     /db_xref="GeneID:36392807"
     mRNA            complement(join(1491939..1492224,1492287..1492379,
                     1492434..1493772,1493832..1494749,1494798..1495434,
                     1495485..1495685))
                     /locus_tag="CNC04945"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658449.1"
                     /db_xref="GeneID:36392807"
     mRNA            complement(join(1491939..1492224,1492287..1492379,
                     1492434..1493772,1493832..1494749,1494798..1495384,
                     1495485..1495628))
                     /locus_tag="CNC04945"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658450.1"
                     /db_xref="GeneID:36392807"
     CDS             complement(join(1492720..1493772,1493832..1494749,
                     1494798..1495379))
                     /locus_tag="CNC04945"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514306.1"
                     /db_xref="GeneID:36392807"
                     /translation="MFPIEYYPPPPNMRGTEQSVSQQDHPSITYMPSQLTAHVHAQPR
                     PFMHLPQHQATHPSSPGESSRLPSFQVTQPTPTKGRKFRGSDTNASASVESMFMPSPT
                     WQTGLLPSPVARGSGTLEMSIEPLSTLAPIASGSRSRPRSPDLKARKDSLSELERQAE
                     IRQAEIMAEKQARMREKGRERQRRKRERDKKAREAAAAAMNCTKGTPTHISSNASNNL
                     NINMPSPKSSSYSSLTTGTYFSISPTHPLTLSAGSASVSGESSPNTLFSPAISTPGTG
                     YSIDGMTVGGYNPGSELTGNANRRSRIARASSGSIPTNSNTLKVSSTTGLPVLQGDKT
                     ASPSPPYKRRKSEPKPELFRQRIDNIFGAGLDFIEQLKKERPKPHRTQSDGFMLVGET
                     NKTAPSRSPTPPPVPTLPDEYRQRSTAVPAHDLQLSPASVEASDFASTIILSMCRSEL
                     PDVKQSKERLGLGDVEIESMKEGLATFYDKWALERGMSKISLDNSESGNIGPGSSVGN
                     QSVGSTTYSPSRIPPSFLAPASGNATQQDIEAPATLPLSFPAPFESPLATQSHGRQRS
                     LSALSVITRPSTVRWQPETPTTQSAKSLLASKDDAGSPITSSIHTPSTGHGAFPVLEN
                     LMSLKSQHYRSATDPTGSRSYTIFSRAQVNEVSSGDVWDQIVSETRGTNLPDSPLLST
                     DQSELISVGMSHAASMTHPRCNVVAGSNISGADNHSSSSQLERHRSFPGHYRTPSGPR
                     SSGLKSAQGVPFTPPTPLDARGQGQGNYSAEEGLADPLFYSGVFGGPPPQVLDQPQIG
                     QPQTQPHSQDLLQQPQALFDYLPVSDFSLPPQSSSRSQTPQPSFPLRQAENQ"
     CDS             complement(join(1492720..1493772,1493832..1494749,
                     1494798..1495379))
                     /locus_tag="CNC04945"
                     /codon_start=1
                     /product="hypothetical protein"
                     /prote